Sequence alignment for CL0246

PF01144

SCOA_XANCP/13-225--------------------------------------------------------------------------------
GCTB_ACIFV/10-224--------------------------------------------------------------------------------
GCTA_ACIFV/4-241--------------------------------------------------------------------------------
Q9Y916_AERPE/14-262--------------------------------------------------------------------------------
SCOT_CAEEL/300-499--------------------------------------------------------------------------------
SCOB_HELPY/2-198--------------------------------------------------------------------------------
YODS_BACSU/7-219--------------------------------------------------------------------------------
Q9RZA0_DEIRA/23-234--------------------------------------------------------------------------------
ATOA_HAEIN/4-200--------------------------------------------------------------------------------
CTFA_CLOAB/5-216--------------------------------------------------------------------------------
CTFB_CLOAB/9-205--------------------------------------------------------------------------------
PCAI_ACIAD/6-219--------------------------------------------------------------------------------
SCOT1_HUMAN/43-272--------------------------------------------------------------------------------
Q973S5_SULTO/3-202--------------------------------------------------------------------------------
Q9RZ86_DEIRA/5-217--------------------------------------------------------------------------------
SCOA_BACSU/5-216--------------------------------------------------------------------------------
PCAJ_ACIAD/8-206--------------------------------------------------------------------------------
SCOT1_HUMAN/302-501--------------------------------------------------------------------------------
YDIF_ECOLI/15-253--------------------------------------------------------------------------------
SCOT_CAEEL/40-271--------------------------------------------------------------------------------
SCOB_BACSU/5-202--------------------------------------------------------------------------------
Q9XAM7_STRCO/5-234--------------------------------------------------------------------------------
Y1199_ARCFU/148-369--------------------------------------------------------------------------------
Q8PDH3_XANCP/7-217--------------------------------------------------------------------------------
Q8RGS9_FUSNN/11-226--------------------------------------------------------------------------------
SCOA_HELPY/5-216--------------------------------------------------------------------------------
ATOD_HAEIN/5-216--------------------------------------------------------------------------------
Q8F685_LEPIN/8-247--------------------------------------------------------------------------------
Q9W058_DROME/37-266--------------------------------------------------------------------------------
Q97Z51_SULSO/6-206--------------------------------------------------------------------------------
ATOD_ECOLI/5-216--------------------------------------------------------------------------------
Q98EM4_RHILO/9-219--------------------------------------------------------------------------------
Q92TL1_RHIME/7-217--------------------------------------------------------------------------------
A5VGV2_SPHWW/10-217--------------------------------------------------------------------------------
A6M018_CLOB8/11-214--------------------------------------------------------------------------------
Y3551_MYCTU/6-233--------------------------------------------------------------------------------
SCOB_MYCTU/9-204--------------------------------------------------------------------------------
SCOA_MYCTU/6-233--------------------------------------------------------------------------------
Q88FX5_PSEPK/6-218--------------------------------------------------------------------------------
S6BGT4_PSERE/8-217--------------------------------------------------------------------------------

PF00455

Q98FV5_RHILO/86-240--------------------------------------------------------------------------------
A9CFA5_AGRT5/78-235--------------------------------------------------------------------------------
A9CH78_AGRT5/78-237--------------------------------------------------------------------------------
Q98JJ0_RHILO/76-235--------------------------------------------------------------------------------
Q8EUZ1_MYCPE/77-233--------------------------------------------------------------------------------
Q98AQ9_RHILO/74-232--------------------------------------------------------------------------------
Q8Y5F7_LISMO/74-230--------------------------------------------------------------------------------
Q8Y9Y5_LISMO/74-233--------------------------------------------------------------------------------
Q89SG7_BRADU/74-233--------------------------------------------------------------------------------
Q98M65_RHILO/73-232--------------------------------------------------------------------------------
Q7VVL2_BORPE/74-233--------------------------------------------------------------------------------
ACCR_AGRT5/77-237--------------------------------------------------------------------------------
Q9X0F8_THEMA/73-233--------------------------------------------------------------------------------
Q8EMN4_OCEIH/74-231--------------------------------------------------------------------------------
Q8R736_THETN/74-232--------------------------------------------------------------------------------
Q8ES05_OCEIH/74-231--------------------------------------------------------------------------------
FRUR_BACSU/74-232--------------------------------------------------------------------------------
Q8ESW8_OCEIH/75-233--------------------------------------------------------------------------------
Q986N7_RHILO/100-258--------------------------------------------------------------------------------
Q988Q4_RHILO/55-214--------------------------------------------------------------------------------
A9CHG2_AGRT5/75-234--------------------------------------------------------------------------------
Q98GA9_RHILO/78-237--------------------------------------------------------------------------------
Q7D3J6_AGRT5/74-233--------------------------------------------------------------------------------
Q92UW3_RHIME/80-239--------------------------------------------------------------------------------
Q98BY9_RHILO/73-232--------------------------------------------------------------------------------
Q986T2_RHILO/74-233--------------------------------------------------------------------------------
Q9RZP5_DEIRA/82-243--------------------------------------------------------------------------------
Q9K3L7_STRCO/73-239--------------------------------------------------------------------------------
Q9AD80_STRCO/62-221--------------------------------------------------------------------------------
Q5UXV7_HALMA/72-230--------------------------------------------------------------------------------
Q5V513_HALMA/74-231--------------------------------------------------------------------------------
Q5YVT8_NOCFA/75-235--------------------------------------------------------------------------------
YULB_BACSU/74-232--------------------------------------------------------------------------------
LACR_STAA8/75-234--------------------------------------------------------------------------------
ULAR_ECOLI/75-231--------------------------------------------------------------------------------
AGAR_ECOLI/88-247--------------------------------------------------------------------------------
DEOR_ECOLI/76-232--------------------------------------------------------------------------------
FUCR_ECOLI/75-233--------------------------------------------------------------------------------
YIHW_ECOLI/78-237--------------------------------------------------------------------------------
SGCR_ECOLI/79-236--------------------------------------------------------------------------------
IOLR_BACSU/72-231--------------------------------------------------------------------------------
YGBI_ECOLI/75-232--------------------------------------------------------------------------------
YDJF_ECOLI/76-233--------------------------------------------------------------------------------
GLCR_BACSU/75-231--------------------------------------------------------------------------------
Q2G240_STAA8/76-232--------------------------------------------------------------------------------
Q2YIQ5_BRUA2/76-232--------------------------------------------------------------------------------
Q2YIY1_BRUA2/81-239--------------------------------------------------------------------------------
Q2YLA3_BRUA2/76-232--------------------------------------------------------------------------------
Q32AN5_SHIDS/73-232--------------------------------------------------------------------------------
Q32CM1_SHIDS/74-232--------------------------------------------------------------------------------
Q32GP8_SHIDS/68-227--------------------------------------------------------------------------------
GLPR_PSEAE/74-231--------------------------------------------------------------------------------
Q7CFX9_YERPE/75-232--------------------------------------------------------------------------------
Q7CGX6_YERPE/76-234--------------------------------------------------------------------------------
Q7CHA9_YERPE/76-237--------------------------------------------------------------------------------
Q7CHG1_YERPE/76-235--------------------------------------------------------------------------------
Q7CKA8_YERPE/91-249--------------------------------------------------------------------------------
Q8DN15_STRR6/75-235--------------------------------------------------------------------------------
Q8DPP7_STRR6/78-234--------------------------------------------------------------------------------
Q8DQ97_STRR6/74-227--------------------------------------------------------------------------------
Q8DRC4_STRR6/83-243--------------------------------------------------------------------------------
Q8PDH7_XANCP/77-235--------------------------------------------------------------------------------
Q8R8Q0_THETN/73-230--------------------------------------------------------------------------------
Q8Y4U4_LISMO/74-229--------------------------------------------------------------------------------
Q8YA06_LISMO/78-236--------------------------------------------------------------------------------
Q8YA14_LISMO/74-233--------------------------------------------------------------------------------
Q928R7_LISMO/75-232--------------------------------------------------------------------------------
Q97EY9_CLOAB/77-234--------------------------------------------------------------------------------
Q97F00_CLOAB/78-235--------------------------------------------------------------------------------
Q97F05_CLOAB/78-235--------------------------------------------------------------------------------
Q97J56_CLOAB/68-226--------------------------------------------------------------------------------
Q97J82_CLOAB/75-231--------------------------------------------------------------------------------
Q97MG7_CLOAB/76-233--------------------------------------------------------------------------------
Q97MS8_CLOAB/74-235--------------------------------------------------------------------------------
Q9HT24_PSEAE/78-233--------------------------------------------------------------------------------
Q9I3M2_PSEAE/74-231--------------------------------------------------------------------------------
Q9JYJ2_NEIMB/75-234--------------------------------------------------------------------------------
Q9K3N4_STRCO/82-247--------------------------------------------------------------------------------
Q9KL10_VIBCH/75-233--------------------------------------------------------------------------------
Q9KMS3_VIBCH/75-231--------------------------------------------------------------------------------
Q9KRT3_VIBCH/76-234--------------------------------------------------------------------------------
Q9KUM9_VIBCH/81-237--------------------------------------------------------------------------------
Q9KYU7_STRCO/74-233--------------------------------------------------------------------------------
Q9S2D1_STRCO/76-233--------------------------------------------------------------------------------
Q9X9X5_STRCO/79-237--------------------------------------------------------------------------------
Q9ZC48_YERPE/76-232--------------------------------------------------------------------------------

PF02550

O28424_ARCFU/3-199--------------------------------------------------------------------------------
O29120_ARCFU/9-201--------------------------------------------------------------------------------
P73661_SYNY3/6-196--------------------------------------------------------------------------------
ACH1_YEAST/12-230--------------------------------------------------------------------------------
SCPC_ECOLI/1-213--------------------------------------------------------------------------------

PF01008

EI2BD_MOUSE/219-510--------------------------------------------------------------------------------
R15PI_METJA/22-292--------------------------------------------------------------------------------
EI2BB_YEAST/33-358--------------------------------------------------------------------------------
MTNA_BACSU/49-337--------------------------------------------------------------------------------
MTNA_ARCFU/41-327--------------------------------------------------------------------------------
EI2BA_HUMAN/15-293--------------------------------------------------------------------------------
MTNA_SYNY3/51-343--------------------------------------------------------------------------------
MTNA_METTH/44-310--------------------------------------------------------------------------------
MTNA_CAEEL/66-357--------------------------------------------------------------------------------
EI2BA_CAEEL/15-293--------------------------------------------------------------------------------
EI2BA_YEAST/15-292--------------------------------------------------------------------------------
EI2BD_YEAST/285-637--------------------------------------------------------------------------------
MTNA_METJA/48-319--------------------------------------------------------------------------------
EI2BB_RABIT/27-333--------------------------------------------------------------------------------
MTNA_YEAST/49-399--------------------------------------------------------------------------------
EI2BD_SCHPO/156-452--------------------------------------------------------------------------------
Q5V075_HALMA/195-460--------------------------------------------------------------------------------
R15PI_ARCFU/15-284--------------------------------------------------------------------------------

PF04198

YJHU_ECOLI/63-323--------------------------------------------------------------------------------
Q9WWA6_AGRRK/83-337--------------------------------------------------------------------------------
Q9CKH2_PASMU/56-313--------------------------------------------------------------------------------
Q98GB2_RHILO/49-296--------------------------------------------------------------------------------
Q9RT33_DEIRA/86-346--------------------------------------------------------------------------------
Q986P9_RHILO/64-319--------------------------------------------------------------------------------
Q97L54_CLOAB/89-338--------------------------------------------------------------------------------
CGGR_BACMD/89-339--------------------------------------------------------------------------------
Q9CGB1_LACLA/54-307--------------------------------------------------------------------------------
Q98CZ8_RHILO/62-317--------------------------------------------------------------------------------
Q9L0Z6_STRCO/89-343--------------------------------------------------------------------------------
Q99XS9_STRP1/56-314--------------------------------------------------------------------------------
Q9CLG2_PASMU/68-318--------------------------------------------------------------------------------
LSRR_ECOLI/66-316--------------------------------------------------------------------------------
Q9KER9_BACHD/57-313--------------------------------------------------------------------------------
DEOR_BACSU/56-311--------------------------------------------------------------------------------
Q9KLX0_VIBCH/62-319--------------------------------------------------------------------------------
CGGR_BACSU/89-338--------------------------------------------------------------------------------
Q9K712_BACHD/89-338--------------------------------------------------------------------------------
Q986M3_RHILO/57-311--------------------------------------------------------------------------------
Q98FV1_RHILO/42-296--------------------------------------------------------------------------------
A6TBJ1_KLEP7/59-311--------------------------------------------------------------------------------
A6TGS9_KLEP7/60-317--------------------------------------------------------------------------------
D5AUX6_RHOCB/60-314--------------------------------------------------------------------------------
Q1GB28_LACDA/125-376--------------------------------------------------------------------------------
Q2G033_STAA8/91-337--------------------------------------------------------------------------------
Q2YIQ4_BRUA2/58-310--------------------------------------------------------------------------------
Q3J1R9_RHOS4/62-317--------------------------------------------------------------------------------
Q8DRC3_STRR6/59-313--------------------------------------------------------------------------------

PF06026

RPIA_BURPS/53-222--------------------------------------------------------------------------------
RPIA_METJA/51-220--------------------------------------------------------------------------------
K4L1A8_SIMAS/53-215--------------------------------------------------------------------------------
D0KYM3_HALNC/50-214--------------------------------------------------------------------------------
D5MHI2_9BACT/41-208--------------------------------------------------------------------------------
D5DBB1_BACMD/47-216--------------------------------------------------------------------------------
G7M4M9_9CLOT/48-219--------------------------------------------------------------------------------
V5UL52_9BURK/53-222--------------------------------------------------------------------------------
RPIA_STAEQ/52-222--------------------------------------------------------------------------------
RPIA_CHLAA/55-225--------------------------------------------------------------------------------
E8WXH2_ACISM/47-217--------------------------------------------------------------------------------
RPIA_RHOPB/50-225--------------------------------------------------------------------------------
H8MW96_CORCM/57-227--------------------------------------------------------------------------------
RPIA_SHELP/49-213--------------------------------------------------------------------------------
M4QFB2_LIBAS/50-224--------------------------------------------------------------------------------
U5H8J3_USTV1/122-297--------------------------------------------------------------------------------
N0BJC6_9EURY/47-217--------------------------------------------------------------------------------
H0PXY1_9RHOO/49-213--------------------------------------------------------------------------------
RPIA_RHILO/50-224--------------------------------------------------------------------------------
I3UDK7_ADVKW/56-221--------------------------------------------------------------------------------
E4X352_OIKDI/53-229--------------------------------------------------------------------------------
C7R992_KANKD/49-211--------------------------------------------------------------------------------
K9ZYM6_DEIPD/53-221--------------------------------------------------------------------------------
RPIA_LEPCP/49-214--------------------------------------------------------------------------------
A0RTM4_CENSY/52-220--------------------------------------------------------------------------------
RPIA_HAEIN/49-214--------------------------------------------------------------------------------
S2J2W4_MUCC1/53-230--------------------------------------------------------------------------------
RPIA_LACRD/52-220--------------------------------------------------------------------------------
RPIA_PHOPR/49-213--------------------------------------------------------------------------------
G4RF46_PELHB/49-224--------------------------------------------------------------------------------
A9V4I9_MONBE/88-261--------------------------------------------------------------------------------
F2I5Y3_AERUA/48-215--------------------------------------------------------------------------------
G2MHG7_9ARCH/54-222--------------------------------------------------------------------------------
C6XK92_HIRBI/49-225--------------------------------------------------------------------------------
C4R764_PICPG/66-245--------------------------------------------------------------------------------
D3E2P7_METRM/49-218--------------------------------------------------------------------------------
W8KJT3_HALHR/50-214--------------------------------------------------------------------------------
E0SPG1_IGNAA/58-230--------------------------------------------------------------------------------
RPIA_HALWD/54-223--------------------------------------------------------------------------------
L0B5Z2_9PROT/36-200--------------------------------------------------------------------------------
T0N5R5_9EURY/50-215--------------------------------------------------------------------------------
D2A0V2_TRICA/53-227--------------------------------------------------------------------------------
R7ELE2_9BACE/67-233--------------------------------------------------------------------------------
T0LRI8_9EURY/54-219--------------------------------------------------------------------------------
A4YX18_BRASO/48-223--------------------------------------------------------------------------------
W1Q6V8_OGAPD/53-229--------------------------------------------------------------------------------
J7Q837_METSZ/64-239--------------------------------------------------------------------------------
S5YAN5_PARAH/56-230--------------------------------------------------------------------------------
RPIA_RHOPA/50-225--------------------------------------------------------------------------------
W0JVE5_9EURY/51-218--------------------------------------------------------------------------------
RPIA_PEDPA/51-220--------------------------------------------------------------------------------
S2JUJ5_MUCC1/54-231--------------------------------------------------------------------------------
U3U6Y6_9BACT/49-214--------------------------------------------------------------------------------
RPIA_BAUCH/49-214--------------------------------------------------------------------------------
K9SSM9_9SYNE/57-227--------------------------------------------------------------------------------
D5EB20_METMS/56-224--------------------------------------------------------------------------------
J9W6I1_LACBU/52-220--------------------------------------------------------------------------------
G0VA31_NAUCC/62-239--------------------------------------------------------------------------------
A1B891_PARDP/56-230--------------------------------------------------------------------------------
RPIA_DICNV/49-213--------------------------------------------------------------------------------
K7SFG2_GLUOY/48-220--------------------------------------------------------------------------------
C5M9K4_CANTT/70-245--------------------------------------------------------------------------------
C7JF40_ACEP3/57-228--------------------------------------------------------------------------------
RPIA_LACC3/51-220--------------------------------------------------------------------------------
A9SR64_PHYPA/70-245--------------------------------------------------------------------------------
F3Y8A6_MELPT/48-218--------------------------------------------------------------------------------
D8RIH7_SELML/81-253--------------------------------------------------------------------------------
RPIA_STRMU/49-217--------------------------------------------------------------------------------
Q2FVT0_STAA8/52-222--------------------------------------------------------------------------------
E2BIQ5_HARSA/33-208--------------------------------------------------------------------------------
RPIA_BACSK/48-216--------------------------------------------------------------------------------
R9T971_9EURY/48-216--------------------------------------------------------------------------------
RPIA_DEBHA/69-245--------------------------------------------------------------------------------
E9G3C7_DAPPU/53-228--------------------------------------------------------------------------------
M1XYN2_NATM8/55-227--------------------------------------------------------------------------------
B7VHI7_VIBSL/94-259--------------------------------------------------------------------------------
Q8I3W2_PLAF7/51-226--------------------------------------------------------------------------------
A3DN78_STAMF/53-223--------------------------------------------------------------------------------
J4I3H4_FIBRA/107-283--------------------------------------------------------------------------------
K5XRW6_AGABU/63-240--------------------------------------------------------------------------------
U5QS13_9CYAN/54-225--------------------------------------------------------------------------------
E3NWK8_CAERE/55-230--------------------------------------------------------------------------------
D7EAR3_METEZ/57-226--------------------------------------------------------------------------------
R5EWG7_9GAMM/48-213--------------------------------------------------------------------------------
A6X0Q4_OCHA4/51-225--------------------------------------------------------------------------------
K4AIV0_SETIT/101-286--------------------------------------------------------------------------------
D6S665_9LACO/56-223--------------------------------------------------------------------------------
D3RQX1_ALLVD/48-212--------------------------------------------------------------------------------
D5X4J8_THIK1/49-213--------------------------------------------------------------------------------
R5VQ59_9PORP/67-230--------------------------------------------------------------------------------
D1Z1V9_METPS/54-222--------------------------------------------------------------------------------
A1RX06_THEPD/46-219--------------------------------------------------------------------------------
Q4UBE3_THEAN/56-233--------------------------------------------------------------------------------
V5WM65_9SPIO/65-247--------------------------------------------------------------------------------
D2RI11_ARCPA/48-216--------------------------------------------------------------------------------
RPIA_PROMP/47-218--------------------------------------------------------------------------------
B2IHK8_BEII9/53-228--------------------------------------------------------------------------------
RPIA_OLICO/50-225--------------------------------------------------------------------------------
RPIA_PICGU/64-240--------------------------------------------------------------------------------
K1VP09_TRIAC/61-234--------------------------------------------------------------------------------
I4YBK0_WALSC/145-321--------------------------------------------------------------------------------
RPIA_CAUSK/47-220--------------------------------------------------------------------------------
F6HTS6_VITVI/101-277--------------------------------------------------------------------------------
M4DCW1_BRARP/79-256--------------------------------------------------------------------------------
RPIA_METRJ/50-224--------------------------------------------------------------------------------
B5Y3N7_PHATC/98-280--------------------------------------------------------------------------------
H9UGB7_SPIAZ/58-234--------------------------------------------------------------------------------
RPIA_THERP/50-221--------------------------------------------------------------------------------
RPIA_METPP/49-213--------------------------------------------------------------------------------
L0I9N5_HALRX/54-222--------------------------------------------------------------------------------
X2H3T4_9NEIS/50-214--------------------------------------------------------------------------------
D7DSD0_METV3/58-228--------------------------------------------------------------------------------
T1HW83_RHOPR/84-259--------------------------------------------------------------------------------
A9RL35_PHYPA/31-216--------------------------------------------------------------------------------
V9VTU6_9RHOB/56-231--------------------------------------------------------------------------------
Q4MZ63_THEPA/56-234--------------------------------------------------------------------------------
RPIA_SODGM/49-213--------------------------------------------------------------------------------
K9XKW8_9CHRO/57-227--------------------------------------------------------------------------------
K5W1L5_PHACS/65-241--------------------------------------------------------------------------------
RPIA_ALKEH/50-214--------------------------------------------------------------------------------
E8UX17_TERSS/51-221--------------------------------------------------------------------------------
RPIA_KORCO/48-217--------------------------------------------------------------------------------
U5T5D8_9GAMM/49-213--------------------------------------------------------------------------------
C3AWU3_BACMY/48-217--------------------------------------------------------------------------------
RPIA_VIBPA/49-213--------------------------------------------------------------------------------
E5SAM9_TRISP/143-319--------------------------------------------------------------------------------
I0FD89_BORCA/51-219--------------------------------------------------------------------------------
F2UBB3_SALR5/70-247--------------------------------------------------------------------------------
E1QRN8_VULDI/53-227--------------------------------------------------------------------------------
RPIA_BURXL/53-222--------------------------------------------------------------------------------
C1CUX0_DEIDV/53-221--------------------------------------------------------------------------------
E1VFV9_9GAMM/49-213--------------------------------------------------------------------------------
D9Q2B6_ACIS3/51-222--------------------------------------------------------------------------------
S6C126_9GAMM/49-213--------------------------------------------------------------------------------
F6HFJ9_VITVI/87-263--------------------------------------------------------------------------------
U1N8Y7_ASCSU/112-290--------------------------------------------------------------------------------
Q8SR79_ENCCU/35-195--------------------------------------------------------------------------------
RPIA_THEEB/55-223--------------------------------------------------------------------------------
Q11IC0_CHESB/51-225--------------------------------------------------------------------------------
A6LVZ7_CLOB8/47-215--------------------------------------------------------------------------------
B9I0V6_POPTR/93-277--------------------------------------------------------------------------------
RPIA_LARHH/50-214--------------------------------------------------------------------------------
RPIA_DESAA/53-223--------------------------------------------------------------------------------
RPIA_DINSH/56-231--------------------------------------------------------------------------------
B2GAA8_LACF3/52-221--------------------------------------------------------------------------------
R5PSN2_9BURK/55-218--------------------------------------------------------------------------------
H8GLH3_METAL/47-217--------------------------------------------------------------------------------
K3Y9J6_SETIT/66-248--------------------------------------------------------------------------------
RPIA_BUCBP/49-213--------------------------------------------------------------------------------
U5N777_9BURK/52-220--------------------------------------------------------------------------------
RPIA_METB6/55-226--------------------------------------------------------------------------------
F9VP11_SULTO/46-214--------------------------------------------------------------------------------
RPIA_ALBFT/60-228--------------------------------------------------------------------------------
D9S606_FIBSS/55-226--------------------------------------------------------------------------------
A8I636_AZOC5/111-286--------------------------------------------------------------------------------
R9SLS4_9EURY/48-217--------------------------------------------------------------------------------
G8ZWF9_TORDC/75-252--------------------------------------------------------------------------------
R5JU55_9BACE/67-230--------------------------------------------------------------------------------
E6U2Y3_ETHHY/42-213--------------------------------------------------------------------------------
F7XM76_METZD/57-225--------------------------------------------------------------------------------
RPIA_RUTMC/49-214--------------------------------------------------------------------------------
RPIA_YARLI/58-236--------------------------------------------------------------------------------
V5SCR1_9RHIZ/50-225--------------------------------------------------------------------------------
G4QMA8_GLANF/49-213--------------------------------------------------------------------------------
RPIA_THIDA/48-212--------------------------------------------------------------------------------
A8IRQ1_CHLRE/82-257--------------------------------------------------------------------------------
Q8ZXY8_PYRAE/44-218--------------------------------------------------------------------------------
W8RXL1_9RHOB/56-231--------------------------------------------------------------------------------
R6UK51_9FIRM/42-213--------------------------------------------------------------------------------
K8ENG0_CARML/47-216--------------------------------------------------------------------------------
B8ELA7_METSB/53-228--------------------------------------------------------------------------------
H3CYY4_TETNG/53-228--------------------------------------------------------------------------------
F8J7J2_HYPSM/50-225--------------------------------------------------------------------------------
U6B5B2_9RHIZ/50-224--------------------------------------------------------------------------------
RPIA_HALMA/53-220--------------------------------------------------------------------------------
C7PIS1_CHIPD/51-219--------------------------------------------------------------------------------
I1MGA3_SOYBN/93-278--------------------------------------------------------------------------------
M1MZH8_9CLOT/50-221--------------------------------------------------------------------------------
RPIA_LACPL/51-219--------------------------------------------------------------------------------
D3HMT7_LEGLN/47-211--------------------------------------------------------------------------------
Q0C4A9_HYPNA/53-230--------------------------------------------------------------------------------
U9SW08_RHIID/55-228--------------------------------------------------------------------------------
J3LWN1_ORYBR/36-221--------------------------------------------------------------------------------
Q4FT49_PSYA2/48-213--------------------------------------------------------------------------------
R6B3B3_9CLOT/67-229--------------------------------------------------------------------------------
E4NRI2_HALBP/54-223--------------------------------------------------------------------------------
D0N1R6_PHYIT/55-229--------------------------------------------------------------------------------
A7AMM8_BABBO/53-227--------------------------------------------------------------------------------
R4K5G7_CLOPA/48-219--------------------------------------------------------------------------------
A3CVB5_METMJ/49-220--------------------------------------------------------------------------------
E6X8C9_CELAD/51-219--------------------------------------------------------------------------------
F4LL35_TREBD/63-237--------------------------------------------------------------------------------
F4B7Z8_ACIHW/47-219--------------------------------------------------------------------------------
G3ARG1_SPAPN/52-227--------------------------------------------------------------------------------
F8HYA4_WEIKK/48-216--------------------------------------------------------------------------------
F4BMW4_CARS1/47-216--------------------------------------------------------------------------------
E3F3G7_KETVY/65-240--------------------------------------------------------------------------------
A4YJ22_METS5/48-219--------------------------------------------------------------------------------
I1XM21_METNJ/57-227--------------------------------------------------------------------------------
RPIA_BACAN/47-216--------------------------------------------------------------------------------
RPIA_BORBU/52-221--------------------------------------------------------------------------------
B9SKS7_RICCO/78-256--------------------------------------------------------------------------------
G2SRP4_LACRR/51-220--------------------------------------------------------------------------------
RPIA_CAEEL/64-240--------------------------------------------------------------------------------
K0SNV8_THAOC/54-236--------------------------------------------------------------------------------
I6NDH1_ERECY/69-246--------------------------------------------------------------------------------
Q1H2B3_METFK/48-218--------------------------------------------------------------------------------
RPIA_THISH/49-213--------------------------------------------------------------------------------
RPIA2_OCEIH/50-216--------------------------------------------------------------------------------
G2KTC4_LACSM/362-530--------------------------------------------------------------------------------
W8X9J3_CASDE/54-218--------------------------------------------------------------------------------
I0A1J3_FERFK/50-220--------------------------------------------------------------------------------
K9Z869_CYAAP/56-224--------------------------------------------------------------------------------
Q3IDN5_PSEHT/83-247--------------------------------------------------------------------------------
L0JQT2_NATP1/54-229--------------------------------------------------------------------------------
RPIA_ARCFU/50-221--------------------------------------------------------------------------------
G7LZ92_9CLOT/50-221--------------------------------------------------------------------------------
D8PA73_9BACT/59-229--------------------------------------------------------------------------------
G0W6N5_NAUDC/71-248--------------------------------------------------------------------------------
G4SXW6_META2/48-217--------------------------------------------------------------------------------
RPIA_METCA/49-213--------------------------------------------------------------------------------
F7PF08_9EURY/53-222--------------------------------------------------------------------------------
RPIA_BARHE/50-224--------------------------------------------------------------------------------
D8LDV8_ECTSI/54-228--------------------------------------------------------------------------------
A0A023B5X1_GRENI/97-274--------------------------------------------------------------------------------
R7L548_9CLOT/66-232--------------------------------------------------------------------------------
A8Q7R0_MALGO/62-237--------------------------------------------------------------------------------
RPIA_LACAC/56-223--------------------------------------------------------------------------------
Q1AY26_RUBXD/56-224--------------------------------------------------------------------------------
G7LY74_9CLOT/48-219--------------------------------------------------------------------------------
B0UBT0_METS4/49-223--------------------------------------------------------------------------------
Q0SCN2_RHOSR/56-232--------------------------------------------------------------------------------
D3PRM8_MEIRD/53-219--------------------------------------------------------------------------------
G4RM57_THETK/46-222--------------------------------------------------------------------------------
C4Y2N7_CLAL4/69-244--------------------------------------------------------------------------------
Q0W3M2_UNCMA/58-226--------------------------------------------------------------------------------
M9S9J2_9EURY/54-223--------------------------------------------------------------------------------
S2JGP9_MUCC1/65-242--------------------------------------------------------------------------------
RPIA_CUPNH/53-222--------------------------------------------------------------------------------
RPIA_PICST/55-230--------------------------------------------------------------------------------
RPIA_MARAV/53-217--------------------------------------------------------------------------------
Q035R3_LACC3/44-210--------------------------------------------------------------------------------
Q2FLE9_METHJ/57-228--------------------------------------------------------------------------------
Q97ZD9_SULSO/48-216--------------------------------------------------------------------------------
RPIA_AROAE/49-213--------------------------------------------------------------------------------
D5U1E6_THEAM/52-228--------------------------------------------------------------------------------
J0DZG3_LOALO/63-242--------------------------------------------------------------------------------
B9QKE6_TOXGO/54-249--------------------------------------------------------------------------------
RPIA_TOLAT/49-213--------------------------------------------------------------------------------
G0EH21_PYRF1/55-229--------------------------------------------------------------------------------
E9CB07_CAPO3/132-305--------------------------------------------------------------------------------
K9SHM7_9CYAN/60-232--------------------------------------------------------------------------------
A8A9K9_IGNH4/47-217--------------------------------------------------------------------------------
E5SB58_TRISP/33-210--------------------------------------------------------------------------------
D9QGR4_BRESC/47-221--------------------------------------------------------------------------------
B9DLS8_STACT/50-220--------------------------------------------------------------------------------
RPIA_ASHGO/71-248--------------------------------------------------------------------------------
RPIA_STRSY/49-217--------------------------------------------------------------------------------
RPIA_THET8/54-221--------------------------------------------------------------------------------
M5C6T3_THACB/108-284--------------------------------------------------------------------------------
Q018K0_OSTTA/92-274--------------------------------------------------------------------------------
M0Y9D9_HORVD/96-282--------------------------------------------------------------------------------
F9ZVU0_METMM/51-220--------------------------------------------------------------------------------
T0UHY2_9STRE/43-211--------------------------------------------------------------------------------
T1IW49_STRMM/51-225--------------------------------------------------------------------------------
Q1D141_MYXXD/60-230--------------------------------------------------------------------------------
RPIA_PSEF5/53-217--------------------------------------------------------------------------------
M0TZ20_MUSAM/31-216--------------------------------------------------------------------------------
I6SWV8_ENTHA/48-217--------------------------------------------------------------------------------
RPIA_METAC/57-225--------------------------------------------------------------------------------
RPIA_RHOS4/56-231--------------------------------------------------------------------------------
R6M617_9BACE/67-231--------------------------------------------------------------------------------
F2GCW9_ALTMD/49-213--------------------------------------------------------------------------------
X1X1C6_ACYPI/49-213--------------------------------------------------------------------------------
D8LXP9_BLAHO/52-223--------------------------------------------------------------------------------
C9A9E9_ENTCA/48-217--------------------------------------------------------------------------------
W0JTR2_9EURY/54-238--------------------------------------------------------------------------------
K0IFH0_NITGG/62-228--------------------------------------------------------------------------------
E8SF16_STAPH/51-221--------------------------------------------------------------------------------
RPIA_POLSJ/62-234--------------------------------------------------------------------------------
F4PQH6_DICFS/53-227--------------------------------------------------------------------------------
M9SAJ3_9EURY/47-210--------------------------------------------------------------------------------
G7MC82_9CLOT/47-215--------------------------------------------------------------------------------
C5AQI6_METEA/50-225--------------------------------------------------------------------------------
F9VGE3_LACGL/49-217--------------------------------------------------------------------------------
F8F3R8_TRECH/53-227--------------------------------------------------------------------------------
H9IUK6_BOMMO/52-227--------------------------------------------------------------------------------
L0HHU8_METFS/55-226--------------------------------------------------------------------------------
I1YH59_METFJ/55-224--------------------------------------------------------------------------------
W0RDQ8_9BACT/54-222--------------------------------------------------------------------------------
C7P232_HALMD/53-220--------------------------------------------------------------------------------
D7CXV5_TRURR/54-220--------------------------------------------------------------------------------
RPIA_RHISN/50-224--------------------------------------------------------------------------------
RPIA_CANGA/75-252--------------------------------------------------------------------------------
F3YU57_DESAF/56-226--------------------------------------------------------------------------------
RPIA_STRA5/49-217--------------------------------------------------------------------------------
B3MF62_DROAN/58-234--------------------------------------------------------------------------------
Q1LN72_RALME/49-213--------------------------------------------------------------------------------
E0VP73_PEDHC/118-294--------------------------------------------------------------------------------
G2I0N1_GLUMN/57-227--------------------------------------------------------------------------------
K4B7U4_SOLLC/96-281--------------------------------------------------------------------------------
R7BZ16_9BURK/48-213--------------------------------------------------------------------------------
B5IA06_ACIB4/51-219--------------------------------------------------------------------------------
RPIA_HALSA/52-219--------------------------------------------------------------------------------
C5DMD9_LACTC/92-269--------------------------------------------------------------------------------
L0AA43_CALLD/51-220--------------------------------------------------------------------------------
D7A674_STAND/52-227--------------------------------------------------------------------------------
I3TCM9_THEC1/55-227--------------------------------------------------------------------------------
G0L9M6_ZOBGA/50-218--------------------------------------------------------------------------------
RPIA_ROSDO/56-231--------------------------------------------------------------------------------
M5DVR1_9GAMM/53-217--------------------------------------------------------------------------------
W0EYB5_9SPHI/49-217--------------------------------------------------------------------------------
E5AQX1_BURRH/75-245--------------------------------------------------------------------------------
RPIA_CHLTR/62-231--------------------------------------------------------------------------------
RPIA_STRGC/49-217--------------------------------------------------------------------------------
S0EY17_CHTCT/49-220--------------------------------------------------------------------------------
D5ALR5_RHOCB/56-231--------------------------------------------------------------------------------
C6VYP5_DYAFD/51-218--------------------------------------------------------------------------------
RPIA_NITHX/50-225--------------------------------------------------------------------------------
RPIA2_YERPE/53-229--------------------------------------------------------------------------------
D1CC48_THET1/51-220--------------------------------------------------------------------------------
T0V876_9STRE/49-217--------------------------------------------------------------------------------
RPIA_ENTFA/48-217--------------------------------------------------------------------------------
RPIA_CHRVO/50-214--------------------------------------------------------------------------------
RPIA_BLOFL/50-215--------------------------------------------------------------------------------
A8NMB3_COPC7/98-275--------------------------------------------------------------------------------
C4ZP88_THASP/49-213--------------------------------------------------------------------------------
D3S1R9_FERPA/46-214--------------------------------------------------------------------------------
RPIA_MARMM/50-225--------------------------------------------------------------------------------
A8MCS2_CALMQ/49-224--------------------------------------------------------------------------------
H1YW83_9EURY/51-222--------------------------------------------------------------------------------
K0RC06_THAOC/94-276--------------------------------------------------------------------------------
A5FY01_ACICJ/53-221--------------------------------------------------------------------------------
U6IN39_HYMMI/82-258--------------------------------------------------------------------------------
S0ANJ2_FERAC/51-213--------------------------------------------------------------------------------
A5K9L2_PLAVS/51-226--------------------------------------------------------------------------------
M4EY56_BRARP/82-268--------------------------------------------------------------------------------
W0BAQ9_9GAMM/47-211--------------------------------------------------------------------------------
J3TF98_9ENTR/49-213--------------------------------------------------------------------------------
G2IZW6_PSEUL/50-214--------------------------------------------------------------------------------
RPIA_XYLFA/47-210--------------------------------------------------------------------------------
G7V788_THELD/48-218--------------------------------------------------------------------------------
A2SQC5_METLZ/52-219--------------------------------------------------------------------------------
C7PJG1_CHIPD/49-221--------------------------------------------------------------------------------
C5CXD5_VARPS/68-236--------------------------------------------------------------------------------
F8KWT0_PARAV/52-221--------------------------------------------------------------------------------
U5MRI4_CLOSA/54-225--------------------------------------------------------------------------------
I0AN47_IGNAJ/47-215--------------------------------------------------------------------------------
Q47A42_DECAR/63-227--------------------------------------------------------------------------------
A9A2Y6_NITMS/51-216--------------------------------------------------------------------------------
I2FUT0_USTH4/82-257--------------------------------------------------------------------------------
F4BTP9_METCG/55-220--------------------------------------------------------------------------------
RPIA_LACBA/51-220--------------------------------------------------------------------------------
G8PQ27_PSEUV/49-223--------------------------------------------------------------------------------
A9H338_GLUDA/56-227--------------------------------------------------------------------------------
D1C4M5_SPHTD/55-227--------------------------------------------------------------------------------
W1NXJ9_AMBTC/82-258--------------------------------------------------------------------------------
C6CYP4_PAESJ/48-216--------------------------------------------------------------------------------
M1LTZ6_9PROT/54-218--------------------------------------------------------------------------------
A7IKA7_XANP2/69-244--------------------------------------------------------------------------------
RPIA_STRMK/47-210--------------------------------------------------------------------------------
G8QPQ4_AZOSU/53-217--------------------------------------------------------------------------------
RPIA_GLOVI/50-220--------------------------------------------------------------------------------
RPIA_THICR/49-214--------------------------------------------------------------------------------
L0PFR9_PNEJ8/65-240--------------------------------------------------------------------------------
RPIA_FRATT/54-219--------------------------------------------------------------------------------
L0EWH5_LIBCB/45-219--------------------------------------------------------------------------------
W5JTH8_ANODA/99-275--------------------------------------------------------------------------------
I0HZU4_CALAS/53-223--------------------------------------------------------------------------------
G4L3E1_TETHN/48-216--------------------------------------------------------------------------------
M1MGW5_9CLOT/47-215--------------------------------------------------------------------------------
D4G7S8_RIEPU/49-213--------------------------------------------------------------------------------
RPIA_DEIRA/52-220--------------------------------------------------------------------------------
F9ZXG6_METMM/48-216--------------------------------------------------------------------------------
D0MER0_RHOM4/56-228--------------------------------------------------------------------------------
RPIA_TREDE/58-234--------------------------------------------------------------------------------
X6MIV2_RETFI/61-244--------------------------------------------------------------------------------
F4GMC6_PUSST/54-218--------------------------------------------------------------------------------
Q0BTU6_GRABC/50-222--------------------------------------------------------------------------------
W6RAI3_9RHIZ/50-224--------------------------------------------------------------------------------
W1Q961_OGAPD/51-223--------------------------------------------------------------------------------
F7QLK3_9BRAD/51-226--------------------------------------------------------------------------------
E8UAB6_DEIML/52-220--------------------------------------------------------------------------------
T2GAB9_DESGI/59-229--------------------------------------------------------------------------------
J7S9W0_KAZNA/74-251--------------------------------------------------------------------------------
M4CUR6_BRARP/74-251--------------------------------------------------------------------------------
Q12XU6_METBU/57-225--------------------------------------------------------------------------------
J3TZ31_9ENTR/49-213--------------------------------------------------------------------------------
RPIA_METTH/52-221--------------------------------------------------------------------------------
G7E8P3_MIXOS/323-499--------------------------------------------------------------------------------
M4FG93_BRARP/93-269--------------------------------------------------------------------------------
G2KV06_LACSM/53-221--------------------------------------------------------------------------------
C4XRS4_DESMR/57-226--------------------------------------------------------------------------------
D8J531_HALJB/54-221--------------------------------------------------------------------------------
G8TEW3_NIAKG/51-220--------------------------------------------------------------------------------
J1L527_9EURY/55-219--------------------------------------------------------------------------------
G2SRV1_LACRR/44-202--------------------------------------------------------------------------------
U6EAE1_9EURY/63-232--------------------------------------------------------------------------------
Q31QQ3_SYNE7/62-233--------------------------------------------------------------------------------
H3ZMP8_THELN/50-221--------------------------------------------------------------------------------
S6A8V6_9SPIO/62-238--------------------------------------------------------------------------------
I2GY20_TETBL/77-255--------------------------------------------------------------------------------
F6BER2_METIK/49-218--------------------------------------------------------------------------------
RPIA_SCHPO/61-236--------------------------------------------------------------------------------
K4M6Y4_9EURY/76-244--------------------------------------------------------------------------------
C6XCW0_METGS/48-218--------------------------------------------------------------------------------
F9ZME5_ACICS/49-213--------------------------------------------------------------------------------
D3QZ19_CLOB3/64-256--------------------------------------------------------------------------------
D3SEL8_THISK/49-213--------------------------------------------------------------------------------
E8RQ79_ASTEC/50-224--------------------------------------------------------------------------------
F2NWS5_TRES6/60-234--------------------------------------------------------------------------------
B6JUX1_SCHJY/63-238--------------------------------------------------------------------------------
G8S1W4_ACTS5/66-231--------------------------------------------------------------------------------
M4NK33_9GAMM/49-211--------------------------------------------------------------------------------
C6WWN6_METML/48-217--------------------------------------------------------------------------------
RPIA_SPHAL/51-218--------------------------------------------------------------------------------
E8UD73_TAYEM/55-219--------------------------------------------------------------------------------
RPIA1_OCEIH/52-220--------------------------------------------------------------------------------
D3SVA8_NATMM/69-244--------------------------------------------------------------------------------
A0B633_METTP/29-193--------------------------------------------------------------------------------
I3ZAW8_TERRK/54-224--------------------------------------------------------------------------------
RPIA_PICTO/49-211--------------------------------------------------------------------------------
RPIA_PARL1/50-225--------------------------------------------------------------------------------
D5CP37_SIDLE/51-215--------------------------------------------------------------------------------
R5TAR3_9CLOT/56-224--------------------------------------------------------------------------------
RPIA_SYNPW/54-226--------------------------------------------------------------------------------
RPIA_NITEU/49-213--------------------------------------------------------------------------------
RPIA_POLSQ/52-230--------------------------------------------------------------------------------
R5YZJ2_9FIRM/42-213--------------------------------------------------------------------------------
RPIA_DICDI/49-225--------------------------------------------------------------------------------
E7KIH3_YEASA/23-200--------------------------------------------------------------------------------
E4U7T3_OCEP5/52-221--------------------------------------------------------------------------------
M1A5R9_SOLTU/83-260--------------------------------------------------------------------------------
H6NMT6_9BACL/47-215--------------------------------------------------------------------------------
RPIA_EXIS2/49-214--------------------------------------------------------------------------------
W1NX77_AMBTC/31-216--------------------------------------------------------------------------------
F6QWW6_CIOIN/61-235--------------------------------------------------------------------------------
J3LTE4_ORYBR/98-282--------------------------------------------------------------------------------
F2J5C1_POLGS/81-255--------------------------------------------------------------------------------
RPIA_PROMA/54-224--------------------------------------------------------------------------------
Q4XZ68_PLACH/43-218--------------------------------------------------------------------------------
T0M835_9EURY/55-221--------------------------------------------------------------------------------
A7SX61_NEMVE/50-223--------------------------------------------------------------------------------
RPIA_COLP3/49-213--------------------------------------------------------------------------------
C3YIZ9_BRAFL/53-227--------------------------------------------------------------------------------
I4Y6Z4_WALSC/89-265--------------------------------------------------------------------------------
D3E7P8_GEOS4/51-220--------------------------------------------------------------------------------
RPIA_AERHH/49-213--------------------------------------------------------------------------------
F2NQH9_MARHT/52-220--------------------------------------------------------------------------------
Q97J55_CLOAB/50-221--------------------------------------------------------------------------------
RPIA_BORPE/54-218--------------------------------------------------------------------------------
F8L7D9_SIMNZ/50-220--------------------------------------------------------------------------------
RPIA_LODEL/87-262--------------------------------------------------------------------------------
RPIA_BUCAI/49-213--------------------------------------------------------------------------------
A5WDJ0_PSYWF/48-213--------------------------------------------------------------------------------
C5E421_ZYGRC/103-280--------------------------------------------------------------------------------
R6KAA0_9BACE/67-232--------------------------------------------------------------------------------
RPIA_CRYNJ/105-288--------------------------------------------------------------------------------
R4I0M9_9ENTR/27-192--------------------------------------------------------------------------------
F2KNC4_ARCVS/49-218--------------------------------------------------------------------------------
RPIA_BIFAA/54-223--------------------------------------------------------------------------------
Q2NFM0_METST/52-220--------------------------------------------------------------------------------
A2BLS3_HYPBU/56-231--------------------------------------------------------------------------------
E1ZSN1_CHLVA/75-268--------------------------------------------------------------------------------
X4ZZX6_9BACL/47-215--------------------------------------------------------------------------------
RPIA_NEIMB/50-214--------------------------------------------------------------------------------
I2GXY8_TETBL/82-259--------------------------------------------------------------------------------
H2B0V5_KAZAF/71-248--------------------------------------------------------------------------------
F0XSQ4_GROCL/58-244--------------------------------------------------------------------------------
K0IAH2_NITGG/43-211--------------------------------------------------------------------------------
G0GBX5_SPITZ/48-222--------------------------------------------------------------------------------
Q2S577_SALRD/94-266--------------------------------------------------------------------------------
H1YDM0_9SPHI/67-233--------------------------------------------------------------------------------
M9R6A5_9RHOB/107-282--------------------------------------------------------------------------------
RPIA_MARMS/53-217--------------------------------------------------------------------------------
N0B2Z0_9RHIZ/50-225--------------------------------------------------------------------------------
H8GNV1_METAL/49-213--------------------------------------------------------------------------------
RPIA_SACD2/53-217--------------------------------------------------------------------------------
I0HPM0_RUBGI/49-214--------------------------------------------------------------------------------
E3I3Z1_RHOVT/52-227--------------------------------------------------------------------------------
W8JFF3_9CHLA/57-226--------------------------------------------------------------------------------
B3S327_TRIAD/82-257--------------------------------------------------------------------------------
E1V466_HALED/53-217--------------------------------------------------------------------------------
RPIA_LISMO/48-217--------------------------------------------------------------------------------
K0HYL3_9BURK/55-223--------------------------------------------------------------------------------
L0DB73_SINAD/52-222--------------------------------------------------------------------------------
I1GB43_AMPQE/96-272--------------------------------------------------------------------------------
F7WZV0_9ENTR/48-215--------------------------------------------------------------------------------
RPIA_AZOSB/49-213--------------------------------------------------------------------------------
F0Y5F5_AURAN/53-236--------------------------------------------------------------------------------
V2WV49_MONRO/117-294--------------------------------------------------------------------------------
F4NUT5_BATDJ/57-224--------------------------------------------------------------------------------
I6ZP08_MELRP/52-241--------------------------------------------------------------------------------
RPIA_TERTT/53-217--------------------------------------------------------------------------------
F6D5Q0_METSW/48-217--------------------------------------------------------------------------------
RPIA_THEAC/52-221--------------------------------------------------------------------------------
M9WWF3_PASHA/49-214--------------------------------------------------------------------------------
K0KIV4_WICCF/89-265--------------------------------------------------------------------------------
F5XWJ8_RAMTT/49-217--------------------------------------------------------------------------------
F1P520_CHICK/51-225--------------------------------------------------------------------------------
Q8A699_BACTN/68-231--------------------------------------------------------------------------------
RPIA_WIGBR/49-213--------------------------------------------------------------------------------
RPIA_ACIAD/51-216--------------------------------------------------------------------------------
RPIA_ALCBS/49-213--------------------------------------------------------------------------------
R7KJK7_9BURK/49-212--------------------------------------------------------------------------------
D7DIR1_METV0/48-216--------------------------------------------------------------------------------
RPIA_COXBU/49-213--------------------------------------------------------------------------------
R6DID1_9BACE/67-232--------------------------------------------------------------------------------
G8YN53_PICSO/70-246--------------------------------------------------------------------------------
RPIA_NITMU/49-213--------------------------------------------------------------------------------
G8NWP6_GRAMM/50-220--------------------------------------------------------------------------------
Q2JK16_SYNJB/60-231--------------------------------------------------------------------------------
E4RMI9_HALHG/47-215--------------------------------------------------------------------------------
RPIA_STRU0/49-217--------------------------------------------------------------------------------
M4YU37_9EURY/54-224--------------------------------------------------------------------------------
E1SRT4_FERBD/49-213--------------------------------------------------------------------------------
G2TNQ6_BACCO/47-213--------------------------------------------------------------------------------
T0LJI5_9EURY/46-210--------------------------------------------------------------------------------
R4VWQ3_9EURY/50-228--------------------------------------------------------------------------------
D7BFY7_MEISD/53-219--------------------------------------------------------------------------------
A6LDT5_PARD8/67-229--------------------------------------------------------------------------------
RPIA_BRADU/50-229--------------------------------------------------------------------------------
RPIA_PSYIN/49-213--------------------------------------------------------------------------------
G4LWP8_SCHMA/56-232--------------------------------------------------------------------------------
D6YRJ4_WADCW/55-225--------------------------------------------------------------------------------
B3PGI3_CELJU/53-218--------------------------------------------------------------------------------
RPIA_HALLT/54-234--------------------------------------------------------------------------------
G3B6X8_CANTC/51-227--------------------------------------------------------------------------------
X4ZKY5_9BACL/47-218--------------------------------------------------------------------------------
M7NVH6_PNEMU/63-238--------------------------------------------------------------------------------
T1G2H1_HELRO/34-210--------------------------------------------------------------------------------
B8GFA6_METPE/54-225--------------------------------------------------------------------------------
D5VCE7_MORCR/51-215--------------------------------------------------------------------------------
RPIA_AERPE/52-223--------------------------------------------------------------------------------
E3GWJ6_METFV/52-219--------------------------------------------------------------------------------
RPIA_LEGPH/46-211--------------------------------------------------------------------------------
M0SLL9_MUSAM/77-246--------------------------------------------------------------------------------
E3KHK5_PUCGT/92-267--------------------------------------------------------------------------------
F6I3G7_VITVI/31-214--------------------------------------------------------------------------------
G8BV63_TETPH/74-250--------------------------------------------------------------------------------
RPIA_VANPO/73-250--------------------------------------------------------------------------------
Q5L9R3_BACFN/67-232--------------------------------------------------------------------------------
B8D3V9_DESK1/56-231--------------------------------------------------------------------------------
C1DG96_AZOVD/53-217--------------------------------------------------------------------------------
J0DD48_AURDE/58-235--------------------------------------------------------------------------------
F9UTV2_LACPL/44-213--------------------------------------------------------------------------------
D3EQA2_ATETH/54-222--------------------------------------------------------------------------------
E3EIW3_PAEPS/47-215--------------------------------------------------------------------------------
B4RDL0_PHEZH/48-222--------------------------------------------------------------------------------
E8R3Z4_ISOPI/46-223--------------------------------------------------------------------------------
Q03Y20_LEUMM/48-216--------------------------------------------------------------------------------
H8L3T4_FRAAD/49-212--------------------------------------------------------------------------------
K1QVV1_CRAGI/53-228--------------------------------------------------------------------------------
G0S4N8_CHATD/70-253--------------------------------------------------------------------------------
B9SV71_RICCO/31-216--------------------------------------------------------------------------------
K8GIM2_9CYAN/57-226--------------------------------------------------------------------------------
F0YD86_AURAN/31-218--------------------------------------------------------------------------------
RPIA_PARUW/56-226--------------------------------------------------------------------------------
RPIA_PROMT/53-224--------------------------------------------------------------------------------
D8QJZ8_SCHCM/98-277--------------------------------------------------------------------------------
E0WTW1_9ENTR/49-211--------------------------------------------------------------------------------
I0DQJ4_PROSM/49-213--------------------------------------------------------------------------------
C8WXS2_ALIAD/47-215--------------------------------------------------------------------------------
Q057H5_BUCCC/48-211--------------------------------------------------------------------------------
R7IB62_9BURK/49-212--------------------------------------------------------------------------------
RPIA_NATPD/54-221--------------------------------------------------------------------------------
RPIA_AGRVS/50-224--------------------------------------------------------------------------------
A9FJ44_SORC5/54-221--------------------------------------------------------------------------------
C4K7U6_HAMD5/49-213--------------------------------------------------------------------------------
I3R125_HALMT/54-224--------------------------------------------------------------------------------
E1RIV4_METP4/53-224--------------------------------------------------------------------------------
E0TBP1_PARBH/47-221--------------------------------------------------------------------------------
A5UJW1_METS3/48-217--------------------------------------------------------------------------------
Q4J990_SULAC/47-214--------------------------------------------------------------------------------
RPIA_NITOC/49-213--------------------------------------------------------------------------------
L0KVT8_METHD/75-244--------------------------------------------------------------------------------
U4LD71_PYROM/74-243--------------------------------------------------------------------------------
Q04HC0_OENOB/54-221--------------------------------------------------------------------------------
C4WVS8_ACYPI/93-269--------------------------------------------------------------------------------
RPIA_METMP/63-233--------------------------------------------------------------------------------
A9TPW9_PHYPA/30-202--------------------------------------------------------------------------------
W4X032_ATTCE/11-187--------------------------------------------------------------------------------
K0C3P7_CYCSP/48-212--------------------------------------------------------------------------------
B4KS42_DROMO/59-235--------------------------------------------------------------------------------
G7UTB3_PSEUP/49-212--------------------------------------------------------------------------------
R6FYM5_9FIRM/44-214--------------------------------------------------------------------------------
RPIA_IDILO/51-215--------------------------------------------------------------------------------
B9H933_POPTR/302-473--------------------------------------------------------------------------------
E6N4F6_9ARCH/47-216--------------------------------------------------------------------------------
Q38UZ2_LACSS/51-220--------------------------------------------------------------------------------
G7WLJ5_METH6/55-219--------------------------------------------------------------------------------
R6UYF7_9FIRM/64-231--------------------------------------------------------------------------------
G0AB06_COLFT/70-238--------------------------------------------------------------------------------
C8XJ99_NAKMY/47-205--------------------------------------------------------------------------------
E3DMJ6_HALPG/47-216--------------------------------------------------------------------------------
D8IPP5_HERSS/49-217--------------------------------------------------------------------------------
F8DCN0_HALXS/54-229--------------------------------------------------------------------------------
RPIA_META3/58-228--------------------------------------------------------------------------------
RPIA_ROSS1/52-222--------------------------------------------------------------------------------
C7RN75_ACCPU/49-213--------------------------------------------------------------------------------
RPIA_TREPA/69-245--------------------------------------------------------------------------------

PF16957

G8NWE8_GRAMM/11-551----------------------------------------------SWTTRRDEKARRMRAVQAW....MSGPVLPREKT
A4G553_HERAR/3-550----------------------------------------------QWNLLSENRGKRIAR....G.LAITGRIADPGKI
F2F9P2_SOLSS/9-549----------------------------------------------SWSTRLEGKKKRLAEVEHL....VKGVTIPTEKI
R5PZQ8_9BURK/9-554----------------------------------------------RWDVRRRAKHARLEGTRKAL..GLSGKVIPTNKI
H0Q3G8_9RHOO/10-553----------------------------------------------AWDTRARNRARRLERAASL....ANGRNVAPENI
D7A7S5_STAND/12-556----------------------------------------------TWDRTRQSREARLAAASAY....ARGKLVAADNV
A1T0S7_PSYIN/7-551----------------------------------------------NWATKKALKVERINSVQHI....SHGKVIPTEQM
Q21AG5_RHOPB/6-554----------------------------------------------KWDKLATDTRQRMEAAAKY...IGPGKQVKKEDT
Q20XM1_RHOPB/13-552----------------------------------------------SWATRREGKQRRMALVSPW....MNGKFLPQKKI
Q478I4_DECAR/8-554----------------------------------------------QWDSLRQNRARRLERAASLGLAGQNGKEIPVDRI
D3FW15_BACPE/11-551----------------------------------------------SWTTKREAKARRLENIKKI....TTSKVIPTESI
A4VRZ1_PSEU5/10-555----------------------------------------------QWSRRRAEKARRLDQVQSL....ADGVVLPSERI
B2JLU6_BURP8/23-563----------------------------------------------SWTTKRDEKRRRLAAIEPW....LEDGILPANRI
B6JFK2_OLICO/14-556----------------------------------------------.WTRLEQSYRGRMERGNAI....SGHKIVPHQDA
C5APL2_METEA/4-548----------------------------------------------.WGRERAARDARIEAGRAH....AAGKIVTAANV
C9A847_ENTCA/7-547----------------------------------------------NWASKREKKAQTMKKIEHL....LDGKYVPTEAI
D5DB08_BACMD/10-550----------------------------------------------SWTTRRDQKAARLAKIDHL....LKGKLLGNEHI
E0SJB1_DICD3/11-551----------------------------------------------.WNTRRSEKQRRKASIA......VPGKVLPTEHL
Q5ZSU0_LEGPH/3-548----------------------------------------------.WNKNLKDYESRLIKIKPF...FKKGKIVSEKNI
Q63VB2_BURPS/4-548----------------------------------------------.WNEARAARAARLAAAAPL....ARGKRVAARDA
Q8P4U7_XANCP/4-548----------------------------------------------QWDTQAESRRQRLQRAAAL...APRGRVVAADDV
R7CR99_9FIRM/10-557----------------------------------------------NWNTRGEDTAARLKDGSAY....AKGKIVAAEDT

PF01182

Q3SH15_THIDA/10-221--------------------------------------------------------------------------------
B8HJV3_CYAP4/9-228--------------------------------------------------------------------------------
6PGL1_ORYSJ/38-272--------------------------------------------------------------------------------
D0LNM1_HALO1/16-236--------------------------------------------------------------------------------
B1XIZ0_SYNP2/9-227--------------------------------------------------------------------------------
B4M2H3_DROVI/15-234--------------------------------------------------------------------------------
B8GMY0_THISH/13-236--------------------------------------------------------------------------------
A8KYS2_FRASN/18-247--------------------------------------------------------------------------------
Q5NMF8_ZYMMO/10-233--------------------------------------------------------------------------------
C1EGM8_MICSR/42-262--------------------------------------------------------------------------------
C5B9U1_EDWI9/8-229--------------------------------------------------------------------------------
Q7NGI9_GLOVI/9-228--------------------------------------------------------------------------------
C7MSN0_SACVD/11-245--------------------------------------------------------------------------------
Q39SD7_GEOMG/6-227--------------------------------------------------------------------------------
A0L802_MAGSM/12-233--------------------------------------------------------------------------------
Q7V1T4_PROMP/18-234--------------------------------------------------------------------------------
C1D789_LARHH/8-223--------------------------------------------------------------------------------
A5FY02_ACICJ/12-233--------------------------------------------------------------------------------
Q3A631_PELCD/13-221--------------------------------------------------------------------------------
B0C6U0_ACAM1/9-229--------------------------------------------------------------------------------
A1BIC7_CHLPD/11-265--------------------------------------------------------------------------------
D2Q4L4_KRIFD/10-274--------------------------------------------------------------------------------
D0LCU1_GORB4/9-234--------------------------------------------------------------------------------
A9WT44_RENSM/9-251--------------------------------------------------------------------------------
Q1AZZ4_RUBXD/7-229--------------------------------------------------------------------------------
B8FL61_DESAA/16-238--------------------------------------------------------------------------------
B4S4M1_PROA2/7-257--------------------------------------------------------------------------------
A1SJQ5_NOCSJ/11-231--------------------------------------------------------------------------------
B3RVC2_TRIAD/8-226--------------------------------------------------------------------------------
D0L091_HALNC/12-236--------------------------------------------------------------------------------
D5URS5_TSUPD/12-243--------------------------------------------------------------------------------
Q1IWW4_DEIGD/7-212--------------------------------------------------------------------------------
C3ZBQ0_BRAFL/569-794--------------------------------------------------------------------------------
B1VDQ7_CORU7/27-269--------------------------------------------------------------------------------
Q2JHW7_SYNJB/10-224--------------------------------------------------------------------------------
A2G0T4_TRIVA/480-702--------------------------------------------------------------------------------
B2IE85_BEII9/11-231--------------------------------------------------------------------------------
A9UYD4_MONBE/167-386--------------------------------------------------------------------------------
A1U1P6_MARAV/16-235--------------------------------------------------------------------------------
A4S930_OSTLU/33-252--------------------------------------------------------------------------------
Q165T6_ROSDO/7-221--------------------------------------------------------------------------------
C6VSE7_DYAFD/7-229--------------------------------------------------------------------------------
B2GH88_KOCRD/13-243--------------------------------------------------------------------------------
Q3SP94_NITWN/19-240--------------------------------------------------------------------------------
A1AR88_PELPD/9-231--------------------------------------------------------------------------------
A6TTT0_ALKMQ/9-234--------------------------------------------------------------------------------
Q31GB5_THICR/12-219--------------------------------------------------------------------------------
C5BV30_BEUC1/10-236--------------------------------------------------------------------------------
Q89FE0_BRADU/14-235--------------------------------------------------------------------------------
6PGL_DICDI/11-234--------------------------------------------------------------------------------
E3D833_GARV3/17-261--------------------------------------------------------------------------------
A0JWQ2_ARTS2/11-250--------------------------------------------------------------------------------
Q60CQ2_METCA/8-232--------------------------------------------------------------------------------
D3Q4S0_STANL/10-238--------------------------------------------------------------------------------
B0T0C3_CAUSK/15-233--------------------------------------------------------------------------------
B9RWU5_RICCO/17-246--------------------------------------------------------------------------------
Q0V513_PHANO/11-243--------------------------------------------------------------------------------
A8LLP7_DINSH/7-222--------------------------------------------------------------------------------
C5E1Z3_LACTC/131-360--------------------------------------------------------------------------------
Q6A7F7_PROAC/10-227--------------------------------------------------------------------------------
6PGL_RAT/13-237--------------------------------------------------------------------------------
A3HVL3_9BACT/7-226--------------------------------------------------------------------------------
Q482L5_COLP3/8-229--------------------------------------------------------------------------------
Q602U1_METCA/13-226--------------------------------------------------------------------------------
A7RMK1_NEMVE/10-232--------------------------------------------------------------------------------
A8Y0B4_CAEBR/9-229--------------------------------------------------------------------------------
C1MQ42_MICPC/10-239--------------------------------------------------------------------------------
B4SF86_PELPB/47-298--------------------------------------------------------------------------------
B1LXU6_METRJ/11-233--------------------------------------------------------------------------------
A6X608_OCHA4/9-230--------------------------------------------------------------------------------
Q2SQ14_HAHCH/16-233--------------------------------------------------------------------------------
C7R459_JONDD/9-233--------------------------------------------------------------------------------
C1DRP8_AZOVD/18-236--------------------------------------------------------------------------------
A5FAH5_FLAJ1/6-228--------------------------------------------------------------------------------
A9PA91_POPTR/14-244--------------------------------------------------------------------------------
6PGL_TREPA/7-224--------------------------------------------------------------------------------
Q7UM40_RHOBA/5-223--------------------------------------------------------------------------------
C3ZB29_BRAFL/10-239--------------------------------------------------------------------------------
B8C1W9_THAPS/20-270--------------------------------------------------------------------------------
Q5FQ99_GLUOX/14-235--------------------------------------------------------------------------------
Q6NH39_CORDI/8-228--------------------------------------------------------------------------------
A8IFM0_AZOC5/18-239--------------------------------------------------------------------------------
B0UFD2_METS4/12-231--------------------------------------------------------------------------------
Q08ZT9_STIAD/9-213--------------------------------------------------------------------------------
Q2IHT3_ANADE/13-235--------------------------------------------------------------------------------
D1CEH8_THET1/9-231--------------------------------------------------------------------------------
Q31QV8_SYNE7/9-229--------------------------------------------------------------------------------
C1DDK6_AZOVD/18-235--------------------------------------------------------------------------------
A6WC51_KINRD/12-239--------------------------------------------------------------------------------
B1MC71_MYCA9/10-236--------------------------------------------------------------------------------
D2SF51_GEOOG/27-257--------------------------------------------------------------------------------
D1BS91_XYLCX/10-239--------------------------------------------------------------------------------
Q5YTR6_NOCFA/29-251--------------------------------------------------------------------------------
Q0BTV3_GRABC/17-236--------------------------------------------------------------------------------
B2FL79_STRMK/16-238--------------------------------------------------------------------------------
A5BJC3_VITVI/17-249--------------------------------------------------------------------------------
B8IN69_METNO/12-232--------------------------------------------------------------------------------
Q8DJZ4_THEEB/10-227--------------------------------------------------------------------------------
D2AVA1_STRRD/10-237--------------------------------------------------------------------------------
Q4Q8S1_LEIMA/12-256--------------------------------------------------------------------------------
Q312M1_DESAG/38-260--------------------------------------------------------------------------------
A5EXD3_DICNV/9-224--------------------------------------------------------------------------------
A0LDZ7_MAGSM/13-230--------------------------------------------------------------------------------
C4LIR1_CORK4/27-277--------------------------------------------------------------------------------
B3EN23_CHLPB/5-259--------------------------------------------------------------------------------
B7FPL4_PHATC/11-262--------------------------------------------------------------------------------
B8ELV8_METSB/11-231--------------------------------------------------------------------------------
G6PE_HUMAN/558-782--------------------------------------------------------------------------------
A5VAC4_SPHWW/10-232--------------------------------------------------------------------------------
Q4K7U0_PSEF5/18-235--------------------------------------------------------------------------------
C5FTG3_ARTOC/12-245--------------------------------------------------------------------------------
C7LRB5_DESBD/8-228--------------------------------------------------------------------------------
D2QID0_SPILD/7-229--------------------------------------------------------------------------------
C1FA85_ACIC5/13-240--------------------------------------------------------------------------------
B4GTC9_DROPE/14-235--------------------------------------------------------------------------------
6PGL_CAEEL/21-242--------------------------------------------------------------------------------
6PGL_XYLFA/15-237--------------------------------------------------------------------------------
F2G576_ALTMD/9-228--------------------------------------------------------------------------------
A9BG97_PETMO/7-228--------------------------------------------------------------------------------
C7MCP6_BRAFD/326-560--------------------------------------------------------------------------------
B2J9Q0_NOSP7/9-228--------------------------------------------------------------------------------
D7B103_NOCDD/10-238--------------------------------------------------------------------------------
B3RLE2_TRIAD/566-785--------------------------------------------------------------------------------
SOL4_YEAST/8-241--------------------------------------------------------------------------------
C5B1S2_METEA/13-236--------------------------------------------------------------------------------
Q2Y8J3_NITMU/15-226--------------------------------------------------------------------------------
A0LTY4_ACIC1/9-232--------------------------------------------------------------------------------
Q6FQZ7_CANGA/8-232--------------------------------------------------------------------------------
Q16H01_AEDAE/9-231--------------------------------------------------------------------------------
Q11M12_CHESB/10-230--------------------------------------------------------------------------------
A0QWX6_MYCS2/10-234--------------------------------------------------------------------------------
B9L0S4_THERP/9-234--------------------------------------------------------------------------------
B5HF46_STRPR/11-241--------------------------------------------------------------------------------
Q01VT6_SOLUE/9-230--------------------------------------------------------------------------------
A2EC78_TRIVA/488-712--------------------------------------------------------------------------------
A6L9R0_PARD8/7-228--------------------------------------------------------------------------------
A8HQW1_CHLRE/5-232--------------------------------------------------------------------------------
Q210H8_RHOPB/9-229--------------------------------------------------------------------------------
Q7D149_AGRT5/9-230--------------------------------------------------------------------------------
B0REI8_CLAMS/11-237--------------------------------------------------------------------------------
Q6CXV1_KLULA/8-237--------------------------------------------------------------------------------
Q4CQA8_TRYCC/11-251--------------------------------------------------------------------------------
Q5LRS8_RUEPO/7-221--------------------------------------------------------------------------------
C8X5S3_DESRD/22-247--------------------------------------------------------------------------------
Q0C1F0_HYPNA/9-234--------------------------------------------------------------------------------
Q1IMT5_KORVE/19-241--------------------------------------------------------------------------------
C5DTU9_ZYGRC/7-240--------------------------------------------------------------------------------
B3PCY8_CELJU/8-232--------------------------------------------------------------------------------
A9TLR4_PHYPA/4-237--------------------------------------------------------------------------------
Q28QX5_JANSC/8-222--------------------------------------------------------------------------------
Q0ALB6_MARMM/15-240--------------------------------------------------------------------------------
Q1QTX1_CHRSD/7-223--------------------------------------------------------------------------------
A7TEX2_VANPO/8-238--------------------------------------------------------------------------------
Q2H6B6_CHAGB/11-242--------------------------------------------------------------------------------
Q7QGR5_ANOGA/12-234--------------------------------------------------------------------------------
A7RLB1_NEMVE/507-732--------------------------------------------------------------------------------
B3MQE2_DROAN/14-235--------------------------------------------------------------------------------
Q1H2F6_METFK/21-229--------------------------------------------------------------------------------
A9F2S9_SORC5/11-231--------------------------------------------------------------------------------
A4CNJ0_ROBBH/7-226--------------------------------------------------------------------------------
Q758H7_ASHGO/101-325--------------------------------------------------------------------------------
6PGL_RHILO/17-236--------------------------------------------------------------------------------
A1A127_BIFAA/13-255--------------------------------------------------------------------------------
A3N1V8_ACTP2/9-222--------------------------------------------------------------------------------
A6L429_BACV8/12-221--------------------------------------------------------------------------------
B2UK49_RALPJ/10-223--------------------------------------------------------------------------------
B7J926_ACIF2/14-216--------------------------------------------------------------------------------
B7VN92_VIBSL/13-227--------------------------------------------------------------------------------
C0ZZG4_RHOE4/11-231--------------------------------------------------------------------------------
D7GEP6_PROFC/12-230--------------------------------------------------------------------------------
E7QFR9_YEASZ/10-234--------------------------------------------------------------------------------
F7BV51_XENTR/350-572--------------------------------------------------------------------------------
H9JWK2_BOMMO/8-220--------------------------------------------------------------------------------
J9ZCI7_LEPFM/20-235--------------------------------------------------------------------------------
M1F8P0_9ALTE/19-237--------------------------------------------------------------------------------
M4Q661_LIBAS/11-223--------------------------------------------------------------------------------
6PGL_MYCTU/10-235--------------------------------------------------------------------------------
Q385D6_TRYB2/12-245--------------------------------------------------------------------------------
Q3JBF3_NITOC/9-228--------------------------------------------------------------------------------
Q46LF9_PROMT/11-224--------------------------------------------------------------------------------
Q59PZ6_CANAL/10-232--------------------------------------------------------------------------------
Q5LE34_BACFN/13-219--------------------------------------------------------------------------------
Q5ZYF5_LEGPH/14-220--------------------------------------------------------------------------------
Q6G4F3_BARHE/14-230--------------------------------------------------------------------------------
Q6LS72_PHOPR/10-227--------------------------------------------------------------------------------
Q7V812_PROMM/11-220--------------------------------------------------------------------------------
Q83GH9_TROWT/52-269--------------------------------------------------------------------------------
Q887J1_PSESM/19-235--------------------------------------------------------------------------------
Q8EE99_SHEON/12-226--------------------------------------------------------------------------------
Q8G730_BIFLO/41-300--------------------------------------------------------------------------------
Q8NQ61_CORGL/9-224--------------------------------------------------------------------------------
6PGL_DROME/15-227--------------------------------------------------------------------------------
6PGL_THEMA/14-216--------------------------------------------------------------------------------
R5U357_9BACE/14-221--------------------------------------------------------------------------------
R6K673_9BACE/10-218--------------------------------------------------------------------------------

PF02589

Q30YW4_DESAG/23-221--------------------------------------------------------------------------------
Q72A59_DESVH/13-211--------------------------------------------------------------------------------
A0LET5_SYNFM/13-211--------------------------------------------------------------------------------
A8ZY31_DESOH/13-211--------------------------------------------------------------------------------
Q6AQM0_DESPS/13-211--------------------------------------------------------------------------------
A5N319_CLOK5/16-217--------------------------------------------------------------------------------
A3DDG8_CLOTH/16-211--------------------------------------------------------------------------------
Q18C30_PEPD6/15-209--------------------------------------------------------------------------------
A6LXE8_CLOB8/15-209--------------------------------------------------------------------------------
B8D0K4_HALOH/12-205--------------------------------------------------------------------------------
A4XID0_CALS8/13-207--------------------------------------------------------------------------------
A5I080_CLOBH/11-201--------------------------------------------------------------------------------
A7HK56_FERNB/14-207--------------------------------------------------------------------------------
A6LMB1_THEM4/14-207--------------------------------------------------------------------------------
A8F3V4_THELT/14-204--------------------------------------------------------------------------------
A5MYV3_CLOK5/13-207--------------------------------------------------------------------------------
Q97IL7_CLOAB/13-207--------------------------------------------------------------------------------
Q188D0_PEPD6/13-206--------------------------------------------------------------------------------
Q892L7_CLOTE/13-207--------------------------------------------------------------------------------
A8MGY9_ALKOO/13-207--------------------------------------------------------------------------------
A5N989_CLOK5/13-207--------------------------------------------------------------------------------
A5I1I2_CLOBH/13-207--------------------------------------------------------------------------------
Q897Y1_CLOTE/13-206--------------------------------------------------------------------------------
B8CXT8_HALOH/13-207--------------------------------------------------------------------------------
B8I8V5_CLOCE/13-218--------------------------------------------------------------------------------
Q7MR09_WOLSU/5-199--------------------------------------------------------------------------------
Q251U6_DESHY/5-199--------------------------------------------------------------------------------
Q97M44_CLOAB/13-207--------------------------------------------------------------------------------
B5EEH8_GEOBB/16-211--------------------------------------------------------------------------------
A5G901_GEOUR/16-211--------------------------------------------------------------------------------
A5CYU3_PELTS/16-210--------------------------------------------------------------------------------
A0PZA2_CLONN/13-207--------------------------------------------------------------------------------
Q6M046_METMP/13-207--------------------------------------------------------------------------------
A4J2Z4_DESRM/12-207--------------------------------------------------------------------------------
A6TQ94_ALKMQ/5-197--------------------------------------------------------------------------------
A8MHS3_ALKOO/5-197--------------------------------------------------------------------------------
A7I305_CAMHC/3-194--------------------------------------------------------------------------------
A8EV54_ARCB4/1-193--------------------------------------------------------------------------------
A6LYD8_CLOB8/3-195--------------------------------------------------------------------------------
B9LU40_HALLT/27-212--------------------------------------------------------------------------------
Q5V6G7_HALMA/27-212--------------------------------------------------------------------------------
A3CXV8_METMJ/32-217--------------------------------------------------------------------------------
Q8T2H5_DICDI/31-220--------------------------------------------------------------------------------
Q8T2H6_DICDI/31-218--------------------------------------------------------------------------------
Q9BI24_DICDI/30-213--------------------------------------------------------------------------------
A8LFX8_FRASN/21-203--------------------------------------------------------------------------------
Q6ABE0_PROAC/50-223--------------------------------------------------------------------------------
A1ATQ9_PELPD/34-209--------------------------------------------------------------------------------
B5EIV8_GEOBB/2-175--------------------------------------------------------------------------------
A4J2C5_DESRM/13-186--------------------------------------------------------------------------------
A5D032_PELTS/17-190--------------------------------------------------------------------------------
Q30WA8_DESAG/6-203--------------------------------------------------------------------------------
Q6APH5_DESPS/6-194--------------------------------------------------------------------------------
A0LF89_SYNFM/7-180--------------------------------------------------------------------------------
Q1ARS5_RUBXD/44-220--------------------------------------------------------------------------------
LUTC_BACP2/52-237--------------------------------------------------------------------------------
Q836K1_ENTFA/52-236--------------------------------------------------------------------------------
LUTC_OCEIH/49-232--------------------------------------------------------------------------------
Q1WT28_LACS1/55-240--------------------------------------------------------------------------------
Q6LPN1_PHOPR/50-245--------------------------------------------------------------------------------
Q24VR0_DESHY/42-220--------------------------------------------------------------------------------
Q2SMI8_HAHCH/39-216--------------------------------------------------------------------------------
Q47V41_COLP3/52-226--------------------------------------------------------------------------------
Q3IEG6_PSEHT/41-215--------------------------------------------------------------------------------
Q7NTM5_CHRVO/41-217--------------------------------------------------------------------------------
Q4KII4_PSEF5/42-220--------------------------------------------------------------------------------
Q2VZP0_MAGSA/37-213--------------------------------------------------------------------------------
Q5F884_NEIG1/42-219--------------------------------------------------------------------------------
Q310K5_DESAG/40-217--------------------------------------------------------------------------------
Q6AIU4_DESPS/43-219--------------------------------------------------------------------------------
Q72B57_DESVH/44-220--------------------------------------------------------------------------------
Q0PC62_CAMJE/47-218--------------------------------------------------------------------------------
A0RPC6_CAMFF/42-213--------------------------------------------------------------------------------
Q7VIF4_HELHP/38-218--------------------------------------------------------------------------------
A7IG69_XANP2/53-223--------------------------------------------------------------------------------
Q11LF2_CHESB/52-222--------------------------------------------------------------------------------
A1SVG8_PSYIN/32-224--------------------------------------------------------------------------------
A8MDI5_CALMQ/50-279--------------------------------------------------------------------------------
A2BLD6_HYPBU/71-302--------------------------------------------------------------------------------
Q9YFI8_AERPE/68-298--------------------------------------------------------------------------------
A7HA97_ANADF/64-283--------------------------------------------------------------------------------
Q7MVA5_PORGI/38-257--------------------------------------------------------------------------------
Q47F70_DECAR/78-303--------------------------------------------------------------------------------
Q6ABE1_PROAC/94-322--------------------------------------------------------------------------------
Q47IA5_DECAR/76-304--------------------------------------------------------------------------------
A1B665_PARDP/69-294--------------------------------------------------------------------------------
A5G2K5_ACICJ/68-296--------------------------------------------------------------------------------
A0LED1_SYNFM/69-293--------------------------------------------------------------------------------
A5V1N8_ROSS1/68-292--------------------------------------------------------------------------------
Q67TB4_SYMTH/77-301--------------------------------------------------------------------------------
Q1ARS4_RUBXD/86-314--------------------------------------------------------------------------------
Q01UG1_SOLUE/67-291--------------------------------------------------------------------------------
Q1IN28_KORVE/68-293--------------------------------------------------------------------------------
LUTB_BACLD/70-295--------------------------------------------------------------------------------
LUTB_OCEIH/70-294--------------------------------------------------------------------------------
Q6D5W9_PECAS/70-294--------------------------------------------------------------------------------
Q81ND6_BACAN/69-293--------------------------------------------------------------------------------
Q24VR1_DESHY/69-293--------------------------------------------------------------------------------
A5VIG9_LACRD/70-294--------------------------------------------------------------------------------
B9LU44_HALLT/67-296--------------------------------------------------------------------------------
Q3ISD5_NATPD/64-299--------------------------------------------------------------------------------
A5GDG8_GEOUR/64-287--------------------------------------------------------------------------------
A5D031_PELTS/65-292--------------------------------------------------------------------------------
Q3AEY7_CARHZ/62-279--------------------------------------------------------------------------------
Q24W82_DESHY/65-292--------------------------------------------------------------------------------
Q8RIN1_FUSNN/65-294--------------------------------------------------------------------------------
Q726S3_DESVH/69-294--------------------------------------------------------------------------------
Q74CQ3_GEOSL/61-280--------------------------------------------------------------------------------
A4J1M6_DESRM/66-295--------------------------------------------------------------------------------
A5UNQ3_METS3/51-284--------------------------------------------------------------------------------
O26243_METTH/51-280--------------------------------------------------------------------------------
A4J1M5_DESRM/47-258--------------------------------------------------------------------------------
A5HZY1_CLOBH/14-207--------------------------------------------------------------------------------
A5VIG8_LACRD/58-241--------------------------------------------------------------------------------
A9WGW7_CHLAA/44-229--------------------------------------------------------------------------------
C6XV06_PEDHD/69-292--------------------------------------------------------------------------------
M9X3V9_PASHA/50-227--------------------------------------------------------------------------------
O24950_HELPY/71-295--------------------------------------------------------------------------------
Q0PC61_CAMJE/70-292--------------------------------------------------------------------------------
Q24WP5_DESHY/68-297--------------------------------------------------------------------------------
Q5SIK3_THET8/69-291--------------------------------------------------------------------------------
Q63NH7_BURPS/72-300--------------------------------------------------------------------------------
Q63SM7_BURPS/67-292--------------------------------------------------------------------------------
Q6LSA7_PHOPR/40-218--------------------------------------------------------------------------------
LUTB_BACCR/71-293--------------------------------------------------------------------------------
Q81ND7_BACAN/48-228--------------------------------------------------------------------------------
LUTC_BACAN/51-236--------------------------------------------------------------------------------
Q8XH83_CLOPE/14-207--------------------------------------------------------------------------------
Q9WXZ9_THEMA/17-208--------------------------------------------------------------------------------
R5KLF2_9CLOT/15-206--------------------------------------------------------------------------------
R5QY75_9FIRM/13-205--------------------------------------------------------------------------------
R5UE40_9FIRM/14-205--------------------------------------------------------------------------------
R6MWQ8_9CLOT/13-227--------------------------------------------------------------------------------
R7FYW0_9FIRM/15-206--------------------------------------------------------------------------------
U5L6H3_9BACI/52-235--------------------------------------------------------------------------------

PF01812

MTHFS_HUMAN/10-198--------------------------------------------------------------------------------
5FCLL_ARATH/92-290--------------------------------------------------------------------------------
MTHFS_CAEEL/8-197--------------------------------------------------------------------------------
YQGN_BACSU/2-179--------------------------------------------------------------------------------
O83692_TREPA/4-207--------------------------------------------------------------------------------
Q9RKA5_STRCO/12-197--------------------------------------------------------------------------------
Y858_HAEIN/6-187--------------------------------------------------------------------------------
MTHFS_RABIT/10-198--------------------------------------------------------------------------------
O26306_METTH/134-322--------------------------------------------------------------------------------
FTHC_YEAST/4-203--------------------------------------------------------------------------------
Q9YFU3_AERPE/7-205--------------------------------------------------------------------------------
P73038_SYNY3/3-179--------------------------------------------------------------------------------
O67621_AQUAE/3-175--------------------------------------------------------------------------------
Q9ZD82_RICPR/3-172--------------------------------------------------------------------------------
O05575_MYCTU/6-186--------------------------------------------------------------------------------
H2VFJ2_CHLTE/8-188--------------------------------------------------------------------------------
Q7AQM9_MYCLE/6-186--------------------------------------------------------------------------------
Q8DVY5_STRMU/3-174--------------------------------------------------------------------------------

PF13336

A6LV90_CLOB8/275-428----------------------------------------------GTKRL-----------------------------
B8F9H4_DESAA/272-425----------------------------------------------GTERL-----------------------------
Q7MWD3_PORGI/273-426----------------------------------------------GSEDV-----------------------------
B8CZD4_HALOH/271-424----------------------------------------------GTNRL-----------------------------
Q3ACH6_CARHZ/275-428----------------------------------------------GTKKL-----------------------------
D2QBR0_SPILD/268-420----------------------------------------------GSQRV-----------------------------
D7BE02_MEISD/284-437----------------------------------------------GSERL-----------------------------
Q898H0_CLOTE/272-425----------------------------------------------GTKKL-----------------------------
A0L8K8_MAGSM/267-420----------------------------------------------GTKRI-----------------------------
A5N390_CLOK5/276-429----------------------------------------------GTKKL-----------------------------
Q15V19_PSEA6/267-420----------------------------------------------GSKKL-----------------------------
Q39QG7_GEOMG/278-431----------------------------------------------GTKRL-----------------------------
B3QTM9_CHLT3/265-417----------------------------------------------GSRRL-----------------------------
A9AXP3_HERA2/264-416----------------------------------------------GTRRL-----------------------------
Q8CXQ9_LEPIN/270-422----------------------------------------------GTRKL-----------------------------
A5URR7_ROSS1/272-425----------------------------------------------GSQRC-----------------------------
Q24WU2_DESHY/311-467----------------------------------------------GTQKT-----------------------------
C7M4J2_CAPOD/265-417----------------------------------------------GTQEL-----------------------------
Q5QXA2_IDILO/264-417----------------------------------------------GSQAL-----------------------------
B9M8N9_GEODF/274-427----------------------------------------------GTRRL-----------------------------
B9M9H7_GEODF/264-417----------------------------------------------GSQKV-----------------------------
A7H923_ANADF/265-417----------------------------------------------GTRRL-----------------------------
C7RL22_ACCPU/274-427----------------------------------------------GSQKL-----------------------------
Q3ANX0_CHLCH/266-418----------------------------------------------GTKRL-----------------------------
A0M1A3_GRAFK/267-419----------------------------------------------GSPKL-----------------------------
Q0IG02_AEDAE/314-468----------------------------------------------GTKKL-----------------------------
D1C4I7_SPHTD/264-417----------------------------------------------GTDRL-----------------------------
A7HKG2_FERNB/273-426----------------------------------------------GSKKM-----------------------------
A6GWR2_FLAPJ/265-417----------------------------------------------GSQRL-----------------------------
A8F649_THELT/274-427----------------------------------------------GTKRM-----------------------------
B5ECU8_GEOBB/278-431----------------------------------------------GTKRL-----------------------------
A1KBF4_AZOSB/272-425----------------------------------------------GSRKL-----------------------------
Q2LSP1_SYNAS/286-439----------------------------------------------GKKET-----------------------------
A4ASU6_MARSH/266-418----------------------------------------------GSRRL-----------------------------
Q01VE3_SOLUE/270-423----------------------------------------------GSKVL-----------------------------
B5E7S1_GEOBB/278-431----------------------------------------------GTKRL-----------------------------
B2TLD8_CLOBB/272-425----------------------------------------------GSQRL-----------------------------
A0B6T6_METTP/284-437----------------------------------------------GTRKT-----------------------------
A4J1E7_DESRM/279-435----------------------------------------------GSQRL-----------------------------
D6Z2N5_DESAT/282-435----------------------------------------------GTRKL-----------------------------
Q1IT47_KORVE/273-426----------------------------------------------GTRRM-----------------------------
B5Y607_COPPD/273-426----------------------------------------------GTQRL-----------------------------
D3FVG7_BACPE/268-421----------------------------------------------GTKRL-----------------------------
Q0AVM5_SYNWW/279-434----------------------------------------------GSQEL-----------------------------
Q2FRF0_METHJ/278-431----------------------------------------------GTRRM-----------------------------
B2A2S6_NATTJ/273-426----------------------------------------------GSQKL-----------------------------
B9JLD2_AGRRK/284-435----------------------------------------------GDQAL-----------------------------
A3HTS6_9BACT/267-419----------------------------------------------GTREL-----------------------------
A9GMK9_SORC5/277-430----------------------------------------------GSRAL-----------------------------
C7PPM1_CHIPD/268-420----------------------------------------------GTRKL-----------------------------
C0QJK6_DESAH/274-427----------------------------------------------GSRKL-----------------------------
D2VMT8_NAEGR/323-475----------------------------------------------GSRNI-----------------------------
B2HRD6_MYCMM/288-439----------------------------------------------GDRKT-----------------------------
A9BH20_PETMO/279-432----------------------------------------------GTKRM-----------------------------
Q0AW71_SYNWW/272-425----------------------------------------------GSRRL-----------------------------
Q4A5M6_MYCS5/287-438----------------------------------------------GNKQM-----------------------------
A4J4L6_DESRM/279-435----------------------------------------------GTQRL-----------------------------
E6VZH2_DESAO/276-429----------------------------------------------GTRDT-----------------------------
Q220T6_ALBFT/272-425----------------------------------------------GSKKL-----------------------------
A4AMZ0_MARSH/269-421----------------------------------------------GSQDL-----------------------------
D4IP35_9BACT/266-418----------------------------------------------GSRRL-----------------------------
A1U877_MARAV/284-436----------------------------------------------GDRKL-----------------------------
D4J7D4_9FIRM/278-438----------------------------------------------GSQRL-----------------------------
D2VCN4_NAEGR/199-351----------------------------------------------GSKEM-----------------------------
C6X0M3_FLAB3/276-428----------------------------------------------GTRKL-----------------------------
C0QKC6_DESAH/273-426----------------------------------------------GSKQL-----------------------------
C8VZ55_DESAS/277-433----------------------------------------------GSKNL-----------------------------
C0QAD0_DESAH/281-437----------------------------------------------GSQRL-----------------------------
A0LMU1_SYNFM/292-445----------------------------------------------GSREL-----------------------------
A9NFJ4_ACHLI/270-431----------------------------------------------GTQEL-----------------------------
B8FDQ1_DESAA/279-432----------------------------------------------GSEKL-----------------------------
Q3A1S1_PELCD/278-433----------------------------------------------GTRKM-----------------------------
Q21W64_ALBFT/279-435----------------------------------------------GSQKL-----------------------------
B8F9D7_DESAA/274-430----------------------------------------------GSKAT-----------------------------
A4J5F7_DESRM/278-434----------------------------------------------GSQKL-----------------------------
A8MLT0_ALKOO/317-464----------------------------------------------GLKRL-----------------------------
A4J1H7_DESRM/278-434----------------------------------------------GSPRL-----------------------------
Q0AW62_SYNWW/282-438----------------------------------------------GNREL-----------------------------
A8ZXP1_DESOH/277-430----------------------------------------------GSAEL-----------------------------
Q0AZT0_SYNWW/278-433----------------------------------------------GSQRL-----------------------------
A2SP55_METPP/278-433----------------------------------------------GSRHL-----------------------------
D4KHS0_9FIRM/319-466----------------------------------------------GLKRF-----------------------------
Q2RRD2_RHORT/322-473----------------------------------------------GNKEM-----------------------------
A0LHR8_SYNFM/278-431----------------------------------------------GSADL-----------------------------
Q18599_CAEEL/306-460----------------------------------------------GSTKL-----------------------------
A7SYK6_NEMVE/323-477----------------------------------------------GTKKV-----------------------------
Q0AXU7_SYNWW/280-436----------------------------------------------GSEKL-----------------------------
C4Z8H6_EUBR3/279-435----------------------------------------------GTKKM-----------------------------
D1B8D5_THEAS/325-472----------------------------------------------GARRM-----------------------------
Q0B052_SYNWW/278-434----------------------------------------------GTNKL-----------------------------
B7QJI4_IXOSC/314-468----------------------------------------------GTQRL-----------------------------
Q6AQI5_DESPS/285-438----------------------------------------------GTKKL-----------------------------
B0TCP9_HELMI/277-433----------------------------------------------GTKRL-----------------------------
A4J446_DESRM/283-434----------------------------------------------GTKRL-----------------------------
C0QDJ7_DESAH/279-431----------------------------------------------GSTTF-----------------------------
A0R5U0_MYCS2/274-430----------------------------------------------GSPDL-----------------------------
Q2LPI7_SYNAS/276-429----------------------------------------------GPKEM-----------------------------
A8WP03_CAEBR/305-459----------------------------------------------GTKEF-----------------------------
B2W452_PYRTR/302-453----------------------------------------------GFQRF-----------------------------
Q0RWG8_RHOSR/538-685----------------------------------------------GIEEL-----------------------------
A1TGQ6_MYCVP/271-426----------------------------------------------GSTEL-----------------------------
A5E2Y9_LODEL/243-394----------------------------------------------GFKKF-----------------------------
A7HPG3_PARL1/328-491----------------------------------------------GSRAF-----------------------------
D2RM64_ACIFV/277-437----------------------------------------------GSQEL-----------------------------
Q0AY76_SYNWW/278-434----------------------------------------------GTQIL-----------------------------
O29120_ARCFU/297-457----------------------------------------------GSLKL-----------------------------
Q2SL76_HAHCH/439-606----------------------------------------------GPQRF-----------------------------
ACH1_YARLI/333-484----------------------------------------------GFKRF-----------------------------
O28424_ARCFU/289-449----------------------------------------------GTRKL-----------------------------
A7HD82_ANADF/326-473----------------------------------------------GQERF-----------------------------
C5DU17_ZYGRC/331-482----------------------------------------------GFDRL-----------------------------
D4JBB9_9FIRM/276-431----------------------------------------------GDKAM-----------------------------
B5EIE5_GEOBB/327-478----------------------------------------------GFQRL-----------------------------
B0DKN0_LACBS/350-501----------------------------------------------GFDHF-----------------------------
B6K306_SCHJY/330-481----------------------------------------------GFEHF-----------------------------
ACH1_SCHPO/330-481----------------------------------------------GFEKF-----------------------------
A0LG92_SYNFM/280-432----------------------------------------------GTKDL-----------------------------
Q74GS1_GEOSL/327-478----------------------------------------------GFKRF-----------------------------
A5V7D2_SPHWW/272-423----------------------------------------------GDQCF-----------------------------
Q0AV35_SYNWW/283-439----------------------------------------------GDQAL-----------------------------
D2V812_NAEGR/332-483----------------------------------------------GFKKF-----------------------------
D2RN63_ACIFV/277-434----------------------------------------------GSQEL-----------------------------
B9M8L3_GEODF/333-484----------------------------------------------GIKRL-----------------------------
Q6LQ13_PHOPR/472-639----------------------------------------------GPKDF-----------------------------
A8ZWK6_DESOH/447-610----------------------------------------------GANRF-----------------------------
A1W2A3_ACISJ/277-426----------------------------------------------GGEKL-----------------------------
B6JG54_OLICO/334-497----------------------------------------------GPKSF-----------------------------
Q0VNK9_ALCBS/436-599----------------------------------------------GPRDF-----------------------------
D3BTR1_POLPA/348-499----------------------------------------------GFNRL-----------------------------
B8FMI7_DESAA/441-604----------------------------------------------GPNGF-----------------------------
ACH1_DICDI/341-492----------------------------------------------GFNRL-----------------------------
Q0BZS7_HYPNA/258-410----------------------------------------------GTPAL-----------------------------
Q1DA17_MYXXD/323-474----------------------------------------------GRQRF-----------------------------
A1SHN0_NOCSJ/246-396----------------------------------------------GSPEL-----------------------------
C0QKG0_DESAH/440-603----------------------------------------------GPQAF-----------------------------
Q88CB5_PSEPK/319-482----------------------------------------------GPQAF-----------------------------
A8ZT97_DESOH/278-429----------------------------------------------GTENL-----------------------------
D0LM00_HALO1/437-597----------------------------------------------GSRRF-----------------------------
Q0RK43_FRAAA/215-365----------------------------------------------GSAEL-----------------------------
D1A9C8_THECD/271-421----------------------------------------------GSPEL-----------------------------
Q2JCQ5_FRASC/281-431----------------------------------------------GSAEL-----------------------------
Q0C1R5_HYPNA/318-481----------------------------------------------GPQNF-----------------------------
C7LYG5_ACIFD/255-405----------------------------------------------GSAEL-----------------------------
D2UEK6_XANAP/366-529----------------------------------------------GSTAF-----------------------------
B8FN92_DESAA/282-434----------------------------------------------GSQEL-----------------------------
C0QDF6_DESAH/275-427----------------------------------------------GTPDL-----------------------------
C0QHQ8_DESAH/271-423----------------------------------------------GSKAL-----------------------------
B0SLS6_LEPBP/320-466----------------------------------------------GLKRF-----------------------------
B2FSG4_STRMK/367-531----------------------------------------------GSPEF-----------------------------
B4R0Y1_DROSI/312-466----------------------------------------------GDKAL-----------------------------
B5EES2_GEOBB/332-482----------------------------------------------GFPRF-----------------------------
B5EIS2_GEOBB/283-439----------------------------------------------GTKRL-----------------------------
D1BNH2_VEIPT/320-466----------------------------------------------GLKRF-----------------------------
D3HLY9_LEGLN/281-431----------------------------------------------GDKHL-----------------------------
D4K633_9FIRM/279-436----------------------------------------------GTQKM-----------------------------
D4MZL1_9FIRM/279-435----------------------------------------------GTKKL-----------------------------
D5HDR6_9FIRM/278-433----------------------------------------------GSNEL-----------------------------
D6DE02_CLOSC/291-448----------------------------------------------GSQEL-----------------------------
F4BPR0_CARS1/263-416----------------------------------------------GSKQL-----------------------------
F4BSM4_CARS1/266-423----------------------------------------------GTRKL-----------------------------
F4KMH9_PORAD/277-429----------------------------------------------GTKEL-----------------------------
F4KN61_PORAD/269-421----------------------------------------------GTQEL-----------------------------
G4Q2X4_ACIIR/277-434----------------------------------------------GSAEL-----------------------------
G4Q5N3_ACIIR/281-437----------------------------------------------GTKKL-----------------------------
CAT2_CLOK5/272-424----------------------------------------------GTKKL-----------------------------
Q185L2_PEPD6/271-425----------------------------------------------GTKKL-----------------------------
Q24S37_DESHY/279-435----------------------------------------------GTQKL-----------------------------
Q24ZX0_DESHY/273-425----------------------------------------------GTKRV-----------------------------
Q3JAD8_NITOC/444-607----------------------------------------------GPQRF-----------------------------
Q3SQD4_NITWN/334-497----------------------------------------------GSQSF-----------------------------
Q63JS7_BURPS/286-433----------------------------------------------GDRAM-----------------------------
Q6A8E8_PROAC/249-399----------------------------------------------GTPAL-----------------------------
Q6N157_RHOPA/260-409----------------------------------------------GTQRL-----------------------------
Q6NCD5_RHOPA/324-470----------------------------------------------GYDEF-----------------------------
Q7MTJ6_PORGI/273-425----------------------------------------------GSKEL-----------------------------
Q7NBY9_MYCGA/280-429----------------------------------------------GDQDM-----------------------------
Q88BB0_PSESM/361-524----------------------------------------------GPSSF-----------------------------
Q8EG98_SHEON/267-420----------------------------------------------GSQKL-----------------------------
Q8P4W8_XANCP/323-469----------------------------------------------GNEEF-----------------------------
Q8RC84_THETN/272-425----------------------------------------------GTKKL-----------------------------
Q9ZC36_YERPE/283-434----------------------------------------------GQQEM-----------------------------
R5BUI5_9FIRM/274-427----------------------------------------------GDQNL-----------------------------
R5SJH9_9FIRM/335-481----------------------------------------------GLKRF-----------------------------
R6G778_9FIRM/279-435----------------------------------------------GTKKM-----------------------------
R6R3R6_9FIRM/277-429----------------------------------------------GTRRL-----------------------------
R7JML8_9BACT/267-419----------------------------------------------GSKRL-----------------------------
R7JP79_9BACT/270-422----------------------------------------------GSQRV-----------------------------

PF04223

Q99ZK7_STRP1/45-510DSKLLGSVREAIEKTGLTDGMTISFHHHFREGDFIMNMVLEEIAKMGIKNLSIAPSSIANVH.EPLIDHIKNGVVTNITS
Q9CGA7_LACLA/46-510.NKLVDSLEEVVLKT.VKDGMTISFHHHFREGDYVFNKVMRIIIDHGFKDLRIAPSSLTNVMNDILVEAIEKGVVTNITS
CILA_HAEIN/33-498DRKLCTSLEEAIKRSGLKDGMTVSFHHAFRGGDFVVNMVMNKIAEMGFKNLTLASSSLIDSH.FPIVEHIKNGVVTKIYS
CILA_ECOLI/43-508DRKLCANLEEAIRRSGLQDGMTVSFHHAFRGGDLTVNMVMDVIAKMGFKNLTLASSSLSDCH.APLVEHIRQGVVTRIYT
Q9KTT9_VIBCH/66-531SRKVKSSIREAIVDLGLKDGMTISFHHAFRGGDKTVNLVMEVIAELGIKNLTLASSSLTSCH.SPLIEHIKNGVVSKIYT

PF01144

SCOA_XANCP/13-225--------------------------------------------------------------------------------
GCTB_ACIFV/10-224--------------------------------------------------------------------------------
GCTA_ACIFV/4-241--------------------------------------------------------------------------------
Q9Y916_AERPE/14-262--------------------------------------------------------------------------------
SCOT_CAEEL/300-499--------------------------------------------------------------------------------
SCOB_HELPY/2-198--------------------------------------------------------------------------------
YODS_BACSU/7-219--------------------------------------------------------------------------------
Q9RZA0_DEIRA/23-234--------------------------------------------------------------------------------
ATOA_HAEIN/4-200--------------------------------------------------------------------------------
CTFA_CLOAB/5-216--------------------------------------------------------------------------------
CTFB_CLOAB/9-205--------------------------------------------------------------------------------
PCAI_ACIAD/6-219--------------------------------------------------------------------------------
SCOT1_HUMAN/43-272--------------------------------------------------------------------------------
Q973S5_SULTO/3-202--------------------------------------------------------------------------------
Q9RZ86_DEIRA/5-217--------------------------------------------------------------------------------
SCOA_BACSU/5-216--------------------------------------------------------------------------------
PCAJ_ACIAD/8-206--------------------------------------------------------------------------------
SCOT1_HUMAN/302-501--------------------------------------------------------------------------------
YDIF_ECOLI/15-253--------------------------------------------------------------------------------
SCOT_CAEEL/40-271--------------------------------------------------------------------------------
SCOB_BACSU/5-202--------------------------------------------------------------------------------
Q9XAM7_STRCO/5-234--------------------------------------------------------------------------------
Y1199_ARCFU/148-369--------------------------------------------------------------------------------
Q8PDH3_XANCP/7-217--------------------------------------------------------------------------------
Q8RGS9_FUSNN/11-226--------------------------------------------------------------------------------
SCOA_HELPY/5-216--------------------------------------------------------------------------------
ATOD_HAEIN/5-216--------------------------------------------------------------------------------
Q8F685_LEPIN/8-247--------------------------------------------------------------------------------
Q9W058_DROME/37-266--------------------------------------------------------------------------------
Q97Z51_SULSO/6-206--------------------------------------------------------------------------------
ATOD_ECOLI/5-216--------------------------------------------------------------------------------
Q98EM4_RHILO/9-219--------------------------------------------------------------------------------
Q92TL1_RHIME/7-217--------------------------------------------------------------------------------
A5VGV2_SPHWW/10-217--------------------------------------------------------------------------------
A6M018_CLOB8/11-214--------------------------------------------------------------------------------
Y3551_MYCTU/6-233--------------------------------------------------------------------------------
SCOB_MYCTU/9-204--------------------------------------------------------------------------------
SCOA_MYCTU/6-233--------------------------------------------------------------------------------
Q88FX5_PSEPK/6-218--------------------------------------------------------------------------------
S6BGT4_PSERE/8-217--------------------------------------------------------------------------------

PF00455

Q98FV5_RHILO/86-240---------------------------------------------------------------------LAV-----E--
A9CFA5_AGRT5/78-235---------------------------------------------------------------------VNI-----D--
A9CH78_AGRT5/78-237---------------------------------------------------------------------SHA-----T--
Q98JJ0_RHILO/76-235---------------------------------------------------------------------SHA-----A--
Q8EUZ1_MYCPE/77-233---------------------------------------------------------------------ENI-----N--
Q98AQ9_RHILO/74-232---------------------------------------------------------------------SER-----A--
Q8Y5F7_LISMO/74-230---------------------------------------------------------------------KQS-----E--
Q8Y9Y5_LISMO/74-233---------------------------------------------------------------------ENH-----L--
Q89SG7_BRADU/74-233---------------------------------------------------------------------VAA-----E--
Q98M65_RHILO/73-232---------------------------------------------------------------------IAA-----D--
Q7VVL2_BORPE/74-233---------------------------------------------------------------------LHA-----E--
ACCR_AGRT5/77-237---------------------------------------------------------------------WNR-----A--
Q9X0F8_THEMA/73-233---------------------------------------------------------------------INR-----E--
Q8EMN4_OCEIH/74-231---------------------------------------------------------------------IVS-----D--
Q8R736_THETN/74-232---------------------------------------------------------------------VEL-----E--
Q8ES05_OCEIH/74-231---------------------------------------------------------------------KNV-----Q--
FRUR_BACSU/74-232---------------------------------------------------------------------KNL-----H--
Q8ESW8_OCEIH/75-233---------------------------------------------------------------------MNV-----R--
Q986N7_RHILO/100-258---------------------------------------------------------------------QAT-----E--
Q988Q4_RHILO/55-214---------------------------------------------------------------------TRH-----R--
A9CHG2_AGRT5/75-234---------------------------------------------------------------------EDA-----D--
Q98GA9_RHILO/78-237---------------------------------------------------------------------TMI-----E--
Q7D3J6_AGRT5/74-233---------------------------------------------------------------------LFV-----G--
Q92UW3_RHIME/80-239---------------------------------------------------------------------ENA-----A--
Q98BY9_RHILO/73-232---------------------------------------------------------------------ENA-----D--
Q986T2_RHILO/74-233---------------------------------------------------------------------TNL-----D--
Q9RZP5_DEIRA/82-243---------------------------------------------------------------------VNH-----L--
Q9K3L7_STRCO/73-239---------------------------------------------------------------------RRA-----S--
Q9AD80_STRCO/62-221---------------------------------------------------------------------LAT-----A--
Q5UXV7_HALMA/72-230---------------------------------------------------------------------DNP-----S--
Q5V513_HALMA/74-231---------------------------------------------------------------------DHY-----A--
Q5YVT8_NOCFA/75-235---------------------------------------------------------------------THT-----A--
YULB_BACSU/74-232---------------------------------------------------------------------TNV-----I--
LACR_STAA8/75-234---------------------------------------------------------------------RQI-----A--
ULAR_ECOLI/75-231---------------------------------------------------------------------QNH-----D--
AGAR_ECOLI/88-247---------------------------------------------------------------------LNT-----A--
DEOR_ECOLI/76-232---------------------------------------------------------------------..V-----E--
FUCR_ECOLI/75-233---------------------------------------------------------------------SHY-----A--
YIHW_ECOLI/78-237---------------------------------------------------------------------SQT-----E--
SGCR_ECOLI/79-236---------------------------------------------------------------------.QS-----V--
IOLR_BACSU/72-231---------------------------------------------------------------------QHQ-----D--
YGBI_ECOLI/75-232---------------------------------------------------------------------.AM-----T--
YDJF_ECOLI/76-233---------------------------------------------------------------------.FY-----E--
GLCR_BACSU/75-231---------------------------------------------------------------------.VS-----E--
Q2G240_STAA8/76-232---------------------------------------------------------------------TNL-----D--
Q2YIQ5_BRUA2/76-232---------------------------------------------------------------------..G-----E--
Q2YIY1_BRUA2/81-239---------------------------------------------------------------------RQS-----E--
Q2YLA3_BRUA2/76-232---------------------------------------------------------------------..H-----N--
Q32AN5_SHIDS/73-232---------------------------------------------------------------------TQT-----E--
Q32CM1_SHIDS/74-232---------------------------------------------------------------------.NT-----H--
Q32GP8_SHIDS/68-227---------------------------------------------------------------------SNY-----T--
GLPR_PSEAE/74-231---------------------------------------------------------------------.MR-----D--
Q7CFX9_YERPE/75-232---------------------------------------------------------------------..S-----E--
Q7CGX6_YERPE/76-234---------------------------------------------------------------------.NS-----G--
Q7CHA9_YERPE/76-237---------------------------------------------------------------------LNH-----E--
Q7CHG1_YERPE/76-235---------------------------------------------------------------------KQV-----E--
Q7CKA8_YERPE/91-249---------------------------------------------------------------------EHP-----D--
Q8DN15_STRR6/75-235---------------------------------------------------------------------.ST-----R--
Q8DPP7_STRR6/78-234---------------------------------------------------------------------.QT-----A--
Q8DQ97_STRR6/74-227---------------------------------------------------------------------KNL-----Q--
Q8DRC4_STRR6/83-243---------------------------------------------------------------------INY-----E--
Q8PDH7_XANCP/77-235---------------------------------------------------------------------.QA-----R--
Q8R8Q0_THETN/73-230---------------------------------------------------------------------EHI-----E--
Q8Y4U4_LISMO/74-229---------------------------------------------------------------------KNI-----Q--
Q8YA06_LISMO/78-236---------------------------------------------------------------------SNE-----T--
Q8YA14_LISMO/74-233---------------------------------------------------------------------RNI-----E--
Q928R7_LISMO/75-232---------------------------------------------------------------------.RY-----E--
Q97EY9_CLOAB/77-234---------------------------------------------------------------------INA-----E--
Q97F00_CLOAB/78-235---------------------------------------------------------------------INI-----E--
Q97F05_CLOAB/78-235---------------------------------------------------------------------INI-----E--
Q97J56_CLOAB/68-226---------------------------------------------------------------------.KY-----E--
Q97J82_CLOAB/75-231---------------------------------------------------------------------ENK-----E--
Q97MG7_CLOAB/76-233---------------------------------------------------------------------..Q-----V--
Q97MS8_CLOAB/74-235---------------------------------------------------------------------ANV-----K--
Q9HT24_PSEAE/78-233---------------------------------------------------------------------...-----.--
Q9I3M2_PSEAE/74-231---------------------------------------------------------------------EHA-----Q--
Q9JYJ2_NEIMB/75-234---------------------------------------------------------------------.CQ-----N--
Q9K3N4_STRCO/82-247---------------------------------------------------------------------.EP-----T--
Q9KL10_VIBCH/75-233---------------------------------------------------------------------..Q-----N--
Q9KMS3_VIBCH/75-231---------------------------------------------------------------------EHY-----E--
Q9KRT3_VIBCH/76-234---------------------------------------------------------------------.NL-----T--
Q9KUM9_VIBCH/81-237---------------------------------------------------------------------...-----V--
Q9KYU7_STRCO/74-233---------------------------------------------------------------------TAA-----D--
Q9S2D1_STRCO/76-233---------------------------------------------------------------------..P-----D--
Q9X9X5_STRCO/79-237---------------------------------------------------------------------SHV-----P--
Q9ZC48_YERPE/76-232---------------------------------------------------------------------..S-----R--

PF02550

O28424_ARCFU/3-199---------------------------------------------------------------------YQK-----E--
O29120_ARCFU/9-201---------------------------------------------------------------------YRE-----E--
P73661_SYNY3/6-196---------------------------------------------------------------------RQE-----Q--
ACH1_YEAST/12-230---------------------------------------------------------------------RYA-----P--
SCPC_ECOLI/1-213---------------------------------------------------------------------MET-----Q--

PF01008

EI2BD_MOUSE/219-510---------------------------------------------------------------------LIS-----G--
R15PI_METJA/22-292---------------------------------------------------------------------EIR-----G--
EI2BB_YEAST/33-358---------------------------------------------------------------------QVQ-----G--
MTNA_BACSU/49-337---------------------------------------------------------------------KVR-----G--
MTNA_ARCFU/41-327---------------------------------------------------------------------AVR-----G--
EI2BA_HUMAN/15-293---------------------------------------------------------------------KED-----P--
MTNA_SYNY3/51-343---------------------------------------------------------------------VVR-----G--
MTNA_METTH/44-310---------------------------------------------------------------------VVR-----G--
MTNA_CAEEL/66-357---------------------------------------------------------------------QVR-----G--
EI2BA_CAEEL/15-293---------------------------------------------------------------------END-----P--
EI2BA_YEAST/15-292---------------------------------------------------------------------EED-----T--
EI2BD_YEAST/285-637---------------------------------------------------------------------KIV-----G--
MTNA_METJA/48-319---------------------------------------------------------------------VVR-----G--
EI2BB_RABIT/27-333---------------------------------------------------------------------GQR-----S--
MTNA_YEAST/49-399---------------------------------------------------------------------QVR-----G--
EI2BD_SCHPO/156-452---------------------------------------------------------------------KIF-----G--
Q5V075_HALMA/195-460---------------------------------------------------------------------RTH-----G--
R15PI_ARCFU/15-284---------------------------------------------------------------------EVR-----G--

PF04198

YJHU_ECOLI/63-323---------------------------------------------------------------------VNV-----F--
Q9WWA6_AGRRK/83-337---------------------------------------------------------------------SPY-----V--
Q9CKH2_PASMU/56-313---------------------------------------------------------------------YHP-----I--
Q98GB2_RHILO/49-296---------------------------------------------------------------------D.L-----A--
Q9RT33_DEIRA/86-346---------------------------------------------------------------------DPQ-----G--
Q986P9_RHILO/64-319---------------------------------------------------------------------GEV-----S--
Q97L54_CLOAB/89-338---------------------------------------------------------------------REF-----K--
CGGR_BACMD/89-339---------------------------------------------------------------------KEV-----S--
Q9CGB1_LACLA/54-307---------------------------------------------------------------------SPI-----E--
Q98CZ8_RHILO/62-317---------------------------------------------------------------------HPI-----A--
Q9L0Z6_STRCO/89-343---------------------------------------------------------------------VPA-----E--
Q99XS9_STRP1/56-314---------------------------------------------------------------------DYD-----A--
Q9CLG2_PASMU/68-318---------------------------------------------------------------------SRF-----T--
LSRR_ECOLI/66-316---------------------------------------------------------------------SRF-----E--
Q9KER9_BACHD/57-313---------------------------------------------------------------------DEN-----I--
DEOR_BACSU/56-311---------------------------------------------------------------------DPF-----E--
Q9KLX0_VIBCH/62-319---------------------------------------------------------------------YHP-----V--
CGGR_BACSU/89-338---------------------------------------------------------------------KDV-----L--
Q9K712_BACHD/89-338---------------------------------------------------------------------KEL-----L--
Q986M3_RHILO/57-311---------------------------------------------------------------------TQL-----F--
Q98FV1_RHILO/42-296---------------------------------------------------------------------SEL-----S--
A6TBJ1_KLEP7/59-311---------------------------------------------------------------------HPV-----A--
A6TGS9_KLEP7/60-317---------------------------------------------------------------------.DY-----N--
D5AUX6_RHOCB/60-314---------------------------------------------------------------------.KI-----S--
Q1GB28_LACDA/125-376---------------------------------------------------------------------.RL-----F--
Q2G033_STAA8/91-337---------------------------------------------------------------------..Y-----A--
Q2YIQ4_BRUA2/58-310---------------------------------------------------------------------..I-----T--
Q3J1R9_RHOS4/62-317---------------------------------------------------------------------HRV-----S--
Q8DRC3_STRR6/59-313---------------------------------------------------------------------...-----T--

PF06026

RPIA_BURPS/53-222---------------------------------------------------------------------.AV-----S--
RPIA_METJA/51-220---------------------------------------------------------------------FGI-----P--
K4L1A8_SIMAS/53-215---------------------------------------------------------------------.AV-----A--
D0KYM3_HALNC/50-214---------------------------------------------------------------------.AV-----S--
D5MHI2_9BACT/41-208---------------------------------------------------------------------TAV-----S--
D5DBB1_BACMD/47-216---------------------------------------------------------------------KAV-----P--
G7M4M9_9CLOT/48-219---------------------------------------------------------------------KIV-----T--
V5UL52_9BURK/53-222---------------------------------------------------------------------.AV-----S--
RPIA_STAEQ/52-222---------------------------------------------------------------------TGV-----C--
RPIA_CHLAA/55-225---------------------------------------------------------------------VGV-----P--
E8WXH2_ACISM/47-217---------------------------------------------------------------------RCV-----A--
RPIA_RHOPB/50-225---------------------------------------------------------------------VGV-----P--
H8MW96_CORCM/57-227---------------------------------------------------------------------VGI-----P--
RPIA_SHELP/49-213---------------------------------------------------------------------.AV-----S--
M4QFB2_LIBAS/50-224---------------------------------------------------------------------QVI-----P--
U5H8J3_USTV1/122-297---------------------------------------------------------------------.FV-----P--
N0BJC6_9EURY/47-217---------------------------------------------------------------------WGV-----P--
H0PXY1_9RHOO/49-213---------------------------------------------------------------------.AV-----S--
RPIA_RHILO/50-224---------------------------------------------------------------------IGV-----P--
I3UDK7_ADVKW/56-221---------------------------------------------------------------------.AV-----A--
E4X352_OIKDI/53-229---------------------------------------------------------------------TCV-----P--
C7R992_KANKD/49-211---------------------------------------------------------------------.AV-----S--
K9ZYM6_DEIPD/53-221---------------------------------------------------------------------IGV-----A--
RPIA_LEPCP/49-214---------------------------------------------------------------------.AV-----S--
A0RTM4_CENSY/52-220---------------------------------------------------------------------TGV-----P--
RPIA_HAEIN/49-214---------------------------------------------------------------------.AV-----A--
S2J2W4_MUCC1/53-230---------------------------------------------------------------------VYV-----P--
RPIA_LACRD/52-220---------------------------------------------------------------------IGV-----T--
RPIA_PHOPR/49-213---------------------------------------------------------------------.AV-----S--
G4RF46_PELHB/49-224---------------------------------------------------------------------LCV-----P--
A9V4I9_MONBE/88-261---------------------------------------------------------------------ICI-----P--
F2I5Y3_AERUA/48-215---------------------------------------------------------------------KAV-----S--
G2MHG7_9ARCH/54-222---------------------------------------------------------------------RGI-----P--
C6XK92_HIRBI/49-225---------------------------------------------------------------------ICV-----S--
C4R764_PICPG/66-245---------------------------------------------------------------------VCI-----P--
D3E2P7_METRM/49-218---------------------------------------------------------------------MGI-----P--
W8KJT3_HALHR/50-214---------------------------------------------------------------------.TV-----A--
E0SPG1_IGNAA/58-230---------------------------------------------------------------------.VI-----V--
RPIA_HALWD/54-223---------------------------------------------------------------------HGV-----P--
L0B5Z2_9PROT/36-200---------------------------------------------------------------------GAV-----A--
T0N5R5_9EURY/50-215---------------------------------------------------------------------TFV-----P--
D2A0V2_TRICA/53-227---------------------------------------------------------------------QCV-----P--
R7ELE2_9BACE/67-233---------------------------------------------------------------------EII-----P--
T0LRI8_9EURY/54-219---------------------------------------------------------------------TFV-----S--
A4YX18_BRASO/48-223---------------------------------------------------------------------VGV-----P--
W1Q6V8_OGAPD/53-229---------------------------------------------------------------------VCV-----P--
J7Q837_METSZ/64-239---------------------------------------------------------------------VCV-----P--
S5YAN5_PARAH/56-230---------------------------------------------------------------------.CA-----S--
RPIA_RHOPA/50-225---------------------------------------------------------------------IGV-----P--
W0JVE5_9EURY/51-218---------------------------------------------------------------------EGV-----P--
RPIA_PEDPA/51-220---------------------------------------------------------------------VGV-----P--
S2JUJ5_MUCC1/54-231---------------------------------------------------------------------TYV-----P--
U3U6Y6_9BACT/49-214---------------------------------------------------------------------.AV-----S--
RPIA_BAUCH/49-214---------------------------------------------------------------------.VV-----S--
K9SSM9_9SYNE/57-227---------------------------------------------------------------------IGI-----P--
D5EB20_METMS/56-224---------------------------------------------------------------------RAV-----V--
J9W6I1_LACBU/52-220---------------------------------------------------------------------VGV-----P--
G0VA31_NAUCC/62-239---------------------------------------------------------------------VCI-----P--
A1B891_PARDP/56-230---------------------------------------------------------------------.CA-----A--
RPIA_DICNV/49-213---------------------------------------------------------------------.IV-----A--
K7SFG2_GLUOY/48-220---------------------------------------------------------------------VGI-----P--
C5M9K4_CANTT/70-245---------------------------------------------------------------------ICI-----P--
C7JF40_ACEP3/57-228---------------------------------------------------------------------RAI-----P--
RPIA_LACC3/51-220---------------------------------------------------------------------TGV-----A--
A9SR64_PHYPA/70-245---------------------------------------------------------------------VGV-----P--
F3Y8A6_MELPT/48-218---------------------------------------------------------------------TGV-----A--
D8RIH7_SELML/81-253---------------------------------------------------------------------VGV-----A--
RPIA_STRMU/49-217---------------------------------------------------------------------IGV-----T--
Q2FVT0_STAA8/52-222---------------------------------------------------------------------TGV-----C--
E2BIQ5_HARSA/33-208---------------------------------------------------------------------VCI-----P--
RPIA_BACSK/48-216---------------------------------------------------------------------QAV-----A--
R9T971_9EURY/48-216---------------------------------------------------------------------VGI-----P--
RPIA_DEBHA/69-245---------------------------------------------------------------------VCV-----P--
E9G3C7_DAPPU/53-228---------------------------------------------------------------------ICV-----P--
M1XYN2_NATM8/55-227---------------------------------------------------------------------.AI-----P--
B7VHI7_VIBSL/94-259---------------------------------------------------------------------HCV-----S--
Q8I3W2_PLAF7/51-226---------------------------------------------------------------------VCI-----P--
A3DN78_STAMF/53-223---------------------------------------------------------------------.VV-----V--
J4I3H4_FIBRA/107-283---------------------------------------------------------------------VFI-----P--
K5XRW6_AGABU/63-240---------------------------------------------------------------------VFI-----P--
U5QS13_9CYAN/54-225---------------------------------------------------------------------VGV-----P--
E3NWK8_CAERE/55-230---------------------------------------------------------------------.CT-----T--
D7EAR3_METEZ/57-226---------------------------------------------------------------------QAV-----V--
R5EWG7_9GAMM/48-213---------------------------------------------------------------------AAV-----S--
A6X0Q4_OCHA4/51-225---------------------------------------------------------------------IGV-----P--
K4AIV0_SETIT/101-286---------------------------------------------------------------------VAV-----T--
D6S665_9LACO/56-223---------------------------------------------------------------------.IV-----T--
D3RQX1_ALLVD/48-212---------------------------------------------------------------------.AV-----S--
D5X4J8_THIK1/49-213---------------------------------------------------------------------.AV-----S--
R5VQ59_9PORP/67-230---------------------------------------------------------------------TVI-----P--
D1Z1V9_METPS/54-222---------------------------------------------------------------------VGV-----P--
A1RX06_THEPD/46-219---------------------------------------------------------------------FFV-----S--
Q4UBE3_THEAN/56-233---------------------------------------------------------------------FGI-----P--
V5WM65_9SPIO/65-247---------------------------------------------------------------------VAV-----A--
D2RI11_ARCPA/48-216---------------------------------------------------------------------YGV-----P--
RPIA_PROMP/47-218---------------------------------------------------------------------KGV-----P--
B2IHK8_BEII9/53-228---------------------------------------------------------------------LCV-----P--
RPIA_OLICO/50-225---------------------------------------------------------------------VGV-----P--
RPIA_PICGU/64-240---------------------------------------------------------------------VCI-----S--
K1VP09_TRIAC/61-234---------------------------------------------------------------------..F-----P--
I4YBK0_WALSC/145-321---------------------------------------------------------------------.FI-----P--
RPIA_CAUSK/47-220---------------------------------------------------------------------RGV-----P--
F6HTS6_VITVI/101-277---------------------------------------------------------------------VGV-----P--
M4DCW1_BRARP/79-256---------------------------------------------------------------------VGI-----P--
RPIA_METRJ/50-224---------------------------------------------------------------------VGV-----P--
B5Y3N7_PHATC/98-280---------------------------------------------------------------------LAI-----P--
H9UGB7_SPIAZ/58-234---------------------------------------------------------------------LVV-----P--
RPIA_THERP/50-221---------------------------------------------------------------------IGV-----A--
RPIA_METPP/49-213---------------------------------------------------------------------.AV-----S--
L0I9N5_HALRX/54-222---------------------------------------------------------------------HGV-----A--
X2H3T4_9NEIS/50-214---------------------------------------------------------------------.AV-----S--
D7DSD0_METV3/58-228---------------------------------------------------------------------YGV-----P--
T1HW83_RHOPR/84-259---------------------------------------------------------------------VCV-----P--
A9RL35_PHYPA/31-216---------------------------------------------------------------------ICV-----P--
V9VTU6_9RHOB/56-231---------------------------------------------------------------------TAV-----P--
Q4MZ63_THEPA/56-234---------------------------------------------------------------------LGI-----P--
RPIA_SODGM/49-213---------------------------------------------------------------------.AV-----S--
K9XKW8_9CHRO/57-227---------------------------------------------------------------------VGI-----P--
K5W1L5_PHACS/65-241---------------------------------------------------------------------VFI-----P--
RPIA_ALKEH/50-214---------------------------------------------------------------------.TV-----S--
E8UX17_TERSS/51-221---------------------------------------------------------------------RGI-----A--
RPIA_KORCO/48-217---------------------------------------------------------------------KVI-----P--
U5T5D8_9GAMM/49-213---------------------------------------------------------------------.AV-----A--
C3AWU3_BACMY/48-217---------------------------------------------------------------------QAV-----P--
RPIA_VIBPA/49-213---------------------------------------------------------------------.AV-----S--
E5SAM9_TRISP/143-319---------------------------------------------------------------------VCI-----P--
I0FD89_BORCA/51-219---------------------------------------------------------------------TFY-----P--
F2UBB3_SALR5/70-247---------------------------------------------------------------------QCV-----P--
E1QRN8_VULDI/53-227---------------------------------------------------------------------LLV-----P--
RPIA_BURXL/53-222---------------------------------------------------------------------.AV-----S--
C1CUX0_DEIDV/53-221---------------------------------------------------------------------VGV-----A--
E1VFV9_9GAMM/49-213---------------------------------------------------------------------.AV-----A--
D9Q2B6_ACIS3/51-222---------------------------------------------------------------------.VV-----S--
S6C126_9GAMM/49-213---------------------------------------------------------------------.AV-----S--
F6HFJ9_VITVI/87-263---------------------------------------------------------------------VGI-----P--
U1N8Y7_ASCSU/112-290---------------------------------------------------------------------VCV-----P--
Q8SR79_ENCCU/35-195---------------------------------------------------------------------TYV-----P--
RPIA_THEEB/55-223---------------------------------------------------------------------VGV-----P--
Q11IC0_CHESB/51-225---------------------------------------------------------------------VGV-----P--
A6LVZ7_CLOB8/47-215---------------------------------------------------------------------KAV-----A--
B9I0V6_POPTR/93-277---------------------------------------------------------------------VGV-----P--
RPIA_LARHH/50-214---------------------------------------------------------------------.AV-----A--
RPIA_DESAA/53-223---------------------------------------------------------------------VGI-----P--
RPIA_DINSH/56-231---------------------------------------------------------------------TCV-----A--
B2GAA8_LACF3/52-221---------------------------------------------------------------------TGV-----T--
R5PSN2_9BURK/55-218---------------------------------------------------------------------.CV-----S--
H8GLH3_METAL/47-217---------------------------------------------------------------------KTI-----A--
K3Y9J6_SETIT/66-248---------------------------------------------------------------------AGV-----P--
RPIA_BUCBP/49-213---------------------------------------------------------------------.AV-----S--
U5N777_9BURK/52-220---------------------------------------------------------------------.AV-----S--
RPIA_METB6/55-226---------------------------------------------------------------------VGV-----P--
F9VP11_SULTO/46-214---------------------------------------------------------------------IFV-----A--
RPIA_ALBFT/60-228---------------------------------------------------------------------.AV-----S--
D9S606_FIBSS/55-226---------------------------------------------------------------------TGV-----S--
A8I636_AZOC5/111-286---------------------------------------------------------------------TGV-----P--
R9SLS4_9EURY/48-217---------------------------------------------------------------------MGI-----P--
G8ZWF9_TORDC/75-252---------------------------------------------------------------------VCV-----A--
R5JU55_9BACE/67-230---------------------------------------------------------------------RVI-----P--
E6U2Y3_ETHHY/42-213---------------------------------------------------------------------RVV-----T--
F7XM76_METZD/57-225---------------------------------------------------------------------LAV-----P--
RPIA_RUTMC/49-214---------------------------------------------------------------------.AI-----A--
RPIA_YARLI/58-236---------------------------------------------------------------------VFI-----S--
V5SCR1_9RHIZ/50-225---------------------------------------------------------------------LCV-----P--
G4QMA8_GLANF/49-213---------------------------------------------------------------------.AV-----S--
RPIA_THIDA/48-212---------------------------------------------------------------------.TV-----A--
A8IRQ1_CHLRE/82-257---------------------------------------------------------------------VGV-----P--
Q8ZXY8_PYRAE/44-218---------------------------------------------------------------------LLV-----A--
W8RXL1_9RHOB/56-231---------------------------------------------------------------------TGV-----A--
R6UK51_9FIRM/42-213---------------------------------------------------------------------QIV-----T--
K8ENG0_CARML/47-216---------------------------------------------------------------------TGV-----T--
B8ELA7_METSB/53-228---------------------------------------------------------------------LCV-----P--
H3CYY4_TETNG/53-228---------------------------------------------------------------------VCV-----P--
F8J7J2_HYPSM/50-225---------------------------------------------------------------------VCV-----P--
U6B5B2_9RHIZ/50-224---------------------------------------------------------------------EAV-----A--
RPIA_HALMA/53-220---------------------------------------------------------------------VGV-----P--
C7PIS1_CHIPD/51-219---------------------------------------------------------------------RAV-----A--
I1MGA3_SOYBN/93-278---------------------------------------------------------------------VGI-----P--
M1MZH8_9CLOT/50-221---------------------------------------------------------------------KVI-----T--
RPIA_LACPL/51-219---------------------------------------------------------------------VGV-----S--
D3HMT7_LEGLN/47-211---------------------------------------------------------------------.CV-----A--
Q0C4A9_HYPNA/53-230---------------------------------------------------------------------RCI-----E--
U9SW08_RHIID/55-228---------------------------------------------------------------------.YI-----P--
J3LWN1_ORYBR/36-221---------------------------------------------------------------------GGV-----P--
Q4FT49_PSYA2/48-213---------------------------------------------------------------------.AV-----A--
R6B3B3_9CLOT/67-229---------------------------------------------------------------------IAI-----P--
E4NRI2_HALBP/54-223---------------------------------------------------------------------RGV-----P--
D0N1R6_PHYIT/55-229---------------------------------------------------------------------KCI-----P--
A7AMM8_BABBO/53-227---------------------------------------------------------------------TAV-----A--
R4K5G7_CLOPA/48-219---------------------------------------------------------------------KVV-----T--
A3CVB5_METMJ/49-220---------------------------------------------------------------------AGV-----P--
E6X8C9_CELAD/51-219---------------------------------------------------------------------YGV-----P--
F4LL35_TREBD/63-237---------------------------------------------------------------------KAV-----A--
F4B7Z8_ACIHW/47-219---------------------------------------------------------------------.YI-----A--
G3ARG1_SPAPN/52-227---------------------------------------------------------------------VCI-----P--
F8HYA4_WEIKK/48-216---------------------------------------------------------------------TGV-----T--
F4BMW4_CARS1/47-216---------------------------------------------------------------------TGV-----T--
E3F3G7_KETVY/65-240---------------------------------------------------------------------RAV-----P--
A4YJ22_METS5/48-219---------------------------------------------------------------------.LV-----T--
I1XM21_METNJ/57-227---------------------------------------------------------------------QVV-----A--
RPIA_BACAN/47-216---------------------------------------------------------------------QAV-----P--
RPIA_BORBU/52-221---------------------------------------------------------------------.FY-----T--
B9SKS7_RICCO/78-256---------------------------------------------------------------------VGI-----P--
G2SRP4_LACRR/51-220---------------------------------------------------------------------TGV-----T--
RPIA_CAEEL/64-240---------------------------------------------------------------------ICV-----P--
K0SNV8_THAOC/54-236---------------------------------------------------------------------VAI-----P--
I6NDH1_ERECY/69-246---------------------------------------------------------------------ICI-----P--
Q1H2B3_METFK/48-218---------------------------------------------------------------------TAA-----A--
RPIA_THISH/49-213---------------------------------------------------------------------.TV-----A--
RPIA2_OCEIH/50-216---------------------------------------------------------------------VGI-----P--
G2KTC4_LACSM/362-530---------------------------------------------------------------------QCV-----A--
W8X9J3_CASDE/54-218---------------------------------------------------------------------.AV-----S--
I0A1J3_FERFK/50-220---------------------------------------------------------------------VFV-----T--
K9Z869_CYAAP/56-224---------------------------------------------------------------------VGV-----P--
Q3IDN5_PSEHT/83-247---------------------------------------------------------------------.AV-----S--
L0JQT2_NATP1/54-229---------------------------------------------------------------------RGV-----P--
RPIA_ARCFU/50-221---------------------------------------------------------------------YGI-----P--
G7LZ92_9CLOT/50-221---------------------------------------------------------------------KVV-----T--
D8PA73_9BACT/59-229---------------------------------------------------------------------HAV-----P--
G0W6N5_NAUDC/71-248---------------------------------------------------------------------ICI-----P--
G4SXW6_META2/48-217---------------------------------------------------------------------IVI-----A--
RPIA_METCA/49-213---------------------------------------------------------------------.AV-----S--
F7PF08_9EURY/53-222---------------------------------------------------------------------VGV-----T--
RPIA_BARHE/50-224---------------------------------------------------------------------TCV-----A--
D8LDV8_ECTSI/54-228---------------------------------------------------------------------VAI-----P--
A0A023B5X1_GRENI/97-274---------------------------------------------------------------------KFV-----C--
R7L548_9CLOT/66-232---------------------------------------------------------------------LAI-----P--
A8Q7R0_MALGO/62-237---------------------------------------------------------------------.FV-----P--
RPIA_LACAC/56-223---------------------------------------------------------------------.IV-----T--
Q1AY26_RUBXD/56-224---------------------------------------------------------------------RGV-----P--
G7LY74_9CLOT/48-219---------------------------------------------------------------------KVV-----T--
B0UBT0_METS4/49-223---------------------------------------------------------------------VGV-----P--
Q0SCN2_RHOSR/56-232---------------------------------------------------------------------VGV-----P--
D3PRM8_MEIRD/53-219---------------------------------------------------------------------VAV-----P--
G4RM57_THETK/46-222---------------------------------------------------------------------TLV-----S--
C4Y2N7_CLAL4/69-244---------------------------------------------------------------------VCI-----P--
Q0W3M2_UNCMA/58-226---------------------------------------------------------------------VGV-----P--
M9S9J2_9EURY/54-223---------------------------------------------------------------------KCV-----A--
S2JGP9_MUCC1/65-242---------------------------------------------------------------------VCI-----P--
RPIA_CUPNH/53-222---------------------------------------------------------------------.AV-----S--
RPIA_PICST/55-230---------------------------------------------------------------------VCI-----P--
RPIA_MARAV/53-217---------------------------------------------------------------------.AV-----A--
Q035R3_LACC3/44-210---------------------------------------------------------------------..C-----S--
Q2FLE9_METHJ/57-228---------------------------------------------------------------------VGI-----P--
Q97ZD9_SULSO/48-216---------------------------------------------------------------------.FV-----A--
RPIA_AROAE/49-213---------------------------------------------------------------------.AV-----S--
D5U1E6_THEAM/52-228---------------------------------------------------------------------IIV-----P--
J0DZG3_LOALO/63-242---------------------------------------------------------------------ICV-----P--
B9QKE6_TOXGO/54-249---------------------------------------------------------------------LCV-----P--
RPIA_TOLAT/49-213---------------------------------------------------------------------.AV-----S--
G0EH21_PYRF1/55-229---------------------------------------------------------------------.FL-----A--
E9CB07_CAPO3/132-305---------------------------------------------------------------------VCI-----P--
K9SHM7_9CYAN/60-232---------------------------------------------------------------------VGI-----P--
A8A9K9_IGNH4/47-217---------------------------------------------------------------------.TV-----P--
E5SB58_TRISP/33-210---------------------------------------------------------------------ICV-----P--
D9QGR4_BRESC/47-221---------------------------------------------------------------------RCV-----P--
B9DLS8_STACT/50-220---------------------------------------------------------------------TGV-----C--
RPIA_ASHGO/71-248---------------------------------------------------------------------ICI-----P--
RPIA_STRSY/49-217---------------------------------------------------------------------TGV-----T--
RPIA_THET8/54-221---------------------------------------------------------------------VGV-----P--
M5C6T3_THACB/108-284---------------------------------------------------------------------VFI-----P--
Q018K0_OSTTA/92-274---------------------------------------------------------------------ICI-----P--
M0Y9D9_HORVD/96-282---------------------------------------------------------------------VGI-----P--
F9ZVU0_METMM/51-220---------------------------------------------------------------------.AV-----S--
T0UHY2_9STRE/43-211---------------------------------------------------------------------VGV-----T--
T1IW49_STRMM/51-225---------------------------------------------------------------------VCV-----P--
Q1D141_MYXXD/60-230---------------------------------------------------------------------VGV-----P--
RPIA_PSEF5/53-217---------------------------------------------------------------------.AV-----A--
M0TZ20_MUSAM/31-216---------------------------------------------------------------------VGV-----P--
I6SWV8_ENTHA/48-217---------------------------------------------------------------------TGV-----T--
RPIA_METAC/57-225---------------------------------------------------------------------LGV-----V--
RPIA_RHOS4/56-231---------------------------------------------------------------------QGV-----P--
R6M617_9BACE/67-231---------------------------------------------------------------------EII-----P--
F2GCW9_ALTMD/49-213---------------------------------------------------------------------.AV-----S--
X1X1C6_ACYPI/49-213---------------------------------------------------------------------.AV-----S--
D8LXP9_BLAHO/52-223---------------------------------------------------------------------VGV-----A--
C9A9E9_ENTCA/48-217---------------------------------------------------------------------TGV-----P--
W0JTR2_9EURY/54-238---------------------------------------------------------------------RGI-----P--
K0IFH0_NITGG/62-228---------------------------------------------------------------------ECI-----P--
E8SF16_STAPH/51-221---------------------------------------------------------------------IGV-----C--
RPIA_POLSJ/62-234---------------------------------------------------------------------.AV-----S--
F4PQH6_DICFS/53-227---------------------------------------------------------------------TCV-----P--
M9SAJ3_9EURY/47-210---------------------------------------------------------------------KFV-----A--
G7MC82_9CLOT/47-215---------------------------------------------------------------------KAV-----A--
C5AQI6_METEA/50-225---------------------------------------------------------------------TGV-----P--
F9VGE3_LACGL/49-217---------------------------------------------------------------------VGV-----T--
F8F3R8_TRECH/53-227---------------------------------------------------------------------LAV-----P--
H9IUK6_BOMMO/52-227---------------------------------------------------------------------TCI-----P--
L0HHU8_METFS/55-226---------------------------------------------------------------------TGV-----P--
I1YH59_METFJ/55-224---------------------------------------------------------------------.VV-----A--
W0RDQ8_9BACT/54-222---------------------------------------------------------------------VGV-----P--
C7P232_HALMD/53-220---------------------------------------------------------------------TGV-----P--
D7CXV5_TRURR/54-220---------------------------------------------------------------------..A-----V--
RPIA_RHISN/50-224---------------------------------------------------------------------QGV-----P--
RPIA_CANGA/75-252---------------------------------------------------------------------ICI-----P--
F3YU57_DESAF/56-226---------------------------------------------------------------------LGV-----P--
RPIA_STRA5/49-217---------------------------------------------------------------------VGV-----T--
B3MF62_DROAN/58-234---------------------------------------------------------------------ICV-----P--
Q1LN72_RALME/49-213---------------------------------------------------------------------.AV-----S--
E0VP73_PEDHC/118-294---------------------------------------------------------------------ICI-----P--
G2I0N1_GLUMN/57-227---------------------------------------------------------------------.AI-----P--
K4B7U4_SOLLC/96-281---------------------------------------------------------------------TAI-----P--
R7BZ16_9BURK/48-213---------------------------------------------------------------------ACV-----S--
B5IA06_ACIB4/51-219---------------------------------------------------------------------IGI-----P--
RPIA_HALSA/52-219---------------------------------------------------------------------SGV-----A--
C5DMD9_LACTC/92-269---------------------------------------------------------------------ICI-----P--
L0AA43_CALLD/51-220---------------------------------------------------------------------.LI-----S--
D7A674_STAND/52-227---------------------------------------------------------------------VGV-----P--
I3TCM9_THEC1/55-227---------------------------------------------------------------------LFV-----P--
G0L9M6_ZOBGA/50-218---------------------------------------------------------------------KGV-----P--
RPIA_ROSDO/56-231---------------------------------------------------------------------TGV-----P--
M5DVR1_9GAMM/53-217---------------------------------------------------------------------.AV-----A--
W0EYB5_9SPHI/49-217---------------------------------------------------------------------KAI-----P--
E5AQX1_BURRH/75-245---------------------------------------------------------------------.AV-----S--
RPIA_CHLTR/62-231---------------------------------------------------------------------TAV-----A--
RPIA_STRGC/49-217---------------------------------------------------------------------IAV-----T--
S0EY17_CHTCT/49-220---------------------------------------------------------------------RAV-----A--
D5ALR5_RHOCB/56-231---------------------------------------------------------------------VGV-----P--
C6VYP5_DYAFD/51-218---------------------------------------------------------------------QGV-----P--
RPIA_NITHX/50-225---------------------------------------------------------------------VGV-----P--
RPIA2_YERPE/53-229---------------------------------------------------------------------TCT-----T--
D1CC48_THET1/51-220---------------------------------------------------------------------VGV-----P--
T0V876_9STRE/49-217---------------------------------------------------------------------TAV-----T--
RPIA_ENTFA/48-217---------------------------------------------------------------------VGV-----T--
RPIA_CHRVO/50-214---------------------------------------------------------------------.AV-----S--
RPIA_BLOFL/50-215---------------------------------------------------------------------.VV-----S--
A8NMB3_COPC7/98-275---------------------------------------------------------------------VFI-----P--
C4ZP88_THASP/49-213---------------------------------------------------------------------.AV-----S--
D3S1R9_FERPA/46-214---------------------------------------------------------------------EVI-----P--
RPIA_MARMM/50-225---------------------------------------------------------------------RGV-----P--
A8MCS2_CALMQ/49-224---------------------------------------------------------------------KLI-----A--
H1YW83_9EURY/51-222---------------------------------------------------------------------VGV-----P--
K0RC06_THAOC/94-276---------------------------------------------------------------------VAI-----P--
A5FY01_ACICJ/53-221---------------------------------------------------------------------ECV-----A--
U6IN39_HYMMI/82-258---------------------------------------------------------------------QCV-----P--
S0ANJ2_FERAC/51-213---------------------------------------------------------------------TGV-----P--
A5K9L2_PLAVS/51-226---------------------------------------------------------------------VCI-----P--
M4EY56_BRARP/82-268---------------------------------------------------------------------VGV-----P--
W0BAQ9_9GAMM/47-211---------------------------------------------------------------------.CI-----A--
J3TF98_9ENTR/49-213---------------------------------------------------------------------.AV-----S--
G2IZW6_PSEUL/50-214---------------------------------------------------------------------.AV-----S--
RPIA_XYLFA/47-210---------------------------------------------------------------------.AV-----S--
G7V788_THELD/48-218---------------------------------------------------------------------WTV-----P--
A2SQC5_METLZ/52-219---------------------------------------------------------------------FGV-----P--
C7PJG1_CHIPD/49-221---------------------------------------------------------------------.VT-----S--
C5CXD5_VARPS/68-236---------------------------------------------------------------------.AV-----S--
F8KWT0_PARAV/52-221---------------------------------------------------------------------QAL-----A--
U5MRI4_CLOSA/54-225---------------------------------------------------------------------KVV-----T--
I0AN47_IGNAJ/47-215---------------------------------------------------------------------TCV-----S--
Q47A42_DECAR/63-227---------------------------------------------------------------------.AV-----A--
A9A2Y6_NITMS/51-216---------------------------------------------------------------------KGV-----P--
I2FUT0_USTH4/82-257---------------------------------------------------------------------.FV-----P--
F4BTP9_METCG/55-220---------------------------------------------------------------------CGV-----P--
RPIA_LACBA/51-220---------------------------------------------------------------------IGV-----A--
G8PQ27_PSEUV/49-223---------------------------------------------------------------------IGV-----P--
A9H338_GLUDA/56-227---------------------------------------------------------------------VAI-----P--
D1C4M5_SPHTD/55-227---------------------------------------------------------------------VGV-----P--
W1NXJ9_AMBTC/82-258---------------------------------------------------------------------IGI-----P--
C6CYP4_PAESJ/48-216---------------------------------------------------------------------QAV-----A--
M1LTZ6_9PROT/54-218---------------------------------------------------------------------.AV-----A--
A7IKA7_XANP2/69-244---------------------------------------------------------------------LGV-----P--
RPIA_STRMK/47-210---------------------------------------------------------------------.AV-----S--
G8QPQ4_AZOSU/53-217---------------------------------------------------------------------.AV-----A--
RPIA_GLOVI/50-220---------------------------------------------------------------------VGI-----P--
RPIA_THICR/49-214---------------------------------------------------------------------.AV-----A--
L0PFR9_PNEJ8/65-240---------------------------------------------------------------------IFI-----P--
RPIA_FRATT/54-219---------------------------------------------------------------------TVV-----S--
L0EWH5_LIBCB/45-219---------------------------------------------------------------------KGV-----A--
W5JTH8_ANODA/99-275---------------------------------------------------------------------VCI-----P--
I0HZU4_CALAS/53-223---------------------------------------------------------------------VGV-----A--
G4L3E1_TETHN/48-216---------------------------------------------------------------------IGV-----P--
M1MGW5_9CLOT/47-215---------------------------------------------------------------------KAI-----A--
D4G7S8_RIEPU/49-213---------------------------------------------------------------------.AV-----S--
RPIA_DEIRA/52-220---------------------------------------------------------------------VGV-----S--
F9ZXG6_METMM/48-216---------------------------------------------------------------------EVV-----A--
D0MER0_RHOM4/56-228---------------------------------------------------------------------VGV-----P--
RPIA_TREDE/58-234---------------------------------------------------------------------YAV-----P--
X6MIV2_RETFI/61-244---------------------------------------------------------------------KCV-----A--
F4GMC6_PUSST/54-218---------------------------------------------------------------------.AV-----S--
Q0BTU6_GRABC/50-222---------------------------------------------------------------------VGI-----P--
W6RAI3_9RHIZ/50-224---------------------------------------------------------------------EGV-----P--
W1Q961_OGAPD/51-223---------------------------------------------------------------------VCV-----P--
F7QLK3_9BRAD/51-226---------------------------------------------------------------------VGV-----P--
E8UAB6_DEIML/52-220---------------------------------------------------------------------TAV-----A--
T2GAB9_DESGI/59-229---------------------------------------------------------------------TTV-----P--
J7S9W0_KAZNA/74-251---------------------------------------------------------------------VCI-----P--
M4CUR6_BRARP/74-251---------------------------------------------------------------------IGI-----P--
Q12XU6_METBU/57-225---------------------------------------------------------------------LAV-----V--
J3TZ31_9ENTR/49-213---------------------------------------------------------------------.AV-----S--
RPIA_METTH/52-221---------------------------------------------------------------------MGV-----P--
G7E8P3_MIXOS/323-499---------------------------------------------------------------------.FV-----P--
M4FG93_BRARP/93-269---------------------------------------------------------------------VGI-----P--
G2KV06_LACSM/53-221---------------------------------------------------------------------VGV-----P--
C4XRS4_DESMR/57-226---------------------------------------------------------------------.FV-----P--
D8J531_HALJB/54-221---------------------------------------------------------------------QGI-----P--
G8TEW3_NIAKG/51-220---------------------------------------------------------------------QAV-----P--
J1L527_9EURY/55-219---------------------------------------------------------------------VGV-----P--
G2SRV1_LACRR/44-202---------------------------------------------------------------------..T-----T--
U6EAE1_9EURY/63-232---------------------------------------------------------------------MGI-----P--
Q31QQ3_SYNE7/62-233---------------------------------------------------------------------QAV-----P--
H3ZMP8_THELN/50-221---------------------------------------------------------------------YGI-----P--
S6A8V6_9SPIO/62-238---------------------------------------------------------------------FAV-----P--
I2GY20_TETBL/77-255---------------------------------------------------------------------ICI-----S--
F6BER2_METIK/49-218---------------------------------------------------------------------FGV-----P--
RPIA_SCHPO/61-236---------------------------------------------------------------------VFI-----P--
K4M6Y4_9EURY/76-244---------------------------------------------------------------------IAV-----V--
C6XCW0_METGS/48-218---------------------------------------------------------------------TTV-----A--
F9ZME5_ACICS/49-213---------------------------------------------------------------------.YV-----A--
D3QZ19_CLOB3/64-256---------------------------------------------------------------------KAV-----A--
D3SEL8_THISK/49-213---------------------------------------------------------------------.AV-----A--
E8RQ79_ASTEC/50-224---------------------------------------------------------------------TLV-----S--
F2NWS5_TRES6/60-234---------------------------------------------------------------------KAV-----A--
B6JUX1_SCHJY/63-238---------------------------------------------------------------------VFL-----P--
G8S1W4_ACTS5/66-231---------------------------------------------------------------------TAI-----P--
M4NK33_9GAMM/49-211---------------------------------------------------------------------.AV-----S--
C6WWN6_METML/48-217---------------------------------------------------------------------TTI-----A--
RPIA_SPHAL/51-218---------------------------------------------------------------------TAV-----A--
E8UD73_TAYEM/55-219---------------------------------------------------------------------.TV-----A--
RPIA1_OCEIH/52-220---------------------------------------------------------------------EGI-----P--
D3SVA8_NATMM/69-244---------------------------------------------------------------------RAI-----P--
A0B633_METTP/29-193---------------------------------------------------------------------LAV-----P--
I3ZAW8_TERRK/54-224---------------------------------------------------------------------QGI-----A--
RPIA_PICTO/49-211---------------------------------------------------------------------TGI-----P--
RPIA_PARL1/50-225---------------------------------------------------------------------VGV-----P--
D5CP37_SIDLE/51-215---------------------------------------------------------------------.AV-----A--
R5TAR3_9CLOT/56-224---------------------------------------------------------------------HVL-----P--
RPIA_SYNPW/54-226---------------------------------------------------------------------VGV-----T--
RPIA_NITEU/49-213---------------------------------------------------------------------.AV-----A--
RPIA_POLSQ/52-230---------------------------------------------------------------------.TV-----S--
R5YZJ2_9FIRM/42-213---------------------------------------------------------------------KAV-----T--
RPIA_DICDI/49-225---------------------------------------------------------------------ICV-----P--
E7KIH3_YEASA/23-200---------------------------------------------------------------------ICI-----P--
E4U7T3_OCEP5/52-221---------------------------------------------------------------------VGV-----P--
M1A5R9_SOLTU/83-260---------------------------------------------------------------------VGI-----P--
H6NMT6_9BACL/47-215---------------------------------------------------------------------RAV-----A--
RPIA_EXIS2/49-214---------------------------------------------------------------------QGV-----A--
W1NX77_AMBTC/31-216---------------------------------------------------------------------VGI-----P--
F6QWW6_CIOIN/61-235---------------------------------------------------------------------TCV-----P--
J3LTE4_ORYBR/98-282---------------------------------------------------------------------MGI-----P--
F2J5C1_POLGS/81-255---------------------------------------------------------------------VGV-----P--
RPIA_PROMA/54-224---------------------------------------------------------------------IGV-----P--
Q4XZ68_PLACH/43-218---------------------------------------------------------------------VCV-----P--
T0M835_9EURY/55-221---------------------------------------------------------------------RGV-----A--
A7SX61_NEMVE/50-223---------------------------------------------------------------------VCV-----P--
RPIA_COLP3/49-213---------------------------------------------------------------------.AV-----S--
C3YIZ9_BRAFL/53-227---------------------------------------------------------------------VCV-----P--
I4Y6Z4_WALSC/89-265---------------------------------------------------------------------VFI-----P--
D3E7P8_GEOS4/51-220---------------------------------------------------------------------QAV-----A--
RPIA_AERHH/49-213---------------------------------------------------------------------.AV-----S--
F2NQH9_MARHT/52-220---------------------------------------------------------------------RGV-----P--
Q97J55_CLOAB/50-221---------------------------------------------------------------------KVV-----T--
RPIA_BORPE/54-218---------------------------------------------------------------------.TV-----A--
F8L7D9_SIMNZ/50-220---------------------------------------------------------------------TVV-----S--
RPIA_LODEL/87-262---------------------------------------------------------------------VCI-----S--
RPIA_BUCAI/49-213---------------------------------------------------------------------.AV-----S--
A5WDJ0_PSYWF/48-213---------------------------------------------------------------------.AV-----A--
C5E421_ZYGRC/103-280---------------------------------------------------------------------KCV-----A--
R6KAA0_9BACE/67-232---------------------------------------------------------------------EVI-----P--
RPIA_CRYNJ/105-288---------------------------------------------------------------------.FL-----P--
R4I0M9_9ENTR/27-192---------------------------------------------------------------------.AV-----S--
F2KNC4_ARCVS/49-218---------------------------------------------------------------------YGV-----P--
RPIA_BIFAA/54-223---------------------------------------------------------------------TGV-----T--
Q2NFM0_METST/52-220---------------------------------------------------------------------LGI-----P--
A2BLS3_HYPBU/56-231---------------------------------------------------------------------.VY-----A--
E1ZSN1_CHLVA/75-268---------------------------------------------------------------------RCV-----P--
X4ZZX6_9BACL/47-215---------------------------------------------------------------------TAV-----A--
RPIA_NEIMB/50-214---------------------------------------------------------------------.AV-----S--
I2GXY8_TETBL/82-259---------------------------------------------------------------------ICI-----P--
H2B0V5_KAZAF/71-248---------------------------------------------------------------------ICI-----P--
F0XSQ4_GROCL/58-244---------------------------------------------------------------------TFY-----P--
K0IAH2_NITGG/43-211---------------------------------------------------------------------EFV-----P--
G0GBX5_SPITZ/48-222---------------------------------------------------------------------VGV-----A--
Q2S577_SALRD/94-266---------------------------------------------------------------------QGV-----P--
H1YDM0_9SPHI/67-233---------------------------------------------------------------------KGI-----P--
M9R6A5_9RHOB/107-282---------------------------------------------------------------------KGV-----P--
RPIA_MARMS/53-217---------------------------------------------------------------------.TV-----A--
N0B2Z0_9RHIZ/50-225---------------------------------------------------------------------VCV-----P--
H8GNV1_METAL/49-213---------------------------------------------------------------------.AV-----S--
RPIA_SACD2/53-217---------------------------------------------------------------------.AV-----S--
I0HPM0_RUBGI/49-214---------------------------------------------------------------------.AV-----S--
E3I3Z1_RHOVT/52-227---------------------------------------------------------------------TCV-----A--
W8JFF3_9CHLA/57-226---------------------------------------------------------------------HAV-----A--
B3S327_TRIAD/82-257---------------------------------------------------------------------VCI-----P--
E1V466_HALED/53-217---------------------------------------------------------------------.AV-----A--
RPIA_LISMO/48-217---------------------------------------------------------------------TGV-----A--
K0HYL3_9BURK/55-223---------------------------------------------------------------------.AV-----S--
L0DB73_SINAD/52-222---------------------------------------------------------------------VGV-----P--
I1GB43_AMPQE/96-272---------------------------------------------------------------------RCV-----P--
F7WZV0_9ENTR/48-215---------------------------------------------------------------------GAV-----A--
RPIA_AZOSB/49-213---------------------------------------------------------------------.AV-----S--
F0Y5F5_AURAN/53-236---------------------------------------------------------------------IAV-----P--
V2WV49_MONRO/117-294---------------------------------------------------------------------VFV-----P--
F4NUT5_BATDJ/57-224---------------------------------------------------------------------ACI-----A--
I6ZP08_MELRP/52-241---------------------------------------------------------------------YGI-----P--
RPIA_TERTT/53-217---------------------------------------------------------------------.AV-----S--
F6D5Q0_METSW/48-217---------------------------------------------------------------------MGI-----P--
RPIA_THEAC/52-221---------------------------------------------------------------------RAV-----C--
M9WWF3_PASHA/49-214---------------------------------------------------------------------.AV-----A--
K0KIV4_WICCF/89-265---------------------------------------------------------------------ICI-----P--
F5XWJ8_RAMTT/49-217---------------------------------------------------------------------.AV-----S--
F1P520_CHICK/51-225---------------------------------------------------------------------VCI-----P--
Q8A699_BACTN/68-231---------------------------------------------------------------------.VI-----P--
RPIA_WIGBR/49-213---------------------------------------------------------------------.TV-----S--
RPIA_ACIAD/51-216---------------------------------------------------------------------.AV-----A--
RPIA_ALCBS/49-213---------------------------------------------------------------------.TV-----A--
R7KJK7_9BURK/49-212---------------------------------------------------------------------.CV-----S--
D7DIR1_METV0/48-216---------------------------------------------------------------------TTV-----A--
RPIA_COXBU/49-213---------------------------------------------------------------------.AV-----A--
R6DID1_9BACE/67-232---------------------------------------------------------------------EVI-----P--
G8YN53_PICSO/70-246---------------------------------------------------------------------TCI-----A--
RPIA_NITMU/49-213---------------------------------------------------------------------.AV-----A--
G8NWP6_GRAMM/50-220---------------------------------------------------------------------RCV-----A--
Q2JK16_SYNJB/60-231---------------------------------------------------------------------IGV-----P--
E4RMI9_HALHG/47-215---------------------------------------------------------------------KAV-----P--
RPIA_STRU0/49-217---------------------------------------------------------------------VGV-----T--
M4YU37_9EURY/54-224---------------------------------------------------------------------KCV-----T--
E1SRT4_FERBD/49-213---------------------------------------------------------------------.AV-----S--
G2TNQ6_BACCO/47-213---------------------------------------------------------------------TGV-----P--
T0LJI5_9EURY/46-210---------------------------------------------------------------------VGV-----A--
R4VWQ3_9EURY/50-228---------------------------------------------------------------------QGV-----P--
D7BFY7_MEISD/53-219---------------------------------------------------------------------RAV-----P--
A6LDT5_PARD8/67-229---------------------------------------------------------------------LAI-----P--
RPIA_BRADU/50-229---------------------------------------------------------------------IGV-----P--
RPIA_PSYIN/49-213---------------------------------------------------------------------.AV-----S--
G4LWP8_SCHMA/56-232---------------------------------------------------------------------QCI-----P--
D6YRJ4_WADCW/55-225---------------------------------------------------------------------AAV-----A--
B3PGI3_CELJU/53-218---------------------------------------------------------------------AAV-----A--
RPIA_HALLT/54-234---------------------------------------------------------------------RGV-----A--
G3B6X8_CANTC/51-227---------------------------------------------------------------------VCI-----P--
X4ZKY5_9BACL/47-218---------------------------------------------------------------------KVV-----T--
M7NVH6_PNEMU/63-238---------------------------------------------------------------------IFI-----P--
T1G2H1_HELRO/34-210---------------------------------------------------------------------ICI-----P--
B8GFA6_METPE/54-225---------------------------------------------------------------------TGI-----P--
D5VCE7_MORCR/51-215---------------------------------------------------------------------.AV-----A--
RPIA_AERPE/52-223---------------------------------------------------------------------VAV-----P--
E3GWJ6_METFV/52-219---------------------------------------------------------------------LGI-----P--
RPIA_LEGPH/46-211---------------------------------------------------------------------ACV-----A--
M0SLL9_MUSAM/77-246---------------------------------------------------------------------VGI-----P--
E3KHK5_PUCGT/92-267---------------------------------------------------------------------.FI-----P--
F6I3G7_VITVI/31-214---------------------------------------------------------------------TGI-----P--
G8BV63_TETPH/74-250---------------------------------------------------------------------ICI-----P--
RPIA_VANPO/73-250---------------------------------------------------------------------VCI-----P--
Q5L9R3_BACFN/67-232---------------------------------------------------------------------TVI-----P--
B8D3V9_DESK1/56-231---------------------------------------------------------------------.LV-----P--
C1DG96_AZOVD/53-217---------------------------------------------------------------------.AV-----A--
J0DD48_AURDE/58-235---------------------------------------------------------------------VFI-----P--
F9UTV2_LACPL/44-213---------------------------------------------------------------------TVV-----T--
D3EQA2_ATETH/54-222---------------------------------------------------------------------VGI-----P--
E3EIW3_PAEPS/47-215---------------------------------------------------------------------QAV-----A--
B4RDL0_PHEZH/48-222---------------------------------------------------------------------VGV-----P--
E8R3Z4_ISOPI/46-223---------------------------------------------------------------------RGV-----A--
Q03Y20_LEUMM/48-216---------------------------------------------------------------------IGV-----T--
H8L3T4_FRAAD/49-212---------------------------------------------------------------------.AV-----S--
K1QVV1_CRAGI/53-228---------------------------------------------------------------------ICI-----P--
G0S4N8_CHATD/70-253---------------------------------------------------------------------.FY-----P--
B9SV71_RICCO/31-216---------------------------------------------------------------------VGI-----P--
K8GIM2_9CYAN/57-226---------------------------------------------------------------------QGI-----T--
F0YD86_AURAN/31-218---------------------------------------------------------------------LCL-----P--
RPIA_PARUW/56-226---------------------------------------------------------------------TAI-----A--
RPIA_PROMT/53-224---------------------------------------------------------------------VGV-----T--
D8QJZ8_SCHCM/98-277---------------------------------------------------------------------IFV-----P--
E0WTW1_9ENTR/49-211---------------------------------------------------------------------.AV-----S--
I0DQJ4_PROSM/49-213---------------------------------------------------------------------.AV-----S--
C8WXS2_ALIAD/47-215---------------------------------------------------------------------VAI-----P--
Q057H5_BUCCC/48-211---------------------------------------------------------------------.VV-----V--
R7IB62_9BURK/49-212---------------------------------------------------------------------.CV-----S--
RPIA_NATPD/54-221---------------------------------------------------------------------RGI-----P--
RPIA_AGRVS/50-224---------------------------------------------------------------------QGV-----P--
A9FJ44_SORC5/54-221---------------------------------------------------------------------KGV-----A--
C4K7U6_HAMD5/49-213---------------------------------------------------------------------.AV-----S--
I3R125_HALMT/54-224---------------------------------------------------------------------RGV-----P--
E1RIV4_METP4/53-224---------------------------------------------------------------------IGV-----P--
E0TBP1_PARBH/47-221---------------------------------------------------------------------.AI-----P--
A5UJW1_METS3/48-217---------------------------------------------------------------------MGI-----P--
Q4J990_SULAC/47-214---------------------------------------------------------------------.YI-----A--
RPIA_NITOC/49-213---------------------------------------------------------------------.AV-----S--
L0KVT8_METHD/75-244---------------------------------------------------------------------LAV-----V--
U4LD71_PYROM/74-243---------------------------------------------------------------------TFI-----P--
Q04HC0_OENOB/54-221---------------------------------------------------------------------TGV-----A--
C4WVS8_ACYPI/93-269---------------------------------------------------------------------VCV-----P--
RPIA_METMP/63-233---------------------------------------------------------------------YGV-----P--
A9TPW9_PHYPA/30-202---------------------------------------------------------------------QFV-----A--
W4X032_ATTCE/11-187---------------------------------------------------------------------ICV-----P--
K0C3P7_CYCSP/48-212---------------------------------------------------------------------.AV-----S--
B4KS42_DROMO/59-235---------------------------------------------------------------------ICV-----P--
G7UTB3_PSEUP/49-212---------------------------------------------------------------------.AV-----S--
R6FYM5_9FIRM/44-214---------------------------------------------------------------------TVV-----T--
RPIA_IDILO/51-215---------------------------------------------------------------------.AV-----S--
B9H933_POPTR/302-473---------------------------------------------------------------------IAV-----G--
E6N4F6_9ARCH/47-216---------------------------------------------------------------------VII-----P--
Q38UZ2_LACSS/51-220---------------------------------------------------------------------TCV-----C--
G7WLJ5_METH6/55-219---------------------------------------------------------------------LGV-----P--
R6UYF7_9FIRM/64-231---------------------------------------------------------------------QVV-----S--
G0AB06_COLFT/70-238---------------------------------------------------------------------.AV-----A--
C8XJ99_NAKMY/47-205---------------------------------------------------------------------RCV-----A--
E3DMJ6_HALPG/47-216---------------------------------------------------------------------KAV-----P--
D8IPP5_HERSS/49-217---------------------------------------------------------------------.AV-----A--
F8DCN0_HALXS/54-229---------------------------------------------------------------------QGI-----P--
RPIA_META3/58-228---------------------------------------------------------------------FGV-----P--
RPIA_ROSS1/52-222---------------------------------------------------------------------TGV-----P--
C7RN75_ACCPU/49-213---------------------------------------------------------------------.AV-----A--
RPIA_TREPA/69-245---------------------------------------------------------------------AAV-----P--

PF16957

G8NWE8_GRAMM/11-551IEALESVIVSGDRIVMEGDNQKQADFLSRSLVQVDAKKIHDLHLIISSISRPEHLTLFELGIAKKVDFAFAG-----P--
A4G553_HERAR/3-550VALLEAVIESGDRVCLEGNNQKQANFLAGALCALDPARVHDLHMLLSVLALPEHLDIFDKGIASRLDFSFSG-----P--
F2F9P2_SOLSS/9-549VDVLELLIKPGDRVVLEGNNQKQASFLSQALVKVDPERVHDLHMIMSSVSRPEHLDIFEEGIAKKIDLSFAG-----P--
R5PZQ8_9BURK/9-554GMAIDTLVMPGDRVVLEGNNQKQADFLSRALVNVDSERIHGLHMIMPSVSLPEHMDLFEKGIAKRLDFSYAG-----S--
H0Q3G8_9RHOO/10-553VALLEAVIEPGDRLCVEGNNQKQADFLSRALTKTDPSRVRDLHLVQSVLALPEHVDIIESGQVSRIDFSFSG-----P--
D7A7S5_STAND/12-556TKLLEAVVRPGDRVCLEGDNQKQADFLAASLAAVDPKIVNDLHIVQSGVVLAEHLDLFEAGVAKRLDFSYSG-----P--
A1T0S7_PSYIN/7-551VAALECLLHIGDRVILEGNNQKQADFLARALEKVDSTKVNNLHMIMPSVSLPEHMNIFEKGIASKLDFAFAG-----Q--
Q21AG5_RHOPB/6-554VALLKAVIRSFDRVNIEGNNQKQADYLADCLLQVDPKEINNLHMVQSCVPLPVHLDMFEKGIAKKLDFAFGG-----P--
Q20XM1_RHOPB/13-552VEALETLLVPGDRVIIE.SVQKQADFLSRSLAKVNPKKIHDLKAVIWAIARPDHMEIFELGIASEVDFSFAG-----P--
Q478I4_DECAR/8-554IDLLEAVIQPGDRVCLEGNNQKQADFLSESLADCDPARINHLSMVQSVLALPSHVDLFERGLATRLDFSFSG-----P--
D3FW15_BACPE/11-551VEAMELVIQPHDRVVMEGNNQKQASFLSKSLSLVNPDKLHDLHMIMSSISRPEHLDIFEKGIAHTVDFAYAG-----P--
A4VRZ1_PSEU5/10-555VEALELLIAPGDRVVLEGNNQKQADFLSRSLAKADPGKLHDLHMIMPSVSRAEHLDLFERQIARKLDFSFAG-----P--
B2JLU6_BURP8/23-563VDALETLICPGDRVALEGDNQKQADFLSRSLAKVNPQKVHDVHLLISSISRPEHLTLFEKNIAHKVDFSFAG-----P--
B6JFK2_OLICO/14-556VALMEAVIEPGDRVCIEGNNQKHADFLAAELARCSPERIHGLHIVQSNIALPTHLDVFENGLAEKLDFCYSG-----P--
C5APL2_METEA/4-548VALLEAILQPDDRVCLEGDNQKQADCLARGLSQCDPARVHDLHMVQSGIVLPEHLDIFEQGIARRLDYSYSG-----P--
C9A847_ENTCA/7-547IEVLEQLIRPGDKVVLEGDNQKQASFLSKSLEQVDAQKVNNLHMIMSSISRPEHLTIFEKGIAAKIDFSYAG-----A--
D5DB08_BACMD/10-550IEALELLISPGDKVVLEGDNQKQASFLSKALNEVSADKIHGLHMIMSSISRPEHLDIFEKGIAEKIDFSYAG-----A--
E0SJB1_DICD3/11-551AAMLEKLIAPGDKVVLEGNNQKQADFLSRTLAEVDPQKVHDLHMIMPSVGRSEHLDIFEKGIAHKLDFSFSG-----T--
Q5ZSU0_LEGPH/3-548VTLLETAIKPYDKVCLEGDNQKQADFLARCLCSVNPQKIYGLHMLQSAVTLSEHLDLFERGIAEKIDFAFAG-----P--
Q63VB2_BURPS/4-548TALLEAVLRPGERVCIEGDNQKQADLLAAALAAVDSAKVHGLHMVQSGVVLPEHLDVFERGIAKRLDYAYSG-----P--
Q8P4U7_XANCP/4-548VALLEAVIEPGDRVCLEGNNQKQADFLARCLTEVDPTRVHDLHMVQSVLSLPAHLDVFERGIAKRLDFSFSG-----P--
R7CR99_9FIRM/10-557VKLLEAVLRPGDKVNIEGDNQKQADFLAKQLCEVDPTKVHDLHMIQSTLSIPEHLDVFEKGIAHKLDFAYAG-----S--

PF01182

Q3SH15_THIDA/10-221-----------------------------------------------------------------------------P--
B8HJV3_CYAP4/9-228-----------------------------------------------------------------------------P--
6PGL1_ORYSJ/38-272-----------------------------------------------------------------------------E--
D0LNM1_HALO1/16-236-----------------------------------------------------------------------------E--
B1XIZ0_SYNP2/9-227-----------------------------------------------------------------------------D--
B4M2H3_DROVI/15-234-----------------------------------------------------------------------------E--
B8GMY0_THISH/13-236-----------------------------------------------------------------------------P--
A8KYS2_FRASN/18-247-----------------------------------------------------------------------------A--
Q5NMF8_ZYMMO/10-233-----------------------------------------------------------------------------E--
C1EGM8_MICSR/42-262-----------------------------------------------------------------------------D--
C5B9U1_EDWI9/8-229-----------------------------------------------------------------------------G--
Q7NGI9_GLOVI/9-228-----------------------------------------------------------------------------P--
C7MSN0_SACVD/11-245-----------------------------------------------------------------------------P--
Q39SD7_GEOMG/6-227-----------------------------------------------------------------------------L--
A0L802_MAGSM/12-233-----------------------------------------------------------------------------S--
Q7V1T4_PROMP/18-234-----------------------------------------------------------------------------K--
C1D789_LARHH/8-223-----------------------------------------------------------------------------D--
A5FY02_ACICJ/12-233-----------------------------------------------------------------------------P--
Q3A631_PELCD/13-221-----------------------------------------------------------------------------A--
B0C6U0_ACAM1/9-229-----------------------------------------------------------------------------A--
A1BIC7_CHLPD/11-265-----------------------------------------------------------------------------G--
D2Q4L4_KRIFD/10-274-----------------------------------------------------------------------------R--
D0LCU1_GORB4/9-234-----------------------------------------------------------------------------D--
A9WT44_RENSM/9-251-----------------------------------------------------------------------------P--
Q1AZZ4_RUBXD/7-229-----------------------------------------------------------------------------E--
B8FL61_DESAA/16-238-----------------------------------------------------------------------------E--
B4S4M1_PROA2/7-257-----------------------------------------------------------------------------G--
A1SJQ5_NOCSJ/11-231-----------------------------------------------------------------------------P--
B3RVC2_TRIAD/8-226-----------------------------------------------------------------------------E--
D0L091_HALNC/12-236-----------------------------------------------------------------------------A--
D5URS5_TSUPD/12-243-----------------------------------------------------------------------------D--
Q1IWW4_DEIGD/7-212-----------------------------------------------------------------------------P--
C3ZBQ0_BRAFL/569-794-----------------------------------------------------------------------------G--
B1VDQ7_CORU7/27-269-----------------------------------------------------------------------------A--
Q2JHW7_SYNJB/10-224-----------------------------------------------------------------------------P--
A2G0T4_TRIVA/480-702-----------------------------------------------------------------------------R--
B2IE85_BEII9/11-231-----------------------------------------------------------------------------L--
A9UYD4_MONBE/167-386-----------------------------------------------------------------------------N--
A1U1P6_MARAV/16-235-----------------------------------------------------------------------------D--
A4S930_OSTLU/33-252-----------------------------------------------------------------------------D--
Q165T6_ROSDO/7-221-----------------------------------------------------------------------------I--
C6VSE7_DYAFD/7-229-----------------------------------------------------------------------------K--
B2GH88_KOCRD/13-243-----------------------------------------------------------------------------A--
Q3SP94_NITWN/19-240-----------------------------------------------------------------------------P--
A1AR88_PELPD/9-231-----------------------------------------------------------------------------N--
A6TTT0_ALKMQ/9-234-----------------------------------------------------------------------------G--
Q31GB5_THICR/12-219-----------------------------------------------------------------------------E--
C5BV30_BEUC1/10-236-----------------------------------------------------------------------------P--
Q89FE0_BRADU/14-235-----------------------------------------------------------------------------A--
6PGL_DICDI/11-234-----------------------------------------------------------------------------I--
E3D833_GARV3/17-261-----------------------------------------------------------------------------D--
A0JWQ2_ARTS2/11-250-----------------------------------------------------------------------------P--
Q60CQ2_METCA/8-232-----------------------------------------------------------------------------D--
D3Q4S0_STANL/10-238-----------------------------------------------------------------------------P--
B0T0C3_CAUSK/15-233-----------------------------------------------------------------------------P--
B9RWU5_RICCO/17-246-----------------------------------------------------------------------------D--
Q0V513_PHANO/11-243-----------------------------------------------------------------------------E--
A8LLP7_DINSH/7-222-----------------------------------------------------------------------------P--
C5E1Z3_LACTC/131-360-----------------------------------------------------------------------------D--
Q6A7F7_PROAC/10-227-----------------------------------------------------------------------------Q--
6PGL_RAT/13-237-----------------------------------------------------------------------------S--
A3HVL3_9BACT/7-226-----------------------------------------------------------------------------S--
Q482L5_COLP3/8-229-----------------------------------------------------------------------------N--
Q602U1_METCA/13-226-----------------------------------------------------------------------------P--
A7RMK1_NEMVE/10-232-----------------------------------------------------------------------------S--
A8Y0B4_CAEBR/9-229-----------------------------------------------------------------------------G--
C1MQ42_MICPC/10-239-----------------------------------------------------------------------------Q--
B4SF86_PELPB/47-298-----------------------------------------------------------------------------G--
B1LXU6_METRJ/11-233-----------------------------------------------------------------------------K--
A6X608_OCHA4/9-230-----------------------------------------------------------------------------T--
Q2SQ14_HAHCH/16-233-----------------------------------------------------------------------------E--
C7R459_JONDD/9-233-----------------------------------------------------------------------------S--
C1DRP8_AZOVD/18-236-----------------------------------------------------------------------------A--
A5FAH5_FLAJ1/6-228-----------------------------------------------------------------------------N--
A9PA91_POPTR/14-244-----------------------------------------------------------------------------D--
6PGL_TREPA/7-224-----------------------------------------------------------------------------E--
Q7UM40_RHOBA/5-223-----------------------------------------------------------------------------E--
C3ZB29_BRAFL/10-239-----------------------------------------------------------------------------A--
B8C1W9_THAPS/20-270-----------------------------------------------------------------------------S--
Q5FQ99_GLUOX/14-235-----------------------------------------------------------------------------P--
Q6NH39_CORDI/8-228-----------------------------------------------------------------------------S--
A8IFM0_AZOC5/18-239-----------------------------------------------------------------------------E--
B0UFD2_METS4/12-231-----------------------------------------------------------------------------P--
Q08ZT9_STIAD/9-213-----------------------------------------------------------------------------V--
Q2IHT3_ANADE/13-235-----------------------------------------------------------------------------A--
D1CEH8_THET1/9-231-----------------------------------------------------------------------------E--
Q31QV8_SYNE7/9-229-----------------------------------------------------------------------------A--
C1DDK6_AZOVD/18-235-----------------------------------------------------------------------------A--
A6WC51_KINRD/12-239-----------------------------------------------------------------------------T--
B1MC71_MYCA9/10-236-----------------------------------------------------------------------------A--
D2SF51_GEOOG/27-257-----------------------------------------------------------------------------P--
D1BS91_XYLCX/10-239-----------------------------------------------------------------------------P--
Q5YTR6_NOCFA/29-251-----------------------------------------------------------------------------P--
Q0BTV3_GRABC/17-236-----------------------------------------------------------------------------D--
B2FL79_STRMK/16-238-----------------------------------------------------------------------------S--
A5BJC3_VITVI/17-249-----------------------------------------------------------------------------E--
B8IN69_METNO/12-232-----------------------------------------------------------------------------P--
Q8DJZ4_THEEB/10-227-----------------------------------------------------------------------------P--
D2AVA1_STRRD/10-237-----------------------------------------------------------------------------R--
Q4Q8S1_LEIMA/12-256-----------------------------------------------------------------------------E--
Q312M1_DESAG/38-260-----------------------------------------------------------------------------P--
A5EXD3_DICNV/9-224-----------------------------------------------------------------------------S--
A0LDZ7_MAGSM/13-230-----------------------------------------------------------------------------P--
C4LIR1_CORK4/27-277-----------------------------------------------------------------------------A--
B3EN23_CHLPB/5-259-----------------------------------------------------------------------------G--
B7FPL4_PHATC/11-262-----------------------------------------------------------------------------S--
B8ELV8_METSB/11-231-----------------------------------------------------------------------------A--
G6PE_HUMAN/558-782-----------------------------------------------------------------------------A--
A5VAC4_SPHWW/10-232-----------------------------------------------------------------------------E--
Q4K7U0_PSEF5/18-235-----------------------------------------------------------------------------R--
C5FTG3_ARTOC/12-245-----------------------------------------------------------------------------P--
C7LRB5_DESBD/8-228-----------------------------------------------------------------------------P--
D2QID0_SPILD/7-229-----------------------------------------------------------------------------K--
C1FA85_ACIC5/13-240-----------------------------------------------------------------------------E--
B4GTC9_DROPE/14-235-----------------------------------------------------------------------------E--
6PGL_CAEEL/21-242-----------------------------------------------------------------------------G--
6PGL_XYLFA/15-237-----------------------------------------------------------------------------D--
F2G576_ALTMD/9-228-----------------------------------------------------------------------------E--
A9BG97_PETMO/7-228-----------------------------------------------------------------------------D--
C7MCP6_BRAFD/326-560-----------------------------------------------------------------------------A--
B2J9Q0_NOSP7/9-228-----------------------------------------------------------------------------P--
D7B103_NOCDD/10-238-----------------------------------------------------------------------------S--
B3RLE2_TRIAD/566-785-----------------------------------------------------------------------------G--
SOL4_YEAST/8-241-----------------------------------------------------------------------------S--
C5B1S2_METEA/13-236-----------------------------------------------------------------------------D--
Q2Y8J3_NITMU/15-226-----------------------------------------------------------------------------A--
A0LTY4_ACIC1/9-232-----------------------------------------------------------------------------P--
Q6FQZ7_CANGA/8-232-----------------------------------------------------------------------------S--
Q16H01_AEDAE/9-231-----------------------------------------------------------------------------R--
Q11M12_CHESB/10-230-----------------------------------------------------------------------------A--
A0QWX6_MYCS2/10-234-----------------------------------------------------------------------------A--
B9L0S4_THERP/9-234-----------------------------------------------------------------------------D--
B5HF46_STRPR/11-241-----------------------------------------------------------------------------R--
Q01VT6_SOLUE/9-230-----------------------------------------------------------------------------P--
A2EC78_TRIVA/488-712-----------------------------------------------------------------------------R--
A6L9R0_PARD8/7-228-----------------------------------------------------------------------------N--
A8HQW1_CHLRE/5-232-----------------------------------------------------------------------------V--
Q210H8_RHOPB/9-229-----------------------------------------------------------------------------A--
Q7D149_AGRT5/9-230-----------------------------------------------------------------------------D--
B0REI8_CLAMS/11-237-----------------------------------------------------------------------------P--
Q6CXV1_KLULA/8-237-----------------------------------------------------------------------------S--
Q4CQA8_TRYCC/11-251-----------------------------------------------------------------------------G--
Q5LRS8_RUEPO/7-221-----------------------------------------------------------------------------P--
C8X5S3_DESRD/22-247-----------------------------------------------------------------------------P--
Q0C1F0_HYPNA/9-234-----------------------------------------------------------------------------D--
Q1IMT5_KORVE/19-241-----------------------------------------------------------------------------A--
C5DTU9_ZYGRC/7-240-----------------------------------------------------------------------------S--
B3PCY8_CELJU/8-232-----------------------------------------------------------------------------D--
A9TLR4_PHYPA/4-237-----------------------------------------------------------------------------Q--
Q28QX5_JANSC/8-222-----------------------------------------------------------------------------P--
Q0ALB6_MARMM/15-240-----------------------------------------------------------------------------V--
Q1QTX1_CHRSD/7-223-----------------------------------------------------------------------------E--
A7TEX2_VANPO/8-238-----------------------------------------------------------------------------A--
Q2H6B6_CHAGB/11-242-----------------------------------------------------------------------------P--
Q7QGR5_ANOGA/12-234-----------------------------------------------------------------------------R--
A7RLB1_NEMVE/507-732-----------------------------------------------------------------------------G--
B3MQE2_DROAN/14-235-----------------------------------------------------------------------------D--
Q1H2F6_METFK/21-229-----------------------------------------------------------------------------T--
A9F2S9_SORC5/11-231-----------------------------------------------------------------------------A--
A4CNJ0_ROBBH/7-226-----------------------------------------------------------------------------P--
Q758H7_ASHGO/101-325-----------------------------------------------------------------------------P--
6PGL_RHILO/17-236-----------------------------------------------------------------------------P--
A1A127_BIFAA/13-255-----------------------------------------------------------------------------.--
A3N1V8_ACTP2/9-222-----------------------------------------------------------------------------.--
A6L429_BACV8/12-221-----------------------------------------------------------------------------.--
B2UK49_RALPJ/10-223-----------------------------------------------------------------------------.--
B7J926_ACIF2/14-216-----------------------------------------------------------------------------P--
B7VN92_VIBSL/13-227-----------------------------------------------------------------------------.--
C0ZZG4_RHOE4/11-231-----------------------------------------------------------------------------.--
D7GEP6_PROFC/12-230-----------------------------------------------------------------------------.--
E7QFR9_YEASZ/10-234-----------------------------------------------------------------------------.--
F7BV51_XENTR/350-572-----------------------------------------------------------------------------.--
H9JWK2_BOMMO/8-220-----------------------------------------------------------------------------.--
J9ZCI7_LEPFM/20-235-----------------------------------------------------------------------------P--
M1F8P0_9ALTE/19-237-----------------------------------------------------------------------------.--
M4Q661_LIBAS/11-223-----------------------------------------------------------------------------.--
6PGL_MYCTU/10-235-----------------------------------------------------------------------------.--
Q385D6_TRYB2/12-245-----------------------------------------------------------------------------.--
Q3JBF3_NITOC/9-228-----------------------------------------------------------------------------.--
Q46LF9_PROMT/11-224-----------------------------------------------------------------------------.--
Q59PZ6_CANAL/10-232-----------------------------------------------------------------------------.--
Q5LE34_BACFN/13-219-----------------------------------------------------------------------------.--
Q5ZYF5_LEGPH/14-220-----------------------------------------------------------------------------.--
Q6G4F3_BARHE/14-230-----------------------------------------------------------------------------.--
Q6LS72_PHOPR/10-227-----------------------------------------------------------------------------.--
Q7V812_PROMM/11-220-----------------------------------------------------------------------------.--
Q83GH9_TROWT/52-269-----------------------------------------------------------------------------.--
Q887J1_PSESM/19-235-----------------------------------------------------------------------------.--
Q8EE99_SHEON/12-226-----------------------------------------------------------------------------.--
Q8G730_BIFLO/41-300-----------------------------------------------------------------------------.--
Q8NQ61_CORGL/9-224-----------------------------------------------------------------------------.--
6PGL_DROME/15-227-----------------------------------------------------------------------------.--
6PGL_THEMA/14-216-----------------------------------------------------------------------------.--
R5U357_9BACE/14-221-----------------------------------------------------------------------------.--
R6K673_9BACE/10-218-----------------------------------------------------------------------------.--

PF02589

Q30YW4_DESAG/23-221---------------------------------------------------------------------LAE-----.--
Q72A59_DESVH/13-211---------------------------------------------------------------------LTE-----.--
A0LET5_SYNFM/13-211---------------------------------------------------------------------LSD-----.--
A8ZY31_DESOH/13-211---------------------------------------------------------------------LAQ-----.--
Q6AQM0_DESPS/13-211---------------------------------------------------------------------LRA-----.--
A5N319_CLOK5/16-217---------------------------------------------------------------------ATK-----.--
A3DDG8_CLOTH/16-211---------------------------------------------------------------------APR-----.--
Q18C30_PEPD6/15-209---------------------------------------------------------------------GPH-----.--
A6LXE8_CLOB8/15-209---------------------------------------------------------------------STK-----.--
B8D0K4_HALOH/12-205---------------------------------------------------------------------AEK-----.--
A4XID0_CALS8/13-207---------------------------------------------------------------------LET-----.--
A5I080_CLOBH/11-201---------------------------------------------------------------------LAQ-----K--
A7HK56_FERNB/14-207---------------------------------------------------------------------AQK-----.--
A6LMB1_THEM4/14-207---------------------------------------------------------------------ANK-----.--
A8F3V4_THELT/14-204---------------------------------------------------------------------CRK-----.--
A5MYV3_CLOK5/13-207---------------------------------------------------------------------IKR-----.--
Q97IL7_CLOAB/13-207---------------------------------------------------------------------IER-----.--
Q188D0_PEPD6/13-206---------------------------------------------------------------------IEK-----.--
Q892L7_CLOTE/13-207---------------------------------------------------------------------VER-----.--
A8MGY9_ALKOO/13-207---------------------------------------------------------------------VQR-----.--
A5N989_CLOK5/13-207---------------------------------------------------------------------IER-----.--
A5I1I2_CLOBH/13-207---------------------------------------------------------------------VER-----.--
Q897Y1_CLOTE/13-206---------------------------------------------------------------------VQR-----.--
B8CXT8_HALOH/13-207---------------------------------------------------------------------IER-----.--
B8I8V5_CLOCE/13-218---------------------------------------------------------------------IKK-----.--
Q7MR09_WOLSU/5-199---------------------------------------------------------------------VRK-----.--
Q251U6_DESHY/5-199---------------------------------------------------------------------LER-----.--
Q97M44_CLOAB/13-207---------------------------------------------------------------------AKK-----.--
B5EEH8_GEOBB/16-211---------------------------------------------------------------------CNK-----.--
A5G901_GEOUR/16-211---------------------------------------------------------------------CEK-----.--
A5CYU3_PELTS/16-210---------------------------------------------------------------------CKR-----.--
A0PZA2_CLONN/13-207---------------------------------------------------------------------GEK-----.--
Q6M046_METMP/13-207---------------------------------------------------------------------GKK-----.--
A4J2Z4_DESRM/12-207---------------------------------------------------------------------GEK-----.--
A6TQ94_ALKMQ/5-197---------------------------------------------------------------------VEV-----.--
A8MHS3_ALKOO/5-197---------------------------------------------------------------------IEK-----.--
A7I305_CAMHC/3-194---------------------------------------------------------------------MSD-----.--
A8EV54_ARCB4/1-193---------------------------------------------------------------------MKE-----.--
A6LYD8_CLOB8/3-195---------------------------------------------------------------------FTK-----.--
B9LU40_HALLT/27-212---------------------------------------------------------------------VEE-----.--
Q5V6G7_HALMA/27-212---------------------------------------------------------------------IEE-----.--
A3CXV8_METMJ/32-217---------------------------------------------------------------------LKK-----.--
Q8T2H5_DICDI/31-220---------------------------------------------------------------------LNE-----.--
Q8T2H6_DICDI/31-218---------------------------------------------------------------------INE-----.--
Q9BI24_DICDI/30-213---------------------------------------------------------------------LME-----.--
A8LFX8_FRASN/21-203---------------------------------------------------------------------IDR-----.--
Q6ABE0_PROAC/50-223---------------------------------------------------------------------VGT-----.--
A1ATQ9_PELPD/34-209---------------------------------------------------------------------MYE-----L--
B5EIV8_GEOBB/2-175---------------------------------------------------------------------YEL-----.--
A4J2C5_DESRM/13-186---------------------------------------------------------------------YKE-----.--
A5D032_PELTS/17-190---------------------------------------------------------------------YEE-----.--
Q30WA8_DESAG/6-203---------------------------------------------------------------------SRL-----.--
Q6APH5_DESPS/6-194---------------------------------------------------------------------IQL-----.--
A0LF89_SYNFM/7-180---------------------------------------------------------------------IAK-----.--
Q1ARS5_RUBXD/44-220---------------------------------------------------------------------PSR-----.--
LUTC_BACP2/52-237---------------------------------------------------------------------VEQ-----.--
Q836K1_ENTFA/52-236---------------------------------------------------------------------LTI-----.--
LUTC_OCEIH/49-232---------------------------------------------------------------------IDV-----.--
Q1WT28_LACS1/55-240---------------------------------------------------------------------LEI-----.--
Q6LPN1_PHOPR/50-245---------------------------------------------------------------------KDV-----.--
Q24VR0_DESHY/42-220---------------------------------------------------------------------IDK-----.--
Q2SMI8_HAHCH/39-216---------------------------------------------------------------------VRV-----.--
Q47V41_COLP3/52-226---------------------------------------------------------------------LAQ-----.--
Q3IEG6_PSEHT/41-215---------------------------------------------------------------------LEQ-----.--
Q7NTM5_CHRVO/41-217---------------------------------------------------------------------LRH-----.--
Q4KII4_PSEF5/42-220---------------------------------------------------------------------IPQ-----.--
Q2VZP0_MAGSA/37-213---------------------------------------------------------------------KAK-----.--
Q5F884_NEIG1/42-219---------------------------------------------------------------------LKH-----.--
Q310K5_DESAG/40-217---------------------------------------------------------------------EER-----.--
Q6AIU4_DESPS/43-219---------------------------------------------------------------------IAK-----.--
Q72B57_DESVH/44-220---------------------------------------------------------------------IPL-----.--
Q0PC62_CAMJE/47-218---------------------------------------------------------------------LTE-----.--
A0RPC6_CAMFF/42-213---------------------------------------------------------------------YAE-----.--
Q7VIF4_HELHP/38-218---------------------------------------------------------------------VQE-----.--
A7IG69_XANP2/53-223---------------------------------------------------------------------LAL-----.--
Q11LF2_CHESB/52-222---------------------------------------------------------------------IAL-----.--
A1SVG8_PSYIN/32-224---------------------------------------------------------------------RQE-----.--
A8MDI5_CALMQ/50-279---------------------------------------------------------------------VDK-----.--
A2BLD6_HYPBU/71-302---------------------------------------------------------------------IDM-----.--
Q9YFI8_AERPE/68-298---------------------------------------------------------------------VER-----.--
A7HA97_ANADF/64-283---------------------------------------------------------------------LEE-----.--
Q7MVA5_PORGI/38-257---------------------------------------------------------------------LLR-----.--
Q47F70_DECAR/78-303---------------------------------------------------------------------LEQ-----.--
Q6ABE1_PROAC/94-322---------------------------------------------------------------------LVE-----.--
Q47IA5_DECAR/76-304---------------------------------------------------------------------LDI-----.--
A1B665_PARDP/69-294---------------------------------------------------------------------LEM-----.--
A5G2K5_ACICJ/68-296---------------------------------------------------------------------LER-----.--
A0LED1_SYNFM/69-293---------------------------------------------------------------------LDR-----.--
A5V1N8_ROSS1/68-292---------------------------------------------------------------------LVR-----.--
Q67TB4_SYMTH/77-301---------------------------------------------------------------------LKQ-----.--
Q1ARS4_RUBXD/86-314---------------------------------------------------------------------LGQ-----.--
Q01UG1_SOLUE/67-291---------------------------------------------------------------------LEE-----.--
Q1IN28_KORVE/68-293---------------------------------------------------------------------LEE-----.--
LUTB_BACLD/70-295---------------------------------------------------------------------LEQ-----.--
LUTB_OCEIH/70-294---------------------------------------------------------------------LHQ-----.--
Q6D5W9_PECAS/70-294---------------------------------------------------------------------LYQ-----.--
Q81ND6_BACAN/69-293---------------------------------------------------------------------LEQ-----.--
Q24VR1_DESHY/69-293---------------------------------------------------------------------LDM-----.--
A5VIG9_LACRD/70-294---------------------------------------------------------------------LEE-----.--
B9LU44_HALLT/67-296---------------------------------------------------------------------IDE-----.--
Q3ISD5_NATPD/64-299---------------------------------------------------------------------IEE-----.--
A5GDG8_GEOUR/64-287---------------------------------------------------------------------AAA-----.--
A5D031_PELTS/65-292---------------------------------------------------------------------AER-----.--
Q3AEY7_CARHZ/62-279---------------------------------------------------------------------VEQ-----.--
Q24W82_DESHY/65-292---------------------------------------------------------------------IEQ-----.--
Q8RIN1_FUSNN/65-294---------------------------------------------------------------------IAE-----.--
Q726S3_DESVH/69-294---------------------------------------------------------------------YAQ-----.--
Q74CQ3_GEOSL/61-280---------------------------------------------------------------------VKE-----.--
A4J1M6_DESRM/66-295---------------------------------------------------------------------ISK-----.--
A5UNQ3_METS3/51-284---------------------------------------------------------------------MDI-----.--
O26243_METTH/51-280---------------------------------------------------------------------IAG-----.--
A4J1M5_DESRM/47-258---------------------------------------------------------------------VGR-----.--
A5HZY1_CLOBH/14-207---------------------------------------------------------------------.MR-----.--
A5VIG8_LACRD/58-241---------------------------------------------------------------------.EL-----.--
A9WGW7_CHLAA/44-229---------------------------------------------------------------------AEQ-----.--
C6XV06_PEDHD/69-292---------------------------------------------------------------------.PE-----.--
M9X3V9_PASHA/50-227---------------------------------------------------------------------.QE-----.--
O24950_HELPY/71-295---------------------------------------------------------------------LEL-----.--
Q0PC61_CAMJE/70-292---------------------------------------------------------------------..E-----.--
Q24WP5_DESHY/68-297---------------------------------------------------------------------LAQ-----.--
Q5SIK3_THET8/69-291---------------------------------------------------------------------.EL-----.--
Q63NH7_BURPS/72-300---------------------------------------------------------------------LER-----.--
Q63SM7_BURPS/67-292---------------------------------------------------------------------LEM-----.--
Q6LSA7_PHOPR/40-218---------------------------------------------------------------------.QR-----.--
LUTB_BACCR/71-293---------------------------------------------------------------------.MQ-----.--
Q81ND7_BACAN/48-228---------------------------------------------------------------------VEQ-----.--
LUTC_BACAN/51-236---------------------------------------------------------------------LEV-----.--
Q8XH83_CLOPE/14-207---------------------------------------------------------------------.NK-----.--
Q9WXZ9_THEMA/17-208---------------------------------------------------------------------.EH-----.--
R5KLF2_9CLOT/15-206---------------------------------------------------------------------..A-----.--
R5QY75_9FIRM/13-205---------------------------------------------------------------------.KR-----.--
R5UE40_9FIRM/14-205---------------------------------------------------------------------..R-----.--
R6MWQ8_9CLOT/13-227---------------------------------------------------------------------IQR-----.--
R7FYW0_9FIRM/15-206---------------------------------------------------------------------..K-----.--
U5L6H3_9BACI/52-235---------------------------------------------------------------------.EV-----.--

PF01812

MTHFS_HUMAN/10-198---------------------------------------------------------------------KRS-----L--
5FCLL_ARATH/92-290---------------------------------------------------------------------KWV-----I--
MTHFS_CAEEL/8-197---------------------------------------------------------------------KSE-----L--
YQGN_BACSU/2-179---------------------------------------------------------------------KSQ-----L--
O83692_TREPA/4-207---------------------------------------------------------------------KQN-----A--
Q9RKA5_STRCO/12-197---------------------------------------------------------------------KRL-----L--
Y858_HAEIN/6-187---------------------------------------------------------------------RQQ-----I--
MTHFS_RABIT/10-198---------------------------------------------------------------------KRS-----L--
O26306_METTH/134-322---------------------------------------------------------------------DGG-----E--
FTHC_YEAST/4-203---------------------------------------------------------------------KQL-----L--
Q9YFU3_AERPE/7-205---------------------------------------------------------------------KQA-----I--
P73038_SYNY3/3-179---------------------------------------------------------------------KAQ-----L--
O67621_AQUAE/3-175---------------------------------------------------------------------KSE-----L--
Q9ZD82_RICPR/3-172---------------------------------------------------------------------KQE-----L--
O05575_MYCTU/6-186---------------------------------------------------------------------KSA-----L--
H2VFJ2_CHLTE/8-188---------------------------------------------------------------------KPE-----L--
Q7AQM9_MYCLE/6-186---------------------------------------------------------------------KAT-----L--
Q8DVY5_STRMU/3-174---------------------------------------------------------------------KKD-----Y--

PF13336

A6LV90_CLOB8/275-428--------------------------------------------------------------------YDYV.....N..
B8F9H4_DESAA/272-425--------------------------------------------------------------------YKFV.....H..
Q7MWD3_PORGI/273-426--------------------------------------------------------------------YHFI.....D..
B8CZD4_HALOH/271-424--------------------------------------------------------------------YEFL.....D..
Q3ACH6_CARHZ/275-428--------------------------------------------------------------------YSFL.....N..
D2QBR0_SPILD/268-420--------------------------------------------------------------------YDFI.....D..
D7BE02_MEISD/284-437--------------------------------------------------------------------YRFV.....H..
Q898H0_CLOTE/272-425--------------------------------------------------------------------YDFV.....D..
A0L8K8_MAGSM/267-420--------------------------------------------------------------------YDYV.....D..
A5N390_CLOK5/276-429--------------------------------------------------------------------YDFI.....N..
Q15V19_PSEA6/267-420--------------------------------------------------------------------YDFV.....D..
Q39QG7_GEOMG/278-431--------------------------------------------------------------------YEFM.....N..
B3QTM9_CHLT3/265-417--------------------------------------------------------------------YDFI.....D..
A9AXP3_HERA2/264-416--------------------------------------------------------------------YDFV.....D..
Q8CXQ9_LEPIN/270-422--------------------------------------------------------------------YDFI.....D..
A5URR7_ROSS1/272-425--------------------------------------------------------------------FDWA.....H..
Q24WU2_DESHY/311-467--------------------------------------------------------------------YDFL.....H..
C7M4J2_CAPOD/265-417--------------------------------------------------------------------YDFI.....D..
Q5QXA2_IDILO/264-417--------------------------------------------------------------------YDFV.....D..
B9M8N9_GEODF/274-427--------------------------------------------------------------------YDFI.....D..
B9M9H7_GEODF/264-417--------------------------------------------------------------------YDFV.....D..
A7H923_ANADF/265-417--------------------------------------------------------------------YDFL.....H..
C7RL22_ACCPU/274-427--------------------------------------------------------------------YRFM.....H..
Q3ANX0_CHLCH/266-418--------------------------------------------------------------------YDFV.....D..
A0M1A3_GRAFK/267-419--------------------------------------------------------------------YDFV.....D..
Q0IG02_AEDAE/314-468--------------------------------------------------------------------YDFV.....D..
D1C4I7_SPHTD/264-417--------------------------------------------------------------------FSFV.....D..
A7HKG2_FERNB/273-426--------------------------------------------------------------------YEFL.....D..
A6GWR2_FLAPJ/265-417--------------------------------------------------------------------YDFV.....N..
A8F649_THELT/274-427--------------------------------------------------------------------YQFI.....D..
B5ECU8_GEOBB/278-431--------------------------------------------------------------------YEFM.....H..
A1KBF4_AZOSB/272-425--------------------------------------------------------------------YRHL.....H..
Q2LSP1_SYNAS/286-439--------------------------------------------------------------------YEYI.....H..
A4ASU6_MARSH/266-418--------------------------------------------------------------------YDFM.....D..
Q01VE3_SOLUE/270-423--------------------------------------------------------------------FDFI.....D..
B5E7S1_GEOBB/278-431--------------------------------------------------------------------FDFM.....H..
B2TLD8_CLOBB/272-425--------------------------------------------------------------------YDFL.....D..
A0B6T6_METTP/284-437--------------------------------------------------------------------YEYI.....H..
A4J1E7_DESRM/279-435--------------------------------------------------------------------YDFI.....N..
D6Z2N5_DESAT/282-435--------------------------------------------------------------------YDFV.....N..
Q1IT47_KORVE/273-426--------------------------------------------------------------------YDYV.....R..
B5Y607_COPPD/273-426--------------------------------------------------------------------YDFV.....D..
D3FVG7_BACPE/268-421--------------------------------------------------------------------YDFM.....D..
Q0AVM5_SYNWW/279-434--------------------------------------------------------------------YDYI.....D..
Q2FRF0_METHJ/278-431--------------------------------------------------------------------YEFM.....D..
B2A2S6_NATTJ/273-426--------------------------------------------------------------------YDFL.....D..
B9JLD2_AGRRK/284-435--------------------------------------------------------------------YDFL.....N..
A3HTS6_9BACT/267-419--------------------------------------------------------------------YDAV.....H..
A9GMK9_SORC5/277-430--------------------------------------------------------------------YAWA.....H..
C7PPM1_CHIPD/268-420--------------------------------------------------------------------YDFV.....N..
C0QJK6_DESAH/274-427--------------------------------------------------------------------YDYV.....D..
D2VMT8_NAEGR/323-475--------------------------------------------------------------------YDFV.....D..
B2HRD6_MYCMM/288-439--------------------------------------------------------------------YEFM.....D..
A9BH20_PETMO/279-432--------------------------------------------------------------------YEFI.....D..
Q0AW71_SYNWW/272-425--------------------------------------------------------------------YDFL.....D..
Q4A5M6_MYCS5/287-438--------------------------------------------------------------------YEEL.....H..
A4J4L6_DESRM/279-435--------------------------------------------------------------------YDFI.....D..
E6VZH2_DESAO/276-429--------------------------------------------------------------------FDFM.....H..
Q220T6_ALBFT/272-425--------------------------------------------------------------------YQFM.....D..
A4AMZ0_MARSH/269-421--------------------------------------------------------------------YDFI.....N..
D4IP35_9BACT/266-418--------------------------------------------------------------------YDYM.....D..
A1U877_MARAV/284-436--------------------------------------------------------------------YDFL.....D..
D4J7D4_9FIRM/278-438--------------------------------------------------------------------YDFI.....N..
D2VCN4_NAEGR/199-351--------------------------------------------------------------------FDFV.....D..
C6X0M3_FLAB3/276-428--------------------------------------------------------------------YDYI.....D..
C0QKC6_DESAH/273-426--------------------------------------------------------------------YDYV.....D..
C8VZ55_DESAS/277-433--------------------------------------------------------------------YDFM.....D..
C0QAD0_DESAH/281-437--------------------------------------------------------------------YDFI.....N..
A0LMU1_SYNFM/292-445--------------------------------------------------------------------YDFV.....D..
A9NFJ4_ACHLI/270-431--------------------------------------------------------------------YDFL.....N..
B8FDQ1_DESAA/279-432--------------------------------------------------------------------YRQV.....D..
Q3A1S1_PELCD/278-433--------------------------------------------------------------------YDFL.....H..
Q21W64_ALBFT/279-435--------------------------------------------------------------------YDFL.....D..
B8F9D7_DESAA/274-430--------------------------------------------------------------------YEFI.....D..
A4J5F7_DESRM/278-434--------------------------------------------------------------------YDFV.....H..
A8MLT0_ALKOO/317-464--------------------------------------------------------------------HENM.....K..
A4J1H7_DESRM/278-434--------------------------------------------------------------------YEFM.....D..
Q0AW62_SYNWW/282-438--------------------------------------------------------------------WKYI.....D..
A8ZXP1_DESOH/277-430--------------------------------------------------------------------YRYV.....D..
Q0AZT0_SYNWW/278-433--------------------------------------------------------------------YDFI.....D..
A2SP55_METPP/278-433--------------------------------------------------------------------YDTI.....D..
D4KHS0_9FIRM/319-466--------------------------------------------------------------------YENI.....K..
Q2RRD2_RHORT/322-473--------------------------------------------------------------------YEFM.....D..
A0LHR8_SYNFM/278-431--------------------------------------------------------------------YSFV.....H..
Q18599_CAEEL/306-460--------------------------------------------------------------------YDYL.....N..
A7SYK6_NEMVE/323-477--------------------------------------------------------------------FEFI.....D..
Q0AXU7_SYNWW/280-436--------------------------------------------------------------------YNFM.....D..
C4Z8H6_EUBR3/279-435--------------------------------------------------------------------YDYL.....D..
D1B8D5_THEAS/325-472--------------------------------------------------------------------YANM.....D..
Q0B052_SYNWW/278-434--------------------------------------------------------------------YNFL.....D..
B7QJI4_IXOSC/314-468--------------------------------------------------------------------FDFM.....N..
Q6AQI5_DESPS/285-438--------------------------------------------------------------------YDYI.....D..
B0TCP9_HELMI/277-433--------------------------------------------------------------------YDFL.....D..
A4J446_DESRM/283-434--------------------------------------------------------------------YQFI.....N..
C0QDJ7_DESAH/279-431--------------------------------------------------------------------YDFL.....D..
A0R5U0_MYCS2/274-430--------------------------------------------------------------------YEWL.....D..
Q2LPI7_SYNAS/276-429--------------------------------------------------------------------YELM.....D..
A8WP03_CAEBR/305-459--------------------------------------------------------------------YKKI.....D..
B2W452_PYRTR/302-453--------------------------------------------------------------------YDNW.....D..
Q0RWG8_RHOSR/538-685--------------------------------------------------------------------TSNI.....D..
A1TGQ6_MYCVP/271-426--------------------------------------------------------------------YAWL.....D..
A5E2Y9_LODEL/243-394--------------------------------------------------------------------YANW.....D..
A7HPG3_PARL1/328-491--------------------------------------------------------------------YEKLRAMPQE..
D2RM64_ACIFV/277-437--------------------------------------------------------------------YRFL.....H..
Q0AY76_SYNWW/278-434--------------------------------------------------------------------YDFI.....D..
O29120_ARCFU/297-457--------------------------------------------------------------------YEYL.....D..
Q2SL76_HAHCH/439-606--------------------------------------------------------------------YDML.....HGL
ACH1_YARLI/333-484--------------------------------------------------------------------FDNW.....D..
O28424_ARCFU/289-449--------------------------------------------------------------------YDFL.....D..
A7HD82_ANADF/326-473--------------------------------------------------------------------NKNI.....E..
C5DU17_ZYGRC/331-482--------------------------------------------------------------------FKNW.....D..
D4JBB9_9FIRM/276-431--------------------------------------------------------------------YDFM.....D..
B5EIE5_GEOBB/327-478--------------------------------------------------------------------YDNW.....D..
B0DKN0_LACBS/350-501--------------------------------------------------------------------YANW.....A..
B6K306_SCHJY/330-481--------------------------------------------------------------------FNNW.....D..
ACH1_SCHPO/330-481--------------------------------------------------------------------YSNY.....D..
A0LG92_SYNFM/280-432--------------------------------------------------------------------YEFL.....H..
Q74GS1_GEOSL/327-478--------------------------------------------------------------------YGDW.....D..
A5V7D2_SPHWW/272-423--------------------------------------------------------------------YDWI.....A..
Q0AV35_SYNWW/283-439--------------------------------------------------------------------YDYI.....S..
D2V812_NAEGR/332-483--------------------------------------------------------------------YADW.....D..
D2RN63_ACIFV/277-434--------------------------------------------------------------------YDWL.....Q..
B9M8L3_GEODF/333-484--------------------------------------------------------------------LANW.....E..
Q6LQ13_PHOPR/472-639--------------------------------------------------------------------YEAL.....NTM
A8ZWK6_DESOH/447-610--------------------------------------------------------------------YAYLRRMSEE..
A1W2A3_ACISJ/277-426--------------------------------------------------------------------RRWA.....H..
B6JG54_OLICO/334-497--------------------------------------------------------------------YRALREMPPD..
Q0VNK9_ALCBS/436-599--------------------------------------------------------------------YARLLEMSKQ..
D3BTR1_POLPA/348-499--------------------------------------------------------------------FNNW.....K..
B8FMI7_DESAA/441-604--------------------------------------------------------------------YDFLRDMSDE..
ACH1_DICDI/341-492--------------------------------------------------------------------FNNW.....E..
Q0BZS7_HYPNA/258-410--------------------------------------------------------------------YARM.....A..
Q1DA17_MYXXD/323-474--------------------------------------------------------------------LDMF.....E..
A1SHN0_NOCSJ/246-396--------------------------------------------------------------------LEWV.....D..
C0QKG0_DESAH/440-603--------------------------------------------------------------------YTELREMDDD..
Q88CB5_PSEPK/319-482--------------------------------------------------------------------YQRLREMPLE..
A8ZT97_DESOH/278-429--------------------------------------------------------------------YEFV.....H..
D0LM00_HALO1/437-597--------------------------------------------------------------------FERLRALPEA..
Q0RK43_FRAAA/215-365--------------------------------------------------------------------YGWV.....D..
D1A9C8_THECD/271-421--------------------------------------------------------------------YAWM.....H..
Q2JCQ5_FRASC/281-431--------------------------------------------------------------------YSWA.....H..
Q0C1R5_HYPNA/318-481--------------------------------------------------------------------YQDLRD.APD..
C7LYG5_ACIFD/255-405--------------------------------------------------------------------YAWA.....D..
D2UEK6_XANAP/366-529--------------------------------------------------------------------YAWLREMDSQ..
B8FN92_DESAA/282-434--------------------------------------------------------------------MDWL.....D..
C0QDF6_DESAH/275-427--------------------------------------------------------------------MAWL.....D..
C0QHQ8_DESAH/271-423--------------------------------------------------------------------MAWL.....D..
B0SLS6_LEPBP/320-466--------------------------------------------------------------------HENI.....S..
B2FSG4_STRMK/367-531--------------------------------------------------------------------YEWLRTLPED..
B4R0Y1_DROSI/312-466--------------------------------------------------------------------YDFV.....D..
B5EES2_GEOBB/332-482--------------------------------------------------------------------FDNM.....E..
B5EIS2_GEOBB/283-439--------------------------------------------------------------------YDWA.....H..
D1BNH2_VEIPT/320-466--------------------------------------------------------------------YANI.....D..
D3HLY9_LEGLN/281-431--------------------------------------------------------------------YDFI.....N..
D4K633_9FIRM/279-436--------------------------------------------------------------------YDYL.....N..
D4MZL1_9FIRM/279-435--------------------------------------------------------------------YDYL.....N..
D5HDR6_9FIRM/278-433--------------------------------------------------------------------YEWL.....D..
D6DE02_CLOSC/291-448--------------------------------------------------------------------YRWL.....D..
F4BPR0_CARS1/263-416--------------------------------------------------------------------YEFM.....N..
F4BSM4_CARS1/266-423--------------------------------------------------------------------YNFS.....G..
F4KMH9_PORAD/277-429--------------------------------------------------------------------YDFF.....D..
F4KN61_PORAD/269-421--------------------------------------------------------------------YDFA.....H..
G4Q2X4_ACIIR/277-434--------------------------------------------------------------------YQWL.....N..
G4Q5N3_ACIIR/281-437--------------------------------------------------------------------YDYV.....D..
CAT2_CLOK5/272-424--------------------------------------------------------------------YDFV.....N..
Q185L2_PEPD6/271-425--------------------------------------------------------------------YDFA.....N..
Q24S37_DESHY/279-435--------------------------------------------------------------------YDFI.....N..
Q24ZX0_DESHY/273-425--------------------------------------------------------------------YDYI.....H..
Q3JAD8_NITOC/444-607--------------------------------------------------------------------YNFLRGLKKE..
Q3SQD4_NITWN/334-497--------------------------------------------------------------------YRALREMTPD..
Q63JS7_BURPS/286-433--------------------------------------------------------------------YDFI.....H..
Q6A8E8_PROAC/249-399--------------------------------------------------------------------YEWL.....D..
Q6N157_RHOPA/260-409--------------------------------------------------------------------YRFA.....H..
Q6NCD5_RHOPA/324-470--------------------------------------------------------------------LRNL.....D..
Q7MTJ6_PORGI/273-425--------------------------------------------------------------------YDFV.....N..
Q7NBY9_MYCGA/280-429--------------------------------------------------------------------YKYL.....D..
Q88BB0_PSESM/361-524--------------------------------------------------------------------YERLRELPAE..
Q8EG98_SHEON/267-420--------------------------------------------------------------------YDYV.....D..
Q8P4W8_XANCP/323-469--------------------------------------------------------------------KRNI.....D..
Q8RC84_THETN/272-425--------------------------------------------------------------------YDFI.....D..
Q9ZC36_YERPE/283-434--------------------------------------------------------------------YEYL.....N..
R5BUI5_9FIRM/274-427--------------------------------------------------------------------YDCL.....D..
R5SJH9_9FIRM/335-481--------------------------------------------------------------------YANI.....E..
R6G778_9FIRM/279-435--------------------------------------------------------------------YDYL.....D..
R6R3R6_9FIRM/277-429--------------------------------------------------------------------YDFA.....D..
R7JML8_9BACT/267-419--------------------------------------------------------------------YEYM.....D..
R7JP79_9BACT/270-422--------------------------------------------------------------------YDFI.....D..

PF04223

Q99ZK7_STRP1/45-510SGLRDKVGAAISEGLMENPVVIRSHGGRARAIASGDIHIDVAFLGAPSSDAYGNVNGTKGKATCGSLGYAMIDAKYAD--
Q9CGA7_LACLA/46-510SGMRGTLGDVVSHGALKNPVIFRSHGGRARAIETGEIHIDVAFLGTPNADEMGNANGMDGKAPFGSLGYALMDAQYAD--
CILA_HAEIN/33-498SGLRGELAEQISRGLLNEPVNIHSHGGRVHLVKSGELKIDVAFLGVPCCDTFGNANGFTGKSKCGSLGYARVDAEYAD--
CILA_ECOLI/43-508SGLRGPLAEEISRGLLAEPVQIHSHGGRVHLVQSGELNIDVAFLGVPSCDEFGNANGYTGKACCGSLGYAIVDADNAK--
Q9KTT9_VIBCH/66-531SGIRGALADSISNGLLDEPVHIHSHGGRVHLIQSGELYIDMAFIGVPCCDEFGNANGFKGKSNCGSLGYAKVDAEHAE--

PF01144

SCOA_XANCP/13-225------YADA--KA---AL-------------AG-------VVA--D-GQ-----------------------T------
GCTB_ACIFV/10-224------KEMQ--AV---TI-------------AK-------QIK--N-GQ-----------------------V------
GCTA_ACIFV/4-241------VMTL--KD---AI-------------AK-------YVH--S-GD-----------------------H------
Q9Y916_AERPE/14-262------TVTA--EE---AL-------------S.-------NIR--D-GS-----------------------V------
SCOT_CAEEL/300-499------REII--AA---RA-------------AL-------EFT--D-GM-----------------------Y------
SCOB_HELPY/2-198------REAI--IK---RA-------------AK-------ELK--E-GM-----------------------Y------
YODS_BACSU/7-219------AISI--DT---AI-------------A.-------DVR--D-GS-----------------------V------
Q9RZA0_DEIRA/23-234------VLTA--QQ---AA-------------S.-------RVK--S-GQ-----------------------T------
ATOA_HAEIN/4-200------KELI--AR---RI-------------AM-------ELH--D-GD-----------------------I------
CTFA_CLOAB/5-216------IIRF--EN---LR-------------S.-------FFK--D-GM-----------------------T------
CTFB_CLOAB/9-205------KEII--AK---RV-------------AR-------ELK--N-GQ-----------------------L------
PCAI_ACIAD/6-219------AATL--TE---AL-------------S.-------QIH--D-GA-----------------------T------
SCOT1_HUMAN/43-272------YTDP--VE---AV-------------K.-------DIP--D-GA-----------------------T------
Q973S5_SULTO/3-202------IEHV--SK---AI-------------SL-------LLE--D-GE-----------------------K------
Q9RZ86_DEIRA/5-217------YPSA--AE---AL-------------RD-------IVH--D-GQ-----------------------T------
SCOA_BACSU/5-216------LSSS--KE---AA-------------K.-------LIH--D-GD-----------------------T------
PCAJ_ACIAD/8-206------RDQI--AQ---RV-------------AQ-------DIP--E-GS-----------------------Y------
SCOT1_HUMAN/302-501------RERI--IK---RA-------------AL-------EFE--D-GM-----------------------Y------
YDIF_ECOLI/15-253------VLSA--QE---AV-------------N.-------YIP--D-EA-----------------------T------
SCOT_CAEEL/40-271------FNSA--EE---AV-------------K.-------DIP--D-NA-----------------------K------
SCOB_BACSU/5-202------RKRM--VK---RA-------------VQ-------EIK--D-GM-----------------------N------
Q9XAM7_STRCO/5-234------VATA--GA---AV-------------A.-------DVA--D-GA-----------------------S------
Y1199_ARCFU/148-369------TMSA--EE---AV-------------SN-------FIK--D-GM-----------------------Y------
Q8PDH3_XANCP/7-217------NEMM--TV---AA-------------AR-------RLP--D-GA-----------------------V------
Q8RGS9_FUSNN/11-226------KEMQ--AI---TI-------------AK-------EIK--D-GQ-----------------------I------
SCOA_HELPY/5-216------ITDL--DK---AL-------------S.-------ALK--D-GD-----------------------T------
ATOD_HAEIN/5-216------HLKL--NN---LN-------------Q.-------HLH--D-GM-----------------------S------
Q8F685_LEPIN/8-247------FQNP--DE---MI-------------RE-------TVQ--P-KM-----------------------Y------
Q9W058_DROME/37-266------YESA--ID---AV-------------A.-------DVQ--D-GA-----------------------Q------
Q97Z51_SULSO/6-206------VDYV--IK---AI-------------ST-------LLE--D-GE-----------------------L------
ATOD_ECOLI/5-216------LMTL--QD---AT-------------G.-------FFR--D-GM-----------------------T------
Q98EM4_RHILO/9-219------NEMM--TI---AA-------------SR-------ALR--N-DD-----------------------V------
Q92TL1_RHIME/7-217------TEMM--TV---AA-------------AR-------ALS--N-DD-----------------------V------
A5VGV2_SPHWW/10-217------....--GA---AL-------------EG-------LLF--D-GM-----------------------T------
A6M018_CLOB8/11-214------....--..---.K-------------.R-------IFK--D-GM-----------------------T------
Y3551_MYCTU/6-233------.TAL--DD---AV-------------A.-------QLR--S-GM-----------------------T------
SCOB_MYCTU/9-204------.DEM--AA---RV-------------AA-------EFE--D-GQ-----------------------Y------
SCOA_MYCTU/6-233------.ATA--AE---AV-------------A.-------DIA--N-GS-----------------------S------
Q88FX5_PSEPK/6-218------YESI--AS---AV-------------E.-------GIT--D-GS-----------------------T------
S6BGT4_PSERE/8-217------.EMM--TV---AA-------------AR-------RLK--N-GA-----------------------V------

PF00455

Q98FV5_RHILO/86-240-----AKRQI--AA---IA-------------AT-------MVR--D.GD-----------------------A------
A9CFA5_AGRT5/78-235-----KKRAI--AR---KA-------------VD-------LCN--D.GD-----------------------A------
A9CH78_AGRT5/78-237-----AKARA--CR---QA-------------AV-------MIE--P.YD-----------------------T------
Q98JJ0_RHILO/76-235-----AKREA--CA---HA-------------VR-------KIR--P.DE-----------------------T------
Q8EUZ1_MYCPE/77-233-----QKKEI--AK---KA-------------VK-------LVG--Q.YK-----------------------T------
Q98AQ9_RHILO/74-232-----EKSTI--AE---IA-------------LG-------LLK--P.GQ-----------------------N------
Q8Y5F7_LISMO/74-230-----QKQKI--AY---VA-------------GK-------VIK--D.HM-----------------------T------
Q8Y9Y5_LISMO/74-233-----EKQLI--GK---AA-------------AD-------FIE--E.ND-----------------------L------
Q89SG7_BRADU/74-233-----EKKAI--GA---AA-------------AS-------LIP--N.GC-----------------------S------
Q98M65_RHILO/73-232-----EKEAI--GR---AA-------------AR-------LIP--D.NA-----------------------S------
Q7VVL2_BORPE/74-233-----GKRRI--AE---AV-------------AR-------AVP--D.GC-----------------------S------
ACCR_AGRT5/77-237-----EKAAI--AG---VV-------------AG-------MIV--E.GD-----------------------T------
Q9X0F8_THEMA/73-233-----AKEKI--AQ---LA-------------LN-------FVE--D.GD-----------------------I------
Q8EMN4_OCEIH/74-231-----EKKVI--GK---KA-------------AS-------LIY--P.GD-----------------------R------
Q8R736_THETN/74-232-----AKRKI--GR---IA-------------AS-------LIE--E.GD-----------------------T------
Q8ES05_OCEIH/74-231-----HKTSI--GK---FA-------------AS-------LIE--E.ND-----------------------V------
FRUR_BACSU/74-232-----DKLKI--AE---KA-------------AS-------LLE--E.GD-----------------------C------
Q8ESW8_OCEIH/75-233-----EKQKI--AM---EA-------------IK-------HVF--E.GD-----------------------K------
Q986N7_RHILO/100-258-----EKQRL--AA---AA-------------VA-------MIE--P.GQ-----------------------T------
Q988Q4_RHILO/55-214-----QKQAL--AQ---TA-------------AT-------MIE--P.GE-----------------------F------
A9CHG2_AGRT5/75-234-----RKATL--AR---AV-------------VP-------LIE--P.GM-----------------------V------
Q98GA9_RHILO/78-237-----ERARI--GR---GA-------------AG-------LVE--K.GH-----------------------I------
Q7D3J6_AGRT5/74-233-----ERERI--AK---AA-------------VQ-------ILK--G.AQ-----------------------V------
Q92UW3_RHIME/80-239-----AKAAI--GR---KA-------------AE-------LVK--D.GM-----------------------V------
Q98BY9_RHILO/73-232-----AKRII--AR---MV-------------AA-------TIR--D.GE-----------------------S------
Q986T2_RHILO/74-233-----AKKRI--AR---AA-------------VE-------LFE--D.NQ-----------------------S------
Q9RZP5_DEIRA/82-243-----GKQRL--AG---RA-------------LE-------LIA--P.GQ-----------------------T------
Q9K3L7_STRCO/73-239-----EKQRV--AQ---AV-------------AA-------LVA--P.GE-----------------------A------
Q9AD80_STRCO/62-221-----EKTAI--AD---LA-------------AG-------LVE--E.GE-----------------------A------
Q5UXV7_HALMA/72-230-----GKRAI--AK---RA-------------VD-------ELS--D.GD-----------------------A------
Q5V513_HALMA/74-231-----EKQAI--AE---RA-------------AQ-------EVR--E.GQ-----------------------V------
Q5YVT8_NOCFA/75-235-----EKERI--AK---AA-------------LD-------YLP--PTGG-----------------------S------
YULB_BACSU/74-232-----EKKAI--AH---EA-------------AK-------YVK--S.GD-----------------------R------
LACR_STAA8/75-234-----EKRFI--AK---KA-------------AS-------LIE--D.GD-----------------------T------
ULAR_ECOLI/75-231-----EKVRI--AK---AA-------------SQ-------LVN--P.GE-----------------------S------
AGAR_ECOLI/88-247-----MKRSV--AK---AA-------------VE-------LIQ--P.GH-----------------------R------
DEOR_ECOLI/76-232-----EKRRA--AK---LA-------------AT-------LVE--P.DQ-----------------------T------
FUCR_ECOLI/75-233-----HKADI--AR---EA-------------LA-------WIE--E.GM-----------------------V------
YIHW_ECOLI/78-237-----EKKAI--AE---AV-------------AD-------YIP--D.GS-----------------------T------
SGCR_ECOLI/79-236-----AKREI--AA---LA-------------RT-------MIK--D.GD-----------------------C------
IOLR_BACSU/72-231-----EKTKI--AH---YA-------------SR-------FIE--D.HD-----------------------L------
YGBI_ECOLI/75-232-----QKAAI--GK---LA-------------AS-------LVQ--P.GS-----------------------C------
YDJF_ECOLI/76-233-----EKQLI--AR---KA-------------LP-------FID--N.KT-----------------------T------
GLCR_BACSU/75-231-----EKNKI--GR---LA-------------AS-------LIH--D.GD-----------------------R------
Q2G240_STAA8/76-232-----EKKMI--AK---IA-------------AN-------QIN--D.NE-----------------------C------
Q2YIQ5_BRUA2/76-232-----AKLKM--AR---AA-------------LE-------LVE--P.GM-----------------------T------
Q2YIY1_BRUA2/81-239-----EKKLI--AE---AA-------------MQ-------FVE--P.GQ-----------------------A------
Q2YLA3_BRUA2/76-232-----EKAAI--GQ---LA-------------AQ-------MIR--S.GT-----------------------V------
Q32AN5_SHIDS/73-232-----EKERI--AR---KV-------------AE-------QIP--N.GS-----------------------T------
Q32CM1_SHIDS/74-232-----KKELI--AE---AA-------------VS-------FIH--D.GD-----------------------S------
Q32GP8_SHIDS/68-227-----LKREL--AE---FA-------------AS-------LVQ--P.GE-----------------------T------
GLPR_PSEAE/74-231-----EKQRI--AE---AV-------------AS-------LVP--D.NA-----------------------S------
Q7CFX9_YERPE/75-232-----EKARI--AQ---RV-------------AS-------QIP--D.GA-----------------------T------
Q7CGX6_YERPE/76-234-----VKSLI--GQ---AA-------------AK-------LIN--S.GD-----------------------T------
Q7CHA9_YERPE/76-237-----LKQNI--GV---LA-------------AM-------LIE--P.GQ-----------------------T------
Q7CHG1_YERPE/76-235-----EKRRI--GQ---LA-------------AQ-------LII--E.ND-----------------------T------
Q7CKA8_YERPE/91-249-----TKMKI--AK---AA-------------LQ-------FIR--P.GD-----------------------C------
Q8DN15_STRR6/75-235-----QKRLI--AS---LA-------------KD-------FIR--S.GM-----------------------C------
Q8DPP7_STRR6/78-234-----EKQEI--AH---FA-------------GS-------LVE--E.RE-----------------------T------
Q8DQ97_STRR6/74-227-----EKKLL--AQ---KA-------------AS-------LIK--E.KD-----------------------V------
Q8DRC4_STRR6/83-243-----IKRKI--VQ---EA-------------VK-------LVS--D.NE-----------------------T------
Q8PDH7_XANCP/77-235-----EKQQI--AT---QV-------------AR-------FIP--D.DA-----------------------S------
Q8R8Q0_THETN/73-230-----EKQRI--AA---KA-------------VT-------EIK--E.GN-----------------------V------
Q8Y4U4_LISMO/74-229-----SKKVI--AA---YC-------------AS-------LVE--E.ND-----------------------C------
Q8YA06_LISMO/78-236-----SKIRI--AD---IA-------------KS-------LIR--D.DM-----------------------V------
Q8YA14_LISMO/74-233-----EKEAI--AK---EA-------------AT-------LVK--N.NQ-----------------------T------
Q928R7_LISMO/75-232-----EKQRI--AT---LA-------------AT-------MVK--D.GD-----------------------T------
Q97EY9_CLOAB/77-234-----GKMEA--AR---LA-------------AG-------LIK--E.ND-----------------------I------
Q97F00_CLOAB/78-235-----QKRHI--AK---LA-------------SE-------MIE--E.ND-----------------------I------
Q97F05_CLOAB/78-235-----QKKDV--AK---IA-------------AS-------MVE--E.ND-----------------------I------
Q97J56_CLOAB/68-226-----EKLRI--AK---EG-------------IK-------FVD--N.GD-----------------------T------
Q97J82_CLOAB/75-231-----AKIKI--AK---KA-------------AS-------LIK--D.DD-----------------------F------
Q97MG7_CLOAB/76-233-----EKLAI--GK---YA-------------AN-------MIK--N.GD-----------------------T------
Q97MS8_CLOAB/74-235-----EKLII--AK---KA-------------FD-------LIE--D.DE-----------------------T------
Q9HT24_PSEAE/78-233-----YKQAI--GR---AA-------------AA-------RIR--E.HA-----------------------R------
Q9I3M2_PSEAE/74-231-----EKRAV--AR---YA-------------AG-------LFG--P.GD-----------------------S------
Q9JYJ2_NEIMB/75-234-----EKNAI--AR---LI-------------AE-------HIP--D.GS-----------------------S------
Q9K3N4_STRCO/82-247-----AKEDI--AR---AA-------------AE-------LVA--P.GA-----------------------A------
Q9KL10_VIBCH/75-233-----EKEKV--AM---AL-------------VQ-------HIP--D.GA-----------------------T------
Q9KMS3_VIBCH/75-231-----EKSLI--AL---KA-------------AE-------LCQ--P.GD-----------------------S------
Q9KRT3_VIBCH/76-234-----AKQRI--AQ---RV-------------AQ-------ELP--E.GC-----------------------S------
Q9KUM9_VIBCH/81-237-----RKISL--AK---AA-------------AK-------LIR--D.HN-----------------------R------
Q9KYU7_STRCO/74-233-----EKDRI--AR---AA-------------LA-------ELP--A.EG-----------------------T------
Q9S2D1_STRCO/76-233-----GKRKV--AS---AA-------------AG-------LVR--P.GG-----------------------V------
Q9X9X5_STRCO/79-237-----EKRRI--AS---AA-------------VE-------LLG--D.AE-----------------------T------
Q9ZC48_YERPE/76-232-----QKQAI--GT---SA-------------AL-------HIP--R.NS-----------------------C------

PF02550

O28424_ARCFU/3-199-----YERKL--IS.PEEA-------------AN-------LVK--D-GM-----------------------H------
O29120_ARCFU/9-201-----YEKKL--IS.PEEA-------------AG-------LVE--S-GM-----------------------H------
P73661_SYNY3/6-196-----LAQLR--SQYPEKF-------------AS-------YSE--I-FS-----------------------H------
ACH1_YEAST/12-230-----YLKKV--KE.AHEL-------------IP-------LFK--N-GQ-----------------------Y------
SCPC_ECOLI/1-213-----WTRMT--AN...EA-------------AE-------IIQ--H-ND-----------------------M------

PF01008

EI2BD_MOUSE/219-510-----SNARC--IALLHAL-------------QQ-------VIQ--D-YT...TPPSEELSR.....DLVNKLK------
R15PI_METJA/22-292-----AGRIG--RAAAKAL-------------KE-------YAL--K-IS...HLNEEEF.........KNKMR------
EI2BB_YEAST/33-358-----SYAIA--LETLQLL-------------MR-------FIS--A-AR...WNHVNDL.........IEQIR------
MTNA_BACSU/49-337-----APAIG--ITAAFGL-------------AL-------AAK--D-IE...TDNVTEF.........RRRLE------
MTNA_ARCFU/41-327-----APALE--AAGAYGI-------------AL-------AAR--E-RE...FADVDEL.........KEHLK------
EI2BA_HUMAN/15-293-----DMASA--VAAIRTL-------------LE-------FLK--R-DK...GETIQGL.........RANLT------
MTNA_SYNY3/51-343-----APAIG--VAAAYGM-------------YL-------GAR--R-IQ...TTELREF.........VVQLE------
MTNA_METTH/44-310-----APAIG--VTAAFGV-------------AM-------AEL--A-GE.....................DVE------
MTNA_CAEEL/66-357-----APLIA--VVGSLGL-------------LL-------EIQ--K-AS........EL........DSESII------
EI2BA_CAEEL/15-293-----SKSTS--LATVETL-------------LE-------VLD--R-SR...ATTVAEF.........QNELN------
EI2BA_YEAST/15-292-----EMTMP--IAAIEAL-------------VT-------LLR--I-KT...PETAAEM.........INTIK------
EI2BD_YEAST/285-637-----SIPRC--IAMLEVF-------------QI-------VIK--D-YQ...TPKGTTLSR.....NLTSYLS------
MTNA_METJA/48-319-----APAIG--VSAAYGL-------------AL-------AEI--N-GD.....................DIY------
EI2BB_RABIT/27-333-----SEDMA--RETLGLL-------------RR-------IIT--D-HR...WSNAGEL.........MELIR------
MTNA_YEAST/49-399-----APAIA--IVGSLSV-------------LT-------EVQ--L-IKHNPTSDVATLYSLVNWESTKTVLN------
EI2BD_SCHPO/156-452-----SNQRC--IDLLKTF-------------KI-------VIQ--D-YQ...TPYGTTLSR.....HLTTHIN------
Q5V075_HALMA/195-460-----SAWLS--LRALEVL-------------RD-------EAA--L-AD...AGRSDDLETAERDGDDWEALA------
R15PI_ARCFU/15-284-----AARIA--RFAAETL-------------MK-------FAE--K-AS......DEKF.........DEEMR------

PF04198

YJHU_ECOLI/63-323-----GSIDA--AL---QI-------------RD-------KFN--L-QR-----------------------V------
Q9WWA6_AGRRK/83-337-----SSPML--EK---EL-------------VA-------KFD--L-RK-----------------------A------
Q9CKH2_PASMU/56-313-----FTSKL--EQ---RL-------------IE-------QFG--I-HR-----------------------A------
Q98GB2_RHILO/49-296-----TPDDI--TR---QL-------------ID-------GLK--L-RD-----------------------A------
Q9RT33_DEIRA/86-346-----HPCSL--QA---RL-------------ME-------RWP--G-VQ-----------------------A------
Q986P9_RHILO/64-319-----ECVEL--ED---EL-------------SR-------RYG--L-DY-----------------------C------
Q97L54_CLOAB/89-338-----GLTDI--EE---FI-------------RI-------NLN--I-KK-----------------------V------
CGGR_BACMD/89-339-----GLRLL--ET---TL-------------KE-------AFS--L-SE-----------------------V------
Q9CGB1_LACLA/54-307-----RSFEL--EK---QF-------------KT-------LFD--I-PQ-----------------------I------
Q98CZ8_RHILO/62-317-----NCLDL--AA---RL-------------KS-------RFA--L-DL-----------------------V------
Q9L0Z6_STRCO/89-343-----LDAER--SD---AL-------------RA-------RYG--L-RH-----------------------A------
Q99XS9_STRP1/56-314-----DLFAL--EE---YV-------------RQ-------QYG--L-EK-----------------------L------
Q9CLG2_PASMU/68-318-----GCLEL--EE---AL-------------KE-------HFQ--L-KH-----------------------I------
LSRR_ECOLI/66-316-----GCLEY--ET---QL-------------RR-------QFS--L-QH-----------------------V------
Q9KER9_BACHD/57-313-----HTVEL--EQ---RL-------------EK-------KYH--L-KE-----------------------A------
DEOR_BACSU/56-311-----DLDAL--GS---IL-------------EE-------KYG--L-LE-----------------------A------
Q9KLX0_VIBCH/62-319-----FSAKI--EQ---RL-------------IE-------RFG--V-RR-----------------------A------
CGGR_BACSU/89-338-----GLTLL--EK---TL-------------KE-------RLN--L-KD-----------------------A------
Q9K712_BACHD/89-338-----GLRDL--EA---KL-------------RS-------RLG--V-KE-----------------------A------
Q986M3_RHILO/57-311-----TDDVM--AR---RL-------------ED-------ALK--L-DA-----------------------V------
Q98FV1_RHILO/42-296-----EIVRL--ER---AL-------------ER-------TFG--L-QQ-----------------------A------
A6TBJ1_KLEP7/59-311-----NCLDY--AQ---LL-------------QE-------KYR--L-IE-----------------------C------
A6TGS9_KLEP7/60-317-----ENLWL--EQ---QL-------------KQ-------KFG--L-KE-----------------------A------
D5AUX6_RHOCB/60-314-----ACLDL--EV---AL-------------SR-------RFA--L-KL-----------------------A------
Q1GB28_LACDA/125-376-----NASQA--EV---WL-------------AQ-------ALG--I-DR-----------------------T------
Q2G033_STAA8/91-337-----DDNRL--SE---GI-------------KN-------KFQ--I-KE-----------------------V------
Q2YIQ4_BRUA2/58-310-----ECIDL--EN---RL-------------AD-------LYG--L-DY-----------------------C------
Q3J1R9_RHOS4/62-317-----GCLHL--EA---AL-------------IR-------RFG--L-KL-----------------------A------
Q8DRC3_STRR6/59-313-----NMFKL--EN---YV-------------KE-------KYG--L-ES-----------------------L------

PF06026

RPIA_BURPS/53-222-----SSVAT.-TERLKSH-------------GI....K..VFD--L.NE-----------------------I......
RPIA_METJA/51-220-----TSFEA.-KMLAMQY-------------EI....P..LVT--L.DE-----------------------Y......
K4L1A8_SIMAS/53-215-----SSEAS.-AERLKAH-------------GI....P..VYD--L.NA-----------------------V......
D0KYM3_HALNC/50-214-----SSEAS.-TKRLRAH-------------GI....E..VFD--L.NG-----------------------V......
D5MHI2_9BACT/41-208-----TSQVT.-AALAVQL-------------GI....P..LAT--L.EE-----------------------V......
D5DBB1_BACMD/47-216-----TSQKT.-EELARKL-------------GI....P..IVT--L.AD-----------------------V......
G7M4M9_9CLOT/48-219-----PSVKT.-KMLCIEN-------------GL....E..VLH--T.SF-----------------------V......
V5UL52_9BURK/53-222-----SSEAS.-TERLRKH-------------GI....E..VFD--L.NQ-----------------------I......
RPIA_STAEQ/52-222-----TSNKT.-AFLAKEL-------------AM....N..IVD--V.ND-----------------------V......
RPIA_CHLAA/55-225-----CAEGT.-AQLAREL-------------GI....P..LTT--L.DE-----------------------V......
E8WXH2_ACISM/47-217-----SSDAS.-FNLGAEL-------------GL....D..MMT--L.NE-----------------------L......
RPIA_RHOPB/50-225-----TSEVT.-RADALRC-------------GI....A..LTT--L.DE-----------------------V......
H8MW96_CORCM/57-227-----TSHAT.-ETLAASL-------------GV....P..LTT--L.DV-----------------------H......
RPIA_SHELP/49-213-----SSEAS.-TEKMKAL-------------GI....P..VFD--L.NS-----------------------V......
M4QFB2_LIBAS/50-224-----SSRNT.-ENFCKIH-------------HI....P..LHS--P.ED-----------------------V......
U5H8J3_USTV1/122-297-----TGFQS.-KELIVKA-------------GL....N..LGD--V.DQ-----------------------F......
N0BJC6_9EURY/47-217-----SSYQS.-HMLAVEN-------------GI....T..VTD--L.IQ-----------------------F......
H0PXY1_9RHOO/49-213-----SSEAS.-SRRLASY-------------GI....P..VID--L.ND-----------------------V......
RPIA_RHILO/50-224-----TSERT.-AALCREL-------------GV....P..LST--L.EE-----------------------T......
I3UDK7_ADVKW/56-221-----SSERS.-AARLRGH-------------GV....R..VLD--L.AE-----------------------T......
E4X352_OIKDI/53-229-----SSFQA.-RQLIIEH-------------GL....L..LSD--L.ER-----------------------T......
C7R992_KANKD/49-211-----SSEAS.-TERLKKH-------------GI....E..VFE--L.NE-----------------------V......
K9ZYM6_DEIPD/53-221-----TSNAS.-EQLAREV-------------GV....P..VEE--F.DC-----------------------Q......
RPIA_LEPCP/49-214-----SSVRS.-TERLQAL-------------GI....P..VLD--L.SQ-----------------------V......
A0RTM4_CENSY/52-220-----TSLQI.-RLVAEEC-------------GI....S..LRD--P.GD-----------------------T......
RPIA_HAEIN/49-214-----ASKES.-EELLRKQ-------------GI....E..VFN--A.ND-----------------------V......
S2J2W4_MUCC1/53-230-----TSFQS.-KLLILEG-------------GL....T..LGS--V.EQ-----------------------Y......
RPIA_LACRD/52-220-----TSNRT.-AKQARDL-------------GI....T..IKD--I.DD-----------------------V......
RPIA_PHOPR/49-213-----SSVAS.-TERLEKL-------------GI....P..VFE--A.NE-----------------------V......
G4RF46_PELHB/49-224-----TSEAT.-AAQARGL-------------GI....P..LTT--L.DD-----------------------I......
A9V4I9_MONBE/88-261-----TSFQA.-RQLILEN-------------KL....V..LGD--L.NA-----------------------N......
F2I5Y3_AERUA/48-215-----SSIKS.-IDQAKAL-------------GI....E..VLP--I.DQ-----------------------V......
G2MHG7_9ARCH/54-222-----TSFQA.-RQLAQEA-------------GI....P..LTT--L.EE-----------------------A......
C6XK92_HIRBI/49-225-----TSEVT.-EAQARSL-------------NI....P..MAD--L.DT-----------------------A......
C4R764_PICPG/66-245-----TGFQS.-KELILSN-------------GL....R..LGS--V.EE-----------------------Y......
D3E2P7_METRM/49-218-----TSFQS.-SLLARKW-------------NI....P..ITS--L.DE-----------------------H......
W8KJT3_HALHR/50-214-----SSEVS.-AERLRKH-------------GI....P..VMD--L.NS-----------------------A......
E0SPG1_IGNAA/58-230-----SSIDT.-ALYLLNM-------------GI....ENIESG--LPRD-----------------------S......
RPIA_HALWD/54-223-----TSFAT.-RDRAIEA-------------GI....P..LTR--I.EA-----------------------V......
L0B5Z2_9PROT/36-200-----SSKRT.-ELLLSRH-------------GI....K..LFD--L.NE-----------------------L......
T0N5R5_9EURY/50-215-----TSLET.-MYLLNSG-------------GL....R..TST--EFHG-----------------------S......
D2A0V2_TRICA/53-227-----TSFQA.-RQLIIQH-------------RL....H..LTD--L.EI-----------------------H......
R7ELE2_9BACE/67-233-----ASAEI.-SMTCIQL-------------GL....P..QTT--LWNK-----------------------R......
T0LRI8_9EURY/54-219-----TSERT.-TEKALKL-------------GL....N..VNQ--QYKG-----------------------E......
A4YX18_BRASO/48-223-----TSEAT.-RAQAEAC-------------GV....P..LTT--L.DE-----------------------I......
W1Q6V8_OGAPD/53-229-----TGFQS.-RQLIIDN-------------GL....R..LGS--T.EE-----------------------Y......
J7Q837_METSZ/64-239-----TSERT.-RAQAESL-------------GI....T..LST--L.DE-----------------------T......
S5YAN5_PARAH/56-230-----TSKAT.-AELAQSL-------------GL....S..IET--L.DE-----------------------I......
RPIA_RHOPA/50-225-----TSEVT.-RADAERC-------------GI....R..LTS--L.DE-----------------------I......
W0JVE5_9EURY/51-218-----TSFQS.-RQRAIEA-------------GI....P..LTT--L.EE-----------------------A......
RPIA_PEDPA/51-220-----TSDRT.-AEQARSL-------------GI....N..VKS--V.DE-----------------------V......
S2JUJ5_MUCC1/54-231-----TSFQS.-KLLILDN-------------GL....K..LGS--I.EQ-----------------------N......
U3U6Y6_9BACT/49-214-----SSNSS.-TKQLKSL-------------GI....P..VLD--L.NE-----------------------V......
RPIA_BAUCH/49-214-----SSEQS.-TTKLKSM-------------GI....L..LFN--L.ND-----------------------V......
K9SSM9_9SYNE/57-227-----TSFES.-IVLGKKY-------------GV....P..IRS--L.DD-----------------------V......
D5EB20_METMS/56-224-----TSYQS.-EMLAIQA-------------GI....P..LTS--L.AE-----------------------N......
J9W6I1_LACBU/52-220-----TSERT.-REQANSL-------------GI....K..TKG--L.DE-----------------------I......
G0VA31_NAUCC/62-239-----TGFQS.-KKLILDN-------------GL....Q..LST--V.EQ-----------------------H......
A1B891_PARDP/56-230-----TSKAT.-AELATSL-------------GL....G..VEE--L.DE-----------------------I......
RPIA_DICNV/49-213-----ASETS.-SKALEAA-------------GF....R..VRD--L.NA-----------------------C......
K7SFG2_GLUOY/48-220-----TSEDS.-ARKAEKA-------------GI....P..LTD--F.AA-----------------------H......
C5M9K4_CANTT/70-245-----TGFQS.-KQLIIDN-------------GL....N..LGA--I.EQ-----------------------Y......
C7JF40_ACEP3/57-228-----TSSVT.-EKQAKEE-------------GI....P..LTT--F.GE-----------------------Q......
RPIA_LACC3/51-220-----TSVRT.-RKQAESL-------------GI....P..MKA--L.DE-----------------------V......
A9SR64_PHYPA/70-245-----TSKRT.-AEQAASL-------------GI....P..LSV--L.DD-----------------------H......
F3Y8A6_MELPT/48-218-----TSKET.-EKQALSL-------------GI....P..LKS--I.DE-----------------------V......
D8RIH7_SELML/81-253-----SSYQS.-RILARQY-------------GV....K..TVD--L.ND-----------------------V......
RPIA_STRMU/49-217-----TSSRT.-TAQAQAL-------------GI....P..LKS--I.DE-----------------------V......
Q2FVT0_STAA8/52-222-----TSNKI.-AFLAKEL-------------GI....K..ICE--I.ND-----------------------V......
E2BIQ5_HARSA/33-208-----TSFQA.-RQLIVKN-------------HL....T..LGD--L.EI-----------------------Y......
RPIA_BACSK/48-216-----ASRKT.-EALAKAC-------------GI....H..IID--F.PT-----------------------M......
R9T971_9EURY/48-216-----TSIET.-EKQARSL-------------NI....P..LTE--L.EC-----------------------V......
RPIA_DEBHA/69-245-----TGFQS.-KQLIIDA-------------GL....R..LGT--I.EQ-----------------------Y......
E9G3C7_DAPPU/53-228-----SSFQA.-KQLIIQY-------------GL....K..LGD--L.EM-----------------------N......
M1XYN2_NATM8/55-227-----TSHQS.-RALAREA-------------GI....P..LLT--L.EE-----------------------A......
B7VHI7_VIBSL/94-259-----SSVRS.-SRALSSA-------------GL....N..EIS--I.SE-----------------------C......
Q8I3W2_PLAF7/51-226-----TSIDT.-ELKARKL-------------GI....P..LTT--L.EK-----------------------H......
A3DN78_STAMF/53-223-----SSYAT.-HNYLYKH-------------GIDAYTP.....--....-----------------------.......
J4I3H4_FIBRA/107-283-----TSFQS.-KELIVNA-------------QL....L..LGD--V.DQ-----------------------Y......
K5XRW6_AGABU/63-240-----TGFQS.-KLLIIEA-------------GL....N..LGD--V.DE-----------------------F......
U5QS13_9CYAN/54-225-----TSERT.-AQQARSL-------------GI....P..LAT--L.EE-----------------------Q......
E3NWK8_CAERE/55-230-----TSRST.-IEVAQQV-------------GI....E..ITD--P.NE-----------------------I......
D7EAR3_METEZ/57-226-----TSYQS.-EMLAIDA-------------GI....P..LTS--L.SE-----------------------H......
R5EWG7_9GAMM/48-213-----SSNKT.-TEALTKI-------------GV....K..VVD--P.NK-----------------------T......
A6X0Q4_OCHA4/51-225-----TSERT.-AKLCKEL-------------GV....P..LTT--L.DE-----------------------T......
K4AIV0_SETIT/101-286-----SSVLS.-ASEADKA-------------GI....R..ASS--YQEG-----------------------T......
D6S665_9LACO/56-223-----TSSRS.-KKQLESY-------------GF....K..VDE--L.AD-----------------------V......
D3RQX1_ALLVD/48-212-----SSEVS.-TERLKRH-------------GI....P..VFD--L.NA-----------------------V......
D5X4J8_THIK1/49-213-----SSERS.-TERLRAH-------------GI....T..VYD--L.NE-----------------------V......
R5VQ59_9PORP/67-230-----ASFES.-TMACLRF-------------GI....P..LTT--LWEK-----------------------R......
D1Z1V9_METPS/54-222-----TSYAS.-EALAIEC-------------NI....P..LST--L.AE-----------------------C......
A1RX06_THEPD/46-219-----SSIDT.-SLYAAGK-------------GL....L..EVP--LHEY-----------------------T......
Q4UBE3_THEAN/56-233-----TSQST.-HLKAEEL-------------EI....P..LLT--L.DD-----------------------L......
V5WM65_9SPIO/65-247-----TSFST.-QALCQEK-------------GI....P..VFS--LNDS-----------------------R......
D2RI11_ARCPA/48-216-----SSYQS.-HFLALKA-------------GI....R..IVD--L.FE-----------------------Y......
RPIA_PROMP/47-218-----TSFQS.-EVLALEL-------------NI....P..LID--L.AS-----------------------V......
B2IHK8_BEII9/53-228-----TSERT.-RTQADTY-------------KI....P..LST--L.DA-----------------------T......
RPIA_OLICO/50-225-----TSEGT.-RADAERC-------------GV....P..LTT--L.DD-----------------------V......
RPIA_PICGU/64-240-----TGFQS.-KQLIIDN-------------GL....T..LGA--I.EQ-----------------------F......
K1VP09_TRIAC/61-234-----TGFQS.-KQLIIDA-------------GL....Q..LGD--V.DQ-----------------------Y......
I4YBK0_WALSC/145-321-----TSFQA.-KELIVGN-------------GL....T..LGD--V.DQ-----------------------Y......
RPIA_CAUSK/47-220-----TSEAT.-ANLAREL-------------GI....A..LTA--L.DD-----------------------V......
F6HTS6_VITVI/101-277-----TSKRT.-EEQALSL-------------GI....P..LSV--L.DH-----------------------H......
M4DCW1_BRARP/79-256-----TSKKT.-QEQALSL-------------GI....P..LSD--L.DA-----------------------H......
RPIA_METRJ/50-224-----TSEAT.-RAQAESL-------------GI....R..LAT--L.DE-----------------------Q......
B5Y3N7_PHATC/98-280-----TSIRT.-KEQAESL-------------GI....P..LVT--L.DT-----------------------H......
H9UGB7_SPIAZ/58-234-----TSMQT.-RQLCQEL-------------LL....P..VRS--M.ND-----------------------P......
RPIA_THERP/50-221-----TSQRT.-AALARRV-------------GIELRDP.....--..DS-----------------------V......
RPIA_METPP/49-213-----SSVKS.-TERLREK-------------GI....R..VFE--A.AA-----------------------V......
L0I9N5_HALRX/54-222-----TSAES.-AQLARES-------------GI....P..LTT--L.AA-----------------------V......
X2H3T4_9NEIS/50-214-----TSALT.-SETLKKF-------------GI....P..EVT--L.NE-----------------------V......
D7DSD0_METV3/58-228-----TSFDA.-KMLASQC-------------GI....P..LVS--L.DQ-----------------------A......
T1HW83_RHOPR/84-259-----TSFQA.-QMLIVKN-------------NL....V..LRN--L.DE-----------------------C......
A9RL35_PHYPA/31-216-----MSSAS.-AAAAAQA-------------GV....P..LTT--FEDQ-----------------------P......
V9VTU6_9RHOB/56-231-----TSSRT.-AALARDV-------------GI....N..VVS--L.DE-----------------------A......
Q4MZ63_THEPA/56-234-----TSQAT.-YLKAKEL-------------EI....P..LIS--L.DE-----------------------V......
RPIA_SODGM/49-213-----SSEAS.-SAKLQSL-------------GI....P..LFD--L.NE-----------------------V......
K9XKW8_9CHRO/57-227-----TSFQA.-EVLAKQY-------------GI....P..LTT--L.DA-----------------------V......
K5W1L5_PHACS/65-241-----TGFQS.-KELIVDA-------------HL....R..LGD--V.DQ-----------------------Y......
RPIA_ALKEH/50-214-----SSEAS.-TARLRQY-------------GI....P..VLD--L.NE-----------------------V......
E8UX17_TERSS/51-221-----SSEDS.-AKLGAEL-------------GI....P..IID--F.HS-----------------------A......
RPIA_KORCO/48-217-----SSKQI.-EEVARNQ-------------GL....E..VIY--PDGE-----------------------R......
U5T5D8_9GAMM/49-213-----ASEVS.-AARLRRH-------------GI....E..VRD--A.NS-----------------------V......
C3AWU3_BACMY/48-217-----TSIET.-QKLAVQL-------------SI....P..LIP--L.SD-----------------------V......
RPIA_VIBPA/49-213-----SSVAS.-TERLKEL-------------GI....E..VFE--C.ND-----------------------V......
E5SAM9_TRISP/143-319-----TSYQA.-RTLILQN-------------GL....P..LGD--L.EL-----------------------Y......
I0FD89_BORCA/51-219-----TSSDT.-QCLLAKE-------------NIAYESK..FTK--I.NK-----------------------N......
F2UBB3_SALR5/70-247-----TSFQA.-IQLIRQH-------------NL....P..LSD--L.SA-----------------------T......
E1QRN8_VULDI/53-227-----TSTET.-EIEIVRL-------------GL....ANLLRY--P.WQ-----------------------V......
RPIA_BURXL/53-222-----SSLAT.-TARLQSH-------------GF....K..VLD--L.NE-----------------------I......
C1CUX0_DEIDV/53-221-----TSEAS.-DQLARQL-------------GI....P..VEP--L.DP-----------------------R......
E1VFV9_9GAMM/49-213-----SSEET.-RRRLVAK-------------GV....P..VFD--L.NE-----------------------G......
D9Q2B6_ACIS3/51-222-----SSLST.-ALSLSGE-------------GV....D..VIY--YPAG-----------------------D......
S6C126_9GAMM/49-213-----SSEAS.-TERLKAI-------------GI....P..VLD--L.NA-----------------------V......
F6HFJ9_VITVI/87-263-----TSKKT.-HEQAVSL-------------GI....P..LSD--L.DS-----------------------H......
U1N8Y7_ASCSU/112-290-----TSFLT.-RKWLLDA-------------GL....S..VTN--L.EQ-----------------------Q......
Q8SR79_ENCCU/35-195-----SSIRT.-ALILSEK-------------GFTVSSP..LA.--..HG-----------------------V......
RPIA_THEEB/55-223-----TSFQA.-SVLAKKY-------------GI....P..LVT--L.DD-----------------------V......
Q11IC0_CHESB/51-225-----TSERT.-AALCREL-------------SV....P..LST--L.DE-----------------------T......
A6LVZ7_CLOB8/47-215-----TSKST.-ESLAREL-------------KI....P..LLS--I.DE-----------------------V......
B9I0V6_POPTR/93-277-----MSVTS.-ASEAAKA-------------GI....P..LDV--YQDS-----------------------S......
RPIA_LARHH/50-214-----SSQAT.-ADRLKAI-------------GI....Q..VFD--L.NG-----------------------V......
RPIA_DESAA/53-223-----SSTPT.-EEVARSL-------------GI....P..LVG--F.EE-----------------------H......
RPIA_DINSH/56-231-----TSTRT.-AELARDL-------------KL....H..VTT--L.DE-----------------------V......
B2GAA8_LACF3/52-221-----TSNRT.-TAQATSL-------------GI....K..IVD--L.DD-----------------------V......
R5PSN2_9BURK/55-218-----SSERS.-TKRLEAL-------------GF....K..VLD--M.NE-----------------------V......
H8GLH3_METAL/47-217-----SSMVS.-AIKAREL-------------GL....P..QIP--I.EQ-----------------------L......
K3Y9J6_SETIT/66-248-----TSLKT.-ELHAARA-------------GI....P..LLP--L.DA-----------------------A......
RPIA_BUCBP/49-213-----SSNFS.-TACLKRI-------------GI....P..IYD--L.SK-----------------------I......
U5N777_9BURK/52-220-----TSPAS.-TALLREL-------------GI....P..VLD--P.ND-----------------------V......
RPIA_METB6/55-226-----TSYQT.-AMKAREY-------------GI....P..LTT--L.DD-----------------------N......
F9VP11_SULTO/46-214-----SSIDT.-ELEISKR-------------EG....I..VIT--LYSG-----------------------L......
RPIA_ALBFT/60-228-----SSEAS.-TLRLKAL-------------GI....P..VFD--A.NE-----------------------V......
D9S606_FIBSS/55-226-----TSWST.-TLQCRSL-------------GI....P..LKE--M.GE-----------------------V......
A8I636_AZOC5/111-286-----TSEQT.-KAQALSL-------------GV....P..LAT--L.DE-----------------------L......
R9SLS4_9EURY/48-217-----TSYQS.-ALLAQQW-------------NI....P..LTS--L.DE-----------------------H......
G8ZWF9_TORDC/75-252-----TGFQS.-KQLIIDN-------------GL....S..YGI--I.EQ-----------------------N......
R5JU55_9BACE/67-230-----ASMEI.-SMTCVQL-------------GI....P..QTT--LWER-----------------------R......
E6U2Y3_ETHHY/42-213-----PSTRT.-AALCAEH-------------GL....P..VLP--T.WT-----------------------V......
F7XM76_METZD/57-225-----TSYQS.-EMLSIEA-------------GI....P..LTT--L.SQ-----------------------H......
RPIA_RUTMC/49-214-----SSKAT.-RQRLESY-------------DI....K..VFD--L.NE-----------------------V......
RPIA_YARLI/58-236-----TGFQS.-KQLIQNA-------------GL....R..LGC--I.DQ-----------------------Y......
V5SCR1_9RHIZ/50-225-----TSEET.-QRLAEQH-------------GI....P..LTT--L.CE-----------------------T......
G4QMA8_GLANF/49-213-----SSDAS.-TQRLKKL-------------GI....E..VFD--L.NS-----------------------V......
RPIA_THIDA/48-212-----SSEAT.-AARLKSH-------------GI....Q..VLD--L.NS-----------------------V......
A8IRQ1_CHLRE/82-257-----TSIRT.-YEQALSL-------------GI....P..LAT--L.DE-----------------------Q......
Q8ZXY8_PYRAE/44-218-----TSSDS.-EILAYEV-------------GL....GDRLRP--M.WA-----------------------V......
W8RXL1_9RHOB/56-231-----TSTRT.-ADLAREV-------------GI....T..VKT--L.DE-----------------------V......
R6UK51_9FIRM/42-213-----PSLET.-ETLCIKL-------------GL....P..LLP--L.RQ-----------------------I......
K8ENG0_CARML/47-216-----TSNRT.-AEQAKAL-------------GI....P..LKS--V.DE-----------------------V......
B8ELA7_METSB/53-228-----TSEET.-RAQAAAL-------------GV....A..LTT--I.DA-----------------------E......
H3CYY4_TETNG/53-228-----TSFQA.-RQLILQH-------------SL....A..LSD--L.DR-----------------------H......
F8J7J2_HYPSM/50-225-----TSEAT.-RAQAAAL-------------DI....P..LTT--L.DE-----------------------T......
U6B5B2_9RHIZ/50-224-----TSVDT.-ENFCKKN-------------NI....P..LLS--I.ED-----------------------V......
RPIA_HALMA/53-220-----TSFQS.-RQLARDC-------------GI....P..LAD--L.DD-----------------------V......
C7PIS1_CHIPD/51-219-----TSVAS.-EQQAIAL-------------GI....P..ITS--F.SE-----------------------I......
I1MGA3_SOYBN/93-278-----MSVSS.-ASEAAKA-------------GI....P..LDT--YQGS-----------------------S......
M1MZH8_9CLOT/50-221-----PSDNT.-KNLCIKK-------------GI....E..VLP--I.FL-----------------------I......
RPIA_LACPL/51-219-----TSDRT.-AAQAKAL-------------GI....P..MKS--V.DE-----------------------V......
D3HMT7_LEGLN/47-211-----SSKAT.-EALLRQE-------------GI....P..VID--L.NS-----------------------V......
Q0C4A9_HYPNA/53-230-----TSNQT.-RELARSL-------------GV....P..LIP--F.EQ-----------------------V......
U9SW08_RHIID/55-228-----TSFQS.-RLLITEG-------------GL....N..LGD--I.DT-----------------------Y......
J3LWN1_ORYBR/36-221-----TSLKT.-EAHAARV-------------GI....P..MLP--L.GG-----------------------E......
Q4FT49_PSYA2/48-213-----SSQVT.-EDRLRAL-------------GI....E..IVD--L.NF-----------------------A......
R6B3B3_9CLOT/67-229-----TSYEI.-KMLCTYL-------------GI....P..TAT--LEEK-----------------------K......
E4NRI2_HALBP/54-223-----TSFAS.-RELAREE-------------GI....P..LVA--V.DE-----------------------V......
D0N1R6_PHYIT/55-229-----TSFQA.-KQLIVQH-------------KL....T..LSS--L.DE-----------------------N......
A7AMM8_BABBO/53-227-----TSVAT.-FRLMSEL-------------GI....P..SLE--F.DD-----------------------S......
R4K5G7_CLOPA/48-219-----PSFKT.-KLLCIEN-------------GL....E..VLH--T.FS-----------------------V......
A3CVB5_METMJ/49-220-----TSYQA.-AIRARRY-------------GI....P..LTS--L.DE-----------------------Y......
E6X8C9_CELAD/51-219-----TSEAT.-EKFALKN-------------GI....K..ILS--L.EE-----------------------V......
F4LL35_TREBD/63-237-----TSFQT.-TIACEQL-------------DI....P..VYS--L.NA-----------------------K......
F4B7Z8_ACIHW/47-219-----SSIDS.-EIELSKR-------------GF....S..VIS--LFSG-----------------------I......
G3ARG1_SPAPN/52-227-----TGFQS.-QQLIIDN-------------GL....R..LGT--I.EQ-----------------------F......
F8HYA4_WEIKK/48-216-----TSNRT.-AARGAEL-------------GM....K..IVD--V.DE-----------------------V......
F4BMW4_CARS1/47-216-----TSTRT.-KEQAEQL-------------GI....P..LKT--I.DE-----------------------V......
E3F3G7_KETVY/65-240-----TSERT.-AEQARAE-------------GI....D..VVT--L.QD-----------------------V......
A4YJ22_METS5/48-219-----SSTDT.-DLLASSK-------------GA....L..VLS--PFSG-----------------------V......
I1XM21_METNJ/57-227-----SSVIS.-RVKAEQA-------------GL....K..VMA--I.EH-----------------------L......
RPIA_BACAN/47-216-----TSKET.-EALAQQL-------------NI....P..LIS--L.ND-----------------------V......
RPIA_BORBU/52-221-----TSSDT.-KYLLSKE-------------QIPYESN..FSK--L.NK-----------------------N......
B9SKS7_RICCO/78-256-----TSKKT.-QKQALSL-------------GI....P..LSD--L.DS-----------------------H......
G2SRP4_LACRR/51-220-----TSIRT.-ANQAKSL-------------GI....P..LKS--V.DT-----------------------V......
RPIA_CAEEL/64-240-----TSFLT.-KQWLIES-------------GL....P..VSD--L.DS-----------------------H......
K0SNV8_THAOC/54-236-----TSIRT.-KEQAESL-------------GI....P..LVT--L.DT-----------------------H......
I6NDH1_ERECY/69-246-----TGFQS.-QELIISN-------------GL....R..LGS--I.EE-----------------------Y......
Q1H2B3_METFK/48-218-----SSVAS.-TIQAQTH-------------GL....P..LVA--L.EH-----------------------L......
RPIA_THISH/49-213-----SSEAS.-AQRLRGH-------------GI....Q..VMD--L.NT-----------------------A......
RPIA2_OCEIH/50-216-----ASKKS.-ERLATEL-------------GI....P..LTT--F.AT-----------------------Y......
G2KTC4_LACSM/362-530-----TSVGT.-EKLAEKL-------------GM....R..MLD--V.NT-----------------------I......
W8X9J3_CASDE/54-218-----SSERS.-TRRLRAA-------------GI....E..VLD--L.ND-----------------------V......
I0A1J3_FERFK/50-220-----SSFDS.-TLRLKQK-------------GA....K..VLS--I.DS-----------------------I......
K9Z869_CYAAP/56-224-----TSFQA.-EVLAKKY-------------GI....P..LTT--L.DA-----------------------V......
Q3IDN5_PSEHT/83-247-----SSEAS.-TARLKAL-------------GI....E..VFE--L.ND-----------------------V......
L0JQT2_NATP1/54-229-----TSFQS.-RQLALEV-------------GI....E..LTD--L.DA-----------------------V......
RPIA_ARCFU/50-221-----SSYQS.-YFAAIRN-------------GV....E..IVD--L.VE-----------------------F......
G7LZ92_9CLOT/50-221-----PSDNT.-KNLCIKY-------------GI....E..VIP--T.CF-----------------------V......
D8PA73_9BACT/59-229-----TSHDT.-AALARQS-------------GI....P..LIE--S.DN-----------------------A......
G0W6N5_NAUDC/71-248-----TGFQS.-KKLILDN-------------GL....Q..LSN--M.EL-----------------------Y......
G4SXW6_META2/48-217-----SSVVS.-AIKAGEM-------------GL....P..LQS--I.EQ-----------------------T......
RPIA_METCA/49-213-----SSQAS.-SERLKKI-------------GI....P..VLD--L.NA-----------------------A......
F7PF08_9EURY/53-222-----TSFQA.-REIAIEK-------------GI....D..LTT--L.DE-----------------------T......
RPIA_BARHE/50-224-----TSQYS.-EQLCHKF-------------GV....P..IST--L.EK-----------------------I......
D8LDV8_ECTSI/54-228-----TSIRT.-KEQAESL-------------DI....P..LVT--L.DT-----------------------H......
A0A023B5X1_GRENI/97-274-----TSQDT.-VTKARAE-------------GL....Q..VVE--V.QE-----------------------L......
R7L548_9CLOT/66-232-----TSYEM.-KVLCQDL-------------KI....P..TTS--ILSY-----------------------K......
A8Q7R0_MALGO/62-237-----TSFQA.-KNLIIER-------------NL....N..LGD--M.DT-----------------------G......
RPIA_LACAC/56-223-----TSNRS.-KKQLESL-------------GF....E..VSE--L.AD-----------------------I......
Q1AY26_RUBXD/56-224-----TSEYT.-AALAREC-------------GV....P..LVS--LSER-----------------------R......
G7LY74_9CLOT/48-219-----PSMKT.-QMLCIKN-------------GL....E..VLH--T.SS-----------------------V......
B0UBT0_METS4/49-223-----TSEAT.-HRAAQAA-------------GI....P..LTT--L.DE-----------------------T......
Q0SCN2_RHOSR/56-232-----TSTAT.-RDLALSV-------------GI....T..LVD--L.ND-----------------------L......
D3PRM8_MEIRD/53-219-----TSEAT.-ARLAQSQ-------------GI....P..LVE--LEAR-----------------------G......
G4RM57_THETK/46-222-----TSVDS.-ELKAAEV-------------GL....DKYLAP--L.WA-----------------------V......
C4Y2N7_CLAL4/69-244-----TGFQS.-KQLIIDN-------------GL....T..LGT--I.EQ-----------------------F......
Q0W3M2_UNCMA/58-226-----TSYST.-EALAIEC-------------GI....P..LTS--L.AA-----------------------S......
M9S9J2_9EURY/54-223-----TSQQT.-EDIAVEN-------------GI....E..VVD--I.ND-----------------------V......
S2JGP9_MUCC1/65-242-----TSFQT.-RQLILQS-------------NL....R..LGS--L.DS-----------------------Y......
RPIA_CUPNH/53-222-----SSEAS.-TRRLQQH-------------GF....K..VLD--L.NE-----------------------V......
RPIA_PICST/55-230-----TGFQS.-KQLIIDN-------------GL....K..LGA--I.EQ-----------------------F......
RPIA_MARAV/53-217-----SSEAT.-AERLKKH-------------GI....P..VYD--L.NA-----------------------V......
Q035R3_LACC3/44-210-----PSEVT.-LAYCQTL-------------GL....P..TTT--Q...-----------------------.......
Q2FLE9_METHJ/57-228-----TSIQT.-TMRAGAL-------------GI....P..LIG--L.EQ-----------------------A......
Q97ZD9_SULSO/48-216-----SSIDT.-EIELSKR-------------GF....K..VLS--LFSA-----------------------I......
RPIA_AROAE/49-213-----SSEAS.-ARRLQAH-------------GI....P..VLD--L.ND-----------------------I......
D5U1E6_THEAM/52-228-----SSFDT.-AIYLVNM-------------GY....SNIRDP--ITAR-----------------------S......
J0DZG3_LOALO/63-242-----SSFST.-RQWLIDS-------------GL....Q..VID--L.EN-----------------------T......
B9QKE6_TOXGO/54-249-----TSEAT.-RKQAESL-------------GI....P..LTT--L.DG-----------------------I......
RPIA_TOLAT/49-213-----SSEAS.-TARLQAL-------------GI....T..VVD--L.ND-----------------------V......
G0EH21_PYRF1/55-229-----TSLDT.-LLRLKSL-------------GA....S..SVS--LGVQ-----------------------T......
E9CB07_CAPO3/132-305-----TSFQA.-RQLIVEG-------------GL....V..LSD--L.SR-----------------------H......
K9SHM7_9CYAN/60-232-----TSFQA.-TVLGKQA-------------GI....P..IRS--L.DD-----------------------V......
A8A9K9_IGNH4/47-217-----TSYDT.-ALELKKH-------------GL....K..VLD--L...-----------------------.......
E5SB58_TRISP/33-210-----SSFQA.-MQLIINN-------------KL....P..LGD--L.QQ-----------------------C......
D9QGR4_BRESC/47-221-----TSEKT.-ADLAREL-------------GL....P..LTT--L.ED-----------------------V......
B9DLS8_STACT/50-220-----TSNKT.-ALIAKEL-------------GI....K..IVD--V.ND-----------------------V......
RPIA_ASHGO/71-248-----TGFQS.-RQLILDN-------------GL....R..LGS--I.EQ-----------------------Y......
RPIA_STRSY/49-217-----TSHAT.-AEHAASL-------------GI....P..LKN--I.DE-----------------------V......
RPIA_THET8/54-221-----TSRAT.-EELAKRE-------------GI....P..LVD--LPPE-----------------------G......
M5C6T3_THACB/108-284-----TGFQS.-KELIVKG-------------GL....K..LGD--V.DQ-----------------------Y......
Q018K0_OSTTA/92-274-----TSERT.-REQAESL-------------KI....P..LCT--L.NE-----------------------K......
M0Y9D9_HORVD/96-282-----SSVIC.-ASEAEKA-------------GI....K..VGS--HEEG-----------------------A......
F9ZVU0_METMM/51-220-----SSIKT.-TEHLQSI-------------GI....K..VLE--L.NQ-----------------------S......
T0UHY2_9STRE/43-211-----TSSQT.-TAQAEGL-------------GI....P..LKA--V.DD-----------------------I......
T1IW49_STRMM/51-225-----TSFQA.-HQLILEN-------------NL....Q..LTT--L.DQ-----------------------Y......
Q1D141_MYXXD/60-230-----TSRAT.-EALARSL-------------GV....P..VST--L.DA-----------------------H......
RPIA_PSEF5/53-217-----SSEAT.-AARLKGH-------------GI....P..VYE--L.NT-----------------------V......
M0TZ20_MUSAM/31-216-----TSVSS.-ASEAAKA-------------GI....P..LNN--YQEN-----------------------L......
I6SWV8_ENTHA/48-217-----TSNAT.-KEQAEKL-------------GI....P..LKS--I.DE-----------------------V......
RPIA_METAC/57-225-----TSYQS.-EMLAIEA-------------GI....R..LTT--L.AQ-----------------------H......
RPIA_RHOS4/56-231-----TSTRT.-AELARAL-------------GI....Q..VVT--L.DE-----------------------A......
R6M617_9BACE/67-231-----ASNEI.-SMTCIQL-------------NI....P..QTT--LWNK-----------------------R......
F2GCW9_ALTMD/49-213-----SSEAS.-TARLKAL-------------GI....E..VFA--L.NE-----------------------V......
X1X1C6_ACYPI/49-213-----SSEAS.-TEKLKAL-------------GI....H..VFD--L.NE-----------------------I......
D8LXP9_BLAHO/52-223-----TSIET.-DTHARSL-------------NI....P..MTD--I.DS-----------------------V......
C9A9E9_ENTCA/48-217-----TSWAS.-KKQAEGL-------------GI....P..IRT--I.DE-----------------------V......
W0JTR2_9EURY/54-238-----TSFQS.-RQLALEV-------------GI....P..LTS--L.DA-----------------------V......
K0IFH0_NITGG/62-228-----TSFQI.-KLEAECS-------------GL....K..LVG--E.NR-----------------------M......
E8SF16_STAPH/51-221-----TSERT.-ENQAKSL-------------NI....P..IAH--I.ND-----------------------V......
RPIA_POLSJ/62-234-----SSVAS.-TERLQAI-------------GI....K..VFD--A.TE-----------------------V......
F4PQH6_DICFS/53-227-----TSFQS.-TQLIIAA-------------GL....E..LSD--L.SR-----------------------T......
M9SAJ3_9EURY/47-210-----TSLQT.-ASYAQMH-------------GL....E..ISD--I.DQ-----------------------V......
G7MC82_9CLOT/47-215-----TSKGT.-EKLAKEL-------------KI....P..LVK--I.DE-----------------------I......
C5AQI6_METEA/50-225-----TSEAT.-RIACERE-------------GI....P..LAT--L.ED-----------------------L......
F9VGE3_LACGL/49-217-----TSNVT.-SQQAASL-------------NI....P..LKS--I.DE-----------------------V......
F8F3R8_TRECH/53-227-----TSFQT.-VIACEQW-------------GI....P..LYT--L.NS-----------------------K......
H9IUK6_BOMMO/52-227-----TSFQA.-KQLIIKH-------------GL....N..LGE--L.ET-----------------------N......
L0HHU8_METFS/55-226-----TSFQT.-AMRAREY-------------AI....P..LTT--L.DD-----------------------H......
I1YH59_METFJ/55-224-----SSVIS.-HNRAIKA-------------GL....S..VLS--I.NQ-----------------------L......
W0RDQ8_9BACT/54-222-----TSEAT.-ERQAAAL-------------GI....P..LST--L.DR-----------------------H......
C7P232_HALMD/53-220-----TSFQS.-RELAREA-------------GI....P..LTD--L.DA-----------------------A......
D7CXV5_TRURR/54-220-----TSEAT.-GALARSL-------------GI....P..VID--LPRG-----------------------G......
RPIA_RHISN/50-224-----TSERT.-ARLCLEL-------------GV....P..LKS--L.DE-----------------------L......
RPIA_CANGA/75-252-----TGYQS.-RNLIQDN-------------GL....I..LGS--I.EQ-----------------------H......
F3YU57_DESAF/56-226-----CSRRV.-EEEARRL-------------AI....P..LAT--L.DA-----------------------R......
RPIA_STRA5/49-217-----TSNRT.-TEQARGL-------------GI....P..LKS--A.DD-----------------------I......
B3MF62_DROAN/58-234-----SSYQA.-HHLILDY-------------NL....N..LGD--L.DR-----------------------N......
Q1LN72_RALME/49-213-----SSNAT.-TARLRGH-------------GI....R..VLE--A.GE-----------------------V......
E0VP73_PEDHC/118-294-----TSFQA.-EQLITEN-------------KL....N..LGS--L.SQ-----------------------Y......
G2I0N1_GLUMN/57-227-----TSERS.-AEQARSH-------------GI....R..LVT--F.AT-----------------------H......
K4B7U4_SOLLC/96-281-----TCVSS.-ASEAAKA-------------GI....P..LEQ--YDDS-----------------------L......
R7BZ16_9BURK/48-213-----SSERS.-RKKLEAL-------------GF....K..VID--L.NT-----------------------L......
B5IA06_ACIB4/51-219-----TSIAT.-EKLAKEM-------------GI....K..LGS--I.ND-----------------------Y......
RPIA_HALSA/52-219-----TSFES.-RRRAVDA-------------GV....T..VTS--L.EA-----------------------A......
C5DMD9_LACTC/92-269-----TGFQS.-KELILTN-------------GL....R..LGS--V.EQ-----------------------Y......
L0AA43_CALLD/51-220-----SSNST.-SLFLSSL-------------GL....E..TKE--F...-----------------------.......
D7A674_STAND/52-227-----TSEVT.-RAQAESL-------------NV....P..LGT--L.DE-----------------------H......
I3TCM9_THEC1/55-227-----SSIST.-ALLLRRE-------------GF....R..VLD--A.ST-----------------------V......
G0L9M6_ZOBGA/50-218-----SSNVT.-ARLAKQA-------------GI....S..LIS--L.ED-----------------------A......
RPIA_ROSDO/56-231-----TSTRT.-AELAREV-------------GI....D..IIT--L.DA-----------------------A......
M5DVR1_9GAMM/53-217-----SSEAS.-AQRLRDH-------------GI....H..VYD--L.NA-----------------------V......
W0EYB5_9SPHI/49-217-----TSEET.-KRLAMEL-------------SI....P..LID--I.NE-----------------------V......
E5AQX1_BURRH/75-245-----SSVAT.-TNRLLSH-------------GF....R..VFE--L.GD-----------------------V......
RPIA_CHLTR/62-231-----SSRIS.-QLLAEAV-------------GI....P..LSD--H.SL-----------------------L......
RPIA_STRGC/49-217-----TSSVT.-SQQAEGL-------------GI....P..LKS--I.DE-----------------------V......
S0EY17_CHTCT/49-220-----TSSRS.-REMAAEW-------------GI....P..LID--L.CE-----------------------V......
D5ALR5_RHOCB/56-231-----TSSRT.-ADLARQI-------------GI....S..VVG--L.DE-----------------------A......
C6VYP5_DYAFD/51-218-----TSEKT.-RALAESL-------------NI....P..LLS--I.EE-----------------------V......
RPIA_NITHX/50-225-----TSEAT.-RADAERC-------------GI....P..LTT--L.DD-----------------------L......
RPIA2_YERPE/53-229-----TSRAT.-SEVARDV-------------GI....E..LSD--P.NE-----------------------M......
D1CC48_THET1/51-220-----TSERT.-VAAAKAA-------------GV....E..LTT--L.EE-----------------------H......
T0V876_9STRE/49-217-----TSSVT.-YDQAESL-------------GI....P..LKS--I.DD-----------------------V......
RPIA_ENTFA/48-217-----TSKET.-EKQALAL-------------GI....P..LKS--I.DE-----------------------V......
RPIA_CHRVO/50-214-----SSEAS.-TARLKAH-------------HI....Q..VFD--L.NE-----------------------V......
RPIA_BLOFL/50-215-----SSQHS.-SNQLKKL-------------GI....P..LYN--L.NN-----------------------L......
A8NMB3_COPC7/98-275-----TGFQS.-RQLIVAA-------------GL....T..LGD--V.DQ-----------------------Y......
C4ZP88_THASP/49-213-----SSEAS.-TQRLRAH-------------GI....E..VFD--L.DG-----------------------I......
D3S1R9_FERPA/46-214-----TSYDT.-EILAVKN-------------GL....K..VSS--L.LE-----------------------H......
RPIA_MARMM/50-225-----TSQRT.-AQIAAEN-------------GV....P..LID--V.DH-----------------------V......
A8MCS2_CALMQ/49-224-----TSTET.-EYEIVKL-------------GL....GELLRY--P.WQ-----------------------V......
H1YW83_9EURY/51-222-----TSYQA.-MRRAREY-------------GI....P..LGT--L.DD-----------------------Y......
K0RC06_THAOC/94-276-----TSVRT.-KEQAESL-------------GI....P..LVT--L.DT-----------------------H......
A5FY01_ACICJ/53-221-----TSDLT.-AARAEFL-------------GL....R..LVP--L.DG-----------------------S......
U6IN39_HYMMI/82-258-----TSFQA.-LQLIKDA-------------NL....P..LTS--L.TD-----------------------H......
S0ANJ2_FERAC/51-213-----TSLRT.-ADLAKSY-------------GI....K..IE.--..NN-----------------------L......
A5K9L2_PLAVS/51-226-----TSIDT.-EIKARNL-------------GI....P..LTT--L.KK-----------------------N......
M4EY56_BRARP/82-268-----MSARS.-ASEAAKY-------------GV....P..LKH--FRDD-----------------------F......
W0BAQ9_9GAMM/47-211-----SSNAT.-ETRLRSL-------------GI....P..VID--L.NV-----------------------A......
J3TF98_9ENTR/49-213-----SSEAS.-SAKLKRL-------------GI....R..IFD--L.ND-----------------------V......
G2IZW6_PSEUL/50-214-----SSEAS.-TERLKAH-------------HI....P..VYD--L.NT-----------------------V......
RPIA_XYLFA/47-210-----SSEQS.-TAHLKQH-------------GI....E..VLE--L.NH-----------------------T......
G7V788_THELD/48-218-----CSKKM.-ELWAKEC-------------GV....P..STD--LDDR-----------------------G......
A2SQC5_METLZ/52-219-----TSNQT.-AMRAEEY-------------GI....P..LTT--L.SL-----------------------H......
C7PJG1_CHIPD/49-221-----SSFDT.-TALLHEK-------------GF....K..LVA--P...-----------------------.......
C5CXD5_VARPS/68-236-----SSVAS.-TERLRAL-------------GI....P..VFD--S.NE-----------------------V......
F8KWT0_PARAV/52-221-----SSERS.-ATLAREQ-------------KI....P..LLQ--T.DQ-----------------------V......
U5MRI4_CLOSA/54-225-----PSVKT.-KMICVEN-------------GV....E..VLH--T.CL-----------------------V......
I0AN47_IGNAJ/47-215-----TSNRT.-TKYANDF-------------GI....I..IHE--F.DS-----------------------V......
Q47A42_DECAR/63-227-----SSEAT.-RKRLEGH-------------GI....A..VYD--L.ND-----------------------V......
A9A2Y6_NITMS/51-216-----TSLQI.-KLIAEKV-------------GI....P..LIE--A.DQ-----------------------V......
I2FUT0_USTH4/82-257-----TGFQS.-RELIIDA-------------GL....R..LGD--V.DS-----------------------F......
F4BTP9_METCG/55-220-----TSFQA.-EQLAIES-------------NI....R..LTS--L.NQ-----------------------H......
RPIA_LACBA/51-220-----TSDRS.-AKQAESL-------------GI....T..IKE--L.DE-----------------------V......
G8PQ27_PSEUV/49-223-----ASSYS.-QALCDEL-------------GV....P..LTT--L.DE-----------------------T......
A9H338_GLUDA/56-227-----TSEHS.-AEQARAH-------------GI....T..LVT--F.AT-----------------------H......
D1C4M5_SPHTD/55-227-----TSLRS.-ERLARSL-------------GI....P..LID--LQDA-----------------------T......
W1NXJ9_AMBTC/82-258-----TSKQT.-LDQAVAL-------------GI....P..LSD--L.DD-----------------------H......
C6CYP4_PAESJ/48-216-----TSVQS.-EQLAKEL-------------GI....P..MMP--F.AD-----------------------V......
M1LTZ6_9PROT/54-218-----SSKAT.-EDLLLKN-------------NI....K..VFD--L.ND-----------------------L......
A7IKA7_XANP2/69-244-----TSEQT.-LSQAVSL-------------GV....P..IAT--L.DE-----------------------A......
RPIA_STRMK/47-210-----SSEQS.-TARLKQH-------------GI....E..VIE--L.NH-----------------------S......
G8QPQ4_AZOSU/53-217-----SSEAT.-AARLKGH-------------GI....P..VLD--L.ND-----------------------V......
RPIA_GLOVI/50-220-----TSERT.-ARQAEAE-------------GI....V..LGT--L.AE-----------------------Q......
RPIA_THICR/49-214-----SSEAT.-AERLKDH-------------GI....P..VME--L.NS-----------------------V......
L0PFR9_PNEJ8/65-240-----TGFQS.-RQLILDA-------------SL....S..LGD--V.DA-----------------------Y......
RPIA_FRATT/54-219-----SSEDS.-TRKLKAL-------------GF....D..VVD--L.NY-----------------------A......
L0EWH5_LIBCB/45-219-----TSKRT.-ESLCHHL-------------RI....P..LVS--M.DD-----------------------I......
W5JTH8_ANODA/99-275-----TSFQA.-RQLIIEN-------------GL....V..LGD--L.ES-----------------------N......
I0HZU4_CALAS/53-223-----TSTAT.-LREAMEL-------------GI....P..LLS--D.DL-----------------------P......
G4L3E1_TETHN/48-216-----TSTTS.-KKQAEEI-------------GV....P..IKS--I.DE-----------------------V......
M1MGW5_9CLOT/47-215-----TSRST.-ENLAKEL-------------HI....P..LVE--I.DE-----------------------V......
D4G7S8_RIEPU/49-213-----SSTSS.-TNKLKEI-------------GV....S..IID--S.ND-----------------------V......
RPIA_DEIRA/52-220-----TSEAS.-EKLAREV-------------GI....P..TEP--L.DP-----------------------R......
F9ZXG6_METMM/48-216-----SSIVS.-TLKAQQL-------------EL....K..LRG--I.EH-----------------------I......
D0MER0_RHOM4/56-228-----TSYAA.-EQLARAE-------------GI....P..LVT--L.AD-----------------------V......
RPIA_TREDE/58-234-----TSFQT.-SIECEKL-------------GI....P..IYS--L.SS-----------------------Q......
X6MIV2_RETFI/61-244-----TSFQS.-EELVLKS-------------RL....P..LGN--L.KE-----------------------D......
F4GMC6_PUSST/54-218-----SSERS.-SARMASL-------------GI....Q..VLD--L.NQ-----------------------V......
Q0BTU6_GRABC/50-222-----TSLRT.-AEQAQAG-------------GI....P..LTD--L.GA-----------------------H......
W6RAI3_9RHIZ/50-224-----TSERT.-ARLCLEL-------------GV....P..LKS--L.DE-----------------------L......
W1Q961_OGAPD/51-223-----TSFQA.-RELILSH-------------RL....H..LGR--V.DE-----------------------Y......
F7QLK3_9BRAD/51-226-----TSEAT.-RADAERC-------------GV....P..LTT--L.ED-----------------------V......
E8UAB6_DEIML/52-220-----TSEAS.-DALARAV-------------GI....T..VED--L.DP-----------------------R......
T2GAB9_DESGI/59-229-----CSMLV.-EREARAL-------------GI....P..LKQ--L.DD-----------------------V......
J7S9W0_KAZNA/74-251-----TGFQS.-QDLILKN-------------GL....Q..LSS--I.EQ-----------------------H......
M4CUR6_BRARP/74-251-----TSTTT.-HEQAVSL-------------GI....P..LSD--L.DS-----------------------H......
Q12XU6_METBU/57-225-----TSYQA.-EMLAIEA-------------GV....P..LTS--L.AE-----------------------H......
J3TZ31_9ENTR/49-213-----SSEES.-SIKLQKL-------------KI....P..LFD--L.NK-----------------------I......
RPIA_METTH/52-221-----TSYQS.-MFLAAES-------------GI....K..VTS--L.AE-----------------------H......
G7E8P3_MIXOS/323-499-----TGFQS.-KQLICQA-------------KL....K..LGD--V.DQ-----------------------F......
M4FG93_BRARP/93-269-----TSKRT.-EEQARSL-------------GI....P..LVA--L.DT-----------------------H......
G2KV06_LACSM/53-221-----TSKYT.-REHAERL-------------GI....M..MKN--V.DE-----------------------V......
C4XRS4_DESMR/57-226-----AARYM.-AQALRAA-------------GL....P..VAC--L.DD-----------------------F......
D8J531_HALJB/54-221-----TSYQS.-ADLAREV-------------GI....P..LTT--L.DD-----------------------A......
G8TEW3_NIAKG/51-220-----TSKKT.-AALAAQQ-------------NI....P..LAE--L.ND-----------------------V......
J1L527_9EURY/55-219-----TSYQS.-AIRARAA-------------GI....R..VAD--L.AD-----------------------Y......
G2SRV1_LACRR/44-202-----PSLET.-MEILNNL-------------NY....Q..IVA--L.DD-----------------------V......
U6EAE1_9EURY/63-232-----TSYQS.-FYLARDC-------------GI....P..LTT--L.DE-----------------------H......
Q31QQ3_SYNE7/62-233-----TSFQS.-SVLANEY-------------GI....P..LTT--L.NE-----------------------V......
H3ZMP8_THELN/50-221-----TSHQS.-RLLALES-------------GV....P..VVS--L.DE-----------------------V......
S6A8V6_9SPIO/62-238-----TSFQT.-SIECENL-------------GI....P..VYS--L.SS-----------------------K......
I2GY20_TETBL/77-255-----TGFQS.-KRLILDN-------------GL....N..FGV--V.EQ-----------------------Y......
F6BER2_METIK/49-218-----TSFEA.-RMLALQY-------------GV....P..LVS--L.DE-----------------------Y......
RPIA_SCHPO/61-236-----TGFQS.-KQLIVNN-------------GL....R..LGD--P.DC-----------------------Y......
K4M6Y4_9EURY/76-244-----TSYQS.-EMLAIEA-------------GI....T..LTT--L.AE-----------------------H......
C6XCW0_METGS/48-218-----SSTIS.-AIKAAEH-------------GL....P..LLD--I.SQ-----------------------L......
F9ZME5_ACICS/49-213-----SSLAT.-EARLKSL-------------GL....P..VLD--L.NA-----------------------T......
D3QZ19_CLOB3/64-256-----TSEAT.-AKLAAAR-------------HI....P..LLS--A.DA-----------------------V......
D3SEL8_THISK/49-213-----SSEAS.-AERLRGH-------------GI....E..VLD--L.NS-----------------------A......
E8RQ79_ASTEC/50-224-----TSNQT.-THLAQSL-------------GL....E..IKD--I.ND-----------------------V......
F2NWS5_TRES6/60-234-----TSFQT.-TLACEEL-------------GI....P..VYT--L.ND-----------------------R......
B6JUX1_SCHJY/63-238-----TGFQS.-KELIVSN-------------GL....R..LGD--P.DC-----------------------Y......
G8S1W4_ACTS5/66-231-----TSIEV.-ANACAAL-------------GL....R..TAT--LNEA-----------------------R......
M4NK33_9GAMM/49-211-----SSEQS.-TAQLKKL-------------GI....P..VLD--L.NA-----------------------T......
C6WWN6_METML/48-217-----SSAIS.-AHKAQSL-------------QL....P..IVA--L.EH-----------------------V......
RPIA_SPHAL/51-218-----TSQAT.-EALALRL-------------AV....P..LVP--F.QQ-----------------------L......
E8UD73_TAYEM/55-219-----SSVKS.-EELLTKF-------------GI....P..VVD--L.NM-----------------------R......
RPIA1_OCEIH/52-220-----SSNQT.-ATWAEEA-------------GI....P..LTD--F.SN-----------------------V......
D3SVA8_NATMM/69-244-----TSFQS.-RQLALEY-------------DI....P..LTT--L.DA-----------------------V......
A0B633_METTP/29-193-----TSYQS.-EALAIEC-------------GI....P..LTT--L.SQ-----------------------N......
I3ZAW8_TERRK/54-224-----SSQDS.-ENLARSL-------------GI....P..ITD--F.TK-----------------------H......
RPIA_PICTO/49-211-----TSKKS.-EELCRSF-------------NI....P.....--....-----------------------.......
RPIA_PARL1/50-225-----TSERT.-AKLAASL-------------GI....P..LTN--L.DD-----------------------T......
D5CP37_SIDLE/51-215-----SSEAS.-AKRLQGH-------------GI....E..VLS--L.ND-----------------------A......
R5TAR3_9CLOT/56-224-----TSEQT.-RSLASQL-------------NI....P..LLS--T.DT-----------------------A......
RPIA_SYNPW/54-226-----TSFQG.-EVLAAEL-------------GI....P..LRS--L.NA-----------------------V......
RPIA_NITEU/49-213-----SSEVT.-ANRLKQH-------------GI....E..VLD--L.NS-----------------------V......
RPIA_POLSQ/52-230-----SSNAT.-TERLLKH-------------GF....K..VLD--P.ND-----------------------V......
R5YZJ2_9FIRM/42-213-----PSEDT.-MNLCVKA-------------GI....E..VLP--L.EF-----------------------V......
RPIA_DICDI/49-225-----TSFQS.-TQLIVEA-------------GL....E..LSD--L.SR-----------------------T......
E7KIH3_YEASA/23-200-----TGFQS.-RNLILDN-------------KL....Q..LGS--I.EQ-----------------------Y......
E4U7T3_OCEP5/52-221-----TSRAT.-EALMRRV-------------GI....P..VVE--LDER-----------------------G......
M1A5R9_SOLTU/83-260-----TSSIT.-HEQAVSL-------------GI....P..LSD--L.NA-----------------------H......
H6NMT6_9BACL/47-215-----SSQHS.-EDLAREW-------------GI....P..LVA--F.DE-----------------------I......
RPIA_EXIS2/49-214-----TSNET.-VEQAKRL-------------NI....P..LLS--L.EE-----------------------A......
W1NX77_AMBTC/31-216-----MSVSA.-ASEAAKA-------------GI....P..LDN--HLDT-----------------------P......
F6QWW6_CIOIN/61-235-----TSFQA.-RELILKY-------------KL....S..LSD--L.DR-----------------------H......
J3LTE4_ORYBR/98-282-----SSTIS.-ATEAEKA-------------GI....Q..VSS--YKEG-----------------------T......
F2J5C1_POLGS/81-255-----TSERT.-ETLARSE-------------GI....Q..MTT--L.DH-----------------------L......
RPIA_PROMA/54-224-----TSFQG.-EVLASQL-------------GI....P..LRA--F.SA-----------------------V......
Q4XZ68_PLACH/43-218-----TSIDT.-EMKAKSL-------------GI....P..LTG--L.TK-----------------------N......
T0M835_9EURY/55-221-----TSIES.-SERARAA-------------GV....N..VEE--DYAG-----------------------N......
A7SX61_NEMVE/50-223-----TSFQA.-QQLITEN-------------KL....V..LSD--L.ER-----------------------N......
RPIA_COLP3/49-213-----SSEES.-TKRLKAH-------------GI....E..VFD--L.NS-----------------------V......
C3YIZ9_BRAFL/53-227-----TSFQS.-KQLLTEK-------------GL....A..VSD--L.ER-----------------------T......
I4Y6Z4_WALSC/89-265-----TGFQS.-KELIVKN-------------NL....V..LGD--V.DQ-----------------------Y......
D3E7P8_GEOS4/51-220-----TSDAS.-EKLAMEQ-------------GI....P..LTP--V.HQ-----------------------I......
RPIA_AERHH/49-213-----SSVAS.-TERLKGF-------------GI....T..VYD--L.NE-----------------------I......
F2NQH9_MARHT/52-220-----TSEAS.-ARLAREV-------------GI....P..LVE--LGPE-----------------------G......
Q97J55_CLOAB/50-221-----PSIKT.-RNTCIEN-------------GI....E..VLY--T.SS-----------------------V......
RPIA_BORPE/54-218-----SSERS.-AARLAGH-------------GL....A..VLD--L.ND-----------------------V......
F8L7D9_SIMNZ/50-220-----SSIRS.-FEQAQKG-------------GI....P..TAN--M.NT-----------------------V......
RPIA_LODEL/87-262-----TGFQS.-KQLIIDN-------------GL....K..LGQ--I.EQ-----------------------H......
RPIA_BUCAI/49-213-----SSNSS.-TVLLKKH-------------GI....E..VFD--L.KN-----------------------F......
A5WDJ0_PSYWF/48-213-----SSQVT.-QDKLEAL-------------GI....E..VMD--L.NY-----------------------V......
C5E421_ZYGRC/103-280-----TGYQS.-KQLIMDN-------------GL....T..YAI--L.EQ-----------------------H......
R6KAA0_9BACE/67-232-----ASAEI.-SMTCIQL-------------GI....P..QTT--LWNK-----------------------R......
RPIA_CRYNJ/105-288-----TGFQS.-KELIVKA-------------GL....T..LGD--V.DQ-----------------------Y......
R4I0M9_9ENTR/27-192-----SSDAS.-TAKLQSL-------------DI....R..VFD--S.NE-----------------------V......
F2KNC4_ARCVS/49-218-----SSYQS.-HILATNN-------------GI....K..VVD--L.IQ-----------------------Y......
RPIA_BIFAA/54-223-----TSRRT.-QEQAEGY-------------GI....K..IVN--I.DD-----------------------V......
Q2NFM0_METST/52-220-----TSYQS.-LIKAREA-------------GI....N..TTT--L.DE-----------------------Y......
A2BLS3_HYPBU/56-231-----SSFDT.-LLELRRL-------------GI....E..AYD--F.LP-----------------------R......
E1ZSN1_CHLVA/75-268-----ASDAA.-AGEAAFL-------------GV....P..LTT--LQEA-----------------------G......
X4ZZX6_9BACL/47-215-----TSRAS.-EQQAREL-------------GI....P..LVS--F.GE-----------------------I......
RPIA_NEIMB/50-214-----TSKKS.-GELLAQY-------------DI....P..VVS--L.NE-----------------------V......
I2GXY8_TETBL/82-259-----TGFQS.-IQLILDN-------------GL....Q..LGS--I.ER-----------------------N......
H2B0V5_KAZAF/71-248-----TGFQS.-RMLIKEN-------------GL....Q..LGS--I.EM-----------------------F......
F0XSQ4_GROCL/58-244-----TGDQS.-MALIEDA-------------GL....R..LSS--I.AQ-----------------------L......
K0IAH2_NITGG/43-211-----TSLQI.-KLEAERS-------------AL....R..LVG--E.ER-----------------------I......
G0GBX5_SPITZ/48-222-----TSFAS.-EMEAHRL-------------GI....P..VRS--L.ND-----------------------P......
Q2S577_SALRD/94-266-----TSFAT.-ERRARTH-------------GI....P..LTS--L.DD-----------------------T......
H1YDM0_9SPHI/67-233-----TSIEI.-SMFCAKL-------------GI....P..LTT--LFEN-----------------------K......
M9R6A5_9RHOB/107-282-----TSTRT.-AELARDV-------------GI....D..VIS--L.DE-----------------------A......
RPIA_MARMS/53-217-----SSEAS.-AERLKKH-------------GI....P..VYD--L.NS-----------------------V......
N0B2Z0_9RHIZ/50-225-----TSEAT.-RAQAAAL-------------GI....P..LGT--L.DQ-----------------------H......
H8GNV1_METAL/49-213-----SSVGT.-SERLKKV-------------GI....P..VLD--L.NE-----------------------V......
RPIA_SACD2/53-217-----SSEAS.-SEQLKGH-------------GI....P..VYD--L.NS-----------------------V......
I0HPM0_RUBGI/49-214-----SSVQS.-TERLRRH-------------GI....P..VVE--A.AA-----------------------L......
E3I3Z1_RHOVT/52-227-----TSEQT.-KRFAEER-------------GI....K..IAD--F.NT-----------------------I......
W8JFF3_9CHLA/57-226-----SSKDS.-YCLASSL-------------GI....P..IVN--D.EE-----------------------F......
B3S327_TRIAD/82-257-----TSFQA.-RQLIIEN-------------KL....T..LSD--L.ER-----------------------H......
E1V466_HALED/53-217-----SSEAT.-AERLRGH-------------GI....D..VFE--L.NE-----------------------T......
RPIA_LISMO/48-217-----TSEET.-NKQAQNL-------------GI....P..LKS--L.ND-----------------------V......
K0HYL3_9BURK/55-223-----SSVAS.-TERLKAL-------------GI....A..VFD--A.NE-----------------------V......
L0DB73_SINAD/52-222-----TSGAT.-EELARSL-------------AI....P..LRE--L.DE-----------------------V......
I1GB43_AMPQE/96-272-----TSFQA.-KELIISN-------------GL....V..LSN--L.ET-----------------------D......
F7WZV0_9ENTR/48-215-----SSTIS.-YNYLREL-------------NI....P..IIE--L.ND-----------------------L......
RPIA_AZOSB/49-213-----SSEAS.-SKRLAAH-------------GI....A..LLD--L.ND-----------------------V......
F0Y5F5_AURAN/53-236-----TSVRT.-KEQAEEL-------------GI....P..LTT--L.DE-----------------------F......
V2WV49_MONRO/117-294-----TGFQS.-KELIVQS-------------GL....T..LGD--V.DQ-----------------------Y......
F4NUT5_BATDJ/57-224-----TSFQA.-QQLILEA-------------GL....P..LV.--....-----------------------.......
I6ZP08_MELRP/52-241-----TSKKT.-EELAAGL-------------GI....P..LLS--L.NQ-----------------------LFKLRTK
RPIA_TERTT/53-217-----SSEAS.-ARQLEGH-------------GI....P..VYD--L.NE-----------------------V......
F6D5Q0_METSW/48-217-----TSYQS.-FFLAKES-------------GI....P..VTT--L.NE-----------------------H......
RPIA_THEAC/52-221-----TSRRT.-EDLAKQN-------------GI....E..VI.--..QG-----------------------T......
M9WWF3_PASHA/49-214-----ASKAS.-EQRLRDI-------------GI....E..VFS--A.NE-----------------------V......
K0KIV4_WICCF/89-265-----TGFQS.-KNLIVDN-------------GL....R..LGA--I.EQ-----------------------Y......
F5XWJ8_RAMTT/49-217-----SSEAS.-TQRLRAL-------------GI....R..VFD--A.NE-----------------------V......
F1P520_CHICK/51-225-----TSFQA.-RQLILQN-------------GL....T..LSD--L.DR-----------------------H......
Q8A699_BACTN/68-231-----ASQEI.-SMTCIQL-------------GI....P..QTT--LWDK-----------------------R......
RPIA_WIGBR/49-213-----SSRIS.-SSKLKDL-------------NI....P..LFD--L.NE-----------------------V......
RPIA_ACIAD/51-216-----SSEAT.-AKRLKEL-------------GI....E..VVD--M.NH-----------------------V......
RPIA_ALCBS/49-213-----SSEAT.-AERLKQH-------------GI....E..VFS--L.ND-----------------------V......
R7KJK7_9BURK/49-212-----SSVRS.-TNKLQAY-------------GF....K..VLD--L.NE-----------------------V......
D7DIR1_METV0/48-216-----SSTIS.-AITAQSL-------------NL....P..IVA--L.EQ-----------------------I......
RPIA_COXBU/49-213-----SSVAT.-ENRLKEH-------------RI....P..VVD--L.NS-----------------------V......
R6DID1_9BACE/67-232-----ASKEI.-SMTCIQL-------------GI....P..QTT--LWNK-----------------------R......
G8YN53_PICSO/70-246-----TGFQS.-KELIISN-------------GL....R..LGS--I.EQ-----------------------F......
RPIA_NITMU/49-213-----SSEAT.-ARRLSAH-------------GI....E..VMD--L.NN-----------------------V......
G8NWP6_GRAMM/50-220-----SSDAS.-HNLAASL-------------GM....D..ITT--L.DK-----------------------L......
Q2JK16_SYNJB/60-231-----TSERT.-AEQARSL-------------GI....P..LAT--L.EE-----------------------Q......
E4RMI9_HALHG/47-215-----TSKET.-AELALEE-------------GI....E..LIE--L.SQ-----------------------V......
RPIA_STRU0/49-217-----TSSAT.-TKQAESL-------------GI....P..LKA--V.DE-----------------------I......
M4YU37_9EURY/54-224-----TSNAS.-EDLAKEC-------------GI....T..TLD--L.ND-----------------------V......
E1SRT4_FERBD/49-213-----SSEAS.-TERLKAL-------------GI....E..VFD--M.NS-----------------------V......
G2TNQ6_BACCO/47-213-----TSRAT.-EKLAREC-------------GI....P..IAD--L.ND-----------------------T......
T0LJI5_9EURY/46-210-----TSLAS.-EKLARDV-------------GI....K..IVD--I.DS-----------------------V......
R4VWQ3_9EURY/50-228-----TSHQS.-REIALNV-------------GI....P..VVD--L.DQ-----------------------V......
D7BFY7_MEISD/53-219-----TSEAT.-ALLARDA-------------GI....E..LLE--LGPE-----------------------G......
A6LDT5_PARD8/67-229-----TSLEI.-RMTCAQL-------------GI....P..VTS--LFSH-----------------------K......
RPIA_BRADU/50-229-----TSEAT.-RLDATRC-------------GV....P..LTT--L.DE-----------------------I......
RPIA_PSYIN/49-213-----SSDES.-TARLQSY-------------GI....D..VFD--L.NE-----------------------V......
G4LWP8_SCHMA/56-232-----TSFQA.-RQLLINH-------------KL....P..VTE--L.DI-----------------------C......
D6YRJ4_WADCW/55-225-----TSQES.-ELQARLA-------------GI....P..IAD--L.DQ-----------------------L......
B3PGI3_CELJU/53-218-----SSDAS.-AQRLQTL-------------GI....E..VLD--C.NA-----------------------V......
RPIA_HALLT/54-234-----TSFAS.-RELAAEC-------------GI....P..LLD--L.DE-----------------------A......
G3B6X8_CANTC/51-227-----TGFQS.-KNLIIDN-------------GL....Q..LGS--I.EQ-----------------------Y......
X4ZKY5_9BACL/47-218-----PSVKT.-RLLCIEQ-------------GL....E..VLY--T.SA-----------------------V......
M7NVH6_PNEMU/63-238-----TGFQS.-RQLILDF-------------GL....Y..LGD--V.DA-----------------------Y......
T1G2H1_HELRO/34-210-----SSYQAL-RSLQSFE-------------SL....Q..IST--L.DR-----------------------N......
B8GFA6_METPE/54-225-----TSFQT.-AIRARGC-------------GI....P..LAT--L.ND-----------------------Y......
D5VCE7_MORCR/51-215-----SSQVT.-EDKLKAL-------------GI....E..IYD--L.NQ-----------------------L......
RPIA_AERPE/52-223-----SSFET.-AVELAGL-------------GW....S..VGD--.PRV-----------------------Y......
E3GWJ6_METFV/52-219-----TSYQS.-FLLAKNC-------------GI....P..LTT--L.EE-----------------------H......
RPIA_LEGPH/46-211-----SSKAT.-EALLRAE-------------GI....P..VID--L.NS-----------------------V......
M0SLL9_MUSAM/77-246-----TSEWA.-AARAASA-------------GI....P..LTD--L.NA-----------------------H......
E3KHK5_PUCGT/92-267-----TGFQS.-KELIVKA-------------GL....N..LGD--V.DQ-----------------------F......
F6I3G7_VITVI/31-214-----MSVAS.-ASEAAKV-------------GI....P..LGH--YQDC-----------------------S......
G8BV63_TETPH/74-250-----TGFQS.-RALILDN-------------GL....K..LGT--V.DN-----------------------Y......
RPIA_VANPO/73-250-----TGFQS.-RALILDN-------------GL....Q..LDS--I.DH-----------------------H......
Q5L9R3_BACFN/67-232-----ASMEI.-SMECVRL-------------GI....P..QTT--LWMC-----------------------R......
B8D3V9_DESK1/56-231-----SSHDT.-LLHLVSL-------------GL....NTAVDP--AGVD-----------------------D......
C1DG96_AZOVD/53-217-----SSEAT.-AARLRSH-------------GI....E..VHD--L.NS-----------------------I......
J0DD48_AURDE/58-235-----TGFQS.-KNLIVDA-------------GL....V..LGD--I.EQ-----------------------F......
F9UTV2_LACPL/44-213-----PSPTT.-RQLATVL-------------GY....T..VVD--T...-----------------------.......
D3EQA2_ATETH/54-222-----TSFQA.-EVLAKQY-------------NI....P..LST--L.DM-----------------------V......
E3EIW3_PAEPS/47-215-----TSQAS.-EDQARGL-------------GI....P..IIP--F.DQ-----------------------I......
B4RDL0_PHEZH/48-222-----TSQAT.-GELAASL-------------GI....R..IAE--L.GE-----------------------T......
E8R3Z4_ISOPI/46-223-----TSQRT.-EALARTL-------------GI....P..LIE--L.DE-----------------------V......
Q03Y20_LEUMM/48-216-----TSTIT.-SQRCAEL-------------NI....P..IVD--I.DA-----------------------I......
H8L3T4_FRAAD/49-212-----SSVQS.-TEHLHRL-------------QI....P..VLD--L.NA-----------------------C......
K1QVV1_CRAGI/53-228-----TSFQA.-NQLIQEH-------------RL....N..LGT--L.ET-----------------------C......
G0S4N8_CHATD/70-253-----TGSQS.-EELIEAA-------------GL....N..LQY--I.SK-----------------------L......
B9SV71_RICCO/31-216-----MSIAS.-ASEAAKA-------------GI....R..LDR--YQDG-----------------------S......
K8GIM2_9CYAN/57-226-----TSFQG.-EVLAREC-------------GI....P..LTT--L.DV-----------------------V......
F0YD86_AURAN/31-218-----TSDAT.-ARLLETL-------------KL....PTLRHD--S.DA-----------------------S......
RPIA_PARUW/56-226-----SSERS.-MRQARLV-------------GI....P..IVD--S.DT-----------------------I......
RPIA_PROMT/53-224-----TSFQG.-EVLASEL-------------GI....P..LKS--L.SS-----------------------V......
D8QJZ8_SCHCM/98-277-----TGFQS.-KALILNS-------------KL....N..LGD--V.EQ-----------------------F......
E0WTW1_9ENTR/49-211-----SSVAS.-TEKLTSL-------------GI....P..TID--C.NA-----------------------V......
I0DQJ4_PROSM/49-213-----SSEAS.-TAKLKSL-------------GI....P..VLD--C.ND-----------------------V......
C8WXS2_ALIAD/47-215-----TSRET.-ERLAREL-------------GI....P..LTD--F.RS-----------------------C......
Q057H5_BUCCC/48-211-----SSKKS.-EKLLKKI-------------NI....P..IYD--L.NS-----------------------I......
R7IB62_9BURK/49-212-----SSVRS.-TEHLERL-------------GF....K..VLD--P.NE-----------------------V......
RPIA_NATPD/54-221-----TSYQS.-RQLAREA-------------DI....P..LTT--L.EE-----------------------A......
RPIA_AGRVS/50-224-----TSERT.-ARLCLEL-------------GV....P..LMS--L.DE-----------------------L......
A9FJ44_SORC5/54-221-----TSERS.-EALARRE-------------NI....P..TVS--L.EE-----------------------V......
C4K7U6_HAMD5/49-213-----SSEDS.-TRKLNNI-------------GI....P..VLD--T.NE-----------------------V......
I3R125_HALMT/54-224-----TSFAS.-RELAREC-------------GI....P..LVD--L.DE-----------------------V......
E1RIV4_METP4/53-224-----TSFQA.-SMRAREY-------------GI....P..LSV--I.DE-----------------------Y......
E0TBP1_PARBH/47-221-----TSEET.-ARLAEAV-------------GI....S..LIT--P.DE-----------------------T......
A5UJW1_METS3/48-217-----TSFQS.-LLLAKQW-------------NI....P..VTS--L.EE-----------------------H......
Q4J990_SULAC/47-214-----SSIDT.-ELEISQR-------------GG....L..ILS--LYSG-----------------------I......
RPIA_NITOC/49-213-----SSEAS.-TARLKAL-------------NI....P..VYE--L.NA-----------------------V......
L0KVT8_METHD/75-244-----TSYQS.-EMLAIEA-------------GI....P..LTT--L.AE-----------------------H......
U4LD71_PYROM/74-243-----TSYQS.-LQLLLDN-------------NL....R..VSS--I.DH-----------------------V......
Q04HC0_OENOB/54-221-----TSIFT.-AQQAKSL-------------GI....K..IVD--L.DM-----------------------V......
C4WVS8_ACYPI/93-269-----TSYQA.-RQLIIDY-------------KL....T..LGN--L.DT-----------------------H......
RPIA_METMP/63-233-----TSFDS.-RMMASNS-------------GI....P..LIS--L.DQ-----------------------C......
A9TPW9_PHYPA/30-202-----TSYQS.-RVLSRQF-------------GV....K..TMD--L.ND-----------------------V......
W4X032_ATTCE/11-187-----TSFQS.-RQLILDN-------------HL....T..LGD--L.ET-----------------------H......
K0C3P7_CYCSP/48-212-----SSEAS.-TERLLAL-------------GI....P..VLD--L.NA-----------------------V......
B4KS42_DROMO/59-235-----SSFQA.-RQLILDH-------------NL....T..LGD--L.DR-----------------------N......
G7UTB3_PSEUP/49-212-----SSEQS.-TQRLKSH-------------GI....E..VLD--L.NY-----------------------A......
R6FYM5_9FIRM/44-214-----PSDDT.-AELCKNL-------------GL....M..VLS--L.EM-----------------------T......
RPIA_IDILO/51-215-----SSEAS.-TERLKSH-------------GI....E..VFE--L.NS-----------------------V......
B9H933_POPTR/302-473-----GNYQS.-RVLATQF-------------GV....T..VVD--L.SG-----------------------V......
E6N4F6_9ARCH/47-216-----ASWQS.-YYEAIEL-------------GL....M..VSS--L.DQ-----------------------H......
Q38UZ2_LACSS/51-220-----TSIRT.-AEQATSL-------------GI....P..VKA--L.NE-----------------------V......
G7WLJ5_METH6/55-219-----TSYQA.-QELAIAA-------------GI....P..LTS--L.DQ-----------------------D......
R6UYF7_9FIRM/64-231-----SSLAS.-KLLAQQA-------------GLCVVEP.....--..DV-----------------------I......
G0AB06_COLFT/70-238-----SSEAT.-AARLRAH-------------DI....E..VYD--L.NQ-----------------------V......
C8XJ99_NAKMY/47-205-----TSPRT.-ATAAGEL-------------GL....R..IVD--F.SE-----------------------V......
E3DMJ6_HALPG/47-216-----TSKET.-ADLALSE-------------GI....E..LID--L.AE-----------------------A......
D8IPP5_HERSS/49-217-----SSEAT.-AERLRSH-------------GI....T..VFD--L.NE-----------------------V......
F8DCN0_HALXS/54-229-----TSFQS.-RQLALEV-------------GI....P..LTD--L.DA-----------------------V......
RPIA_META3/58-228-----TSFES.-RMMAIQY-------------GI....P..LVS--L.DE-----------------------Y......
RPIA_ROSS1/52-222-----TSEVT.-AALAREL-------------GI....P..LTT--L.DR-----------------------Q......
C7RN75_ACCPU/49-213-----SSEAT.-RQRLASH-------------GI....A..VFD--L.DE-----------------------V......
RPIA_TREPA/69-245-----TSFQT.-ALICERY-------------NI....P..LFS--L.SS-----------------------K......

PF16957

G8NWE8_GRAMM/11-551-----QSLRV--AQLLEDG-------------VLEIGAIHTYVE--LYAR------------------------------
A4G553_HERAR/3-550-----QAVRL--ARLVATG-------------KINIGAIHTYLE--LFGR------------------------------
F2F9P2_SOLSS/9-549-----QSLRI--AQMIEDG-------------RLVLGDLHTYVE--LYGR------------------------------
R5PZQ8_9BURK/9-554-----QSLRI--AQLLEDG-------------QLEIGAIHTYVE--LYSR------------------------------
H0Q3G8_9RHOO/10-553-----QAGRL--ARLVESG-------------RITIGAIHTYLE--LFAR------------------------------
D7A7S5_STAND/12-556-----QGGAI--ARALKAG-------------KIELGAVHTYLE--LFSR------------------------------
A1T0S7_PSYIN/7-551-----QSVRI--SQMLEDG-------------ILEIGAVHTYVE--LYAR------------------------------
Q21AG5_RHOPB/6-554-----QAARV--AKFISEG-------------KIELGAIHTYLE--LFGR------------------------------
Q20XM1_RHOPB/13-552-----QSLRL--AQMLDDG-------------QIKVNSINTYVE--LSAR------------------------------
Q478I4_DECAR/8-554-----QGARL--AKLVQEQ-------------RIEIGAIHTYLE--LFGR------------------------------
D3FW15_BACPE/11-551-----QSLRI--AQMIEDG-------------QLKMGEIHTYVE--LYGR------------------------------
A4VRZ1_PSEU5/10-555-----QSLRI--SQLLEDG-------------LLEVGAIHTYIE--LYSR------------------------------
B2JLU6_BURP8/23-563-----QSLRV--AQLLEDG-------------QLEIGAIYTYVE--LYAR------------------------------
B6JFK2_OLICO/14-556-----QGVRI--SRLVKDG-------------QVKVGAIHTYLE--LYSR------------------------------
C5APL2_METEA/4-548-----QGARI--ARMLYGG-------------HIELGAVHTYLE--LFAR------------------------------
C9A847_ENTCA/7-547-----QSTRV--AQMIEDK-------------TMKLGDIHTYLE--LYGR------------------------------
D5DB08_BACMD/10-550-----QSLRV--SQMIEDE-------------TLKMGEIHTYLE--LYGR------------------------------
E0SJB1_DICD3/11-551-----QSLRI--SQLLEDG-------------ALEVGAIHTYIE--LYSR------------------------------
Q5ZSU0_LEGPH/3-548-----QSTRL--AIMIQRN-------------QVKIGNIHTYNE--LYAR------------------------------
Q63VB2_BURPS/4-548-----QSQRI--AKLLFGG-------------GIELGAVHTYLE--LFAR------------------------------
Q8P4U7_XANCP/4-548-----QAARL--AGLVSEG-------------RIEIGAIHTYLE--LFGR------------------------------
R7CR99_9FIRM/10-557-----QGKRL--AQMVQNG-------------GVELGAIHTYLE--MYSR------------------------------

PF01182

Q3SH15_THIDA/10-221-----DPEHLV-AALADAL-------------CA-------EAE--A--------------------------D------
B8HJV3_CYAP4/9-228-----DSATLI-QRGLEIT-------------LA-------CCQ--T--------------------------A------
6PGL1_ORYSJ/38-272-----SSDEMA-TDLAEYI-------------SQ-------VSE--I--------------------------S------
D0LNM1_HALO1/16-236-----SAEARA-QAMADDV-------------AE-------VLR--A--------------------------A------
B1XIZ0_SYNP2/9-227-----DKPELI-KRALRIV-------------MG-------RIE--E--------------------------A------
B4M2H3_DROVI/15-234-----TEAKLV-QSLCDVL-------------QR-------CAN--R--------------------------A------
B8GMY0_THISH/13-236-----DPEELA-ATVASEV-------------LD-------LAA--R--------------------------C------
A8KYS2_FRASN/18-247-----DAGVLA-RAAAARL-------------IT-------ALV--D--------------------------A------
Q5NMF8_ZYMMO/10-233-----NVEAMA-KQIADDI-------------EF-------IIK--Q--------------------------A------
C1EGM8_MICSR/42-262-----DEDQLA-KALCAEV-------------EE-------NAK--A--------------------------C------
C5B9U1_EDWI9/8-229-----SADALN-IHLAEAV-------------AE-------RLR--Q--------------------------G------
Q7NGI9_GLOVI/9-228-----DLESLS-LEAAQLF-------------EE-------AAH--A--------------------------A------
C7MSN0_SACVD/11-245-----DPEVLA-AAAAARL-------------VS-------TLA--D--------------------------I------
Q39SD7_GEOMG/6-227-----DREALS-MAAAELF-------------AT-------AAH--S--------------------------A------
A0L802_MAGSM/12-233-----SSEEAA-QVLAQSL-------------TQ-------AML--A--------------------------K------
Q7V1T4_PROMP/18-234-----DKLELS-SNVSNFI-------------EN-------QIV--Q--------------------------T------
C1D789_LARHH/8-223-----TATDAV-LAAARHL-------------LH-------LTE--Y--------------------------A------
A5FY02_ACICJ/12-233-----DAKAFA-EYGARLF-------------AE-------EAA--A--------------------------A------
Q3A631_PELCD/13-221-----DAAAVA-RNAADRI-------------LA-------AAS--E--------------------------A------
B0C6U0_ACAM1/9-229-----DPSQLI-ERALELT-------------LA-------EIK--D--------------------------A------
A1BIC7_CHLPD/11-265-----DDRELT-AIAAAVI-------------IS-------AAN--R--------------------------A------
D2Q4L4_KRIFD/10-274-----DPDGLA-HAVAARL-------------IT-------RLV--D--------------------------V------
D0LCU1_GORB4/9-234-----AKDELV-STAARRF-------------VD-------LVT--A--------------------------A------
A9WT44_RENSM/9-251-----SFDVLA-ATTAARI-------------IT-------KLL--D--------------------------T------
Q1AZZ4_RUBXD/7-229-----DPAALA-AAAAREF-------------AA-------RAA--H--------------------------A------
B8FL61_DESAA/16-238-----TPEDLA-AYAAEFF-------------LE-------CAS--S--------------------------G------
B4S4M1_PROA2/7-257-----SEKMVL-EKTAACI-------------IS-------KAL--Q--------------------------A------
A1SJQ5_NOCSJ/11-231-----DRAALA-TAVAGEL-------------LT-------RLA--D--------------------------A------
B3RVC2_TRIAD/8-226-----DKASLG-QDLCKYI-------------AE-------KSS--Q--------------------------A------
D0L091_HALNC/12-236-----TIDELV-AQCGHYV-------------QQ-------KLN--L--------------------------A------
D5URS5_TSUPD/12-243-----DAAALV-TAAADDV-------------AT-------VIA--Q--------------------------A------
Q1IWW4_DEIGD/7-212-----TPEATA-QAAAEAF-------------AQ-------AAR--E--------------------------A------
C3ZBQ0_BRAFL/569-794-----ESDKVI-TQLANDI-------------KD-------IAL--Q--------------------------T------
B1VDQ7_CORU7/27-269-----DQRGLA-AAAARDL-------------VR-------TVT--K--------------------------V------
Q2JHW7_SYNJB/10-224-----EGPVLI-QRAIEIW-------------QA-------RSA--A--------------------------A------
A2G0T4_TRIVA/480-702-----DAQELV-QSVTERL-------------TR-------LIV--D--------------------------T------
B2IE85_BEII9/11-231-----NAEDLT-ERVALWI-------------AN-------CVA--L--------------------------A------
A9UYD4_MONBE/167-386-----DKAGVG-QAAAKWL-------------CE-------QAE--A--------------------------A------
A1U1P6_MARAV/16-235-----NAGRVA-RALASTV-------------AD-------VLA--S--------------------------R------
A4S930_OSTLU/33-252-----TRDDLA-RALCLEV-------------EE-------NAR--G--------------------------C------
Q165T6_ROSDO/7-221-----DRDLAA-IGVADTL-------------AS-------GLK--K--------------------------A------
C6VSE7_DYAFD/7-229-----DTKALS-ASLAEWI-------------NN-------YIQ--Q--------------------------V------
B2GH88_KOCRD/13-243-----DEDLLA-AETARRA-------------LE-------VLE--A--------------------------A------
Q3SP94_NITWN/19-240-----DAEAIA-TEAAERI-------------IL-------RIT--E--------------------------N------
A1AR88_PELPD/9-231-----DEESLS-RAAAEIF-------------AL-------TAE--Q--------------------------A------
A6TTT0_ALKMQ/9-234-----TPQEVA-KKLGVYV-------------TA-------LAM--D--------------------------S------
Q31GB5_THICR/12-219-----SAELVA-QALAETL-------------LE-------LAE--K--------------------------A------
C5BV30_BEUC1/10-236-----DAETLA-EAVAARL-------------AL-------AIA--D--------------------------A------
Q89FE0_BRADU/14-235-----DAEALA-QAAAERV-------------MA-------RIG--A--------------------------N------
6PGL_DICDI/11-234-----EKERFE-DECVKFI-------------KN-------VIT--D--------------------------S------
E3D833_GARV3/17-261-----NQDILA-AVAAQK.-------------..-------.LV--T--------------------------L------
A0JWQ2_ARTS2/11-250-----DSSVLM-AAIAARL-------------IT-------KLV--D--------------------------V------
Q60CQ2_METCA/8-232-----DNTSLA-PALAAAV-------------AE-------DVR--A--------------------------A------
D3Q4S0_STANL/10-238-----DAEVLA-QSVAARL-------------AT-------TII--D--------------------------A------
B0T0C3_CAUSK/15-233-----SREALF-DAAASVL-------------AL-------ALT--D--------------------------G------
B9RWU5_RICCO/17-246-----TEEDLA-VSLAKYT-------------AD-------LSE--K--------------------------F------
Q0V513_PHANO/11-243-----GTSQLA-ASLRAYV-------------LD-------AQN--S--------------------------S------
A8LLP7_DINSH/7-222-----DRDMLM-MRLADRI-------------SA-------DLK--E--------------------------C------
C5E1Z3_LACTC/131-360-----DSAALS-RDLALYI-------------LA-------QQD--A--------------------------A------
Q6A7F7_PROAC/10-227-----SAQGLA-EGVAHRL-------------VQ-------TIV--R--------------------------I------
6PGL_RAT/13-237-----SPQELG-ASLAQLV-------------AQ-------RAA--S--------------------------C------
A3HVL3_9BACT/7-226-----SKTALA-EEFSYYL-------------KE-------