Sequence alignment for CL0246

PF01144

SCOA_XANCP/13-225-----------------------------------------------------------------------Y--------
GCTB_ACIFV/10-224-----------------------------------------------------------------------K--------
GCTA_ACIFV/4-241-----------------------------------------------------------------------V--------
Q9Y916_AERPE/14-262-----------------------------------------------------------------------T--------
SCOT_CAEEL/300-499-----------------------------------------------------------------------R--------
SCOB_HELPY/2-198-----------------------------------------------------------------------R--------
YODS_BACSU/7-219-----------------------------------------------------------------------A--------
Q9RZA0_DEIRA/23-234-----------------------------------------------------------------------V--------
ATOA_HAEIN/4-200-----------------------------------------------------------------------K--------
CTFA_CLOAB/5-216-----------------------------------------------------------------------I--------
CTFB_CLOAB/9-205-----------------------------------------------------------------------K--------
PCAI_ACIAD/6-219-----------------------------------------------------------------------A--------
SCOT1_HUMAN/43-272-----------------------------------------------------------------------Y--------
Q973S5_SULTO/3-202-----------------------------------------------------------------------I--------
Q9RZ86_DEIRA/5-217-----------------------------------------------------------------------Y--------
SCOA_BACSU/5-216-----------------------------------------------------------------------L--------
PCAJ_ACIAD/8-206-----------------------------------------------------------------------R--------
SCOT1_HUMAN/302-501-----------------------------------------------------------------------R--------
YDIF_ECOLI/15-253-----------------------------------------------------------------------V--------
SCOT_CAEEL/40-271-----------------------------------------------------------------------F--------
SCOB_BACSU/5-202-----------------------------------------------------------------------R--------
Q9XAM7_STRCO/5-234-----------------------------------------------------------------------V--------
Y1199_ARCFU/148-369-----------------------------------------------------------------------T--------
Q8PDH3_XANCP/7-217-----------------------------------------------------------------------N--------
Q8RGS9_FUSNN/11-226-----------------------------------------------------------------------K--------
SCOA_HELPY/5-216-----------------------------------------------------------------------I--------
ATOD_HAEIN/5-216-----------------------------------------------------------------------H--------
Q8F685_LEPIN/8-247-----------------------------------------------------------------------F--------
Q9W058_DROME/37-266-----------------------------------------------------------------------Y--------
Q97Z51_SULSO/6-206-----------------------------------------------------------------------V--------
ATOD_ECOLI/5-216-----------------------------------------------------------------------L--------
Q98EM4_RHILO/9-219-----------------------------------------------------------------------N--------
Q92TL1_RHIME/7-217-----------------------------------------------------------------------T--------
A5VGV2_SPHWW/10-217-----------------------------------------------------------------------.--------
A6M018_CLOB8/11-214-----------------------------------------------------------------------.--------
Y3551_MYCTU/6-233-----------------------------------------------------------------------.--------
SCOB_MYCTU/9-204-----------------------------------------------------------------------.--------
SCOA_MYCTU/6-233-----------------------------------------------------------------------.--------
Q88FX5_PSEPK/6-218-----------------------------------------------------------------------Y--------
S6BGT4_PSERE/8-217-----------------------------------------------------------------------.--------

PF00455

Q98FV5_RHILO/86-240------------------------------------------------------------------LAVEAK--------
A9CFA5_AGRFC/78-235------------------------------------------------------------------VNIDKK--------
A9CH78_AGRFC/78-237------------------------------------------------------------------SHATAK--------
Q98JJ0_RHILO/76-235------------------------------------------------------------------SHAAAK--------
Q8EUZ1_MYCPE/77-233------------------------------------------------------------------ENINQK--------
Q98AQ9_RHILO/74-232------------------------------------------------------------------SERAEK--------
Q8Y5F7_LISMO/74-230------------------------------------------------------------------KQSEQK--------
Q8Y9Y5_LISMO/74-233------------------------------------------------------------------ENHLEK--------
Q89SG7_BRADU/74-233------------------------------------------------------------------VAAEEK--------
Q98M65_RHILO/73-232------------------------------------------------------------------IAADEK--------
Q7VVL2_BORPE/74-233------------------------------------------------------------------LHAEGK--------
ACCR_AGRFC/77-237------------------------------------------------------------------WNRAEK--------
Q9X0F8_THEMA/73-233------------------------------------------------------------------INREAK--------
Q8EMN4_OCEIH/74-231------------------------------------------------------------------IVSDEK--------
Q8R736_CALS4/74-232------------------------------------------------------------------VELEAK--------
Q8ES05_OCEIH/74-231------------------------------------------------------------------KNVQHK--------
FRUR_BACSU/74-232------------------------------------------------------------------KNLHDK--------
Q8ESW8_OCEIH/75-233------------------------------------------------------------------MNVREK--------
Q986N7_RHILO/100-258------------------------------------------------------------------QATEEK--------
Q988Q4_RHILO/55-214------------------------------------------------------------------TRHRQK--------
A9CHG2_AGRFC/75-234------------------------------------------------------------------EDADRK--------
Q98GA9_RHILO/78-237------------------------------------------------------------------TMIEER--------
Q7D3J6_AGRFC/74-233------------------------------------------------------------------LFVGER--------
Q92UW3_RHIME/80-239------------------------------------------------------------------ENAAAK--------
Q98BY9_RHILO/73-232------------------------------------------------------------------ENADAK--------
Q986T2_RHILO/74-233------------------------------------------------------------------TNLDAK--------
Q9RZP5_DEIRA/82-243------------------------------------------------------------------VNHLGK--------
Q9K3L7_STRCO/73-239------------------------------------------------------------------RRASEK--------
Q9AD80_STRCO/62-221------------------------------------------------------------------LATAEK--------
Q5UXV7_HALMA/72-230------------------------------------------------------------------DNPSGK--------
Q5V513_HALMA/74-231------------------------------------------------------------------DHYAEK--------
Q5YVT8_NOCFA/75-235------------------------------------------------------------------THTAEK--------
YULB_BACSU/74-232------------------------------------------------------------------TNVIEK--------
LACR_STAA8/75-234------------------------------------------------------------------RQIAEK--------
ULAR_ECOLI/75-231------------------------------------------------------------------QNHDEK--------
AGAR_ECOLI/88-247------------------------------------------------------------------LNTAMK--------
DEOR_ECOLI/76-232------------------------------------------------------------------..VEEK--------
FUCR_ECOLI/75-233------------------------------------------------------------------SHYAHK--------
YIHW_ECOLI/78-237------------------------------------------------------------------SQTEEK--------
SGCR_ECOLI/79-236------------------------------------------------------------------.QSVAK--------
IOLR_BACSU/72-231------------------------------------------------------------------QHQDEK--------
YGBI_ECOLI/75-232------------------------------------------------------------------.AMTQK--------
YDJF_ECOLI/76-233------------------------------------------------------------------.FYEEK--------
GLCR_BACSU/75-231------------------------------------------------------------------.VSEEK--------
Q2G240_STAA8/76-232------------------------------------------------------------------TNLDEK--------
Q2YIQ5_BRUA2/76-232------------------------------------------------------------------..GEAK--------
Q2YIY1_BRUA2/81-239------------------------------------------------------------------RQSEEK--------
Q2YLA3_BRUA2/76-232------------------------------------------------------------------..HNEK--------
Q32AN5_SHIDS/73-232------------------------------------------------------------------TQTEEK--------
Q32CM1_SHIDS/74-232------------------------------------------------------------------.NTHKK--------
Q32GP8_SHIDS/68-227------------------------------------------------------------------SNYTLK--------
GLPR_PSEAE/74-231------------------------------------------------------------------.MRDEK--------
Q7CFX9_YERPE/75-232------------------------------------------------------------------..SEEK--------
Q7CGX6_YERPE/76-234------------------------------------------------------------------.NSGVK--------
Q7CHA9_YERPE/76-237------------------------------------------------------------------LNHELK--------
Q7CHG1_YERPE/76-235------------------------------------------------------------------KQVEEK--------
Q7CKA8_YERPE/91-249------------------------------------------------------------------EHPDTK--------
Q8DN15_STRR6/75-235------------------------------------------------------------------.STRQK--------
Q8DPP7_STRR6/78-234------------------------------------------------------------------.QTAEK--------
Q8DQ97_STRR6/74-227------------------------------------------------------------------KNLQEK--------
Q8DRC4_STRR6/83-243------------------------------------------------------------------INYEIK--------
Q8PDH7_XANCP/77-235------------------------------------------------------------------.QAREK--------
Q8R8Q0_CALS4/73-230------------------------------------------------------------------EHIEEK--------
Q8Y4U4_LISMO/74-229------------------------------------------------------------------KNIQSK--------
Q8YA06_LISMO/78-236------------------------------------------------------------------SNETSK--------
Q8YA14_LISMO/74-233------------------------------------------------------------------RNIEEK--------
Q928R7_LISMO/75-232------------------------------------------------------------------.RYEEK--------
Q97EY9_CLOAB/77-234------------------------------------------------------------------INAEGK--------
Q97F00_CLOAB/78-235------------------------------------------------------------------INIEQK--------
Q97F05_CLOAB/78-235------------------------------------------------------------------INIEQK--------
Q97J56_CLOAB/68-226------------------------------------------------------------------.KYEEK--------
Q97J82_CLOAB/75-231------------------------------------------------------------------ENKEAK--------
Q97MG7_CLOAB/76-233------------------------------------------------------------------..QVEK--------
Q97MS8_CLOAB/74-235------------------------------------------------------------------ANVKEK--------
Q9HT24_PSEAE/78-233------------------------------------------------------------------....YK--------
Q9I3M2_PSEAE/74-231------------------------------------------------------------------EHAQEK--------
Q9JYJ2_NEIMB/75-234------------------------------------------------------------------.CQNEK--------
Q9K3N4_STRCO/82-247------------------------------------------------------------------.EPTAK--------
Q9KL10_VIBCH/75-233------------------------------------------------------------------..QNEK--------
Q9KMS3_VIBCH/75-231------------------------------------------------------------------EHYEEK--------
Q9KRT3_VIBCH/76-234------------------------------------------------------------------.NLTAK--------
Q9KUM9_VIBCH/81-237------------------------------------------------------------------...VRK--------
Q9KYU7_STRCO/74-233------------------------------------------------------------------TAADEK--------
Q9S2D1_STRCO/76-233------------------------------------------------------------------..PDGK--------
Q9X9X5_STRCO/79-237------------------------------------------------------------------SHVPEK--------
Q9ZC48_YERPE/76-232------------------------------------------------------------------..SRQK--------

PF02550

O28424_ARCFU/3-199------------------------------------------------------------------YQKEYE--------
O29120_ARCFU/9-201------------------------------------------------------------------YREEYE--------
P73661_SYNY3/6-196------------------------------------------------------------------RQEQLA--------
ACH1_YEAST/12-230------------------------------------------------------------------RYAPYL--------
SCPC_ECOLI/1-213------------------------------------------------------------------METQWT--------

PF01008

EI2BD_MOUSE/219-510------------------------------------------------------------------LISGSN--------
R15PI_METJA/22-292------------------------------------------------------------------EIRGAG--------
EI2BB_YEAST/33-358------------------------------------------------------------------QVQGSY--------
MTNA_BACSU/49-337------------------------------------------------------------------KVRGAP--------
MTNA_ARCFU/41-327------------------------------------------------------------------AVRGAP--------
EI2BA_HUMAN/15-293------------------------------------------------------------------KEDPDM--------
MTNA_SYNY3/51-343------------------------------------------------------------------VVRGAP--------
MTNA_METTH/44-310------------------------------------------------------------------VVRGAP--------
MTNA_CAEEL/66-357------------------------------------------------------------------QVRGAP--------
EI2BA_CAEEL/15-293------------------------------------------------------------------ENDPSK--------
EI2BA_YEAST/15-292------------------------------------------------------------------EEDTEM--------
EI2BD_YEAST/285-637------------------------------------------------------------------KIVGSI--------
MTNA_METJA/48-319------------------------------------------------------------------VVRGAP--------
EI2BB_RABIT/27-333------------------------------------------------------------------GQRSSE--------
MTNA_YEAST/49-399------------------------------------------------------------------QVRGAP--------
EI2BD_SCHPO/156-452------------------------------------------------------------------KIFGSN--------
Q5V075_HALMA/195-460------------------------------------------------------------------RTHGSA--------
R15PI_ARCFU/15-284------------------------------------------------------------------EVRGAA--------

PF06026

B3MF62_DROAN/94-270------------------------------------------------------------------ICVPSS--------
B4KS42_DROMO/101-277------------------------------------------------------------------ICVPSS--------
RPIA_BURPS/53-222------------------------------------------------------------------.AVSSS--------
RPIA_METJA/51-220------------------------------------------------------------------FGIPTS--------
K4L1A8_SIMAS/53-215------------------------------------------------------------------.AVASS--------
D0KYM3_HALNC/50-214------------------------------------------------------------------.AVSSS--------
D5MHI2_9BACT/41-208------------------------------------------------------------------TAVSTS--------
G7M4M9_9CLOT/48-219------------------------------------------------------------------KIVTPS--------
V5UL52_9BURK/53-222------------------------------------------------------------------.AVSSS--------
RPIA_STAEQ/52-222------------------------------------------------------------------TGVCTS--------
RPIA_CHLAA/55-225------------------------------------------------------------------VGVPCA--------
E8WXH2_GRATM/47-217------------------------------------------------------------------RCVASS--------
RPIA_RHOPB/50-225------------------------------------------------------------------VGVPTS--------
H8MW96_CORCM/57-227------------------------------------------------------------------VGIPTS--------
RPIA_SHELP/49-213------------------------------------------------------------------.AVSSS--------
C6XGM4_LIBAP/50-224------------------------------------------------------------------QVIPSS--------
U5H8J3_USTV1/122-297------------------------------------------------------------------.FVPTG--------
N0BJC6_9EURY/47-217------------------------------------------------------------------WGVPSS--------
H0PXY1_9RHOO/49-213------------------------------------------------------------------.AVSSS--------
RPIA_RHILO/50-224------------------------------------------------------------------IGVPTS--------
I3UDK7_ADVKW/56-221------------------------------------------------------------------.AVASS--------
E4X352_OIKDI/53-229------------------------------------------------------------------TCVPSS--------
C7R992_KANKD/49-211------------------------------------------------------------------.AVSSS--------
K9ZYM6_DEIPD/53-221------------------------------------------------------------------IGVATS--------
RPIA_LEPCP/49-214------------------------------------------------------------------.AVSSS--------
A0RTM4_CENSY/52-220------------------------------------------------------------------TGVPTS--------
RPIA_HAEIN/49-214------------------------------------------------------------------.AVAAS--------
S2J2W4_MUCC1/53-230------------------------------------------------------------------VYVPTS--------
RPIA_LACRD/52-220------------------------------------------------------------------IGVTTS--------
RPIA_PHOPR/49-213------------------------------------------------------------------.AVSSS--------
G4RF46_PELHB/49-224------------------------------------------------------------------LCVPTS--------
A9V4I9_MONBE/88-261------------------------------------------------------------------ICIPTS--------
F2I5Y3_AERUA/48-215------------------------------------------------------------------KAVSSS--------
G2MHG7_9ARCH/54-222------------------------------------------------------------------RGIPTS--------
C6XK92_HIRBI/49-225------------------------------------------------------------------ICVSTS--------
C4R764_PICPG/66-245------------------------------------------------------------------VCIPTG--------
D3E2P7_METRM/49-218------------------------------------------------------------------MGIPTS--------
W8KJT3_HALHR/50-214------------------------------------------------------------------.TVASS--------
E0SPG1_IGNAA/58-230------------------------------------------------------------------.VIVSS--------
RPIA_HALWD/54-223------------------------------------------------------------------HGVPTS--------
T0N5R5_9EURY/50-215------------------------------------------------------------------TFVPTS--------
D2A0V2_TRICA/53-227------------------------------------------------------------------QCVPTS--------
R7ELE2_9BACE/67-233------------------------------------------------------------------EIIPAS--------
T0LRI8_9EURY/54-219------------------------------------------------------------------TFVSTS--------
A4YX18_BRASO/48-223------------------------------------------------------------------VGVPTS--------
W1Q6V8_OGAPD/53-229------------------------------------------------------------------VCVPTG--------
J7Q837_METSZ/64-239------------------------------------------------------------------VCVPTS--------
S5YAN5_PARAH/56-230------------------------------------------------------------------.CASTS--------
RPIA_RHOPA/50-225------------------------------------------------------------------IGVPTS--------
W0JVE5_9EURY/51-218------------------------------------------------------------------EGVPTS--------
RPIA_PEDPA/51-220------------------------------------------------------------------VGVPTS--------
S2JUJ5_MUCC1/54-231------------------------------------------------------------------TYVPTS--------
U3U6Y6_9ENTR/49-214------------------------------------------------------------------.AVSSS--------
RPIA_BAUCH/49-214------------------------------------------------------------------.VVSSS--------
K9SSM9_9SYNE/57-227------------------------------------------------------------------IGIPTS--------
D5EB20_METMS/56-224------------------------------------------------------------------RAVVTS--------
J9W6I1_LACBU/52-220------------------------------------------------------------------VGVPTS--------
G0VA31_NAUCC/62-239------------------------------------------------------------------VCIPTG--------
A1B891_PARDP/56-230------------------------------------------------------------------.CAATS--------
RPIA_DICNV/49-213------------------------------------------------------------------.IVAAS--------
K7SFG2_GLUOY/48-220------------------------------------------------------------------VGIPTS--------
C5M9K4_CANTT/70-245------------------------------------------------------------------ICIPTG--------
C7JF40_ACEP3/57-228------------------------------------------------------------------RAIPTS--------
RPIA_LACC3/51-220------------------------------------------------------------------TGVATS--------
A9SR64_PHYPA/70-245------------------------------------------------------------------VGVPTS--------
F3Y8A6_MELPT/48-218------------------------------------------------------------------TGVATS--------
D8RIH7_SELML/81-253------------------------------------------------------------------VGVASS--------
RPIA_STRMU/49-217------------------------------------------------------------------IGVTTS--------
Q2FVT0_STAA8/52-222------------------------------------------------------------------TGVCTS--------
E2BIQ5_HARSA/33-208------------------------------------------------------------------VCIPTS--------
RPIA_BACSK/48-216------------------------------------------------------------------QAVAAS--------
R9T971_9EURY/48-216------------------------------------------------------------------VGIPTS--------
RPIA_DEBHA/69-245------------------------------------------------------------------VCVPTG--------
E9G3C7_DAPPU/53-228------------------------------------------------------------------ICVPSS--------
M1XYN2_NATM8/55-227------------------------------------------------------------------.AIPTS--------
B7VHI7_VIBTL/94-259------------------------------------------------------------------HCVSSS--------
Q8I3W2_PLAF7/51-226------------------------------------------------------------------VCIPTS--------
A3DN78_STAMF/53-223------------------------------------------------------------------.VVVSS--------
K5XRW6_AGABU/63-240------------------------------------------------------------------VFIPTG--------
U5QS13_9CYAN/54-225------------------------------------------------------------------VGVPTS--------
E3NWK8_CAERE/55-230------------------------------------------------------------------.CTTTS--------
D7EAR3_METEZ/57-226------------------------------------------------------------------QAVVTS--------
R5EWG7_9GAMM/48-213------------------------------------------------------------------AAVSSS--------
A6X0Q4_OCHA4/51-225------------------------------------------------------------------IGVPTS--------
K4AIV0_SETIT/101-286------------------------------------------------------------------VAVTSS--------
D6S665_9LACO/56-223------------------------------------------------------------------.IVTTS--------
D3RQX1_ALLVD/48-212------------------------------------------------------------------.AVSSS--------
D5X4J8_THIK1/49-213------------------------------------------------------------------.AVSSS--------
R5VQ59_9PORP/67-230------------------------------------------------------------------TVIPAS--------
D1Z1V9_METPS/54-222------------------------------------------------------------------VGVPTS--------
A1RX06_THEPD/46-219------------------------------------------------------------------FFVSSS--------
Q4UBE3_THEAN/56-233------------------------------------------------------------------FGIPTS--------
V5WM65_9SPIO/65-247------------------------------------------------------------------VAVATS--------
D2RI11_ARCPA/48-216------------------------------------------------------------------YGVPSS--------
RPIA_PROMP/47-218------------------------------------------------------------------KGVPTS--------
B2IHK8_BEII9/53-228------------------------------------------------------------------LCVPTS--------
RPIA_OLICO/50-225------------------------------------------------------------------VGVPTS--------
RPIA_PICGU/64-240------------------------------------------------------------------VCISTG--------
K1VP09_TRIAC/61-234------------------------------------------------------------------..FPTG--------
I4YBK0_WALMC/145-321------------------------------------------------------------------.FIPTS--------
RPIA_CAUSK/47-220------------------------------------------------------------------RGVPTS--------
F6HTS6_VITVI/101-277------------------------------------------------------------------VGVPTS--------
M4DCW1_BRARP/79-256------------------------------------------------------------------VGIPTS--------
RPIA_METRJ/50-224------------------------------------------------------------------VGVPTS--------
B5Y3N7_PHATC/98-280------------------------------------------------------------------LAIPTS--------
H9UGB7_SPIAZ/58-234------------------------------------------------------------------LVVPTS--------
RPIA_THERP/50-221------------------------------------------------------------------IGVATS--------
RPIA_METPP/49-213------------------------------------------------------------------.AVSSS--------
L0I9N5_HALRX/54-222------------------------------------------------------------------HGVATS--------
X2H3T4_9NEIS/50-214------------------------------------------------------------------.AVSTS--------
D7DSD0_METV3/58-228------------------------------------------------------------------YGVPTS--------
T1HW83_RHOPR/84-259------------------------------------------------------------------VCVPTS--------
A9RL35_PHYPA/31-216------------------------------------------------------------------ICVPMS--------
V9VTU6_9RHOB/56-231------------------------------------------------------------------TAVPTS--------
Q4MZ63_THEPA/56-234------------------------------------------------------------------LGIPTS--------
RPIA_SODGM/49-213------------------------------------------------------------------.AVSSS--------
K9XKW8_9CHRO/57-227------------------------------------------------------------------VGIPTS--------
K5W1L5_PHACS/65-241------------------------------------------------------------------VFIPTG--------
RPIA_ALKEH/50-214------------------------------------------------------------------.TVSSS--------
E8UX17_TERSS/51-221------------------------------------------------------------------RGIASS--------
RPIA_KORCO/48-217------------------------------------------------------------------KVIPSS--------
U5T5D8_9GAMM/49-213------------------------------------------------------------------.AVAAS--------
RPIA_VIBPA/49-213------------------------------------------------------------------.AVSSS--------
E5SAM9_TRISP/143-319------------------------------------------------------------------VCIPTS--------
F2UBB3_SALR5/70-247------------------------------------------------------------------QCVPTS--------
E1QRN8_VULDI/53-227------------------------------------------------------------------LLVPTS--------
RPIA_BURXL/53-222------------------------------------------------------------------.AVSSS--------
C1CUX0_DEIDV/53-221------------------------------------------------------------------VGVATS--------
E1VFV9_9GAMM/49-213------------------------------------------------------------------.AVASS--------
D9Q2B6_ACIS3/51-222------------------------------------------------------------------.VVSSS--------
S6C126_9GAMM/49-213------------------------------------------------------------------.AVSSS--------
F6HFJ9_VITVI/87-263------------------------------------------------------------------VGIPTS--------
U1N8Y7_ASCSU/112-290------------------------------------------------------------------VCVPTS--------
Q8SR79_ENCCU/35-195------------------------------------------------------------------TYVPSS--------
RPIA_THEEB/55-223------------------------------------------------------------------VGVPTS--------
Q11IC0_CHESB/51-225------------------------------------------------------------------VGVPTS--------
A6LVZ7_CLOB8/47-215------------------------------------------------------------------KAVATS--------
B9I0V6_POPTR/93-277------------------------------------------------------------------VGVPMS--------
RPIA_LARHH/50-214------------------------------------------------------------------.AVASS--------
RPIA_DESAA/53-223------------------------------------------------------------------VGIPSS--------
RPIA_DINSH/56-231------------------------------------------------------------------TCVATS--------
R5PSN2_9BURK/55-218------------------------------------------------------------------.CVSSS--------
H8GLH3_METAL/47-217------------------------------------------------------------------KTIASS--------
K3Y9J6_SETIT/66-248------------------------------------------------------------------AGVPTS--------
RPIA_BUCBP/49-213------------------------------------------------------------------.AVSSS--------
U5N777_9BURK/52-220------------------------------------------------------------------.AVSTS--------
RPIA_METB6/55-226------------------------------------------------------------------VGVPTS--------
F9VP11_SULTO/46-214------------------------------------------------------------------IFVASS--------
RPIA_RHOFT/60-228------------------------------------------------------------------.AVSSS--------
D9S606_FIBSS/55-226------------------------------------------------------------------TGVSTS--------
A8I636_AZOC5/111-286------------------------------------------------------------------TGVPTS--------
R9SLS4_9EURY/48-217------------------------------------------------------------------MGIPTS--------
G8ZWF9_TORDC/75-252------------------------------------------------------------------VCVATG--------
R5JU55_9BACE/67-230------------------------------------------------------------------RVIPAS--------
E6U2Y3_ETHHY/42-213------------------------------------------------------------------RVVTPS--------
F7XM76_METZD/57-225------------------------------------------------------------------LAVPTS--------
RPIA_RUTMC/49-214------------------------------------------------------------------.AIASS--------
RPIA_YARLI/58-236------------------------------------------------------------------VFISTG--------
V5SCR1_9RHIZ/50-225------------------------------------------------------------------LCVPTS--------
G4QMA8_GLANF/49-213------------------------------------------------------------------.AVSSS--------
RPIA_THIDA/48-212------------------------------------------------------------------.TVASS--------
A8IRQ1_CHLRE/82-257------------------------------------------------------------------VGVPTS--------
Q8ZXY8_PYRAE/44-218------------------------------------------------------------------LLVATS--------
W8RXL1_9RHOB/56-231------------------------------------------------------------------TGVATS--------
R6UK51_9FIRM/42-213------------------------------------------------------------------QIVTPS--------
K8ENG0_CARML/47-216------------------------------------------------------------------TGVTTS--------
B8ELA7_METSB/53-228------------------------------------------------------------------LCVPTS--------
H3CYY4_TETNG/53-228------------------------------------------------------------------VCVPTS--------
F8J7J2_HYPSM/50-225------------------------------------------------------------------VCVPTS--------
U6B5B2_9RHIZ/50-224------------------------------------------------------------------EAVATS--------
RPIA_HALMA/53-220------------------------------------------------------------------VGVPTS--------
C7PIS1_CHIPD/51-219------------------------------------------------------------------RAVATS--------
I1MGA3_SOYBN/93-278------------------------------------------------------------------VGIPMS--------
M1MZH8_9CLOT/50-221------------------------------------------------------------------KVITPS--------
RPIA_LACPL/51-219------------------------------------------------------------------VGVSTS--------
D3HMT7_LEGLN/47-211------------------------------------------------------------------.CVASS--------
Q0C4A9_HYPNA/53-230------------------------------------------------------------------RCIETS--------
U9SW08_RHIID/55-228------------------------------------------------------------------.YIPTS--------
J3LWN1_ORYBR/36-221------------------------------------------------------------------GGVPTS--------
Q4FT49_PSYA2/48-213------------------------------------------------------------------.AVASS--------
R6B3B3_9CLOT/67-229------------------------------------------------------------------IAIPTS--------
E4NRI2_HALBP/54-223------------------------------------------------------------------RGVPTS--------
D0N1R6_PHYIT/55-229------------------------------------------------------------------KCIPTS--------
A7AMM8_BABBO/53-227------------------------------------------------------------------TAVATS--------
R4K5G7_CLOPA/48-219------------------------------------------------------------------KVVTPS--------
A3CVB5_METMJ/49-220------------------------------------------------------------------AGVPTS--------
E6X8C9_CELAD/51-219------------------------------------------------------------------YGVPTS--------
F4LL35_TREBD/63-237------------------------------------------------------------------KAVATS--------
F4B7Z8_ACIHW/47-219------------------------------------------------------------------.YIASS--------
G3ARG1_SPAPN/52-227------------------------------------------------------------------VCIPTG--------
F8HYA4_WEIKK/48-216------------------------------------------------------------------TGVTTS--------
E3F3G7_KETVY/65-240------------------------------------------------------------------RAVPTS--------
A4YJ22_METS5/48-219------------------------------------------------------------------.LVTSS--------
I1XM21_METNJ/57-227------------------------------------------------------------------QVVASS--------
RPIA_BACAN/47-216------------------------------------------------------------------QAVPTS--------
RPIA_BORBU/52-221------------------------------------------------------------------.FYTTS--------
B9SKS7_RICCO/78-256------------------------------------------------------------------VGIPTS--------
G2SRP4_LACRR/51-220------------------------------------------------------------------TGVTTS--------
RPIA_CAEEL/64-240------------------------------------------------------------------ICVPTS--------
K0SNV8_THAOC/54-236------------------------------------------------------------------VAIPTS--------
I6NDH1_ERECY/69-246------------------------------------------------------------------ICIPTG--------
Q1H2B3_METFK/48-218------------------------------------------------------------------TAAASS--------
RPIA_THISH/49-213------------------------------------------------------------------.TVASS--------
RPIA2_OCEIH/50-216------------------------------------------------------------------VGIPAS--------
G2KTC4_LACSM/362-530------------------------------------------------------------------QCVATS--------
W8X9J3_CASDE/54-218------------------------------------------------------------------.AVSSS--------
I0A1J3_FERFK/50-220------------------------------------------------------------------VFVTSS--------
K9Z869_CYAAP/56-224------------------------------------------------------------------VGVPTS--------
Q3IDN5_PSEHT/83-247------------------------------------------------------------------.AVSSS--------
L0JQT2_NATP1/54-229------------------------------------------------------------------RGVPTS--------
RPIA_ARCFU/50-221------------------------------------------------------------------YGIPSS--------
G7LZ92_9CLOT/50-221------------------------------------------------------------------KVVTPS--------
D8PA73_9BACT/59-229------------------------------------------------------------------HAVPTS--------
G0W6N5_NAUDC/71-248------------------------------------------------------------------ICIPTG--------
G4SXW6_META2/48-217------------------------------------------------------------------IVIASS--------
RPIA_METCA/49-213------------------------------------------------------------------.AVSSS--------
F7PF08_9EURY/53-222------------------------------------------------------------------VGVTTS--------
D8LDV8_ECTSI/54-228------------------------------------------------------------------VAIPTS--------
A0A023B5X1_GRENI/97-274------------------------------------------------------------------KFVCTS--------
R7L548_9CLOT/66-232------------------------------------------------------------------LAIPTS--------
A8Q7R0_MALGO/62-237------------------------------------------------------------------.FVPTS--------
RPIA_LACAC/56-223------------------------------------------------------------------.IVTTS--------
Q1AY26_RUBXD/56-224------------------------------------------------------------------RGVPTS--------
G7LY74_9CLOT/48-219------------------------------------------------------------------KVVTPS--------
B0UBT0_METS4/49-223------------------------------------------------------------------VGVPTS--------
Q0SCN2_RHOJR/56-232------------------------------------------------------------------VGVPTS--------
D3PRM8_MEIRD/53-219------------------------------------------------------------------VAVPTS--------
G4RM57_THETK/46-222------------------------------------------------------------------TLVSTS--------
C4Y2N7_CLAL4/69-244------------------------------------------------------------------VCIPTG--------
Q0W3M2_METAR/58-226------------------------------------------------------------------VGVPTS--------
M9S9J2_9EURY/54-223------------------------------------------------------------------KCVATS--------
S2JGP9_MUCC1/65-242------------------------------------------------------------------VCIPTS--------
RPIA_CUPNH/53-222------------------------------------------------------------------.AVSSS--------
RPIA_PICST/55-230------------------------------------------------------------------VCIPTG--------
RPIA_MARHV/53-217------------------------------------------------------------------.AVASS--------
Q035R3_LACC3/44-210------------------------------------------------------------------..CSPS--------
Q2FLE9_METHJ/57-228------------------------------------------------------------------VGIPTS--------
Q97ZD9_SULSO/48-216------------------------------------------------------------------.FVASS--------
RPIA_AROAE/49-213------------------------------------------------------------------.AVSSS--------
D5U1E6_THEAM/52-228------------------------------------------------------------------IIVPSS--------
J0DZG3_LOALO/63-242------------------------------------------------------------------ICVPSS--------
B9QKE6_TOXGO/54-249------------------------------------------------------------------LCVPTS--------
RPIA_TOLAT/49-213------------------------------------------------------------------.AVSSS--------
G0EH21_PYRF1/55-229------------------------------------------------------------------.FLATS--------
A0A0D2VTJ8_CAPO3/132-305------------------------------------------------------------------VCIPTS--------
K9SHM7_9CYAN/60-232------------------------------------------------------------------VGIPTS--------
A8A9K9_IGNH4/47-217------------------------------------------------------------------.TVPTS--------
E5SB58_TRISP/33-210------------------------------------------------------------------ICVPSS--------
D9QGR4_BRESC/47-221------------------------------------------------------------------RCVPTS--------
B9DLS8_STACT/50-220------------------------------------------------------------------TGVCTS--------
RPIA_ASHGO/71-248------------------------------------------------------------------ICIPTG--------
RPIA_STRSY/49-217------------------------------------------------------------------TGVTTS--------
RPIA_THET8/54-221------------------------------------------------------------------VGVPTS--------
M5C6T3_THACB/108-284------------------------------------------------------------------VFIPTG--------
M0Y9D9_HORVD/96-282------------------------------------------------------------------VGIPSS--------
F9ZVU0_METMM/51-220------------------------------------------------------------------.AVSSS--------
T0UHY2_9STRE/43-211------------------------------------------------------------------VGVTTS--------
T1IW49_STRMM/51-225------------------------------------------------------------------VCVPTS--------
Q1D141_MYXXD/60-230------------------------------------------------------------------VGVPTS--------
RPIA_PSEF5/53-217------------------------------------------------------------------.AVASS--------
M0TZ20_MUSAM/31-216------------------------------------------------------------------VGVPTS--------
I6SWV8_ENTHA/48-217------------------------------------------------------------------TGVTTS--------
RPIA_METAC/57-225------------------------------------------------------------------LGVVTS--------
RPIA_RHOS4/56-231------------------------------------------------------------------QGVPTS--------
R6M617_9BACE/67-231------------------------------------------------------------------EIIPAS--------
F2GCW9_ALTMD/49-213------------------------------------------------------------------.AVSSS--------
X1X1C6_ACYPI/49-213------------------------------------------------------------------.AVSSS--------
D8LXP9_BLAHO/52-223------------------------------------------------------------------VGVATS--------
C9A9E9_ENTCA/48-217------------------------------------------------------------------TGVPTS--------
W0JTR2_9EURY/54-238------------------------------------------------------------------RGIPTS--------
K0IFH0_NITGG/62-228------------------------------------------------------------------ECIPTS--------
E8SF16_STAPH/51-221------------------------------------------------------------------IGVCTS--------
RPIA_POLSJ/62-234------------------------------------------------------------------.AVSSS--------
F4PQH6_DICFS/53-227------------------------------------------------------------------TCVPTS--------
M9SAJ3_9EURY/47-210------------------------------------------------------------------KFVATS--------
G7MC82_9CLOT/47-215------------------------------------------------------------------KAVATS--------
C5AQI6_METEA/50-225------------------------------------------------------------------TGVPTS--------
F9VGE3_LACGL/49-217------------------------------------------------------------------VGVTTS--------
F8F3R8_TRECH/53-227------------------------------------------------------------------LAVPTS--------
H9IUK6_BOMMO/52-227------------------------------------------------------------------TCIPTS--------
L0HHU8_METFS/55-226------------------------------------------------------------------TGVPTS--------
I1YH59_METFJ/55-224------------------------------------------------------------------.VVASS--------
W0RDQ8_9BACT/54-222------------------------------------------------------------------VGVPTS--------
C7P232_HALMD/53-220------------------------------------------------------------------TGVPTS--------
D7CXV5_TRURR/54-220------------------------------------------------------------------..AVTS--------
RPIA_RHISN/50-224------------------------------------------------------------------QGVPTS--------
RPIA_CANGA/75-252------------------------------------------------------------------ICIPTG--------
F3YU57_DESAF/56-226------------------------------------------------------------------LGVPCS--------
RPIA_STRA5/49-217------------------------------------------------------------------VGVTTS--------
Q1LN72_CUPMC/49-213------------------------------------------------------------------.AVSSS--------
E0VP73_PEDHC/118-294------------------------------------------------------------------ICIPTS--------
K4B7U4_SOLLC/96-281------------------------------------------------------------------TAIPTC--------
R7BZ16_9BURK/48-213------------------------------------------------------------------ACVSSS--------
B5IA06_ACIB4/51-219------------------------------------------------------------------IGIPTS--------
RPIA_HALSA/52-219------------------------------------------------------------------SGVATS--------
C5DMD9_LACTC/92-269------------------------------------------------------------------ICIPTG--------
L0AA43_CALLD/51-220------------------------------------------------------------------.LISSS--------
D7A674_STAND/52-227------------------------------------------------------------------VGVPTS--------
I3TCM9_THEC1/55-227------------------------------------------------------------------LFVPSS--------
G0L9M6_ZOBGA/50-218------------------------------------------------------------------KGVPSS--------
RPIA_ROSDO/56-231------------------------------------------------------------------TGVPTS--------
M5DVR1_9GAMM/53-217------------------------------------------------------------------.AVASS--------
W0EYB5_9SPHI/49-217------------------------------------------------------------------KAIPTS--------
E5AQX1_BURRH/75-245------------------------------------------------------------------.AVSSS--------
RPIA_CHLTR/62-231------------------------------------------------------------------TAVASS--------
RPIA_STRGC/49-217------------------------------------------------------------------IAVTTS--------
S0EY17_CHTCT/49-220------------------------------------------------------------------RAVATS--------
D5ALR5_RHOCB/56-231------------------------------------------------------------------VGVPTS--------
C6VYP5_DYAFD/51-218------------------------------------------------------------------QGVPTS--------
RPIA_NITHX/50-225------------------------------------------------------------------VGVPTS--------
RPIA2_YERPE/53-229------------------------------------------------------------------TCTTTS--------
D1CC48_THET1/51-220------------------------------------------------------------------VGVPTS--------
T0V876_9STRE/49-217------------------------------------------------------------------TAVTTS--------
RPIA_ENTFA/48-217------------------------------------------------------------------VGVTTS--------
RPIA_CHRVO/50-214------------------------------------------------------------------.AVSSS--------
RPIA_BLOFL/50-215------------------------------------------------------------------.VVSSS--------
A8NMB3_COPC7/98-275------------------------------------------------------------------VFIPTG--------
C4ZP88_THASP/49-213------------------------------------------------------------------.AVSSS--------
D3S1R9_FERPA/46-214------------------------------------------------------------------EVIPTS--------
RPIA_MARMM/50-225------------------------------------------------------------------RGVPTS--------
A8MCS2_CALMQ/49-224------------------------------------------------------------------KLIATS--------
H1YW83_9EURY/51-222------------------------------------------------------------------VGVPTS--------
K0RC06_THAOC/94-276------------------------------------------------------------------VAIPTS--------
A5FY01_ACICJ/53-221------------------------------------------------------------------ECVATS--------
A0A068XPT4_HYMMI/82-258------------------------------------------------------------------QCVPTS--------
A5K9L2_PLAVS/51-226------------------------------------------------------------------VCIPTS--------
M4EY56_BRARP/82-268------------------------------------------------------------------VGVPMS--------
W0BAQ9_9GAMM/47-211------------------------------------------------------------------.CIASS--------
J3TF98_9ENTR/49-213------------------------------------------------------------------.AVSSS--------
G2IZW6_PSEUL/50-214------------------------------------------------------------------.AVSSS--------
RPIA_XYLFA/47-210------------------------------------------------------------------.AVSSS--------
G7V788_THELD/48-218------------------------------------------------------------------WTVPCS--------
A2SQC5_METLZ/52-219------------------------------------------------------------------FGVPTS--------
C7PJG1_CHIPD/49-221------------------------------------------------------------------.VTSSS--------
C5CXD5_VARPS/68-236------------------------------------------------------------------.AVSSS--------
F8KWT0_PARAV/52-221------------------------------------------------------------------QALASS--------
U5MRI4_CLOSA/54-225------------------------------------------------------------------KVVTPS--------
I0AN47_IGNAJ/47-215------------------------------------------------------------------TCVSTS--------
Q47A42_DECAR/63-227------------------------------------------------------------------.AVASS--------
A9A2Y6_NITMS/51-216------------------------------------------------------------------KGVPTS--------
I2FUT0_USTH4/82-257------------------------------------------------------------------.FVPTG--------
F4BTP9_METCG/55-220------------------------------------------------------------------CGVPTS--------
RPIA_LACBA/51-220------------------------------------------------------------------IGVATS--------
G8PQ27_PSEUV/49-223------------------------------------------------------------------IGVPAS--------
A9H338_GLUDA/56-227------------------------------------------------------------------VAIPTS--------
D1C4M5_SPHTD/55-227------------------------------------------------------------------VGVPTS--------
W1NXJ9_AMBTC/82-258------------------------------------------------------------------IGIPTS--------
C6CYP4_PAESJ/48-216------------------------------------------------------------------QAVATS--------
A7IKA7_XANP2/69-244------------------------------------------------------------------LGVPTS--------
RPIA_STRMK/47-210------------------------------------------------------------------.AVSSS--------
G8QPQ4_DECSP/53-217------------------------------------------------------------------.AVASS--------
RPIA_GLOVI/50-220------------------------------------------------------------------VGIPTS--------
RPIA_THICR/49-214------------------------------------------------------------------.AVASS--------
L0PFR9_PNEJ8/65-240------------------------------------------------------------------IFIPTG--------
RPIA_FRATT/54-219------------------------------------------------------------------TVVSSS--------
L0EWH5_LIBCB/45-219------------------------------------------------------------------KGVATS--------
W5JTH8_ANODA/99-275------------------------------------------------------------------VCIPTS--------
I0HZU4_CALAS/53-223------------------------------------------------------------------VGVATS--------
G4L3E1_TETHN/48-216------------------------------------------------------------------IGVPTS--------
M1MGW5_9CLOT/47-215------------------------------------------------------------------KAIATS--------
D4G7S8_RIEPU/49-213------------------------------------------------------------------.AVSSS--------
RPIA_DEIRA/52-220------------------------------------------------------------------VGVSTS--------
F9ZXG6_METMM/48-216------------------------------------------------------------------EVVASS--------
D0MER0_RHOM4/56-228------------------------------------------------------------------VGVPTS--------
RPIA_TREDE/58-234------------------------------------------------------------------YAVPTS--------
X6MIV2_RETFI/61-244------------------------------------------------------------------KCVATS--------
F4GMC6_PUSST/54-218------------------------------------------------------------------.AVSSS--------
Q0BTU6_GRABC/50-222------------------------------------------------------------------VGIPTS--------
W6RAI3_9RHIZ/50-224------------------------------------------------------------------EGVPTS--------
W1Q961_OGAPD/51-223------------------------------------------------------------------VCVPTS--------
F7QLK3_9BRAD/51-226------------------------------------------------------------------VGVPTS--------
E8UAB6_DEIML/52-220------------------------------------------------------------------TAVATS--------
T2GAB9_DESGI/59-229------------------------------------------------------------------TTVPCS--------
J7S9W0_KAZNA/74-251------------------------------------------------------------------VCIPTG--------
M4CUR6_BRARP/74-251------------------------------------------------------------------IGIPTS--------
Q12XU6_METBU/57-225------------------------------------------------------------------LAVVTS--------
J3TZ31_9ENTR/49-213------------------------------------------------------------------.AVSSS--------
RPIA_METTH/52-221------------------------------------------------------------------MGVPTS--------
M4FG93_BRARP/93-269------------------------------------------------------------------VGIPTS--------
G2KV06_LACSM/53-221------------------------------------------------------------------VGVPTS--------
C4XRS4_DESMR/57-226------------------------------------------------------------------.FVPAA--------
D8J531_HALJB/54-221------------------------------------------------------------------QGIPTS--------
G8TEW3_NIAKG/51-220------------------------------------------------------------------QAVPTS--------
J1L527_9EURY/55-219------------------------------------------------------------------VGVPTS--------
G2SRV1_LACRR/44-202------------------------------------------------------------------..TTPS--------
U6EAE1_9EURY/63-232------------------------------------------------------------------MGIPTS--------
Q31QQ3_SYNE7/62-233------------------------------------------------------------------QAVPTS--------
H3ZMP8_THELN/50-221------------------------------------------------------------------YGIPTS--------
S6A8V6_9SPIO/62-238------------------------------------------------------------------FAVPTS--------
I2GY20_TETBL/77-255------------------------------------------------------------------ICISTG--------
RPIA_SCHPO/61-236------------------------------------------------------------------VFIPTG--------
K4M6Y4_9EURY/76-244------------------------------------------------------------------IAVVTS--------
C6XCW0_METGS/48-218------------------------------------------------------------------TTVASS--------
F9ZME5_ACICS/49-213------------------------------------------------------------------.YVASS--------
D3QZ19_MAGIU/64-256------------------------------------------------------------------KAVATS--------
D3SEL8_THISK/49-213------------------------------------------------------------------.AVASS--------
E8RQ79_ASTEC/50-224------------------------------------------------------------------TLVSTS--------
F2NWS5_TRES6/60-234------------------------------------------------------------------KAVATS--------
B6JUX1_SCHJY/63-238------------------------------------------------------------------VFLPTG--------
G8S1W4_ACTS5/66-231------------------------------------------------------------------TAIPTS--------
M4NK33_9GAMM/49-211------------------------------------------------------------------.AVSSS--------
C6WWN6_METML/48-217------------------------------------------------------------------TTIASS--------
RPIA_SPHAL/51-218------------------------------------------------------------------TAVATS--------
E8UD73_TAYEM/55-219------------------------------------------------------------------.TVASS--------
RPIA1_OCEIH/52-220------------------------------------------------------------------EGIPSS--------
D3SVA8_NATMM/69-244------------------------------------------------------------------RAIPTS--------
A0B633_METTP/29-193------------------------------------------------------------------LAVPTS--------
I3ZAW8_TERRK/54-224------------------------------------------------------------------QGIASS--------
RPIA_PICTO/49-211------------------------------------------------------------------TGIPTS--------
RPIA_PARL1/50-225------------------------------------------------------------------VGVPTS--------
D5CP37_SIDLE/51-215------------------------------------------------------------------.AVASS--------
R5TAR3_9CLOT/56-224------------------------------------------------------------------HVLPTS--------
RPIA_SYNPW/54-226------------------------------------------------------------------VGVTTS--------
RPIA_NITEU/49-213------------------------------------------------------------------.AVASS--------
RPIA_POLSQ/52-230------------------------------------------------------------------.TVSSS--------
R5YZJ2_9FIRM/42-213------------------------------------------------------------------KAVTPS--------
RPIA_DICDI/49-225------------------------------------------------------------------ICVPTS--------
E7KIH3_YEASA/23-200------------------------------------------------------------------ICIPTG--------
E4U7T3_OCEP5/52-221------------------------------------------------------------------VGVPTS--------
M1A5R9_SOLTU/83-260------------------------------------------------------------------VGIPTS--------
H6NMT6_9BACL/47-215------------------------------------------------------------------RAVASS--------
RPIA_EXIS2/49-214------------------------------------------------------------------QGVATS--------
W1NX77_AMBTC/31-216------------------------------------------------------------------VGIPMS--------
F6QWW6_CIOIN/61-235------------------------------------------------------------------TCVPTS--------
J3LTE4_ORYBR/98-282------------------------------------------------------------------MGIPSS--------
F2J5C1_POLGS/81-255------------------------------------------------------------------VGVPTS--------
RPIA_PROMA/54-224------------------------------------------------------------------IGVPTS--------
Q4XZ68_PLACH/43-218------------------------------------------------------------------VCVPTS--------
T0M835_9EURY/55-221------------------------------------------------------------------RGVATS--------
A7SX61_NEMVE/50-223------------------------------------------------------------------VCVPTS--------
RPIA_COLP3/49-213------------------------------------------------------------------.AVSSS--------
C3YIZ9_BRAFL/53-227------------------------------------------------------------------VCVPTS--------
I4Y6Z4_WALMC/89-265------------------------------------------------------------------VFIPTG--------
D3E7P8_GEOS4/51-220------------------------------------------------------------------QAVATS--------
RPIA_AERHH/49-213------------------------------------------------------------------.AVSSS--------
F2NQH9_MARHT/52-220------------------------------------------------------------------RGVPTS--------
Q97J55_CLOAB/50-221------------------------------------------------------------------KVVTPS--------
RPIA_BORPE/54-218------------------------------------------------------------------.TVASS--------
F8L7D9_SIMNZ/50-220------------------------------------------------------------------TVVSSS--------
RPIA_LODEL/87-262------------------------------------------------------------------VCISTG--------
RPIA_BUCAI/49-213------------------------------------------------------------------.AVSSS--------
A5WDJ0_PSYWF/48-213------------------------------------------------------------------.AVASS--------
C5E421_ZYGRC/103-280------------------------------------------------------------------KCVATG--------
R6KAA0_9BACE/67-232------------------------------------------------------------------EVIPAS--------
RPIA_CRYNJ/105-288------------------------------------------------------------------.FLPTG--------
R4I0M9_9ENTR/27-192------------------------------------------------------------------.AVSSS--------
F2KNC4_ARCVS/49-218------------------------------------------------------------------YGVPSS--------
RPIA_BIFAA/54-223------------------------------------------------------------------TGVTTS--------
Q2NFM0_METST/52-220------------------------------------------------------------------LGIPTS--------
A2BLS3_HYPBU/56-231------------------------------------------------------------------.VYASS--------
E1ZSN1_CHLVA/75-268------------------------------------------------------------------RCVPAS--------
X4ZZX6_9BACL/47-215------------------------------------------------------------------TAVATS--------
RPIA_NEIMB/50-214------------------------------------------------------------------.AVSTS--------
I2GXY8_TETBL/82-259------------------------------------------------------------------ICIPTG--------
H2B0V5_KAZAF/71-248------------------------------------------------------------------ICIPTG--------
F0XSQ4_GROCL/58-244------------------------------------------------------------------TFYPTG--------
K0IAH2_NITGG/43-211------------------------------------------------------------------EFVPTS--------
G0GBX5_SPITZ/48-222------------------------------------------------------------------VGVATS--------
Q2S577_SALRD/94-266------------------------------------------------------------------QGVPTS--------
H1YDM0_9SPHI/67-233------------------------------------------------------------------KGIPTS--------
M9R6A5_9RHOB/107-282------------------------------------------------------------------KGVPTS--------
RPIA_MARMS/53-217------------------------------------------------------------------.TVASS--------
N0B2Z0_9RHIZ/50-225------------------------------------------------------------------VCVPTS--------
H8GNV1_METAL/49-213------------------------------------------------------------------.AVSSS--------
RPIA_SACD2/53-217------------------------------------------------------------------.AVSSS--------
I0HPM0_RUBGI/49-214------------------------------------------------------------------.AVSSS--------
E3I3Z1_RHOVT/52-227------------------------------------------------------------------TCVATS--------
B3S327_TRIAD/82-257------------------------------------------------------------------VCIPTS--------
E1V466_HALED/53-217------------------------------------------------------------------.AVASS--------
RPIA_LISMO/48-217------------------------------------------------------------------TGVATS--------
K0HYL3_9BURK/55-223------------------------------------------------------------------.AVSSS--------
L0DB73_SINAD/52-222------------------------------------------------------------------VGVPTS--------
I1GB43_AMPQE/96-272------------------------------------------------------------------RCVPTS--------
F7WZV0_9ENTR/48-215------------------------------------------------------------------GAVASS--------
RPIA_AZOSB/49-213------------------------------------------------------------------.AVSSS--------
F0Y5F5_AURAN/53-236------------------------------------------------------------------IAVPTS--------
V2WV49_MONRO/117-294------------------------------------------------------------------VFVPTG--------
F4NUT5_BATDJ/57-224------------------------------------------------------------------ACIATS--------
I6ZP08_MELRP/52-241------------------------------------------------------------------YGIPTS--------
RPIA_TERTT/53-217------------------------------------------------------------------.AVSSS--------
F6D5Q0_METPW/48-217------------------------------------------------------------------MGIPTS--------
RPIA_THEAC/52-221------------------------------------------------------------------RAVCTS--------
M9WWF3_MANHA/49-214------------------------------------------------------------------.AVAAS--------
K0KIV4_WICCF/89-265------------------------------------------------------------------ICIPTG--------
F5XWJ8_RAMTT/49-217------------------------------------------------------------------.AVSSS--------
F1P520_CHICK/51-225------------------------------------------------------------------VCIPTS--------
Q8A699_BACTN/68-231------------------------------------------------------------------.VIPAS--------
RPIA_WIGBR/49-213------------------------------------------------------------------.TVSSS--------
RPIA_ACIAD/51-216------------------------------------------------------------------.AVASS--------
RPIA_ALCBS/49-213------------------------------------------------------------------.TVASS--------
R7KJK7_9BURK/49-212------------------------------------------------------------------.CVSSS--------
D7DIR1_METV0/48-216------------------------------------------------------------------TTVASS--------
RPIA_COXBU/49-213------------------------------------------------------------------.AVASS--------
R6DID1_9BACE/67-232------------------------------------------------------------------EVIPAS--------
G8YN53_PICSO/70-246------------------------------------------------------------------TCIATG--------
RPIA_NITMU/49-213------------------------------------------------------------------.AVASS--------
G8NWP6_GRAMM/50-220------------------------------------------------------------------RCVASS--------
Q2JK16_SYNJB/60-231------------------------------------------------------------------IGVPTS--------
E4RMI9_HALHG/47-215------------------------------------------------------------------KAVPTS--------
RPIA_STRU0/49-217------------------------------------------------------------------VGVTTS--------
M4YU37_9EURY/54-224------------------------------------------------------------------KCVTTS--------
E1SRT4_FERBD/49-213------------------------------------------------------------------.AVSSS--------
G2TNQ6_BACCO/47-213------------------------------------------------------------------TGVPTS--------
T0LJI5_9EURY/46-210------------------------------------------------------------------VGVATS--------
R4VWQ3_9EURY/50-228------------------------------------------------------------------QGVPTS--------
D7BFY7_MEISD/53-219------------------------------------------------------------------RAVPTS--------
A6LDT5_PARD8/67-229------------------------------------------------------------------LAIPTS--------
RPIA_BRADU/50-229------------------------------------------------------------------IGVPTS--------
RPIA_PSYIN/49-213------------------------------------------------------------------.AVSSS--------
G4LWP8_SCHMA/56-232------------------------------------------------------------------QCIPTS--------
D6YRJ4_WADCW/55-225------------------------------------------------------------------AAVATS--------
B3PGI3_CELJU/53-218------------------------------------------------------------------AAVASS--------
RPIA_HALLT/54-234------------------------------------------------------------------RGVATS--------
G3B6X8_CANTC/51-227------------------------------------------------------------------VCIPTG--------
X4ZKY5_9BACL/47-218------------------------------------------------------------------KVVTPS--------
M7NVH6_PNEMU/63-238------------------------------------------------------------------IFIPTG--------
T1G2H1_HELRO/34-210------------------------------------------------------------------ICIPSS--------
B8GFA6_METPE/54-225------------------------------------------------------------------TGIPTS--------
D5VCE7_MORCR/51-215------------------------------------------------------------------.AVASS--------
RPIA_AERPE/52-223------------------------------------------------------------------VAVPSS--------
E3GWJ6_METFV/52-219------------------------------------------------------------------LGIPTS--------
RPIA_LEGPH/46-211------------------------------------------------------------------ACVASS--------
M0SLL9_MUSAM/77-246------------------------------------------------------------------VGIPTS--------
E3KHK5_PUCGT/92-267------------------------------------------------------------------.FIPTG--------
F6I3G7_VITVI/31-214------------------------------------------------------------------TGIPMS--------
G8BV63_TETPH/74-250------------------------------------------------------------------ICIPTG--------
RPIA_VANPO/73-250------------------------------------------------------------------VCIPTG--------
Q5L9R3_BACFN/67-232------------------------------------------------------------------TVIPAS--------
B8D3V9_DESK1/56-231------------------------------------------------------------------.LVPSS--------
C1DG96_AZOVD/53-217------------------------------------------------------------------.AVASS--------
J0DD48_AURST/58-235------------------------------------------------------------------VFIPTG--------
F9UTV2_LACPL/44-213------------------------------------------------------------------TVVTPS--------
D3EQA2_ATETH/54-222------------------------------------------------------------------VGIPTS--------
E3EIW3_PAEPS/47-215------------------------------------------------------------------QAVATS--------
B4RDL0_PHEZH/48-222------------------------------------------------------------------VGVPTS--------
E8R3Z4_ISOPI/46-223------------------------------------------------------------------RGVATS--------
Q03Y20_LEUMM/48-216------------------------------------------------------------------IGVTTS--------
H8L3T4_FRAAD/49-212------------------------------------------------------------------.AVSSS--------
K1QVV1_CRAGI/53-228------------------------------------------------------------------ICIPTS--------
G0S4N8_CHATD/70-253------------------------------------------------------------------.FYPTG--------
B9SV71_RICCO/31-216------------------------------------------------------------------VGIPMS--------
K8GIM2_9CYAN/57-226------------------------------------------------------------------QGITTS--------
F0YD86_AURAN/31-218------------------------------------------------------------------LCLPTS--------
RPIA_PARUW/56-226------------------------------------------------------------------TAIASS--------
RPIA_PROMT/53-224------------------------------------------------------------------VGVTTS--------
D8QJZ8_SCHCM/98-277------------------------------------------------------------------IFVPTG--------
E0WTW1_9ENTR/49-211------------------------------------------------------------------.AVSSS--------
I0DQJ4_PROSM/49-213------------------------------------------------------------------.AVSSS--------
C8WXS2_ALIAD/47-215------------------------------------------------------------------VAIPTS--------
Q057H5_BUCCC/48-211------------------------------------------------------------------.VVVSS--------
R7IB62_9BURK/49-212------------------------------------------------------------------.CVSSS--------
RPIA_NATPD/54-221------------------------------------------------------------------RGIPTS--------
RPIA_AGRVS/50-224------------------------------------------------------------------QGVPTS--------
A9FJ44_SORC5/54-221------------------------------------------------------------------KGVATS--------
C4K7U6_HAMD5/49-213------------------------------------------------------------------.AVSSS--------
E1RIV4_METP4/53-224------------------------------------------------------------------IGVPTS--------
E0TBP1_PARBH/47-221------------------------------------------------------------------.AIPTS--------
A5UJW1_METS3/48-217------------------------------------------------------------------MGIPTS--------
Q4J990_SULAC/47-214------------------------------------------------------------------.YIASS--------
RPIA_NITOC/49-213------------------------------------------------------------------.AVSSS--------
L0KVT8_METHD/75-244------------------------------------------------------------------LAVVTS--------
U4LD71_PYROM/74-243------------------------------------------------------------------TFIPTS--------
Q04HC0_OENOB/54-221------------------------------------------------------------------TGVATS--------
C4WVS8_ACYPI/93-269------------------------------------------------------------------VCVPTS--------
RPIA_METMP/63-233------------------------------------------------------------------YGVPTS--------
A9TPW9_PHYPA/30-202------------------------------------------------------------------QFVATS--------
W4X032_ATTCE/11-187------------------------------------------------------------------ICVPTS--------
K0C3P7_CYCSP/48-212------------------------------------------------------------------.AVSSS--------
G7UTB3_PSEUP/49-212------------------------------------------------------------------.AVSSS--------
R6FYM5_9FIRM/44-214------------------------------------------------------------------TVVTPS--------
RPIA_IDILO/51-215------------------------------------------------------------------.AVSSS--------
B9H933_POPTR/302-473------------------------------------------------------------------IAVGGN--------
E6N4F6_9ARCH/47-216------------------------------------------------------------------VIIPAS--------
Q38UZ2_LACSS/51-220------------------------------------------------------------------TCVCTS--------
G7WLJ5_METH6/55-219------------------------------------------------------------------LGVPTS--------
R6UYF7_9FIRM/64-231------------------------------------------------------------------QVVSSS--------
G0AB06_COLFT/70-238------------------------------------------------------------------.AVASS--------
C8XJ99_NAKMY/47-205------------------------------------------------------------------RCVATS--------
E3DMJ6_HALPG/47-216------------------------------------------------------------------KAVPTS--------
D8IPP5_HERSS/49-217------------------------------------------------------------------.AVASS--------
F8DCN0_HALXS/54-229------------------------------------------------------------------QGIPTS--------
RPIA_META3/58-228------------------------------------------------------------------FGVPTS--------
RPIA_ROSS1/52-222------------------------------------------------------------------TGVPTS--------
C7RN75_ACCPU/49-213------------------------------------------------------------------.AVASS--------
RPIA_TREPA/69-245------------------------------------------------------------------AAVPTS--------

PF04198

YJHU_ECOLI/63-323------------------------------------------------------------------VNVFGS--------
Q9WWA6_AGRRK/83-337------------------------------------------------------------------SPYVSS--------
Q9CKH2_PASMU/56-313------------------------------------------------------------------YHPIFT--------
Q98GB2_RHILO/49-296------------------------------------------------------------------D.LATP--------
Q9RT33_DEIRA/86-346------------------------------------------------------------------DPQGHP--------
Q986P9_RHILO/64-319------------------------------------------------------------------GEVSEC--------
Q97L54_CLOAB/89-338------------------------------------------------------------------REFKGL--------
Q9CGB1_LACLA/54-307------------------------------------------------------------------SPIERS--------
Q98CZ8_RHILO/62-317------------------------------------------------------------------HPIANC--------
Q9L0Z6_STRCO/89-343------------------------------------------------------------------VPAELD--------
Q99XS9_STRP1/56-314------------------------------------------------------------------DYDADL--------
Q9CLG2_PASMU/68-318------------------------------------------------------------------SRFTGC--------
LSRR_ECOLI/66-316------------------------------------------------------------------SRFEGC--------
Q9KER9_BACHD/57-313------------------------------------------------------------------DENIHT--------
DEOR_BACSU/56-311------------------------------------------------------------------DPFEDL--------
Q9KLX0_VIBCH/62-319------------------------------------------------------------------YHPVFS--------
CGGR_BACSU/89-338------------------------------------------------------------------KDVLGL--------
Q9K712_BACHD/89-338------------------------------------------------------------------KELLGL--------
Q986M3_RHILO/57-311------------------------------------------------------------------TQLFTD--------
Q98FV1_RHILO/42-296------------------------------------------------------------------SELSEI--------
A6TBJ1_KLEP7/59-311------------------------------------------------------------------HPVANC--------
A6TGS9_KLEP7/60-317------------------------------------------------------------------.DYNEN--------
D5AUX6_RHOCB/60-314------------------------------------------------------------------.KISAC--------
Q1GB28_LACDA/125-376------------------------------------------------------------------.RLFNA--------
Q2G033_STAA8/91-337------------------------------------------------------------------..YADD--------
Q2YIQ4_BRUA2/58-310------------------------------------------------------------------..ITEC--------
Q3J1R9_RHOS4/62-317------------------------------------------------------------------HRVSGC--------
Q8DRC3_STRR6/59-313------------------------------------------------------------------...TNM--------

PF16957

G8NWE8_GRAMM/11-551SWTTRRDEKARRMRAVQAW....MSGPVLPREKTIEALESVIVSGDRIVMEGDNQKQADFLSRSLVQVDAKK--------
A4G553_HERAR/3-550QWNLLSENRGKRIAR....G.LAITGRIADPGKIVALLEAVIESGDRVCLEGNNQKQANFLAGALCALDPAR--------
F2F9P2_SOLSS/9-549SWSTRLEGKKKRLAEVEHL....VKGVTIPTEKIVDVLELLIKPGDRVVLEGNNQKQASFLSQALVKVDPER--------
R5PZQ8_9BURK/9-554RWDVRRRAKHARLEGTRKAL..GLSGKVIPTNKIGMAIDTLVMPGDRVVLEGNNQKQADFLSRALVNVDSER--------
H0Q3G8_9RHOO/10-553AWDTRARNRARRLERAASL....ANGRNVAPENIVALLEAVIEPGDRLCVEGNNQKQADFLSRALTKTDPSR--------
D7A7S5_STAND/12-556TWDRTRQSREARLAAASAY....ARGKLVAADNVTKLLEAVVRPGDRVCLEGDNQKQADFLAASLAAVDPKI--------
A1T0S7_PSYIN/7-551NWATKKALKVERINSVQHI....SHGKVIPTEQMVAALECLLHIGDRVILEGNNQKQADFLARALEKVDSTK--------
Q21AG5_RHOPB/6-554KWDKLATDTRQRMEAAAKY...IGPGKQVKKEDTVALLKAVIRSFDRVNIEGNNQKQADYLADCLLQVDPKE--------
Q20XM1_RHOPB/13-552SWATRREGKQRRMALVSPW....MNGKFLPQKKIVEALETLLVPGDRVIIE.SVQKQADFLSRSLAKVNPKK--------
Q478I4_DECAR/8-554QWDSLRQNRARRLERAASLGLAGQNGKEIPVDRIIDLLEAVIQPGDRVCLEGNNQKQADFLSESLADCDPAR--------
D3FW15_BACPE/11-551SWTTKREAKARRLENIKKI....TTSKVIPTESIVEAMELVIQPHDRVVMEGNNQKQASFLSKSLSLVNPDK--------
A4VRZ1_PSEU5/10-555QWSRRRAEKARRLDQVQSL....ADGVVLPSERIVEALELLIAPGDRVVLEGNNQKQADFLSRSLAKADPGK--------
B2JLU6_BURP8/23-563SWTTKRDEKRRRLAAIEPW....LEDGILPANRIVDALETLICPGDRVALEGDNQKQADFLSRSLAKVNPQK--------
B6JFK2_OLICO/14-556.WTRLEQSYRGRMERGNAI....SGHKIVPHQDAVALMEAVIEPGDRVCIEGNNQKHADFLAAELARCSPER--------
C5APL2_METEA/4-548.WGRERAARDARIEAGRAH....AAGKIVTAANVVALLEAILQPDDRVCLEGDNQKQADCLARGLSQCDPAR--------
C9A847_ENTCA/7-547NWASKREKKAQTMKKIEHL....LDGKYVPTEAIIEVLEQLIRPGDKVVLEGDNQKQASFLSKSLEQVDAQK--------
E0SJB1_DICD3/11-551.WNTRRSEKQRRKASIA......VPGKVLPTEHLAAMLEKLIAPGDKVVLEGNNQKQADFLSRTLAEVDPQK--------
Q5ZSU0_LEGPH/3-548.WNKNLKDYESRLIKIKPF...FKKGKIVSEKNIVTLLETAIKPYDKVCLEGDNQKQADFLARCLCSVNPQK--------
Q63VB2_BURPS/4-548.WNEARAARAARLAAAAPL....ARGKRVAARDATALLEAVLRPGERVCIEGDNQKQADLLAAALAAVDSAK--------
Q8P4U7_XANCP/4-548QWDTQAESRRQRLQRAAAL...APRGRVVAADDVVALLEAVIEPGDRVCLEGNNQKQADFLARCLTEVDPTR--------
R7CR99_9FIRM/10-557NWNTRGEDTAARLKDGSAY....AKGKIVAAEDTVKLLEAVLRPGDKVNIEGDNQKQADFLAKQLCEVDPTK--------

PF01182

Q3SH15_THIDA/10-221------------------------------------------------------------------PDPEHL--------
B8HJV3_CYAP4/9-228------------------------------------------------------------------PDSATL--------
6PGL1_ORYSJ/38-272------------------------------------------------------------------ESSDEM--------
D0LNM1_HALO1/16-236------------------------------------------------------------------ESAEAR--------
B1XIZ0_SYNP2/9-227------------------------------------------------------------------DDKPEL--------
B4M2H3_DROVI/15-234------------------------------------------------------------------ETEAKL--------
B8GMY0_THISH/13-236------------------------------------------------------------------PDPEEL--------
A8KYS2_FRASN/18-247------------------------------------------------------------------ADAGVL--------
Q5NMF8_ZYMMO/10-233------------------------------------------------------------------ENVEAM--------
C1EGM8_MICSR/42-262------------------------------------------------------------------DDEDQL--------
C5B9U1_EDWI9/8-229------------------------------------------------------------------GSADAL--------
Q7NGI9_GLOVI/9-228------------------------------------------------------------------PDLESL--------
C7MSN0_SACVD/11-245------------------------------------------------------------------PDPEVL--------
Q39SD7_GEOMG/6-227------------------------------------------------------------------LDREAL--------
A0L802_MAGMM/12-233------------------------------------------------------------------SSSEEA--------
Q7V1T4_PROMP/18-234------------------------------------------------------------------KDKLEL--------
C1D789_LARHH/8-223------------------------------------------------------------------DTATDA--------
A5FY02_ACICJ/12-233------------------------------------------------------------------PDAKAF--------
Q3A631_PELCD/13-221------------------------------------------------------------------ADAAAV--------
B0C6U0_ACAM1/9-229------------------------------------------------------------------ADPSQL--------
A1BIC7_CHLPD/11-265------------------------------------------------------------------GDDREL--------
D2Q4L4_KRIFD/10-274------------------------------------------------------------------RDPDGL--------
D0LCU1_GORB4/9-234------------------------------------------------------------------DAKDEL--------
A9WT44_RENSM/9-251------------------------------------------------------------------PSFDVL--------
Q1AZZ4_RUBXD/7-229------------------------------------------------------------------EDPAAL--------
B8FL61_DESAA/16-238------------------------------------------------------------------ETPEDL--------
B4S4M1_PROA2/7-257------------------------------------------------------------------GSEKMV--------
A1SJQ5_NOCSJ/11-231------------------------------------------------------------------PDRAAL--------
B3RVC2_TRIAD/8-226------------------------------------------------------------------EDKASL--------
D0L091_HALNC/12-236------------------------------------------------------------------ATIDEL--------
D5URS5_TSUPD/12-243------------------------------------------------------------------DDAAAL--------
Q1IWW4_DEIGD/7-212------------------------------------------------------------------PTPEAT--------
C3ZBQ0_BRAFL/569-794------------------------------------------------------------------GESDKV--------
B1VDQ7_CORU7/27-269------------------------------------------------------------------ADQRGL--------
Q2JHW7_SYNJB/10-224------------------------------------------------------------------PEGPVL--------
A2G0T4_TRIVA/480-702------------------------------------------------------------------RDAQEL--------
B2IE85_BEII9/11-231------------------------------------------------------------------LNAEDL--------
A9UYD4_MONBE/167-386------------------------------------------------------------------NDKAGV--------
A1U1P6_MARHV/16-235------------------------------------------------------------------DNAGRV--------
A4S930_OSTLU/33-252------------------------------------------------------------------DTRDDL--------
Q165T6_ROSDO/7-221------------------------------------------------------------------IDRDLA--------
C6VSE7_DYAFD/7-229------------------------------------------------------------------KDTKAL--------
B2GH88_KOCRD/13-243------------------------------------------------------------------ADEDLL--------
Q3SP94_NITWN/19-240------------------------------------------------------------------PDAEAI--------
A1AR88_PELPD/9-231------------------------------------------------------------------NDEESL--------
A6TTT0_ALKMQ/9-234------------------------------------------------------------------GTPQEV--------
Q31GB5_THICR/12-219------------------------------------------------------------------ESAELV--------
C5BV30_BEUC1/10-236------------------------------------------------------------------PDAETL--------
Q89FE0_BRADU/14-235------------------------------------------------------------------ADAEAL--------
6PGL_DICDI/11-234------------------------------------------------------------------IEKERF--------
E3D833_GARV3/17-261------------------------------------------------------------------DNQDIL--------
A0JWQ2_ARTS2/11-250------------------------------------------------------------------PDSSVL--------
Q60CQ2_METCA/8-232------------------------------------------------------------------DDNTSL--------
D3Q4S0_STANL/10-238------------------------------------------------------------------PDAEVL--------
B0T0C3_CAUSK/15-233------------------------------------------------------------------PSREAL--------
B9RWU5_RICCO/17-246------------------------------------------------------------------DTEEDL--------
Q0V513_PHANO/11-243------------------------------------------------------------------EGTSQL--------
A8LLP7_DINSH/7-222------------------------------------------------------------------PDRDML--------
C5E1Z3_LACTC/131-360------------------------------------------------------------------DDSAAL--------
Q6A7F7_PROAC/10-227------------------------------------------------------------------QSAQGL--------
6PGL_RAT/13-237------------------------------------------------------------------SSPQEL--------
A3HVL3_9BACT/7-226------------------------------------------------------------------SSKTAL--------
Q482L5_COLP3/8-229------------------------------------------------------------------NARNDL--------
Q602U1_METCA/13-226------------------------------------------------------------------PTAEDF--------
A7RMK1_NEMVE/10-232------------------------------------------------------------------SSEVDL--------
A8Y0B4_CAEBR/9-229------------------------------------------------------------------GDDVEM--------
C1MQ42_MICPC/10-239------------------------------------------------------------------QKDSEV--------
B4SF86_PELPB/47-298------------------------------------------------------------------GSEQEI--------
B1LXU6_METRJ/11-233------------------------------------------------------------------KDPEAV--------
A6X608_OCHA4/9-230------------------------------------------------------------------TSGTEL--------
Q2SQ14_HAHCH/16-233------------------------------------------------------------------EERAAL--------
C7R459_JONDD/9-233------------------------------------------------------------------SDSDAL--------
C1DRP8_AZOVD/18-236------------------------------------------------------------------ADAETL--------
A5FAH5_FLAJ1/6-228------------------------------------------------------------------NTTEEI--------
A9PA91_POPTR/14-244------------------------------------------------------------------DTEQDV--------
6PGL_TREPA/7-224------------------------------------------------------------------EDARAI--------
Q7UM40_RHOBA/5-223------------------------------------------------------------------ESLDEL--------
C3ZB29_BRAFL/10-239------------------------------------------------------------------ADQAEI--------
B8C1W9_THAPS/20-270------------------------------------------------------------------SSKSAV--------
Q5FQ99_GLUOX/14-235------------------------------------------------------------------PDSEAV--------
Q6NH39_CORDI/8-228------------------------------------------------------------------SDLDAV--------
A8IFM0_AZOC5/18-239------------------------------------------------------------------EDRAAL--------
B0UFD2_METS4/12-231------------------------------------------------------------------PDAEAV--------
Q08ZT9_STIAD/9-213------------------------------------------------------------------VASEAL--------
Q2IHT3_ANADE/13-235------------------------------------------------------------------ADPAAL--------
D1CEH8_THET1/9-231------------------------------------------------------------------ENSSEV--------
Q31QV8_SYNE7/9-229------------------------------------------------------------------ADFAAV--------
C1DDK6_AZOVD/18-235------------------------------------------------------------------ADGAAL--------
A6WC51_KINRD/12-239------------------------------------------------------------------TSPEVL--------
B1MC71_MYCA9/10-236------------------------------------------------------------------ADTDAL--------
D2SF51_GEOOG/27-257------------------------------------------------------------------PDADRL--------
D1BS91_XYLCX/10-239------------------------------------------------------------------PDAEVL--------
Q5YTR6_NOCFA/29-251------------------------------------------------------------------PDADAL--------
Q0BTV3_GRABC/17-236------------------------------------------------------------------DTAQAL--------
B2FL79_STRMK/16-238------------------------------------------------------------------SDADGW--------
A5BJC3_VITVI/17-249------------------------------------------------------------------ENLNEL--------
B8IN69_METNO/12-232------------------------------------------------------------------PDPDAV--------
Q8DJZ4_THEEB/10-227------------------------------------------------------------------PNLAAL--------
D2AVA1_STRRD/10-237------------------------------------------------------------------RDADML--------
Q4Q8S1_LEIMA/12-256------------------------------------------------------------------EDISHI--------
Q312M1_DESAG/38-260------------------------------------------------------------------PDPDAM--------
A5EXD3_DICNV/9-224------------------------------------------------------------------STADER--------
A0LDZ7_MAGMM/13-230------------------------------------------------------------------PSEEQS--------
C4LIR1_CORK4/27-277------------------------------------------------------------------ADQAEV--------
B3EN23_CHLPB/5-259------------------------------------------------------------------GTEKRI--------
B7FPL4_PHATC/11-262------------------------------------------------------------------STKSEL--------
B8ELV8_METSB/11-231------------------------------------------------------------------ASAEEL--------
G6PE_HUMAN/558-782------------------------------------------------------------------AWSEEL--------
A5VAC4_SPHWW/10-232------------------------------------------------------------------EDPAEL--------
Q4K7U0_PSEF5/18-235------------------------------------------------------------------RSPTLL--------
C5FTG3_ARTOC/12-245------------------------------------------------------------------PDLGNL--------
C7LRB5_DESBD/8-228------------------------------------------------------------------PNADLL--------
D2QID0_SPILD/7-229------------------------------------------------------------------KNPADL--------
C1FA85_ACIC5/13-240------------------------------------------------------------------EDAAAL--------
B4GTC9_DROPE/14-235------------------------------------------------------------------ESEDKL--------
6PGL_CAEEL/21-242------------------------------------------------------------------GDEKEL--------
6PGL_XYLFA/15-237------------------------------------------------------------------DDPLEW--------
F2G576_ALTMD/9-228------------------------------------------------------------------ETPDAL--------
A9BG97_PETMO/7-228------------------------------------------------------------------DDPETF--------
C7MCP6_BRAFD/326-560------------------------------------------------------------------ADGDAV--------
B2J9Q0_NOSP7/9-228------------------------------------------------------------------PDQPTL--------
D7B103_NOCDD/10-238------------------------------------------------------------------SDAGAL--------
B3RLE2_TRIAD/566-785------------------------------------------------------------------GSPDAV--------
SOL4_YEAST/8-241------------------------------------------------------------------SEKKSL--------
C5B1S2_METEA/13-236------------------------------------------------------------------DNGEAV--------
Q2Y8J3_NITMU/15-226------------------------------------------------------------------ADLTAL--------
A0LTY4_ACIC1/9-232------------------------------------------------------------------PDAGTL--------
Q6FQZ7_CANGA/8-232------------------------------------------------------------------SEKKDL--------
Q16H01_AEDAE/9-231------------------------------------------------------------------RVGDAI--------
Q11M12_CHESB/10-230------------------------------------------------------------------AASEAL--------
A0QWX6_MYCS2/10-234------------------------------------------------------------------ADTAAL--------
B9L0S4_THERP/9-234------------------------------------------------------------------DTTEEA--------
B5HF46_STRPR/11-241------------------------------------------------------------------RDKDLM--------
Q01VT6_SOLUE/9-230------------------------------------------------------------------PDAQAA--------
A2EC78_TRIVA/488-712------------------------------------------------------------------RTPSEL--------
A6L9R0_PARD8/7-228------------------------------------------------------------------NEMKEA--------
A8HQW1_CHLRE/5-232------------------------------------------------------------------VTPEKA--------
Q210H8_RHOPB/9-229------------------------------------------------------------------ADPEEL--------
Q7D149_AGRFC/9-230------------------------------------------------------------------DTAAAL--------
B0REI8_CLAMS/11-237------------------------------------------------------------------PDKKAM--------
Q6CXV1_KLULA/8-237------------------------------------------------------------------SNSSEL--------
Q4CQA8_TRYCC/11-251------------------------------------------------------------------GSPAEL--------
Q5LRS8_RUEPO/7-221------------------------------------------------------------------PDRDML--------
C8X5S3_DESRD/22-247------------------------------------------------------------------PRAADL--------
Q0C1F0_HYPNA/9-234------------------------------------------------------------------DDREAA--------
Q1IMT5_KORVE/19-241------------------------------------------------------------------ADKVAL--------
C5DTU9_ZYGRC/7-240------------------------------------------------------------------SQRPEF--------
B3PCY8_CELJU/8-232------------------------------------------------------------------DSRAEM--------
A9TLR4_PHYPA/4-237------------------------------------------------------------------QRFRVV--------
Q28QX5_JANSC/8-222------------------------------------------------------------------PDQEMM--------
Q0ALB6_MARMM/15-240------------------------------------------------------------------VDKVAM--------
Q1QTX1_CHRSD/7-223------------------------------------------------------------------EGRQRL--------
A7TEX2_VANPO/8-238------------------------------------------------------------------ASSEQL--------
Q2H6B6_CHAGB/11-242------------------------------------------------------------------PAVDAL--------
Q7QGR5_ANOGA/12-234------------------------------------------------------------------RTGDAI--------
A7RLB1_NEMVE/507-732------------------------------------------------------------------GPLEVV--------
B3MQE2_DROAN/14-235------------------------------------------------------------------DSEIDL--------
Q1H2F6_METFK/21-229------------------------------------------------------------------TAQEAL--------
A9F2S9_SORC5/11-231------------------------------------------------------------------ADAAEL--------
A4CNJ0_ROBBH/7-226------------------------------------------------------------------PGKQEA--------
Q758H7_ASHGO/101-325------------------------------------------------------------------PDTDAL--------
6PGL_RHILO/17-236------------------------------------------------------------------PDRPQL--------
A1A127_BIFAA/13-255------------------------------------------------------------------.NPQVL--------
A3N1V8_ACTP2/9-222------------------------------------------------------------------......--------
A6L429_BACV8/12-221------------------------------------------------------------------....QA--------
B2UK49_RALPJ/10-223------------------------------------------------------------------.DPAGQ--------
B7J926_ACIF2/14-216------------------------------------------------------------------PDPEAL--------
B7VN92_VIBTL/13-227------------------------------------------------------------------......--------
C0ZZG4_RHOE4/11-231------------------------------------------------------------------.DAGQL--------
D7GEP6_PROFC/12-230------------------------------------------------------------------.DNEEL--------
E7QFR9_YEASZ/10-234------------------------------------------------------------------..RASL--------
F7BV51_XENTR/350-572------------------------------------------------------------------..AEQL--------
H9JWK2_BOMMO/8-220------------------------------------------------------------------.DEEEI--------
J9ZCI7_LEPFM/20-235------------------------------------------------------------------PDESAL--------
M1F8P0_9ALTE/19-237------------------------------------------------------------------.TPADL--------
C6XF26_LIBAP/11-223------------------------------------------------------------------.NKKRL--------
6PGL_MYCTU/10-235------------------------------------------------------------------.DSDIL--------
Q385D6_TRYB2/12-245------------------------------------------------------------------.TPQEL--------
Q3JBF3_NITOC/9-228------------------------------------------------------------------.TPAAL--------
Q46LF9_PROMT/11-224------------------------------------------------------------------.DKSSL--------
Q59PZ6_CANAL/10-232------------------------------------------------------------------.DSQDV--------
Q5LE34_BACFN/13-219------------------------------------------------------------------......--------
Q5ZYF5_LEGPH/14-220------------------------------------------------------------------.DAKQL--------
Q6LS72_PHOPR/10-227------------------------------------------------------------------......--------
Q7V812_PROMM/11-220------------------------------------------------------------------.DPEDL--------
Q83GH9_TROWT/52-269------------------------------------------------------------------.NKSLL--------
Q887J1_PSESM/19-235------------------------------------------------------------------.TPQQL--------
Q8EE99_SHEON/12-226------------------------------------------------------------------.TPAAL--------
Q8G730_BIFLO/41-300------------------------------------------------------------------.NKDLM--------
Q8NQ61_CORGL/9-224------------------------------------------------------------------.DTEDL--------
6PGL_DROME/15-227------------------------------------------------------------------.SEEQL--------
6PGL_THEMA/14-216------------------------------------------------------------------......--------
R5U357_9BACE/14-221------------------------------------------------------------------......--------
R6K673_9BACE/10-218------------------------------------------------------------------...VET--------

PF02589

Q30YW4_DESAG/23-221------------------------------------------------------------------LAE.AA--------
Q72A59_DESVH/13-211------------------------------------------------------------------LTE.VA--------
A0LET5_SYNFM/13-211------------------------------------------------------------------LSD.LK--------
A8ZY31_DESOH/13-211------------------------------------------------------------------LAQ.VK--------
Q6AQM0_DESPS/13-211------------------------------------------------------------------LRA.VQ--------
A5N319_CLOK5/16-217------------------------------------------------------------------ATK.LI--------
A3DDG8_CLOTH/16-211------------------------------------------------------------------APR.II--------
Q18C30_PEPD6/15-209------------------------------------------------------------------GPH.IV--------
A6LXE8_CLOB8/15-209------------------------------------------------------------------STK.VI--------
B8D0K4_HALOH/12-205------------------------------------------------------------------AEK.LI--------
A4XID0_CALS8/13-207------------------------------------------------------------------LET.LK--------
A5I080_CLOBH/11-201------------------------------------------------------------------LAQKLI--------
A7HK56_FERNB/14-207------------------------------------------------------------------AQK.IK--------
A6LMB1_THEM4/14-207------------------------------------------------------------------ANK.VA--------
A8F3V4_PSELT/14-204------------------------------------------------------------------CRK.LK--------
A5MYV3_CLOK5/13-207------------------------------------------------------------------IKR.TI--------
Q97IL7_CLOAB/13-207------------------------------------------------------------------IER.TI--------
Q188D0_PEPD6/13-206------------------------------------------------------------------IEK.TI--------
Q892L7_CLOTE/13-207------------------------------------------------------------------VER.VI--------
A8MGY9_ALKOO/13-207------------------------------------------------------------------VQR.TM--------
A5N989_CLOK5/13-207------------------------------------------------------------------IER.TI--------
A5I1I2_CLOBH/13-207------------------------------------------------------------------VER.TI--------
Q897Y1_CLOTE/13-206------------------------------------------------------------------VQR.TI--------
B8CXT8_HALOH/13-207------------------------------------------------------------------IER.IL--------
B8I8V5_CLOCE/13-218------------------------------------------------------------------IKK.TM--------
Q7MR09_WOLSU/5-199------------------------------------------------------------------VRK.TI--------
Q251U6_DESHY/5-199------------------------------------------------------------------LER.TI--------
Q97M44_CLOAB/13-207------------------------------------------------------------------AKK.IT--------
B5EEH8_GEOBB/16-211------------------------------------------------------------------CNK.AV--------
A5G901_GEOUR/16-211------------------------------------------------------------------CEK.AV--------
A5CYU3_PELTS/16-210------------------------------------------------------------------CKR.AV--------
A0PZA2_CLONN/13-207------------------------------------------------------------------GEK.VV--------
Q6M046_METMP/13-207------------------------------------------------------------------GKK.LV--------
A4J2Z4_DESRM/12-207------------------------------------------------------------------GEK.VV--------
A6TQ94_ALKMQ/5-197------------------------------------------------------------------VEV.IL--------
A8MHS3_ALKOO/5-197------------------------------------------------------------------IEK.VL--------
A7I305_CAMHC/3-194------------------------------------------------------------------MSD.LI--------
A8EV54_ARCB4/1-193------------------------------------------------------------------MKE.FL--------
A6LYD8_CLOB8/3-195------------------------------------------------------------------FTK.LK--------
B9LU40_HALLT/27-212------------------------------------------------------------------VEE.TV--------
Q5V6G7_HALMA/27-212------------------------------------------------------------------IEE.TV--------
A3CXV8_METMJ/32-217------------------------------------------------------------------LKK.TV--------
Q8T2H5_DICDI/31-220------------------------------------------------------------------LNE.TI--------
Q8T2H6_DICDI/31-218------------------------------------------------------------------INE.TV--------
Q9BI24_DICDI/30-213------------------------------------------------------------------LME.TV--------
A8LFX8_FRASN/21-203------------------------------------------------------------------IDR.AT--------
Q6ABE0_PROAC/50-223------------------------------------------------------------------VGT.FV--------
A1ATQ9_PELPD/34-209------------------------------------------------------------------MYELFK--------
B5EIV8_GEOBB/2-175------------------------------------------------------------------YEL.FK--------
A4J2C5_DESRM/13-186------------------------------------------------------------------YKE.FK--------
A5D032_PELTS/17-190------------------------------------------------------------------YEE.FK--------
Q30WA8_DESAG/6-203------------------------------------------------------------------SRL.MR--------
Q6APH5_DESPS/6-194------------------------------------------------------------------IQL.FS--------
A0LF89_SYNFM/7-180------------------------------------------------------------------IAK.LK--------
Q1ARS5_RUBXD/44-220------------------------------------------------------------------PSR.FL--------
LUTC_BACP2/52-237------------------------------------------------------------------VEQ.LK--------
Q836K1_ENTFA/52-236------------------------------------------------------------------LTI.VK--------
LUTC_OCEIH/49-232------------------------------------------------------------------IDV.LE--------
Q1WT28_LACS1/55-240------------------------------------------------------------------LEI.AK--------
Q6LPN1_PHOPR/50-245------------------------------------------------------------------KDV.LV--------
Q24VR0_DESHY/42-220------------------------------------------------------------------IDK.FM--------
Q2SMI8_HAHCH/39-216------------------------------------------------------------------VRV.FT--------
Q47V41_COLP3/52-226------------------------------------------------------------------LAQ.FI--------
Q3IEG6_PSEHT/41-215------------------------------------------------------------------LEQ.FT--------
Q7NTM5_CHRVO/41-217------------------------------------------------------------------LRH.WA--------
Q4KII4_PSEF5/42-220------------------------------------------------------------------IPQ.LR--------
Q2VZP0_MAGSA/37-213------------------------------------------------------------------KAK.FK--------
Q5F884_NEIG1/42-219------------------------------------------------------------------LKH.WA--------
Q310K5_DESAG/40-217------------------------------------------------------------------EER.FV--------
Q6AIU4_DESPS/43-219------------------------------------------------------------------IAK.FT--------
Q72B57_DESVH/44-220------------------------------------------------------------------IPL.LK--------
Q0PC62_CAMJE/47-218------------------------------------------------------------------LTE.MK--------
A0RPC6_CAMFF/42-213------------------------------------------------------------------YAE.FT--------
Q7VIF4_HELHP/38-218------------------------------------------------------------------VQE.YI--------
A7IG69_XANP2/53-223------------------------------------------------------------------LAL.FK--------
Q11LF2_CHESB/52-222------------------------------------------------------------------IAL.FC--------
A1SVG8_PSYIN/32-224------------------------------------------------------------------RQE.AL--------
A8MDI5_CALMQ/50-279------------------------------------------------------------------VDK.AM--------
A2BLD6_HYPBU/71-302------------------------------------------------------------------IDM.AM--------
Q9YFI8_AERPE/68-298------------------------------------------------------------------VER.AV--------
A7HA97_ANADF/64-283------------------------------------------------------------------LEE.FE--------
Q7MVA5_PORGI/38-257------------------------------------------------------------------LLR.FE--------
Q47F70_DECAR/78-303------------------------------------------------------------------LEQ.LE--------
Q6ABE1_PROAC/94-322------------------------------------------------------------------LVE.AE--------
Q47IA5_DECAR/76-304------------------------------------------------------------------LDI.FE--------
A1B665_PARDP/69-294------------------------------------------------------------------LEM.FE--------
A5G2K5_ACICJ/68-296------------------------------------------------------------------LER.YA--------
A0LED1_SYNFM/69-293------------------------------------------------------------------LDR.LA--------
A5V1N8_ROSS1/68-292------------------------------------------------------------------LVR.LA--------
Q67TB4_SYMTH/77-301------------------------------------------------------------------LKQ.AA--------
Q1ARS4_RUBXD/86-314------------------------------------------------------------------LGQ.MA--------
Q01UG1_SOLUE/67-291------------------------------------------------------------------LEE.FE--------
Q1IN28_KORVE/68-293------------------------------------------------------------------LEE.FE--------
LUTB_BACLD/70-295------------------------------------------------------------------LEQ.LA--------
LUTB_OCEIH/70-294------------------------------------------------------------------LHQ.LS--------
Q6D5W9_PECAS/70-294------------------------------------------------------------------LYQ.LS--------
Q81ND6_BACAN/69-293------------------------------------------------------------------LEQ.LA--------
Q24VR1_DESHY/69-293------------------------------------------------------------------LDM.LI--------
A5VIG9_LACRD/70-294------------------------------------------------------------------LEE.FS--------
B9LU44_HALLT/67-296------------------------------------------------------------------IDE.VT--------
Q3ISD5_NATPD/64-299------------------------------------------------------------------IEE.VR--------
A5GDG8_GEOUR/64-287------------------------------------------------------------------AAA.FT--------
A5D031_PELTS/65-292------------------------------------------------------------------AER.FA--------
Q3AEY7_CARHZ/62-279------------------------------------------------------------------VEQ.FR--------
Q24W82_DESHY/65-292------------------------------------------------------------------IEQ.FE--------
Q8RIN1_FUSNN/65-294------------------------------------------------------------------IAE.FT--------
Q726S3_DESVH/69-294------------------------------------------------------------------YAQ.FK--------
Q74CQ3_GEOSL/61-280------------------------------------------------------------------VKE.FT--------
A4J1M6_DESRM/66-295------------------------------------------------------------------ISK.AT--------
A5UNQ3_METS3/51-284------------------------------------------------------------------MDI.AV--------
O26243_METTH/51-280------------------------------------------------------------------IAG.AS--------
A4J1M5_DESRM/47-258------------------------------------------------------------------VGR.AT--------
A5HZY1_CLOBH/14-207------------------------------------------------------------------.MR.TI--------
A5VIG8_LACRD/58-241------------------------------------------------------------------.EL.AR--------
A9WGW7_CHLAA/44-229------------------------------------------------------------------AEQ.FV--------
C6XV06_PEDHD/69-292------------------------------------------------------------------.PE.FE--------
M9X3V9_MANHA/50-227------------------------------------------------------------------.QE.FI--------
O24950_HELPY/71-295------------------------------------------------------------------LEL.FE--------
Q0PC61_CAMJE/70-292------------------------------------------------------------------..E.FE--------
Q24WP5_DESHY/68-297------------------------------------------------------------------LAQ.AM--------
Q5SIK3_THET8/69-291------------------------------------------------------------------.EL.AE--------
Q63NH7_BURPS/72-300------------------------------------------------------------------LER.YE--------
Q63SM7_BURPS/67-292------------------------------------------------------------------LEM.FE--------
Q6LSA7_PHOPR/40-218------------------------------------------------------------------.QR.FI--------
LUTB_BACCR/71-293------------------------------------------------------------------.MQ.LS--------
Q81ND7_BACAN/48-228------------------------------------------------------------------VEQ.FI--------
LUTC_BACAN/51-236------------------------------------------------------------------LEV.FK--------
Q8XH83_CLOPE/14-207------------------------------------------------------------------.NK.VI--------
Q9WXZ9_THEMA/17-208------------------------------------------------------------------.EH.VA--------
R5KLF2_9CLOT/15-206------------------------------------------------------------------..A.MI--------
R5QY75_9FIRM/13-205------------------------------------------------------------------.KR.VV--------
R5UE40_9FIRM/14-205------------------------------------------------------------------..R.VV--------
R6MWQ8_9CLOT/13-227------------------------------------------------------------------IQR.TM--------
R7FYW0_9FIRM/15-206------------------------------------------------------------------..K.IV--------
U5L6H3_9BACI/52-235------------------------------------------------------------------.EV.LI--------

PF01812

MTHFS_HUMAN/10-198------------------------------------------------------------------KRSLRG--------
5FCLL_ARATH/92-290------------------------------------------------------------------KWVIRK--------
MTHFS_CAEEL/8-197------------------------------------------------------------------KSELRQ--------
YQGN_BACSU/2-179------------------------------------------------------------------KSQLRK--------
O83692_TREPA/4-207------------------------------------------------------------------KQNARR--------
Q9RKA5_STRCO/12-197------------------------------------------------------------------KRLLRR--------
5FCL_HAEIN/6-187------------------------------------------------------------------RQQIRT--------
MTHFS_RABIT/10-198------------------------------------------------------------------KRSLRA--------
O26306_METTH/134-322------------------------------------------------------------------DGGERL--------
FTHC_YEAST/4-203------------------------------------------------------------------KQLLRR--------
Q9YFU3_AERPE/7-205------------------------------------------------------------------KQAIRE--------
P73038_SYNY3/3-179------------------------------------------------------------------KAQLRA--------
O67621_AQUAE/3-175------------------------------------------------------------------KSELRK--------
Q9ZD82_RICPR/3-172------------------------------------------------------------------KQELRF--------
O05575_MYCTU/6-186------------------------------------------------------------------KSALRD--------
H2VFJ2_CHLTE/8-188------------------------------------------------------------------KPELRK--------
Q7AQM9_MYCLE/6-186------------------------------------------------------------------KATLRK--------
Q8DVY5_STRMU/3-174------------------------------------------------------------------KKDYRT--------

PF13336

A6LV90_CLOB8/275-428-------------------------------------------------------------------GTKRL--------
B8F9H4_DESAA/272-425-------------------------------------------------------------------GTERL--------
Q7MWD3_PORGI/273-426-------------------------------------------------------------------GSEDV--------
B8CZD4_HALOH/271-424-------------------------------------------------------------------GTNRL--------
Q3ACH6_CARHZ/275-428-------------------------------------------------------------------GTKKL--------
D2QBR0_SPILD/268-420-------------------------------------------------------------------GSQRV--------
D7BE02_MEISD/284-437-------------------------------------------------------------------GSERL--------
Q898H0_CLOTE/272-425-------------------------------------------------------------------GTKKL--------
A0L8K8_MAGMM/267-420-------------------------------------------------------------------GTKRI--------
A5N390_CLOK5/276-429-------------------------------------------------------------------GTKKL--------
Q15V19_PSEA6/267-420-------------------------------------------------------------------GSKKL--------
Q39QG7_GEOMG/278-431-------------------------------------------------------------------GTKRL--------
B3QTM9_CHLT3/265-417-------------------------------------------------------------------GSRRL--------
A9AXP3_HERA2/264-416-------------------------------------------------------------------GTRRL--------
Q8CXQ9_LEPIN/270-422-------------------------------------------------------------------GTRKL--------
A5URR7_ROSS1/272-425-------------------------------------------------------------------GSQRC--------
Q24WU2_DESHY/311-467-------------------------------------------------------------------GTQKT--------
C7M4J2_CAPOD/265-417-------------------------------------------------------------------GTQEL--------
Q5QXA2_IDILO/264-417-------------------------------------------------------------------GSQAL--------
B9M8N9_GEODF/274-427-------------------------------------------------------------------GTRRL--------
B9M9H7_GEODF/264-417-------------------------------------------------------------------GSQKV--------
A7H923_ANADF/265-417-------------------------------------------------------------------GTRRL--------
C7RL22_ACCPU/274-427-------------------------------------------------------------------GSQKL--------
Q3ANX0_CHLCH/266-418-------------------------------------------------------------------GTKRL--------
A0M1A3_GRAFK/267-419-------------------------------------------------------------------GSPKL--------
Q0IG02_AEDAE/314-468-------------------------------------------------------------------GTKKL--------
D1C4I7_SPHTD/264-417-------------------------------------------------------------------GTDRL--------
A7HKG2_FERNB/273-426-------------------------------------------------------------------GSKKM--------
A6GWR2_FLAPJ/265-417-------------------------------------------------------------------GSQRL--------
A8F649_PSELT/274-427-------------------------------------------------------------------GTKRM--------
B5ECU8_GEOBB/278-431-------------------------------------------------------------------GTKRL--------
A1KBF4_AZOSB/272-425-------------------------------------------------------------------GSRKL--------
Q2LSP1_SYNAS/286-439-------------------------------------------------------------------GKKET--------
A4ASU6_MARSH/266-418-------------------------------------------------------------------GSRRL--------
Q01VE3_SOLUE/270-423-------------------------------------------------------------------GSKVL--------
B5E7S1_GEOBB/278-431-------------------------------------------------------------------GTKRL--------
B2TLD8_CLOBB/272-425-------------------------------------------------------------------GSQRL--------
A0B6T6_METTP/284-437-------------------------------------------------------------------GTRKT--------
A4J1E7_DESRM/279-435-------------------------------------------------------------------GSQRL--------
D6Z2N5_DESAT/282-435-------------------------------------------------------------------GTRKL--------
Q1IT47_KORVE/273-426-------------------------------------------------------------------GTRRM--------
B5Y607_COPPD/273-426-------------------------------------------------------------------GTQRL--------
D3FVG7_BACPE/268-421-------------------------------------------------------------------GTKRL--------
Q0AVM5_SYNWW/279-434-------------------------------------------------------------------GSQEL--------
Q2FRF0_METHJ/278-431-------------------------------------------------------------------GTRRM--------
B2A2S6_NATTJ/273-426-------------------------------------------------------------------GSQKL--------
B9JLD2_AGRRK/284-435-------------------------------------------------------------------GDQAL--------
A3HTS6_9BACT/267-419-------------------------------------------------------------------GTREL--------
A9GMK9_SORC5/277-430-------------------------------------------------------------------GSRAL--------
C7PPM1_CHIPD/268-420-------------------------------------------------------------------GTRKL--------
C0QJK6_DESAH/274-427-------------------------------------------------------------------GSRKL--------
D2VMT8_NAEGR/323-475-------------------------------------------------------------------GSRNI--------
B2HRD6_MYCMM/288-439-------------------------------------------------------------------GDRKT--------
A9BH20_PETMO/279-432-------------------------------------------------------------------GTKRM--------
Q0AW71_SYNWW/272-425-------------------------------------------------------------------GSRRL--------
Q4A5M6_MYCS5/287-438-------------------------------------------------------------------GNKQM--------
A4J4L6_DESRM/279-435-------------------------------------------------------------------GTQRL--------
E6VZH2_DESAO/276-429-------------------------------------------------------------------GTRDT--------
Q220T6_RHOFT/272-425-------------------------------------------------------------------GSKKL--------
A4AMZ0_MARSH/269-421-------------------------------------------------------------------GSQDL--------
D4IP35_9BACT/266-418-------------------------------------------------------------------GSRRL--------
A1U877_MARHV/284-436-------------------------------------------------------------------GDRKL--------
D4J7D4_9FIRM/278-438-------------------------------------------------------------------GSQRL--------
D2VCN4_NAEGR/199-351-------------------------------------------------------------------GSKEM--------
C6X0M3_FLAB3/276-428-------------------------------------------------------------------GTRKL--------
C0QKC6_DESAH/273-426-------------------------------------------------------------------GSKQL--------
C8VZ55_DESAS/277-433-------------------------------------------------------------------GSKNL--------
C0QAD0_DESAH/281-437-------------------------------------------------------------------GSQRL--------
A0LMU1_SYNFM/292-445-------------------------------------------------------------------GSREL--------
A9NFJ4_ACHLI/270-431-------------------------------------------------------------------GTQEL--------
B8FDQ1_DESAA/279-432-------------------------------------------------------------------GSEKL--------
Q3A1S1_PELCD/278-433-------------------------------------------------------------------GTRKM--------
Q21W64_RHOFT/279-435-------------------------------------------------------------------GSQKL--------
B8F9D7_DESAA/274-430-------------------------------------------------------------------GSKAT--------
A4J5F7_DESRM/278-434-------------------------------------------------------------------GSQKL--------
A8MLT0_ALKOO/317-464-------------------------------------------------------------------GLKRL--------
A4J1H7_DESRM/278-434-------------------------------------------------------------------GSPRL--------
Q0AW62_SYNWW/282-438-------------------------------------------------------------------GNREL--------
A8ZXP1_DESOH/277-430-------------------------------------------------------------------GSAEL--------
Q0AZT0_SYNWW/278-433-------------------------------------------------------------------GSQRL--------
A2SP55_METPP/278-433-------------------------------------------------------------------GSRHL--------
D4KHS0_9FIRM/319-466-------------------------------------------------------------------GLKRF--------
Q2RRD2_RHORT/322-473-------------------------------------------------------------------GNKEM--------
A0LHR8_SYNFM/278-431-------------------------------------------------------------------GSADL--------
Q18599_CAEEL/306-460-------------------------------------------------------------------GSTKL--------
A7SYK6_NEMVE/323-477-------------------------------------------------------------------GTKKV--------
Q0AXU7_SYNWW/280-436-------------------------------------------------------------------GSEKL--------
C4Z8H6_AGARV/279-435-------------------------------------------------------------------GTKKM--------
D1B8D5_THEAS/325-472-------------------------------------------------------------------GARRM--------
Q0B052_SYNWW/278-434-------------------------------------------------------------------GTNKL--------
B7QJI4_IXOSC/314-468-------------------------------------------------------------------GTQRL--------
Q6AQI5_DESPS/285-438-------------------------------------------------------------------GTKKL--------
B0TCP9_HELMI/277-433-------------------------------------------------------------------GTKRL--------
A4J446_DESRM/283-434-------------------------------------------------------------------GTKRL--------
C0QDJ7_DESAH/279-431-------------------------------------------------------------------GSTTF--------
A0R5U0_MYCS2/274-430-------------------------------------------------------------------GSPDL--------
Q2LPI7_SYNAS/276-429-------------------------------------------------------------------GPKEM--------
A8WP03_CAEBR/305-459-------------------------------------------------------------------GTKEF--------
B2W452_PYRTR/302-453-------------------------------------------------------------------GFQRF--------
Q0RWG8_RHOJR/538-685-------------------------------------------------------------------GIEEL--------
A1TGQ6_MYCVP/271-426-------------------------------------------------------------------GSTEL--------
A5E2Y9_LODEL/243-394-------------------------------------------------------------------GFKKF--------
A7HPG3_PARL1/328-491-------------------------------------------------------------------GSRAF--------
D2RM64_ACIFV/277-437-------------------------------------------------------------------GSQEL--------
Q0AY76_SYNWW/278-434-------------------------------------------------------------------GTQIL--------
O29120_ARCFU/297-457-------------------------------------------------------------------GSLKL--------
Q2SL76_HAHCH/439-606-------------------------------------------------------------------GPQRF--------
ACH1_YARLI/333-484-------------------------------------------------------------------GFKRF--------
O28424_ARCFU/289-449-------------------------------------------------------------------GTRKL--------
A7HD82_ANADF/326-473-------------------------------------------------------------------GQERF--------
C5DU17_ZYGRC/331-482-------------------------------------------------------------------GFDRL--------
D4JBB9_9FIRM/276-431-------------------------------------------------------------------GDKAM--------
B5EIE5_GEOBB/327-478-------------------------------------------------------------------GFQRL--------
B0DKN0_LACBS/350-501-------------------------------------------------------------------GFDHF--------
B6K306_SCHJY/330-481-------------------------------------------------------------------GFEHF--------
ACH1_SCHPO/330-481-------------------------------------------------------------------GFEKF--------
A0LG92_SYNFM/280-432-------------------------------------------------------------------GTKDL--------
Q74GS1_GEOSL/327-478-------------------------------------------------------------------GFKRF--------
A5V7D2_SPHWW/272-423-------------------------------------------------------------------GDQCF--------
Q0AV35_SYNWW/283-439-------------------------------------------------------------------GDQAL--------
D2V812_NAEGR/332-483-------------------------------------------------------------------GFKKF--------
D2RN63_ACIFV/277-434-------------------------------------------------------------------GSQEL--------
B9M8L3_GEODF/333-484-------------------------------------------------------------------GIKRL--------
Q6LQ13_PHOPR/472-639-------------------------------------------------------------------GPKDF--------
A8ZWK6_DESOH/447-610-------------------------------------------------------------------GANRF--------
A1W2A3_ACISJ/277-426-------------------------------------------------------------------GGEKL--------
B6JG54_OLICO/334-497-------------------------------------------------------------------GPKSF--------
Q0VNK9_ALCBS/436-599-------------------------------------------------------------------GPRDF--------
D3BTR1_POLPA/348-499-------------------------------------------------------------------GFNRL--------
B8FMI7_DESAA/441-604-------------------------------------------------------------------GPNGF--------
ACH1_DICDI/341-492-------------------------------------------------------------------GFNRL--------
Q0BZS7_HYPNA/258-410-------------------------------------------------------------------GTPAL--------
Q1DA17_MYXXD/323-474-------------------------------------------------------------------GRQRF--------
A1SHN0_NOCSJ/246-396-------------------------------------------------------------------GSPEL--------
C0QKG0_DESAH/440-603-------------------------------------------------------------------GPQAF--------
Q88CB5_PSEPK/319-482-------------------------------------------------------------------GPQAF--------
A8ZT97_DESOH/278-429-------------------------------------------------------------------GTENL--------
D0LM00_HALO1/437-597-------------------------------------------------------------------GSRRF--------
Q0RK43_FRAAA/215-365-------------------------------------------------------------------GSAEL--------
D1A9C8_THECD/271-421-------------------------------------------------------------------GSPEL--------
Q2JCQ5_FRASC/281-431-------------------------------------------------------------------GSAEL--------
Q0C1R5_HYPNA/318-481-------------------------------------------------------------------GPQNF--------
C7LYG5_ACIFD/255-405-------------------------------------------------------------------GSAEL--------
D2UEK6_XANAP/366-529-------------------------------------------------------------------GSTAF--------
B8FN92_DESAA/282-434-------------------------------------------------------------------GSQEL--------
C0QDF6_DESAH/275-427-------------------------------------------------------------------GTPDL--------
C0QHQ8_DESAH/271-423-------------------------------------------------------------------GSKAL--------
B0SLS6_LEPBP/320-466-------------------------------------------------------------------GLKRF--------
B2FSG4_STRMK/367-531-------------------------------------------------------------------GSPEF--------
B4R0Y1_DROSI/312-466-------------------------------------------------------------------GDKAL--------
B5EES2_GEOBB/332-482-------------------------------------------------------------------GFPRF--------
B5EIS2_GEOBB/283-439-------------------------------------------------------------------GTKRL--------
D1BNH2_VEIPT/320-466-------------------------------------------------------------------GLKRF--------
D3HLY9_LEGLN/281-431-------------------------------------------------------------------GDKHL--------
D4K633_9FIRM/279-436-------------------------------------------------------------------GTQKM--------
D4MZL1_ANAHA/279-435-------------------------------------------------------------------GTKKL--------
D6DE02_CLOSC/291-448-------------------------------------------------------------------GSQEL--------
F4KMH9_PORAD/277-429-------------------------------------------------------------------GTKEL--------
F4KN61_PORAD/269-421-------------------------------------------------------------------GTQEL--------
G4Q2X4_ACIIR/277-434-------------------------------------------------------------------GSAEL--------
G4Q5N3_ACIIR/281-437-------------------------------------------------------------------GTKKL--------
CAT2_CLOK5/272-424-------------------------------------------------------------------GTKKL--------
Q185L2_PEPD6/271-425-------------------------------------------------------------------GTKKL--------
Q24S37_DESHY/279-435-------------------------------------------------------------------GTQKL--------
Q24ZX0_DESHY/273-425-------------------------------------------------------------------GTKRV--------
Q3JAD8_NITOC/444-607-------------------------------------------------------------------GPQRF--------
Q3SQD4_NITWN/334-497-------------------------------------------------------------------GSQSF--------
Q63JS7_BURPS/286-433-------------------------------------------------------------------GDRAM--------
Q6A8E8_PROAC/249-399-------------------------------------------------------------------GTPAL--------
Q6N157_RHOPA/260-409-------------------------------------------------------------------GTQRL--------
Q6NCD5_RHOPA/324-470-------------------------------------------------------------------GYDEF--------
Q7MTJ6_PORGI/273-425-------------------------------------------------------------------GSKEL--------
Q7NBY9_MYCGA/280-429-------------------------------------------------------------------GDQDM--------
Q88BB0_PSESM/361-524-------------------------------------------------------------------GPSSF--------
Q8EG98_SHEON/267-420-------------------------------------------------------------------GSQKL--------
Q8P4W8_XANCP/323-469-------------------------------------------------------------------GNEEF--------
Q8RC84_CALS4/272-425-------------------------------------------------------------------GTKKL--------
Q9ZC36_YERPE/283-434-------------------------------------------------------------------GQQEM--------
R5BUI5_9FIRM/274-427-------------------------------------------------------------------GDQNL--------
R5SJH9_9FIRM/335-481-------------------------------------------------------------------GLKRF--------
R6G778_9FIRM/279-435-------------------------------------------------------------------GTKKM--------
R6R3R6_9FIRM/277-429-------------------------------------------------------------------GTRRL--------
R7JML8_9BACT/267-419-------------------------------------------------------------------GSKRL--------
R7JP79_9BACT/270-422-------------------------------------------------------------------GSQRV--------

PF04223

Q99ZK7_STRP1/45-510---------------------DSKLLGSVREAIEKTGLTDGMTISFHHHFREGDFIMNMVLEEIAKMGIKNLSIAPSSIA
Q9CGA7_LACLA/46-510---------------------.NKLVDSLEEVVLKT.VKDGMTISFHHHFREGDYVFNKVMRIIIDHGFKDLRIAPSSLT
CILA_HAEIN/33-498---------------------DRKLCTSLEEAIKRSGLKDGMTVSFHHAFRGGDFVVNMVMNKIAEMGFKNLTLASSSLI
CILA_ECOLI/43-508---------------------DRKLCANLEEAIRRSGLQDGMTVSFHHAFRGGDLTVNMVMDVIAKMGFKNLTLASSSLS
Q9KTT9_VIBCH/66-531---------------------SRKVKSSIREAIVDLGLKDGMTISFHHAFRGGDKTVNLVMEVIAELGIKNLTLASSSLT

PF01144

SCOA_XANCP/13-225--------------------------------------------------------------------------------
GCTB_ACIFV/10-224--------------------------------------------------------------------------------
GCTA_ACIFV/4-241--------------------------------------------------------------------------------
Q9Y916_AERPE/14-262--------------------------------------------------------------------------------
SCOT_CAEEL/300-499--------------------------------------------------------------------------------
SCOB_HELPY/2-198--------------------------------------------------------------------------------
YODS_BACSU/7-219--------------------------------------------------------------------------------
Q9RZA0_DEIRA/23-234--------------------------------------------------------------------------------
ATOA_HAEIN/4-200--------------------------------------------------------------------------------
CTFA_CLOAB/5-216--------------------------------------------------------------------------------
CTFB_CLOAB/9-205--------------------------------------------------------------------------------
PCAI_ACIAD/6-219--------------------------------------------------------------------------------
SCOT1_HUMAN/43-272--------------------------------------------------------------------------------
Q973S5_SULTO/3-202--------------------------------------------------------------------------------
Q9RZ86_DEIRA/5-217--------------------------------------------------------------------------------
SCOA_BACSU/5-216--------------------------------------------------------------------------------
PCAJ_ACIAD/8-206--------------------------------------------------------------------------------
SCOT1_HUMAN/302-501--------------------------------------------------------------------------------
YDIF_ECOLI/15-253--------------------------------------------------------------------------------
SCOT_CAEEL/40-271--------------------------------------------------------------------------------
SCOB_BACSU/5-202--------------------------------------------------------------------------------
Q9XAM7_STRCO/5-234--------------------------------------------------------------------------------
Y1199_ARCFU/148-369--------------------------------------------------------------------------------
Q8PDH3_XANCP/7-217--------------------------------------------------------------------------------
Q8RGS9_FUSNN/11-226--------------------------------------------------------------------------------
SCOA_HELPY/5-216--------------------------------------------------------------------------------
ATOD_HAEIN/5-216--------------------------------------------------------------------------------
Q8F685_LEPIN/8-247--------------------------------------------------------------------------------
Q9W058_DROME/37-266--------------------------------------------------------------------------------
Q97Z51_SULSO/6-206--------------------------------------------------------------------------------
ATOD_ECOLI/5-216--------------------------------------------------------------------------------
Q98EM4_RHILO/9-219--------------------------------------------------------------------------------
Q92TL1_RHIME/7-217--------------------------------------------------------------------------------
A5VGV2_SPHWW/10-217--------------------------------------------------------------------------------
A6M018_CLOB8/11-214--------------------------------------------------------------------------------
Y3551_MYCTU/6-233--------------------------------------------------------------------------------
SCOB_MYCTU/9-204--------------------------------------------------------------------------------
SCOA_MYCTU/6-233--------------------------------------------------------------------------------
Q88FX5_PSEPK/6-218--------------------------------------------------------------------------------
S6BGT4_PSERE/8-217--------------------------------------------------------------------------------

PF00455

Q98FV5_RHILO/86-240--------------------------------------------------------------------------------
A9CFA5_AGRFC/78-235--------------------------------------------------------------------------------
A9CH78_AGRFC/78-237--------------------------------------------------------------------------------
Q98JJ0_RHILO/76-235--------------------------------------------------------------------------------
Q8EUZ1_MYCPE/77-233--------------------------------------------------------------------------------
Q98AQ9_RHILO/74-232--------------------------------------------------------------------------------
Q8Y5F7_LISMO/74-230--------------------------------------------------------------------------------
Q8Y9Y5_LISMO/74-233--------------------------------------------------------------------------------
Q89SG7_BRADU/74-233--------------------------------------------------------------------------------
Q98M65_RHILO/73-232--------------------------------------------------------------------------------
Q7VVL2_BORPE/74-233--------------------------------------------------------------------------------
ACCR_AGRFC/77-237--------------------------------------------------------------------------------
Q9X0F8_THEMA/73-233--------------------------------------------------------------------------------
Q8EMN4_OCEIH/74-231--------------------------------------------------------------------------------
Q8R736_CALS4/74-232--------------------------------------------------------------------------------
Q8ES05_OCEIH/74-231--------------------------------------------------------------------------------
FRUR_BACSU/74-232--------------------------------------------------------------------------------
Q8ESW8_OCEIH/75-233--------------------------------------------------------------------------------
Q986N7_RHILO/100-258--------------------------------------------------------------------------------
Q988Q4_RHILO/55-214--------------------------------------------------------------------------------
A9CHG2_AGRFC/75-234--------------------------------------------------------------------------------
Q98GA9_RHILO/78-237--------------------------------------------------------------------------------
Q7D3J6_AGRFC/74-233--------------------------------------------------------------------------------
Q92UW3_RHIME/80-239--------------------------------------------------------------------------------
Q98BY9_RHILO/73-232--------------------------------------------------------------------------------
Q986T2_RHILO/74-233--------------------------------------------------------------------------------
Q9RZP5_DEIRA/82-243--------------------------------------------------------------------------------
Q9K3L7_STRCO/73-239--------------------------------------------------------------------------------
Q9AD80_STRCO/62-221--------------------------------------------------------------------------------
Q5UXV7_HALMA/72-230--------------------------------------------------------------------------------
Q5V513_HALMA/74-231--------------------------------------------------------------------------------
Q5YVT8_NOCFA/75-235--------------------------------------------------------------------------------
YULB_BACSU/74-232--------------------------------------------------------------------------------
LACR_STAA8/75-234--------------------------------------------------------------------------------
ULAR_ECOLI/75-231--------------------------------------------------------------------------------
AGAR_ECOLI/88-247--------------------------------------------------------------------------------
DEOR_ECOLI/76-232--------------------------------------------------------------------------------
FUCR_ECOLI/75-233--------------------------------------------------------------------------------
YIHW_ECOLI/78-237--------------------------------------------------------------------------------
SGCR_ECOLI/79-236--------------------------------------------------------------------------------
IOLR_BACSU/72-231--------------------------------------------------------------------------------
YGBI_ECOLI/75-232--------------------------------------------------------------------------------
YDJF_ECOLI/76-233--------------------------------------------------------------------------------
GLCR_BACSU/75-231--------------------------------------------------------------------------------
Q2G240_STAA8/76-232--------------------------------------------------------------------------------
Q2YIQ5_BRUA2/76-232--------------------------------------------------------------------------------
Q2YIY1_BRUA2/81-239--------------------------------------------------------------------------------
Q2YLA3_BRUA2/76-232--------------------------------------------------------------------------------
Q32AN5_SHIDS/73-232--------------------------------------------------------------------------------
Q32CM1_SHIDS/74-232--------------------------------------------------------------------------------
Q32GP8_SHIDS/68-227--------------------------------------------------------------------------------
GLPR_PSEAE/74-231--------------------------------------------------------------------------------
Q7CFX9_YERPE/75-232--------------------------------------------------------------------------------
Q7CGX6_YERPE/76-234--------------------------------------------------------------------------------
Q7CHA9_YERPE/76-237--------------------------------------------------------------------------------
Q7CHG1_YERPE/76-235--------------------------------------------------------------------------------
Q7CKA8_YERPE/91-249--------------------------------------------------------------------------------
Q8DN15_STRR6/75-235--------------------------------------------------------------------------------
Q8DPP7_STRR6/78-234--------------------------------------------------------------------------------
Q8DQ97_STRR6/74-227--------------------------------------------------------------------------------
Q8DRC4_STRR6/83-243--------------------------------------------------------------------------------
Q8PDH7_XANCP/77-235--------------------------------------------------------------------------------
Q8R8Q0_CALS4/73-230--------------------------------------------------------------------------------
Q8Y4U4_LISMO/74-229--------------------------------------------------------------------------------
Q8YA06_LISMO/78-236--------------------------------------------------------------------------------
Q8YA14_LISMO/74-233--------------------------------------------------------------------------------
Q928R7_LISMO/75-232--------------------------------------------------------------------------------
Q97EY9_CLOAB/77-234--------------------------------------------------------------------------------
Q97F00_CLOAB/78-235--------------------------------------------------------------------------------
Q97F05_CLOAB/78-235--------------------------------------------------------------------------------
Q97J56_CLOAB/68-226--------------------------------------------------------------------------------
Q97J82_CLOAB/75-231--------------------------------------------------------------------------------
Q97MG7_CLOAB/76-233--------------------------------------------------------------------------------
Q97MS8_CLOAB/74-235--------------------------------------------------------------------------------
Q9HT24_PSEAE/78-233--------------------------------------------------------------------------------
Q9I3M2_PSEAE/74-231--------------------------------------------------------------------------------
Q9JYJ2_NEIMB/75-234--------------------------------------------------------------------------------
Q9K3N4_STRCO/82-247--------------------------------------------------------------------------------
Q9KL10_VIBCH/75-233--------------------------------------------------------------------------------
Q9KMS3_VIBCH/75-231--------------------------------------------------------------------------------
Q9KRT3_VIBCH/76-234--------------------------------------------------------------------------------
Q9KUM9_VIBCH/81-237--------------------------------------------------------------------------------
Q9KYU7_STRCO/74-233--------------------------------------------------------------------------------
Q9S2D1_STRCO/76-233--------------------------------------------------------------------------------
Q9X9X5_STRCO/79-237--------------------------------------------------------------------------------
Q9ZC48_YERPE/76-232--------------------------------------------------------------------------------

PF02550

O28424_ARCFU/3-199--------------------------------------------------------------------------------
O29120_ARCFU/9-201--------------------------------------------------------------------------------
P73661_SYNY3/6-196--------------------------------------------------------------------------------
ACH1_YEAST/12-230--------------------------------------------------------------------------------
SCPC_ECOLI/1-213--------------------------------------------------------------------------------

PF01008

EI2BD_MOUSE/219-510--------------------------------------------------------------------------------
R15PI_METJA/22-292--------------------------------------------------------------------------------
EI2BB_YEAST/33-358--------------------------------------------------------------------------------
MTNA_BACSU/49-337--------------------------------------------------------------------------------
MTNA_ARCFU/41-327--------------------------------------------------------------------------------
EI2BA_HUMAN/15-293--------------------------------------------------------------------------------
MTNA_SYNY3/51-343--------------------------------------------------------------------------------
MTNA_METTH/44-310--------------------------------------------------------------------------------
MTNA_CAEEL/66-357--------------------------------------------------------------------------------
EI2BA_CAEEL/15-293--------------------------------------------------------------------------------
EI2BA_YEAST/15-292--------------------------------------------------------------------------------
EI2BD_YEAST/285-637--------------------------------------------------------------------------------
MTNA_METJA/48-319--------------------------------------------------------------------------------
EI2BB_RABIT/27-333--------------------------------------------------------------------------------
MTNA_YEAST/49-399--------------------------------------------------------------------------------
EI2BD_SCHPO/156-452--------------------------------------------------------------------------------
Q5V075_HALMA/195-460--------------------------------------------------------------------------------
R15PI_ARCFU/15-284--------------------------------------------------------------------------------

PF06026

B3MF62_DROAN/94-270--------------------------------------------------------------------------------
B4KS42_DROMO/101-277--------------------------------------------------------------------------------
RPIA_BURPS/53-222--------------------------------------------------------------------------------
RPIA_METJA/51-220--------------------------------------------------------------------------------
K4L1A8_SIMAS/53-215--------------------------------------------------------------------------------
D0KYM3_HALNC/50-214--------------------------------------------------------------------------------
D5MHI2_9BACT/41-208--------------------------------------------------------------------------------
G7M4M9_9CLOT/48-219--------------------------------------------------------------------------------
V5UL52_9BURK/53-222--------------------------------------------------------------------------------
RPIA_STAEQ/52-222--------------------------------------------------------------------------------
RPIA_CHLAA/55-225--------------------------------------------------------------------------------
E8WXH2_GRATM/47-217--------------------------------------------------------------------------------
RPIA_RHOPB/50-225--------------------------------------------------------------------------------
H8MW96_CORCM/57-227--------------------------------------------------------------------------------
RPIA_SHELP/49-213--------------------------------------------------------------------------------
C6XGM4_LIBAP/50-224--------------------------------------------------------------------------------
U5H8J3_USTV1/122-297--------------------------------------------------------------------------------
N0BJC6_9EURY/47-217--------------------------------------------------------------------------------
H0PXY1_9RHOO/49-213--------------------------------------------------------------------------------
RPIA_RHILO/50-224--------------------------------------------------------------------------------
I3UDK7_ADVKW/56-221--------------------------------------------------------------------------------
E4X352_OIKDI/53-229--------------------------------------------------------------------------------
C7R992_KANKD/49-211--------------------------------------------------------------------------------
K9ZYM6_DEIPD/53-221--------------------------------------------------------------------------------
RPIA_LEPCP/49-214--------------------------------------------------------------------------------
A0RTM4_CENSY/52-220--------------------------------------------------------------------------------
RPIA_HAEIN/49-214--------------------------------------------------------------------------------
S2J2W4_MUCC1/53-230--------------------------------------------------------------------------------
RPIA_LACRD/52-220--------------------------------------------------------------------------------
RPIA_PHOPR/49-213--------------------------------------------------------------------------------
G4RF46_PELHB/49-224--------------------------------------------------------------------------------
A9V4I9_MONBE/88-261--------------------------------------------------------------------------------
F2I5Y3_AERUA/48-215--------------------------------------------------------------------------------
G2MHG7_9ARCH/54-222--------------------------------------------------------------------------------
C6XK92_HIRBI/49-225--------------------------------------------------------------------------------
C4R764_PICPG/66-245--------------------------------------------------------------------------------
D3E2P7_METRM/49-218--------------------------------------------------------------------------------
W8KJT3_HALHR/50-214--------------------------------------------------------------------------------
E0SPG1_IGNAA/58-230--------------------------------------------------------------------------------
RPIA_HALWD/54-223--------------------------------------------------------------------------------
T0N5R5_9EURY/50-215--------------------------------------------------------------------------------
D2A0V2_TRICA/53-227--------------------------------------------------------------------------------
R7ELE2_9BACE/67-233--------------------------------------------------------------------------------
T0LRI8_9EURY/54-219--------------------------------------------------------------------------------
A4YX18_BRASO/48-223--------------------------------------------------------------------------------
W1Q6V8_OGAPD/53-229--------------------------------------------------------------------------------
J7Q837_METSZ/64-239--------------------------------------------------------------------------------
S5YAN5_PARAH/56-230--------------------------------------------------------------------------------
RPIA_RHOPA/50-225--------------------------------------------------------------------------------
W0JVE5_9EURY/51-218--------------------------------------------------------------------------------
RPIA_PEDPA/51-220--------------------------------------------------------------------------------
S2JUJ5_MUCC1/54-231--------------------------------------------------------------------------------
U3U6Y6_9ENTR/49-214--------------------------------------------------------------------------------
RPIA_BAUCH/49-214--------------------------------------------------------------------------------
K9SSM9_9SYNE/57-227--------------------------------------------------------------------------------
D5EB20_METMS/56-224--------------------------------------------------------------------------------
J9W6I1_LACBU/52-220--------------------------------------------------------------------------------
G0VA31_NAUCC/62-239--------------------------------------------------------------------------------
A1B891_PARDP/56-230--------------------------------------------------------------------------------
RPIA_DICNV/49-213--------------------------------------------------------------------------------
K7SFG2_GLUOY/48-220--------------------------------------------------------------------------------
C5M9K4_CANTT/70-245--------------------------------------------------------------------------------
C7JF40_ACEP3/57-228--------------------------------------------------------------------------------
RPIA_LACC3/51-220--------------------------------------------------------------------------------
A9SR64_PHYPA/70-245--------------------------------------------------------------------------------
F3Y8A6_MELPT/48-218--------------------------------------------------------------------------------
D8RIH7_SELML/81-253--------------------------------------------------------------------------------
RPIA_STRMU/49-217--------------------------------------------------------------------------------
Q2FVT0_STAA8/52-222--------------------------------------------------------------------------------
E2BIQ5_HARSA/33-208--------------------------------------------------------------------------------
RPIA_BACSK/48-216--------------------------------------------------------------------------------
R9T971_9EURY/48-216--------------------------------------------------------------------------------
RPIA_DEBHA/69-245--------------------------------------------------------------------------------
E9G3C7_DAPPU/53-228--------------------------------------------------------------------------------
M1XYN2_NATM8/55-227--------------------------------------------------------------------------------
B7VHI7_VIBTL/94-259--------------------------------------------------------------------------------
Q8I3W2_PLAF7/51-226--------------------------------------------------------------------------------
A3DN78_STAMF/53-223--------------------------------------------------------------------------------
K5XRW6_AGABU/63-240--------------------------------------------------------------------------------
U5QS13_9CYAN/54-225--------------------------------------------------------------------------------
E3NWK8_CAERE/55-230--------------------------------------------------------------------------------
D7EAR3_METEZ/57-226--------------------------------------------------------------------------------
R5EWG7_9GAMM/48-213--------------------------------------------------------------------------------
A6X0Q4_OCHA4/51-225--------------------------------------------------------------------------------
K4AIV0_SETIT/101-286--------------------------------------------------------------------------------
D6S665_9LACO/56-223--------------------------------------------------------------------------------
D3RQX1_ALLVD/48-212--------------------------------------------------------------------------------
D5X4J8_THIK1/49-213--------------------------------------------------------------------------------
R5VQ59_9PORP/67-230--------------------------------------------------------------------------------
D1Z1V9_METPS/54-222--------------------------------------------------------------------------------
A1RX06_THEPD/46-219--------------------------------------------------------------------------------
Q4UBE3_THEAN/56-233--------------------------------------------------------------------------------
V5WM65_9SPIO/65-247--------------------------------------------------------------------------------
D2RI11_ARCPA/48-216--------------------------------------------------------------------------------
RPIA_PROMP/47-218--------------------------------------------------------------------------------
B2IHK8_BEII9/53-228--------------------------------------------------------------------------------
RPIA_OLICO/50-225--------------------------------------------------------------------------------
RPIA_PICGU/64-240--------------------------------------------------------------------------------
K1VP09_TRIAC/61-234--------------------------------------------------------------------------------
I4YBK0_WALMC/145-321--------------------------------------------------------------------------------
RPIA_CAUSK/47-220--------------------------------------------------------------------------------
F6HTS6_VITVI/101-277--------------------------------------------------------------------------------
M4DCW1_BRARP/79-256--------------------------------------------------------------------------------
RPIA_METRJ/50-224--------------------------------------------------------------------------------
B5Y3N7_PHATC/98-280--------------------------------------------------------------------------------
H9UGB7_SPIAZ/58-234--------------------------------------------------------------------------------
RPIA_THERP/50-221--------------------------------------------------------------------------------
RPIA_METPP/49-213--------------------------------------------------------------------------------
L0I9N5_HALRX/54-222--------------------------------------------------------------------------------
X2H3T4_9NEIS/50-214--------------------------------------------------------------------------------
D7DSD0_METV3/58-228--------------------------------------------------------------------------------
T1HW83_RHOPR/84-259--------------------------------------------------------------------------------
A9RL35_PHYPA/31-216--------------------------------------------------------------------------------
V9VTU6_9RHOB/56-231--------------------------------------------------------------------------------
Q4MZ63_THEPA/56-234--------------------------------------------------------------------------------
RPIA_SODGM/49-213--------------------------------------------------------------------------------
K9XKW8_9CHRO/57-227--------------------------------------------------------------------------------
K5W1L5_PHACS/65-241--------------------------------------------------------------------------------
RPIA_ALKEH/50-214--------------------------------------------------------------------------------
E8UX17_TERSS/51-221--------------------------------------------------------------------------------
RPIA_KORCO/48-217--------------------------------------------------------------------------------
U5T5D8_9GAMM/49-213--------------------------------------------------------------------------------
RPIA_VIBPA/49-213--------------------------------------------------------------------------------
E5SAM9_TRISP/143-319--------------------------------------------------------------------------------
F2UBB3_SALR5/70-247--------------------------------------------------------------------------------
E1QRN8_VULDI/53-227--------------------------------------------------------------------------------
RPIA_BURXL/53-222--------------------------------------------------------------------------------
C1CUX0_DEIDV/53-221--------------------------------------------------------------------------------
E1VFV9_9GAMM/49-213--------------------------------------------------------------------------------
D9Q2B6_ACIS3/51-222--------------------------------------------------------------------------------
S6C126_9GAMM/49-213--------------------------------------------------------------------------------
F6HFJ9_VITVI/87-263--------------------------------------------------------------------------------
U1N8Y7_ASCSU/112-290--------------------------------------------------------------------------------
Q8SR79_ENCCU/35-195--------------------------------------------------------------------------------
RPIA_THEEB/55-223--------------------------------------------------------------------------------
Q11IC0_CHESB/51-225--------------------------------------------------------------------------------
A6LVZ7_CLOB8/47-215--------------------------------------------------------------------------------
B9I0V6_POPTR/93-277--------------------------------------------------------------------------------
RPIA_LARHH/50-214--------------------------------------------------------------------------------
RPIA_DESAA/53-223--------------------------------------------------------------------------------
RPIA_DINSH/56-231--------------------------------------------------------------------------------
R5PSN2_9BURK/55-218--------------------------------------------------------------------------------
H8GLH3_METAL/47-217--------------------------------------------------------------------------------
K3Y9J6_SETIT/66-248--------------------------------------------------------------------------------
RPIA_BUCBP/49-213--------------------------------------------------------------------------------
U5N777_9BURK/52-220--------------------------------------------------------------------------------
RPIA_METB6/55-226--------------------------------------------------------------------------------
F9VP11_SULTO/46-214--------------------------------------------------------------------------------
RPIA_RHOFT/60-228--------------------------------------------------------------------------------
D9S606_FIBSS/55-226--------------------------------------------------------------------------------
A8I636_AZOC5/111-286--------------------------------------------------------------------------------
R9SLS4_9EURY/48-217--------------------------------------------------------------------------------
G8ZWF9_TORDC/75-252--------------------------------------------------------------------------------
R5JU55_9BACE/67-230--------------------------------------------------------------------------------
E6U2Y3_ETHHY/42-213--------------------------------------------------------------------------------
F7XM76_METZD/57-225--------------------------------------------------------------------------------
RPIA_RUTMC/49-214--------------------------------------------------------------------------------
RPIA_YARLI/58-236--------------------------------------------------------------------------------
V5SCR1_9RHIZ/50-225--------------------------------------------------------------------------------
G4QMA8_GLANF/49-213--------------------------------------------------------------------------------
RPIA_THIDA/48-212--------------------------------------------------------------------------------
A8IRQ1_CHLRE/82-257--------------------------------------------------------------------------------
Q8ZXY8_PYRAE/44-218--------------------------------------------------------------------------------
W8RXL1_9RHOB/56-231--------------------------------------------------------------------------------
R6UK51_9FIRM/42-213--------------------------------------------------------------------------------
K8ENG0_CARML/47-216--------------------------------------------------------------------------------
B8ELA7_METSB/53-228--------------------------------------------------------------------------------
H3CYY4_TETNG/53-228--------------------------------------------------------------------------------
F8J7J2_HYPSM/50-225--------------------------------------------------------------------------------
U6B5B2_9RHIZ/50-224--------------------------------------------------------------------------------
RPIA_HALMA/53-220--------------------------------------------------------------------------------
C7PIS1_CHIPD/51-219--------------------------------------------------------------------------------
I1MGA3_SOYBN/93-278--------------------------------------------------------------------------------
M1MZH8_9CLOT/50-221--------------------------------------------------------------------------------
RPIA_LACPL/51-219--------------------------------------------------------------------------------
D3HMT7_LEGLN/47-211--------------------------------------------------------------------------------
Q0C4A9_HYPNA/53-230--------------------------------------------------------------------------------
U9SW08_RHIID/55-228--------------------------------------------------------------------------------
J3LWN1_ORYBR/36-221--------------------------------------------------------------------------------
Q4FT49_PSYA2/48-213--------------------------------------------------------------------------------
R6B3B3_9CLOT/67-229--------------------------------------------------------------------------------
E4NRI2_HALBP/54-223--------------------------------------------------------------------------------
D0N1R6_PHYIT/55-229--------------------------------------------------------------------------------
A7AMM8_BABBO/53-227--------------------------------------------------------------------------------
R4K5G7_CLOPA/48-219--------------------------------------------------------------------------------
A3CVB5_METMJ/49-220--------------------------------------------------------------------------------
E6X8C9_CELAD/51-219--------------------------------------------------------------------------------
F4LL35_TREBD/63-237--------------------------------------------------------------------------------
F4B7Z8_ACIHW/47-219--------------------------------------------------------------------------------
G3ARG1_SPAPN/52-227--------------------------------------------------------------------------------
F8HYA4_WEIKK/48-216--------------------------------------------------------------------------------
E3F3G7_KETVY/65-240--------------------------------------------------------------------------------
A4YJ22_METS5/48-219--------------------------------------------------------------------------------
I1XM21_METNJ/57-227--------------------------------------------------------------------------------
RPIA_BACAN/47-216--------------------------------------------------------------------------------
RPIA_BORBU/52-221--------------------------------------------------------------------------------
B9SKS7_RICCO/78-256--------------------------------------------------------------------------------
G2SRP4_LACRR/51-220--------------------------------------------------------------------------------
RPIA_CAEEL/64-240--------------------------------------------------------------------------------
K0SNV8_THAOC/54-236--------------------------------------------------------------------------------
I6NDH1_ERECY/69-246--------------------------------------------------------------------------------
Q1H2B3_METFK/48-218--------------------------------------------------------------------------------
RPIA_THISH/49-213--------------------------------------------------------------------------------
RPIA2_OCEIH/50-216--------------------------------------------------------------------------------
G2KTC4_LACSM/362-530--------------------------------------------------------------------------------
W8X9J3_CASDE/54-218--------------------------------------------------------------------------------
I0A1J3_FERFK/50-220--------------------------------------------------------------------------------
K9Z869_CYAAP/56-224--------------------------------------------------------------------------------
Q3IDN5_PSEHT/83-247--------------------------------------------------------------------------------
L0JQT2_NATP1/54-229--------------------------------------------------------------------------------
RPIA_ARCFU/50-221--------------------------------------------------------------------------------
G7LZ92_9CLOT/50-221--------------------------------------------------------------------------------
D8PA73_9BACT/59-229--------------------------------------------------------------------------------
G0W6N5_NAUDC/71-248--------------------------------------------------------------------------------
G4SXW6_META2/48-217--------------------------------------------------------------------------------
RPIA_METCA/49-213--------------------------------------------------------------------------------
F7PF08_9EURY/53-222--------------------------------------------------------------------------------
D8LDV8_ECTSI/54-228--------------------------------------------------------------------------------
A0A023B5X1_GRENI/97-274--------------------------------------------------------------------------------
R7L548_9CLOT/66-232--------------------------------------------------------------------------------
A8Q7R0_MALGO/62-237--------------------------------------------------------------------------------
RPIA_LACAC/56-223--------------------------------------------------------------------------------
Q1AY26_RUBXD/56-224--------------------------------------------------------------------------------
G7LY74_9CLOT/48-219--------------------------------------------------------------------------------
B0UBT0_METS4/49-223--------------------------------------------------------------------------------
Q0SCN2_RHOJR/56-232--------------------------------------------------------------------------------
D3PRM8_MEIRD/53-219--------------------------------------------------------------------------------
G4RM57_THETK/46-222--------------------------------------------------------------------------------
C4Y2N7_CLAL4/69-244--------------------------------------------------------------------------------
Q0W3M2_METAR/58-226--------------------------------------------------------------------------------
M9S9J2_9EURY/54-223--------------------------------------------------------------------------------
S2JGP9_MUCC1/65-242--------------------------------------------------------------------------------
RPIA_CUPNH/53-222--------------------------------------------------------------------------------
RPIA_PICST/55-230--------------------------------------------------------------------------------
RPIA_MARHV/53-217--------------------------------------------------------------------------------
Q035R3_LACC3/44-210--------------------------------------------------------------------------------
Q2FLE9_METHJ/57-228--------------------------------------------------------------------------------
Q97ZD9_SULSO/48-216--------------------------------------------------------------------------------
RPIA_AROAE/49-213--------------------------------------------------------------------------------
D5U1E6_THEAM/52-228--------------------------------------------------------------------------------
J0DZG3_LOALO/63-242--------------------------------------------------------------------------------
B9QKE6_TOXGO/54-249--------------------------------------------------------------------------------
RPIA_TOLAT/49-213--------------------------------------------------------------------------------
G0EH21_PYRF1/55-229--------------------------------------------------------------------------------
A0A0D2VTJ8_CAPO3/132-305--------------------------------------------------------------------------------
K9SHM7_9CYAN/60-232--------------------------------------------------------------------------------
A8A9K9_IGNH4/47-217--------------------------------------------------------------------------------
E5SB58_TRISP/33-210--------------------------------------------------------------------------------
D9QGR4_BRESC/47-221--------------------------------------------------------------------------------
B9DLS8_STACT/50-220--------------------------------------------------------------------------------
RPIA_ASHGO/71-248--------------------------------------------------------------------------------
RPIA_STRSY/49-217--------------------------------------------------------------------------------
RPIA_THET8/54-221--------------------------------------------------------------------------------
M5C6T3_THACB/108-284--------------------------------------------------------------------------------
M0Y9D9_HORVD/96-282--------------------------------------------------------------------------------
F9ZVU0_METMM/51-220--------------------------------------------------------------------------------
T0UHY2_9STRE/43-211--------------------------------------------------------------------------------
T1IW49_STRMM/51-225--------------------------------------------------------------------------------
Q1D141_MYXXD/60-230--------------------------------------------------------------------------------
RPIA_PSEF5/53-217--------------------------------------------------------------------------------
M0TZ20_MUSAM/31-216--------------------------------------------------------------------------------
I6SWV8_ENTHA/48-217--------------------------------------------------------------------------------
RPIA_METAC/57-225--------------------------------------------------------------------------------
RPIA_RHOS4/56-231--------------------------------------------------------------------------------
R6M617_9BACE/67-231--------------------------------------------------------------------------------
F2GCW9_ALTMD/49-213--------------------------------------------------------------------------------
X1X1C6_ACYPI/49-213--------------------------------------------------------------------------------
D8LXP9_BLAHO/52-223--------------------------------------------------------------------------------
C9A9E9_ENTCA/48-217--------------------------------------------------------------------------------
W0JTR2_9EURY/54-238--------------------------------------------------------------------------------
K0IFH0_NITGG/62-228--------------------------------------------------------------------------------
E8SF16_STAPH/51-221--------------------------------------------------------------------------------
RPIA_POLSJ/62-234--------------------------------------------------------------------------------
F4PQH6_DICFS/53-227--------------------------------------------------------------------------------
M9SAJ3_9EURY/47-210--------------------------------------------------------------------------------
G7MC82_9CLOT/47-215--------------------------------------------------------------------------------
C5AQI6_METEA/50-225--------------------------------------------------------------------------------
F9VGE3_LACGL/49-217--------------------------------------------------------------------------------
F8F3R8_TRECH/53-227--------------------------------------------------------------------------------
H9IUK6_BOMMO/52-227--------------------------------------------------------------------------------
L0HHU8_METFS/55-226--------------------------------------------------------------------------------
I1YH59_METFJ/55-224--------------------------------------------------------------------------------
W0RDQ8_9BACT/54-222--------------------------------------------------------------------------------
C7P232_HALMD/53-220--------------------------------------------------------------------------------
D7CXV5_TRURR/54-220--------------------------------------------------------------------------------
RPIA_RHISN/50-224--------------------------------------------------------------------------------
RPIA_CANGA/75-252--------------------------------------------------------------------------------
F3YU57_DESAF/56-226--------------------------------------------------------------------------------
RPIA_STRA5/49-217--------------------------------------------------------------------------------
Q1LN72_CUPMC/49-213--------------------------------------------------------------------------------
E0VP73_PEDHC/118-294--------------------------------------------------------------------------------
K4B7U4_SOLLC/96-281--------------------------------------------------------------------------------
R7BZ16_9BURK/48-213--------------------------------------------------------------------------------
B5IA06_ACIB4/51-219--------------------------------------------------------------------------------
RPIA_HALSA/52-219--------------------------------------------------------------------------------
C5DMD9_LACTC/92-269--------------------------------------------------------------------------------
L0AA43_CALLD/51-220--------------------------------------------------------------------------------
D7A674_STAND/52-227--------------------------------------------------------------------------------
I3TCM9_THEC1/55-227--------------------------------------------------------------------------------
G0L9M6_ZOBGA/50-218--------------------------------------------------------------------------------
RPIA_ROSDO/56-231--------------------------------------------------------------------------------
M5DVR1_9GAMM/53-217--------------------------------------------------------------------------------
W0EYB5_9SPHI/49-217--------------------------------------------------------------------------------
E5AQX1_BURRH/75-245--------------------------------------------------------------------------------
RPIA_CHLTR/62-231--------------------------------------------------------------------------------
RPIA_STRGC/49-217--------------------------------------------------------------------------------
S0EY17_CHTCT/49-220--------------------------------------------------------------------------------
D5ALR5_RHOCB/56-231--------------------------------------------------------------------------------
C6VYP5_DYAFD/51-218--------------------------------------------------------------------------------
RPIA_NITHX/50-225--------------------------------------------------------------------------------
RPIA2_YERPE/53-229--------------------------------------------------------------------------------
D1CC48_THET1/51-220--------------------------------------------------------------------------------
T0V876_9STRE/49-217--------------------------------------------------------------------------------
RPIA_ENTFA/48-217--------------------------------------------------------------------------------
RPIA_CHRVO/50-214--------------------------------------------------------------------------------
RPIA_BLOFL/50-215--------------------------------------------------------------------------------
A8NMB3_COPC7/98-275--------------------------------------------------------------------------------
C4ZP88_THASP/49-213--------------------------------------------------------------------------------
D3S1R9_FERPA/46-214--------------------------------------------------------------------------------
RPIA_MARMM/50-225--------------------------------------------------------------------------------
A8MCS2_CALMQ/49-224--------------------------------------------------------------------------------
H1YW83_9EURY/51-222--------------------------------------------------------------------------------
K0RC06_THAOC/94-276--------------------------------------------------------------------------------
A5FY01_ACICJ/53-221--------------------------------------------------------------------------------
A0A068XPT4_HYMMI/82-258--------------------------------------------------------------------------------
A5K9L2_PLAVS/51-226--------------------------------------------------------------------------------
M4EY56_BRARP/82-268--------------------------------------------------------------------------------
W0BAQ9_9GAMM/47-211--------------------------------------------------------------------------------
J3TF98_9ENTR/49-213--------------------------------------------------------------------------------
G2IZW6_PSEUL/50-214--------------------------------------------------------------------------------
RPIA_XYLFA/47-210--------------------------------------------------------------------------------
G7V788_THELD/48-218--------------------------------------------------------------------------------
A2SQC5_METLZ/52-219--------------------------------------------------------------------------------
C7PJG1_CHIPD/49-221--------------------------------------------------------------------------------
C5CXD5_VARPS/68-236--------------------------------------------------------------------------------
F8KWT0_PARAV/52-221--------------------------------------------------------------------------------
U5MRI4_CLOSA/54-225--------------------------------------------------------------------------------
I0AN47_IGNAJ/47-215--------------------------------------------------------------------------------
Q47A42_DECAR/63-227--------------------------------------------------------------------------------
A9A2Y6_NITMS/51-216--------------------------------------------------------------------------------
I2FUT0_USTH4/82-257--------------------------------------------------------------------------------
F4BTP9_METCG/55-220--------------------------------------------------------------------------------
RPIA_LACBA/51-220--------------------------------------------------------------------------------
G8PQ27_PSEUV/49-223--------------------------------------------------------------------------------
A9H338_GLUDA/56-227--------------------------------------------------------------------------------
D1C4M5_SPHTD/55-227--------------------------------------------------------------------------------
W1NXJ9_AMBTC/82-258--------------------------------------------------------------------------------
C6CYP4_PAESJ/48-216--------------------------------------------------------------------------------
A7IKA7_XANP2/69-244--------------------------------------------------------------------------------
RPIA_STRMK/47-210--------------------------------------------------------------------------------
G8QPQ4_DECSP/53-217--------------------------------------------------------------------------------
RPIA_GLOVI/50-220--------------------------------------------------------------------------------
RPIA_THICR/49-214--------------------------------------------------------------------------------
L0PFR9_PNEJ8/65-240--------------------------------------------------------------------------------
RPIA_FRATT/54-219--------------------------------------------------------------------------------
L0EWH5_LIBCB/45-219--------------------------------------------------------------------------------
W5JTH8_ANODA/99-275--------------------------------------------------------------------------------
I0HZU4_CALAS/53-223--------------------------------------------------------------------------------
G4L3E1_TETHN/48-216--------------------------------------------------------------------------------
M1MGW5_9CLOT/47-215--------------------------------------------------------------------------------
D4G7S8_RIEPU/49-213--------------------------------------------------------------------------------
RPIA_DEIRA/52-220--------------------------------------------------------------------------------
F9ZXG6_METMM/48-216--------------------------------------------------------------------------------
D0MER0_RHOM4/56-228--------------------------------------------------------------------------------
RPIA_TREDE/58-234--------------------------------------------------------------------------------
X6MIV2_RETFI/61-244--------------------------------------------------------------------------------
F4GMC6_PUSST/54-218--------------------------------------------------------------------------------
Q0BTU6_GRABC/50-222--------------------------------------------------------------------------------
W6RAI3_9RHIZ/50-224--------------------------------------------------------------------------------
W1Q961_OGAPD/51-223--------------------------------------------------------------------------------
F7QLK3_9BRAD/51-226--------------------------------------------------------------------------------
E8UAB6_DEIML/52-220--------------------------------------------------------------------------------
T2GAB9_DESGI/59-229--------------------------------------------------------------------------------
J7S9W0_KAZNA/74-251--------------------------------------------------------------------------------
M4CUR6_BRARP/74-251--------------------------------------------------------------------------------
Q12XU6_METBU/57-225--------------------------------------------------------------------------------
J3TZ31_9ENTR/49-213--------------------------------------------------------------------------------
RPIA_METTH/52-221--------------------------------------------------------------------------------
M4FG93_BRARP/93-269--------------------------------------------------------------------------------
G2KV06_LACSM/53-221--------------------------------------------------------------------------------
C4XRS4_DESMR/57-226--------------------------------------------------------------------------------
D8J531_HALJB/54-221--------------------------------------------------------------------------------
G8TEW3_NIAKG/51-220--------------------------------------------------------------------------------
J1L527_9EURY/55-219--------------------------------------------------------------------------------
G2SRV1_LACRR/44-202--------------------------------------------------------------------------------
U6EAE1_9EURY/63-232--------------------------------------------------------------------------------
Q31QQ3_SYNE7/62-233--------------------------------------------------------------------------------
H3ZMP8_THELN/50-221--------------------------------------------------------------------------------
S6A8V6_9SPIO/62-238--------------------------------------------------------------------------------
I2GY20_TETBL/77-255--------------------------------------------------------------------------------
RPIA_SCHPO/61-236--------------------------------------------------------------------------------
K4M6Y4_9EURY/76-244--------------------------------------------------------------------------------
C6XCW0_METGS/48-218--------------------------------------------------------------------------------
F9ZME5_ACICS/49-213--------------------------------------------------------------------------------
D3QZ19_MAGIU/64-256--------------------------------------------------------------------------------
D3SEL8_THISK/49-213--------------------------------------------------------------------------------
E8RQ79_ASTEC/50-224--------------------------------------------------------------------------------
F2NWS5_TRES6/60-234--------------------------------------------------------------------------------
B6JUX1_SCHJY/63-238--------------------------------------------------------------------------------
G8S1W4_ACTS5/66-231--------------------------------------------------------------------------------
M4NK33_9GAMM/49-211--------------------------------------------------------------------------------
C6WWN6_METML/48-217--------------------------------------------------------------------------------
RPIA_SPHAL/51-218--------------------------------------------------------------------------------
E8UD73_TAYEM/55-219--------------------------------------------------------------------------------
RPIA1_OCEIH/52-220--------------------------------------------------------------------------------
D3SVA8_NATMM/69-244--------------------------------------------------------------------------------
A0B633_METTP/29-193--------------------------------------------------------------------------------
I3ZAW8_TERRK/54-224--------------------------------------------------------------------------------
RPIA_PICTO/49-211--------------------------------------------------------------------------------
RPIA_PARL1/50-225--------------------------------------------------------------------------------
D5CP37_SIDLE/51-215--------------------------------------------------------------------------------
R5TAR3_9CLOT/56-224--------------------------------------------------------------------------------
RPIA_SYNPW/54-226--------------------------------------------------------------------------------
RPIA_NITEU/49-213--------------------------------------------------------------------------------
RPIA_POLSQ/52-230--------------------------------------------------------------------------------
R5YZJ2_9FIRM/42-213--------------------------------------------------------------------------------
RPIA_DICDI/49-225--------------------------------------------------------------------------------
E7KIH3_YEASA/23-200--------------------------------------------------------------------------------
E4U7T3_OCEP5/52-221--------------------------------------------------------------------------------
M1A5R9_SOLTU/83-260--------------------------------------------------------------------------------
H6NMT6_9BACL/47-215--------------------------------------------------------------------------------
RPIA_EXIS2/49-214--------------------------------------------------------------------------------
W1NX77_AMBTC/31-216--------------------------------------------------------------------------------
F6QWW6_CIOIN/61-235--------------------------------------------------------------------------------
J3LTE4_ORYBR/98-282--------------------------------------------------------------------------------
F2J5C1_POLGS/81-255--------------------------------------------------------------------------------
RPIA_PROMA/54-224--------------------------------------------------------------------------------
Q4XZ68_PLACH/43-218--------------------------------------------------------------------------------
T0M835_9EURY/55-221--------------------------------------------------------------------------------
A7SX61_NEMVE/50-223--------------------------------------------------------------------------------
RPIA_COLP3/49-213--------------------------------------------------------------------------------
C3YIZ9_BRAFL/53-227--------------------------------------------------------------------------------
I4Y6Z4_WALMC/89-265--------------------------------------------------------------------------------
D3E7P8_GEOS4/51-220--------------------------------------------------------------------------------
RPIA_AERHH/49-213--------------------------------------------------------------------------------
F2NQH9_MARHT/52-220--------------------------------------------------------------------------------
Q97J55_CLOAB/50-221--------------------------------------------------------------------------------
RPIA_BORPE/54-218--------------------------------------------------------------------------------
F8L7D9_SIMNZ/50-220--------------------------------------------------------------------------------
RPIA_LODEL/87-262--------------------------------------------------------------------------------
RPIA_BUCAI/49-213--------------------------------------------------------------------------------
A5WDJ0_PSYWF/48-213--------------------------------------------------------------------------------
C5E421_ZYGRC/103-280--------------------------------------------------------------------------------
R6KAA0_9BACE/67-232--------------------------------------------------------------------------------
RPIA_CRYNJ/105-288--------------------------------------------------------------------------------
R4I0M9_9ENTR/27-192--------------------------------------------------------------------------------
F2KNC4_ARCVS/49-218--------------------------------------------------------------------------------
RPIA_BIFAA/54-223--------------------------------------------------------------------------------
Q2NFM0_METST/52-220--------------------------------------------------------------------------------
A2BLS3_HYPBU/56-231--------------------------------------------------------------------------------
E1ZSN1_CHLVA/75-268--------------------------------------------------------------------------------
X4ZZX6_9BACL/47-215--------------------------------------------------------------------------------
RPIA_NEIMB/50-214--------------------------------------------------------------------------------
I2GXY8_TETBL/82-259--------------------------------------------------------------------------------
H2B0V5_KAZAF/71-248--------------------------------------------------------------------------------
F0XSQ4_GROCL/58-244--------------------------------------------------------------------------------
K0IAH2_NITGG/43-211--------------------------------------------------------------------------------
G0GBX5_SPITZ/48-222--------------------------------------------------------------------------------
Q2S577_SALRD/94-266--------------------------------------------------------------------------------
H1YDM0_9SPHI/67-233--------------------------------------------------------------------------------
M9R6A5_9RHOB/107-282--------------------------------------------------------------------------------
RPIA_MARMS/53-217--------------------------------------------------------------------------------
N0B2Z0_9RHIZ/50-225--------------------------------------------------------------------------------
H8GNV1_METAL/49-213--------------------------------------------------------------------------------
RPIA_SACD2/53-217--------------------------------------------------------------------------------
I0HPM0_RUBGI/49-214--------------------------------------------------------------------------------
E3I3Z1_RHOVT/52-227--------------------------------------------------------------------------------
B3S327_TRIAD/82-257--------------------------------------------------------------------------------
E1V466_HALED/53-217--------------------------------------------------------------------------------
RPIA_LISMO/48-217--------------------------------------------------------------------------------
K0HYL3_9BURK/55-223--------------------------------------------------------------------------------
L0DB73_SINAD/52-222--------------------------------------------------------------------------------
I1GB43_AMPQE/96-272--------------------------------------------------------------------------------
F7WZV0_9ENTR/48-215--------------------------------------------------------------------------------
RPIA_AZOSB/49-213--------------------------------------------------------------------------------
F0Y5F5_AURAN/53-236--------------------------------------------------------------------------------
V2WV49_MONRO/117-294--------------------------------------------------------------------------------
F4NUT5_BATDJ/57-224--------------------------------------------------------------------------------
I6ZP08_MELRP/52-241--------------------------------------------------------------------------------
RPIA_TERTT/53-217--------------------------------------------------------------------------------
F6D5Q0_METPW/48-217--------------------------------------------------------------------------------
RPIA_THEAC/52-221--------------------------------------------------------------------------------
M9WWF3_MANHA/49-214--------------------------------------------------------------------------------
K0KIV4_WICCF/89-265--------------------------------------------------------------------------------
F5XWJ8_RAMTT/49-217--------------------------------------------------------------------------------
F1P520_CHICK/51-225--------------------------------------------------------------------------------
Q8A699_BACTN/68-231--------------------------------------------------------------------------------
RPIA_WIGBR/49-213--------------------------------------------------------------------------------
RPIA_ACIAD/51-216--------------------------------------------------------------------------------
RPIA_ALCBS/49-213--------------------------------------------------------------------------------
R7KJK7_9BURK/49-212--------------------------------------------------------------------------------
D7DIR1_METV0/48-216--------------------------------------------------------------------------------
RPIA_COXBU/49-213--------------------------------------------------------------------------------
R6DID1_9BACE/67-232--------------------------------------------------------------------------------
G8YN53_PICSO/70-246--------------------------------------------------------------------------------
RPIA_NITMU/49-213--------------------------------------------------------------------------------
G8NWP6_GRAMM/50-220--------------------------------------------------------------------------------
Q2JK16_SYNJB/60-231--------------------------------------------------------------------------------
E4RMI9_HALHG/47-215--------------------------------------------------------------------------------
RPIA_STRU0/49-217--------------------------------------------------------------------------------
M4YU37_9EURY/54-224--------------------------------------------------------------------------------
E1SRT4_FERBD/49-213--------------------------------------------------------------------------------
G2TNQ6_BACCO/47-213--------------------------------------------------------------------------------
T0LJI5_9EURY/46-210--------------------------------------------------------------------------------
R4VWQ3_9EURY/50-228--------------------------------------------------------------------------------
D7BFY7_MEISD/53-219--------------------------------------------------------------------------------
A6LDT5_PARD8/67-229--------------------------------------------------------------------------------
RPIA_BRADU/50-229--------------------------------------------------------------------------------
RPIA_PSYIN/49-213--------------------------------------------------------------------------------
G4LWP8_SCHMA/56-232--------------------------------------------------------------------------------
D6YRJ4_WADCW/55-225--------------------------------------------------------------------------------
B3PGI3_CELJU/53-218--------------------------------------------------------------------------------
RPIA_HALLT/54-234--------------------------------------------------------------------------------
G3B6X8_CANTC/51-227--------------------------------------------------------------------------------
X4ZKY5_9BACL/47-218--------------------------------------------------------------------------------
M7NVH6_PNEMU/63-238--------------------------------------------------------------------------------
T1G2H1_HELRO/34-210--------------------------------------------------------------------------------
B8GFA6_METPE/54-225--------------------------------------------------------------------------------
D5VCE7_MORCR/51-215--------------------------------------------------------------------------------
RPIA_AERPE/52-223--------------------------------------------------------------------------------
E3GWJ6_METFV/52-219--------------------------------------------------------------------------------
RPIA_LEGPH/46-211--------------------------------------------------------------------------------
M0SLL9_MUSAM/77-246--------------------------------------------------------------------------------
E3KHK5_PUCGT/92-267--------------------------------------------------------------------------------
F6I3G7_VITVI/31-214--------------------------------------------------------------------------------
G8BV63_TETPH/74-250--------------------------------------------------------------------------------
RPIA_VANPO/73-250--------------------------------------------------------------------------------
Q5L9R3_BACFN/67-232--------------------------------------------------------------------------------
B8D3V9_DESK1/56-231--------------------------------------------------------------------------------
C1DG96_AZOVD/53-217--------------------------------------------------------------------------------
J0DD48_AURST/58-235--------------------------------------------------------------------------------
F9UTV2_LACPL/44-213--------------------------------------------------------------------------------
D3EQA2_ATETH/54-222--------------------------------------------------------------------------------
E3EIW3_PAEPS/47-215--------------------------------------------------------------------------------
B4RDL0_PHEZH/48-222--------------------------------------------------------------------------------
E8R3Z4_ISOPI/46-223--------------------------------------------------------------------------------
Q03Y20_LEUMM/48-216--------------------------------------------------------------------------------
H8L3T4_FRAAD/49-212--------------------------------------------------------------------------------
K1QVV1_CRAGI/53-228--------------------------------------------------------------------------------
G0S4N8_CHATD/70-253--------------------------------------------------------------------------------
B9SV71_RICCO/31-216--------------------------------------------------------------------------------
K8GIM2_9CYAN/57-226--------------------------------------------------------------------------------
F0YD86_AURAN/31-218--------------------------------------------------------------------------------
RPIA_PARUW/56-226--------------------------------------------------------------------------------
RPIA_PROMT/53-224--------------------------------------------------------------------------------
D8QJZ8_SCHCM/98-277--------------------------------------------------------------------------------
E0WTW1_9ENTR/49-211--------------------------------------------------------------------------------
I0DQJ4_PROSM/49-213--------------------------------------------------------------------------------
C8WXS2_ALIAD/47-215--------------------------------------------------------------------------------
Q057H5_BUCCC/48-211--------------------------------------------------------------------------------
R7IB62_9BURK/49-212--------------------------------------------------------------------------------
RPIA_NATPD/54-221--------------------------------------------------------------------------------
RPIA_AGRVS/50-224--------------------------------------------------------------------------------
A9FJ44_SORC5/54-221--------------------------------------------------------------------------------
C4K7U6_HAMD5/49-213--------------------------------------------------------------------------------
E1RIV4_METP4/53-224--------------------------------------------------------------------------------
E0TBP1_PARBH/47-221--------------------------------------------------------------------------------
A5UJW1_METS3/48-217--------------------------------------------------------------------------------
Q4J990_SULAC/47-214--------------------------------------------------------------------------------
RPIA_NITOC/49-213--------------------------------------------------------------------------------
L0KVT8_METHD/75-244--------------------------------------------------------------------------------
U4LD71_PYROM/74-243--------------------------------------------------------------------------------
Q04HC0_OENOB/54-221--------------------------------------------------------------------------------
C4WVS8_ACYPI/93-269--------------------------------------------------------------------------------
RPIA_METMP/63-233--------------------------------------------------------------------------------
A9TPW9_PHYPA/30-202--------------------------------------------------------------------------------
W4X032_ATTCE/11-187--------------------------------------------------------------------------------
K0C3P7_CYCSP/48-212--------------------------------------------------------------------------------
G7UTB3_PSEUP/49-212--------------------------------------------------------------------------------
R6FYM5_9FIRM/44-214--------------------------------------------------------------------------------
RPIA_IDILO/51-215--------------------------------------------------------------------------------
B9H933_POPTR/302-473--------------------------------------------------------------------------------
E6N4F6_9ARCH/47-216--------------------------------------------------------------------------------
Q38UZ2_LACSS/51-220--------------------------------------------------------------------------------
G7WLJ5_METH6/55-219--------------------------------------------------------------------------------
R6UYF7_9FIRM/64-231--------------------------------------------------------------------------------
G0AB06_COLFT/70-238--------------------------------------------------------------------------------
C8XJ99_NAKMY/47-205--------------------------------------------------------------------------------
E3DMJ6_HALPG/47-216--------------------------------------------------------------------------------
D8IPP5_HERSS/49-217--------------------------------------------------------------------------------
F8DCN0_HALXS/54-229--------------------------------------------------------------------------------
RPIA_META3/58-228--------------------------------------------------------------------------------
RPIA_ROSS1/52-222--------------------------------------------------------------------------------
C7RN75_ACCPU/49-213--------------------------------------------------------------------------------
RPIA_TREPA/69-245--------------------------------------------------------------------------------

PF04198

YJHU_ECOLI/63-323--------------------------------------------------------------------------------
Q9WWA6_AGRRK/83-337--------------------------------------------------------------------------------
Q9CKH2_PASMU/56-313--------------------------------------------------------------------------------
Q98GB2_RHILO/49-296--------------------------------------------------------------------------------
Q9RT33_DEIRA/86-346--------------------------------------------------------------------------------
Q986P9_RHILO/64-319--------------------------------------------------------------------------------
Q97L54_CLOAB/89-338--------------------------------------------------------------------------------
Q9CGB1_LACLA/54-307--------------------------------------------------------------------------------
Q98CZ8_RHILO/62-317--------------------------------------------------------------------------------
Q9L0Z6_STRCO/89-343--------------------------------------------------------------------------------
Q99XS9_STRP1/56-314--------------------------------------------------------------------------------
Q9CLG2_PASMU/68-318--------------------------------------------------------------------------------
LSRR_ECOLI/66-316--------------------------------------------------------------------------------
Q9KER9_BACHD/57-313--------------------------------------------------------------------------------
DEOR_BACSU/56-311--------------------------------------------------------------------------------
Q9KLX0_VIBCH/62-319--------------------------------------------------------------------------------
CGGR_BACSU/89-338--------------------------------------------------------------------------------
Q9K712_BACHD/89-338--------------------------------------------------------------------------------
Q986M3_RHILO/57-311--------------------------------------------------------------------------------
Q98FV1_RHILO/42-296--------------------------------------------------------------------------------
A6TBJ1_KLEP7/59-311--------------------------------------------------------------------------------
A6TGS9_KLEP7/60-317--------------------------------------------------------------------------------
D5AUX6_RHOCB/60-314--------------------------------------------------------------------------------
Q1GB28_LACDA/125-376--------------------------------------------------------------------------------
Q2G033_STAA8/91-337--------------------------------------------------------------------------------
Q2YIQ4_BRUA2/58-310--------------------------------------------------------------------------------
Q3J1R9_RHOS4/62-317--------------------------------------------------------------------------------
Q8DRC3_STRR6/59-313--------------------------------------------------------------------------------

PF16957

G8NWE8_GRAMM/11-551--------------------------------------------------------------------------------
A4G553_HERAR/3-550--------------------------------------------------------------------------------
F2F9P2_SOLSS/9-549--------------------------------------------------------------------------------
R5PZQ8_9BURK/9-554--------------------------------------------------------------------------------
H0Q3G8_9RHOO/10-553--------------------------------------------------------------------------------
D7A7S5_STAND/12-556--------------------------------------------------------------------------------
A1T0S7_PSYIN/7-551--------------------------------------------------------------------------------
Q21AG5_RHOPB/6-554--------------------------------------------------------------------------------
Q20XM1_RHOPB/13-552--------------------------------------------------------------------------------
Q478I4_DECAR/8-554--------------------------------------------------------------------------------
D3FW15_BACPE/11-551--------------------------------------------------------------------------------
A4VRZ1_PSEU5/10-555--------------------------------------------------------------------------------
B2JLU6_BURP8/23-563--------------------------------------------------------------------------------
B6JFK2_OLICO/14-556--------------------------------------------------------------------------------
C5APL2_METEA/4-548--------------------------------------------------------------------------------
C9A847_ENTCA/7-547--------------------------------------------------------------------------------
E0SJB1_DICD3/11-551--------------------------------------------------------------------------------
Q5ZSU0_LEGPH/3-548--------------------------------------------------------------------------------
Q63VB2_BURPS/4-548--------------------------------------------------------------------------------
Q8P4U7_XANCP/4-548--------------------------------------------------------------------------------
R7CR99_9FIRM/10-557--------------------------------------------------------------------------------

PF01182

Q3SH15_THIDA/10-221--------------------------------------------------------------------------------
B8HJV3_CYAP4/9-228--------------------------------------------------------------------------------
6PGL1_ORYSJ/38-272--------------------------------------------------------------------------------
D0LNM1_HALO1/16-236--------------------------------------------------------------------------------
B1XIZ0_SYNP2/9-227--------------------------------------------------------------------------------
B4M2H3_DROVI/15-234--------------------------------------------------------------------------------
B8GMY0_THISH/13-236--------------------------------------------------------------------------------
A8KYS2_FRASN/18-247--------------------------------------------------------------------------------
Q5NMF8_ZYMMO/10-233--------------------------------------------------------------------------------
C1EGM8_MICSR/42-262--------------------------------------------------------------------------------
C5B9U1_EDWI9/8-229--------------------------------------------------------------------------------
Q7NGI9_GLOVI/9-228--------------------------------------------------------------------------------
C7MSN0_SACVD/11-245--------------------------------------------------------------------------------
Q39SD7_GEOMG/6-227--------------------------------------------------------------------------------
A0L802_MAGMM/12-233--------------------------------------------------------------------------------
Q7V1T4_PROMP/18-234--------------------------------------------------------------------------------
C1D789_LARHH/8-223--------------------------------------------------------------------------------
A5FY02_ACICJ/12-233--------------------------------------------------------------------------------
Q3A631_PELCD/13-221--------------------------------------------------------------------------------
B0C6U0_ACAM1/9-229--------------------------------------------------------------------------------
A1BIC7_CHLPD/11-265--------------------------------------------------------------------------------
D2Q4L4_KRIFD/10-274--------------------------------------------------------------------------------
D0LCU1_GORB4/9-234--------------------------------------------------------------------------------
A9WT44_RENSM/9-251--------------------------------------------------------------------------------
Q1AZZ4_RUBXD/7-229--------------------------------------------------------------------------------
B8FL61_DESAA/16-238--------------------------------------------------------------------------------
B4S4M1_PROA2/7-257--------------------------------------------------------------------------------
A1SJQ5_NOCSJ/11-231--------------------------------------------------------------------------------
B3RVC2_TRIAD/8-226--------------------------------------------------------------------------------
D0L091_HALNC/12-236--------------------------------------------------------------------------------
D5URS5_TSUPD/12-243--------------------------------------------------------------------------------
Q1IWW4_DEIGD/7-212--------------------------------------------------------------------------------
C3ZBQ0_BRAFL/569-794--------------------------------------------------------------------------------
B1VDQ7_CORU7/27-269--------------------------------------------------------------------------------
Q2JHW7_SYNJB/10-224--------------------------------------------------------------------------------
A2G0T4_TRIVA/480-702--------------------------------------------------------------------------------
B2IE85_BEII9/11-231--------------------------------------------------------------------------------
A9UYD4_MONBE/167-386--------------------------------------------------------------------------------
A1U1P6_MARHV/16-235--------------------------------------------------------------------------------
A4S930_OSTLU/33-252--------------------------------------------------------------------------------
Q165T6_ROSDO/7-221--------------------------------------------------------------------------------
C6VSE7_DYAFD/7-229--------------------------------------------------------------------------------
B2GH88_KOCRD/13-243--------------------------------------------------------------------------------
Q3SP94_NITWN/19-240--------------------------------------------------------------------------------
A1AR88_PELPD/9-231--------------------------------------------------------------------------------
A6TTT0_ALKMQ/9-234--------------------------------------------------------------------------------
Q31GB5_THICR/12-219--------------------------------------------------------------------------------
C5BV30_BEUC1/10-236--------------------------------------------------------------------------------
Q89FE0_BRADU/14-235--------------------------------------------------------------------------------
6PGL_DICDI/11-234--------------------------------------------------------------------------------
E3D833_GARV3/17-261--------------------------------------------------------------------------------
A0JWQ2_ARTS2/11-250--------------------------------------------------------------------------------
Q60CQ2_METCA/8-232--------------------------------------------------------------------------------
D3Q4S0_STANL/10-238--------------------------------------------------------------------------------
B0T0C3_CAUSK/15-233--------------------------------------------------------------------------------
B9RWU5_RICCO/17-246--------------------------------------------------------------------------------
Q0V513_PHANO/11-243--------------------------------------------------------------------------------
A8LLP7_DINSH/7-222--------------------------------------------------------------------------------
C5E1Z3_LACTC/131-360--------------------------------------------------------------------------------
Q6A7F7_PROAC/10-227--------------------------------------------------------------------------------
6PGL_RAT/13-237--------------------------------------------------------------------------------
A3HVL3_9BACT/7-226--------------------------------------------------------------------------------
Q482L5_COLP3/8-229--------------------------------------------------------------------------------
Q602U1_METCA/13-226--------------------------------------------------------------------------------
A7RMK1_NEMVE/10-232--------------------------------------------------------------------------------
A8Y0B4_CAEBR/9-229--------------------------------------------------------------------------------
C1MQ42_MICPC/10-239--------------------------------------------------------------------------------
B4SF86_PELPB/47-298--------------------------------------------------------------------------------
B1LXU6_METRJ/11-233--------------------------------------------------------------------------------
A6X608_OCHA4/9-230--------------------------------------------------------------------------------
Q2SQ14_HAHCH/16-233--------------------------------------------------------------------------------
C7R459_JONDD/9-233--------------------------------------------------------------------------------
C1DRP8_AZOVD/18-236--------------------------------------------------------------------------------
A5FAH5_FLAJ1/6-228--------------------------------------------------------------------------------
A9PA91_POPTR/14-244--------------------------------------------------------------------------------
6PGL_TREPA/7-224--------------------------------------------------------------------------------
Q7UM40_RHOBA/5-223--------------------------------------------------------------------------------
C3ZB29_BRAFL/10-239--------------------------------------------------------------------------------
B8C1W9_THAPS/20-270--------------------------------------------------------------------------------
Q5FQ99_GLUOX/14-235--------------------------------------------------------------------------------
Q6NH39_CORDI/8-228--------------------------------------------------------------------------------
A8IFM0_AZOC5/18-239--------------------------------------------------------------------------------
B0UFD2_METS4/12-231--------------------------------------------------------------------------------
Q08ZT9_STIAD/9-213--------------------------------------------------------------------------------
Q2IHT3_ANADE/13-235--------------------------------------------------------------------------------
D1CEH8_THET1/9-231--------------------------------------------------------------------------------
Q31QV8_SYNE7/9-229--------------------------------------------------------------------------------
C1DDK6_AZOVD/18-235--------------------------------------------------------------------------------
A6WC51_KINRD/12-239--------------------------------------------------------------------------------
B1MC71_MYCA9/10-236--------------------------------------------------------------------------------
D2SF51_GEOOG/27-257--------------------------------------------------------------------------------
D1BS91_XYLCX/10-239--------------------------------------------------------------------------------
Q5YTR6_NOCFA/29-251--------------------------------------------------------------------------------
Q0BTV3_GRABC/17-236--------------------------------------------------------------------------------
B2FL79_STRMK/16-238--------------------------------------------------------------------------------
A5BJC3_VITVI/17-249--------------------------------------------------------------------------------
B8IN69_METNO/12-232--------------------------------------------------------------------------------
Q8DJZ4_THEEB/10-227--------------------------------------------------------------------------------
D2AVA1_STRRD/10-237--------------------------------------------------------------------------------
Q4Q8S1_LEIMA/12-256--------------------------------------------------------------------------------
Q312M1_DESAG/38-260--------------------------------------------------------------------------------
A5EXD3_DICNV/9-224--------------------------------------------------------------------------------
A0LDZ7_MAGMM/13-230--------------------------------------------------------------------------------
C4LIR1_CORK4/27-277--------------------------------------------------------------------------------
B3EN23_CHLPB/5-259--------------------------------------------------------------------------------
B7FPL4_PHATC/11-262--------------------------------------------------------------------------------
B8ELV8_METSB/11-231--------------------------------------------------------------------------------
G6PE_HUMAN/558-782--------------------------------------------------------------------------------
A5VAC4_SPHWW/10-232--------------------------------------------------------------------------------
Q4K7U0_PSEF5/18-235--------------------------------------------------------------------------------
C5FTG3_ARTOC/12-245--------------------------------------------------------------------------------
C7LRB5_DESBD/8-228--------------------------------------------------------------------------------
D2QID0_SPILD/7-229--------------------------------------------------------------------------------
C1FA85_ACIC5/13-240--------------------------------------------------------------------------------
B4GTC9_DROPE/14-235--------------------------------------------------------------------------------
6PGL_CAEEL/21-242--------------------------------------------------------------------------------
6PGL_XYLFA/15-237--------------------------------------------------------------------------------
F2G576_ALTMD/9-228--------------------------------------------------------------------------------
A9BG97_PETMO/7-228--------------------------------------------------------------------------------
C7MCP6_BRAFD/326-560--------------------------------------------------------------------------------
B2J9Q0_NOSP7/9-228--------------------------------------------------------------------------------
D7B103_NOCDD/10-238--------------------------------------------------------------------------------
B3RLE2_TRIAD/566-785--------------------------------------------------------------------------------
SOL4_YEAST/8-241--------------------------------------------------------------------------------
C5B1S2_METEA/13-236--------------------------------------------------------------------------------
Q2Y8J3_NITMU/15-226--------------------------------------------------------------------------------
A0LTY4_ACIC1/9-232--------------------------------------------------------------------------------
Q6FQZ7_CANGA/8-232--------------------------------------------------------------------------------
Q16H01_AEDAE/9-231--------------------------------------------------------------------------------
Q11M12_CHESB/10-230--------------------------------------------------------------------------------
A0QWX6_MYCS2/10-234--------------------------------------------------------------------------------
B9L0S4_THERP/9-234--------------------------------------------------------------------------------
B5HF46_STRPR/11-241--------------------------------------------------------------------------------
Q01VT6_SOLUE/9-230--------------------------------------------------------------------------------
A2EC78_TRIVA/488-712--------------------------------------------------------------------------------
A6L9R0_PARD8/7-228--------------------------------------------------------------------------------
A8HQW1_CHLRE/5-232--------------------------------------------------------------------------------
Q210H8_RHOPB/9-229--------------------------------------------------------------------------------
Q7D149_AGRFC/9-230--------------------------------------------------------------------------------
B0REI8_CLAMS/11-237--------------------------------------------------------------------------------
Q6CXV1_KLULA/8-237--------------------------------------------------------------------------------
Q4CQA8_TRYCC/11-251--------------------------------------------------------------------------------
Q5LRS8_RUEPO/7-221--------------------------------------------------------------------------------
C8X5S3_DESRD/22-247--------------------------------------------------------------------------------
Q0C1F0_HYPNA/9-234--------------------------------------------------------------------------------
Q1IMT5_KORVE/19-241--------------------------------------------------------------------------------
C5DTU9_ZYGRC/7-240--------------------------------------------------------------------------------
B3PCY8_CELJU/8-232--------------------------------------------------------------------------------
A9TLR4_PHYPA/4-237--------------------------------------------------------------------------------
Q28QX5_JANSC/8-222--------------------------------------------------------------------------------
Q0ALB6_MARMM/15-240--------------------------------------------------------------------------------
Q1QTX1_CHRSD/7-223--------------------------------------------------------------------------------
A7TEX2_VANPO/8-238--------------------------------------------------------------------------------
Q2H6B6_CHAGB/11-242--------------------------------------------------------------------------------
Q7QGR5_ANOGA/12-234--------------------------------------------------------------------------------
A7RLB1_NEMVE/507-732--------------------------------------------------------------------------------
B3MQE2_DROAN/14-235--------------------------------------------------------------------------------
Q1H2F6_METFK/21-229--------------------------------------------------------------------------------
A9F2S9_SORC5/11-231--------------------------------------------------------------------------------
A4CNJ0_ROBBH/7-226--------------------------------------------------------------------------------
Q758H7_ASHGO/101-325--------------------------------------------------------------------------------
6PGL_RHILO/17-236--------------------------------------------------------------------------------
A1A127_BIFAA/13-255--------------------------------------------------------------------------------
A3N1V8_ACTP2/9-222--------------------------------------------------------------------------------
A6L429_BACV8/12-221--------------------------------------------------------------------------------
B2UK49_RALPJ/10-223--------------------------------------------------------------------------------
B7J926_ACIF2/14-216--------------------------------------------------------------------------------
B7VN92_VIBTL/13-227--------------------------------------------------------------------------------
C0ZZG4_RHOE4/11-231--------------------------------------------------------------------------------
D7GEP6_PROFC/12-230--------------------------------------------------------------------------------
E7QFR9_YEASZ/10-234--------------------------------------------------------------------------------
F7BV51_XENTR/350-572--------------------------------------------------------------------------------
H9JWK2_BOMMO/8-220--------------------------------------------------------------------------------
J9ZCI7_LEPFM/20-235--------------------------------------------------------------------------------
M1F8P0_9ALTE/19-237--------------------------------------------------------------------------------
C6XF26_LIBAP/11-223--------------------------------------------------------------------------------
6PGL_MYCTU/10-235--------------------------------------------------------------------------------
Q385D6_TRYB2/12-245--------------------------------------------------------------------------------
Q3JBF3_NITOC/9-228--------------------------------------------------------------------------------
Q46LF9_PROMT/11-224--------------------------------------------------------------------------------
Q59PZ6_CANAL/10-232--------------------------------------------------------------------------------
Q5LE34_BACFN/13-219--------------------------------------------------------------------------------
Q5ZYF5_LEGPH/14-220--------------------------------------------------------------------------------
Q6LS72_PHOPR/10-227--------------------------------------------------------------------------------
Q7V812_PROMM/11-220--------------------------------------------------------------------------------
Q83GH9_TROWT/52-269--------------------------------------------------------------------------------
Q887J1_PSESM/19-235--------------------------------------------------------------------------------
Q8EE99_SHEON/12-226--------------------------------------------------------------------------------
Q8G730_BIFLO/41-300--------------------------------------------------------------------------------
Q8NQ61_CORGL/9-224--------------------------------------------------------------------------------
6PGL_DROME/15-227--------------------------------------------------------------------------------
6PGL_THEMA/14-216--------------------------------------------------------------------------------
R5U357_9BACE/14-221--------------------------------------------------------------------------------
R6K673_9BACE/10-218--------------------------------------------------------------------------------

PF02589

Q30YW4_DESAG/23-221--------------------------------------------------------------------------------
Q72A59_DESVH/13-211--------------------------------------------------------------------------------
A0LET5_SYNFM/13-211--------------------------------------------------------------------------------
A8ZY31_DESOH/13-211--------------------------------------------------------------------------------
Q6AQM0_DESPS/13-211--------------------------------------------------------------------------------
A5N319_CLOK5/16-217--------------------------------------------------------------------------------
A3DDG8_CLOTH/16-211--------------------------------------------------------------------------------
Q18C30_PEPD6/15-209--------------------------------------------------------------------------------
A6LXE8_CLOB8/15-209--------------------------------------------------------------------------------
B8D0K4_HALOH/12-205--------------------------------------------------------------------------------
A4XID0_CALS8/13-207--------------------------------------------------------------------------------
A5I080_CLOBH/11-201--------------------------------------------------------------------------------
A7HK56_FERNB/14-207--------------------------------------------------------------------------------
A6LMB1_THEM4/14-207--------------------------------------------------------------------------------
A8F3V4_PSELT/14-204--------------------------------------------------------------------------------
A5MYV3_CLOK5/13-207--------------------------------------------------------------------------------
Q97IL7_CLOAB/13-207--------------------------------------------------------------------------------
Q188D0_PEPD6/13-206--------------------------------------------------------------------------------
Q892L7_CLOTE/13-207--------------------------------------------------------------------------------
A8MGY9_ALKOO/13-207--------------------------------------------------------------------------------
A5N989_CLOK5/13-207--------------------------------------------------------------------------------
A5I1I2_CLOBH/13-207--------------------------------------------------------------------------------
Q897Y1_CLOTE/13-206--------------------------------------------------------------------------------
B8CXT8_HALOH/13-207--------------------------------------------------------------------------------
B8I8V5_CLOCE/13-218--------------------------------------------------------------------------------
Q7MR09_WOLSU/5-199--------------------------------------------------------------------------------
Q251U6_DESHY/5-199--------------------------------------------------------------------------------
Q97M44_CLOAB/13-207--------------------------------------------------------------------------------
B5EEH8_GEOBB/16-211--------------------------------------------------------------------------------
A5G901_GEOUR/16-211--------------------------------------------------------------------------------
A5CYU3_PELTS/16-210--------------------------------------------------------------------------------
A0PZA2_CLONN/13-207--------------------------------------------------------------------------------
Q6M046_METMP/13-207--------------------------------------------------------------------------------
A4J2Z4_DESRM/12-207--------------------------------------------------------------------------------
A6TQ94_ALKMQ/5-197--------------------------------------------------------------------------------
A8MHS3_ALKOO/5-197--------------------------------------------------------------------------------
A7I305_CAMHC/3-194--------------------------------------------------------------------------------
A8EV54_ARCB4/1-193--------------------------------------------------------------------------------
A6LYD8_CLOB8/3-195--------------------------------------------------------------------------------
B9LU40_HALLT/27-212--------------------------------------------------------------------------------
Q5V6G7_HALMA/27-212--------------------------------------------------------------------------------
A3CXV8_METMJ/32-217--------------------------------------------------------------------------------
Q8T2H5_DICDI/31-220--------------------------------------------------------------------------------
Q8T2H6_DICDI/31-218--------------------------------------------------------------------------------
Q9BI24_DICDI/30-213--------------------------------------------------------------------------------
A8LFX8_FRASN/21-203--------------------------------------------------------------------------------
Q6ABE0_PROAC/50-223--------------------------------------------------------------------------------
A1ATQ9_PELPD/34-209--------------------------------------------------------------------------------
B5EIV8_GEOBB/2-175--------------------------------------------------------------------------------
A4J2C5_DESRM/13-186--------------------------------------------------------------------------------
A5D032_PELTS/17-190--------------------------------------------------------------------------------
Q30WA8_DESAG/6-203--------------------------------------------------------------------------------
Q6APH5_DESPS/6-194--------------------------------------------------------------------------------
A0LF89_SYNFM/7-180--------------------------------------------------------------------------------
Q1ARS5_RUBXD/44-220--------------------------------------------------------------------------------
LUTC_BACP2/52-237--------------------------------------------------------------------------------
Q836K1_ENTFA/52-236--------------------------------------------------------------------------------
LUTC_OCEIH/49-232--------------------------------------------------------------------------------
Q1WT28_LACS1/55-240--------------------------------------------------------------------------------
Q6LPN1_PHOPR/50-245--------------------------------------------------------------------------------
Q24VR0_DESHY/42-220--------------------------------------------------------------------------------
Q2SMI8_HAHCH/39-216--------------------------------------------------------------------------------
Q47V41_COLP3/52-226--------------------------------------------------------------------------------
Q3IEG6_PSEHT/41-215--------------------------------------------------------------------------------
Q7NTM5_CHRVO/41-217--------------------------------------------------------------------------------
Q4KII4_PSEF5/42-220--------------------------------------------------------------------------------
Q2VZP0_MAGSA/37-213--------------------------------------------------------------------------------
Q5F884_NEIG1/42-219--------------------------------------------------------------------------------
Q310K5_DESAG/40-217--------------------------------------------------------------------------------
Q6AIU4_DESPS/43-219--------------------------------------------------------------------------------
Q72B57_DESVH/44-220--------------------------------------------------------------------------------
Q0PC62_CAMJE/47-218--------------------------------------------------------------------------------
A0RPC6_CAMFF/42-213--------------------------------------------------------------------------------
Q7VIF4_HELHP/38-218--------------------------------------------------------------------------------
A7IG69_XANP2/53-223--------------------------------------------------------------------------------
Q11LF2_CHESB/52-222--------------------------------------------------------------------------------
A1SVG8_PSYIN/32-224--------------------------------------------------------------------------------
A8MDI5_CALMQ/50-279--------------------------------------------------------------------------------
A2BLD6_HYPBU/71-302--------------------------------------------------------------------------------
Q9YFI8_AERPE/68-298--------------------------------------------------------------------------------
A7HA97_ANADF/64-283--------------------------------------------------------------------------------
Q7MVA5_PORGI/38-257--------------------------------------------------------------------------------
Q47F70_DECAR/78-303--------------------------------------------------------------------------------
Q6ABE1_PROAC/94-322--------------------------------------------------------------------------------
Q47IA5_DECAR/76-304--------------------------------------------------------------------------------
A1B665_PARDP/69-294--------------------------------------------------------------------------------
A5G2K5_ACICJ/68-296--------------------------------------------------------------------------------
A0LED1_SYNFM/69-293--------------------------------------------------------------------------------
A5V1N8_ROSS1/68-292--------------------------------------------------------------------------------
Q67TB4_SYMTH/77-301--------------------------------------------------------------------------------
Q1ARS4_RUBXD/86-314--------------------------------------------------------------------------------
Q01UG1_SOLUE/67-291--------------------------------------------------------------------------------
Q1IN28_KORVE/68-293--------------------------------------------------------------------------------
LUTB_BACLD/70-295--------------------------------------------------------------------------------
LUTB_OCEIH/70-294--------------------------------------------------------------------------------
Q6D5W9_PECAS/70-294--------------------------------------------------------------------------------
Q81ND6_BACAN/69-293--------------------------------------------------------------------------------
Q24VR1_DESHY/69-293--------------------------------------------------------------------------------
A5VIG9_LACRD/70-294--------------------------------------------------------------------------------
B9LU44_HALLT/67-296--------------------------------------------------------------------------------
Q3ISD5_NATPD/64-299--------------------------------------------------------------------------------
A5GDG8_GEOUR/64-287--------------------------------------------------------------------------------
A5D031_PELTS/65-292--------------------------------------------------------------------------------
Q3AEY7_CARHZ/62-279--------------------------------------------------------------------------------
Q24W82_DESHY/65-292--------------------------------------------------------------------------------
Q8RIN1_FUSNN/65-294--------------------------------------------------------------------------------
Q726S3_DESVH/69-294--------------------------------------------------------------------------------
Q74CQ3_GEOSL/61-280--------------------------------------------------------------------------------
A4J1M6_DESRM/66-295--------------------------------------------------------------------------------
A5UNQ3_METS3/51-284--------------------------------------------------------------------------------
O26243_METTH/51-280--------------------------------------------------------------------------------
A4J1M5_DESRM/47-258--------------------------------------------------------------------------------
A5HZY1_CLOBH/14-207--------------------------------------------------------------------------------
A5VIG8_LACRD/58-241--------------------------------------------------------------------------------
A9WGW7_CHLAA/44-229--------------------------------------------------------------------------------
C6XV06_PEDHD/69-292--------------------------------------------------------------------------------
M9X3V9_MANHA/50-227--------------------------------------------------------------------------------
O24950_HELPY/71-295--------------------------------------------------------------------------------
Q0PC61_CAMJE/70-292--------------------------------------------------------------------------------
Q24WP5_DESHY/68-297--------------------------------------------------------------------------------
Q5SIK3_THET8/69-291--------------------------------------------------------------------------------
Q63NH7_BURPS/72-300--------------------------------------------------------------------------------
Q63SM7_BURPS/67-292--------------------------------------------------------------------------------
Q6LSA7_PHOPR/40-218--------------------------------------------------------------------------------
LUTB_BACCR/71-293--------------------------------------------------------------------------------
Q81ND7_BACAN/48-228--------------------------------------------------------------------------------
LUTC_BACAN/51-236--------------------------------------------------------------------------------
Q8XH83_CLOPE/14-207--------------------------------------------------------------------------------
Q9WXZ9_THEMA/17-208--------------------------------------------------------------------------------
R5KLF2_9CLOT/15-206--------------------------------------------------------------------------------
R5QY75_9FIRM/13-205--------------------------------------------------------------------------------
R5UE40_9FIRM/14-205--------------------------------------------------------------------------------
R6MWQ8_9CLOT/13-227--------------------------------------------------------------------------------
R7FYW0_9FIRM/15-206--------------------------------------------------------------------------------
U5L6H3_9BACI/52-235--------------------------------------------------------------------------------

PF01812

MTHFS_HUMAN/10-198--------------------------------------------------------------------------------
5FCLL_ARATH/92-290--------------------------------------------------------------------------------
MTHFS_CAEEL/8-197--------------------------------------------------------------------------------
YQGN_BACSU/2-179--------------------------------------------------------------------------------
O83692_TREPA/4-207--------------------------------------------------------------------------------
Q9RKA5_STRCO/12-197--------------------------------------------------------------------------------
5FCL_HAEIN/6-187--------------------------------------------------------------------------------
MTHFS_RABIT/10-198--------------------------------------------------------------------------------
O26306_METTH/134-322--------------------------------------------------------------------------------
FTHC_YEAST/4-203--------------------------------------------------------------------------------
Q9YFU3_AERPE/7-205--------------------------------------------------------------------------------
P73038_SYNY3/3-179--------------------------------------------------------------------------------
O67621_AQUAE/3-175--------------------------------------------------------------------------------
Q9ZD82_RICPR/3-172--------------------------------------------------------------------------------
O05575_MYCTU/6-186--------------------------------------------------------------------------------
H2VFJ2_CHLTE/8-188--------------------------------------------------------------------------------
Q7AQM9_MYCLE/6-186--------------------------------------------------------------------------------
Q8DVY5_STRMU/3-174--------------------------------------------------------------------------------

PF13336

A6LV90_CLOB8/275-428--------------------------------------------------------------------------------
B8F9H4_DESAA/272-425--------------------------------------------------------------------------------
Q7MWD3_PORGI/273-426--------------------------------------------------------------------------------
B8CZD4_HALOH/271-424--------------------------------------------------------------------------------
Q3ACH6_CARHZ/275-428--------------------------------------------------------------------------------
D2QBR0_SPILD/268-420--------------------------------------------------------------------------------
D7BE02_MEISD/284-437--------------------------------------------------------------------------------
Q898H0_CLOTE/272-425--------------------------------------------------------------------------------
A0L8K8_MAGMM/267-420--------------------------------------------------------------------------------
A5N390_CLOK5/276-429--------------------------------------------------------------------------------
Q15V19_PSEA6/267-420--------------------------------------------------------------------------------
Q39QG7_GEOMG/278-431--------------------------------------------------------------------------------
B3QTM9_CHLT3/265-417--------------------------------------------------------------------------------
A9AXP3_HERA2/264-416--------------------------------------------------------------------------------
Q8CXQ9_LEPIN/270-422--------------------------------------------------------------------------------
A5URR7_ROSS1/272-425--------------------------------------------------------------------------------
Q24WU2_DESHY/311-467--------------------------------------------------------------------------------
C7M4J2_CAPOD/265-417--------------------------------------------------------------------------------
Q5QXA2_IDILO/264-417--------------------------------------------------------------------------------
B9M8N9_GEODF/274-427--------------------------------------------------------------------------------
B9M9H7_GEODF/264-417--------------------------------------------------------------------------------
A7H923_ANADF/265-417--------------------------------------------------------------------------------
C7RL22_ACCPU/274-427--------------------------------------------------------------------------------
Q3ANX0_CHLCH/266-418--------------------------------------------------------------------------------
A0M1A3_GRAFK/267-419--------------------------------------------------------------------------------
Q0IG02_AEDAE/314-468--------------------------------------------------------------------------------
D1C4I7_SPHTD/264-417--------------------------------------------------------------------------------
A7HKG2_FERNB/273-426--------------------------------------------------------------------------------
A6GWR2_FLAPJ/265-417--------------------------------------------------------------------------------
A8F649_PSELT/274-427--------------------------------------------------------------------------------
B5ECU8_GEOBB/278-431--------------------------------------------------------------------------------
A1KBF4_AZOSB/272-425--------------------------------------------------------------------------------
Q2LSP1_SYNAS/286-439--------------------------------------------------------------------------------
A4ASU6_MARSH/266-418--------------------------------------------------------------------------------
Q01VE3_SOLUE/270-423--------------------------------------------------------------------------------
B5E7S1_GEOBB/278-431--------------------------------------------------------------------------------
B2TLD8_CLOBB/272-425--------------------------------------------------------------------------------
A0B6T6_METTP/284-437--------------------------------------------------------------------------------
A4J1E7_DESRM/279-435--------------------------------------------------------------------------------
D6Z2N5_DESAT/282-435--------------------------------------------------------------------------------
Q1IT47_KORVE/273-426--------------------------------------------------------------------------------
B5Y607_COPPD/273-426--------------------------------------------------------------------------------
D3FVG7_BACPE/268-421--------------------------------------------------------------------------------
Q0AVM5_SYNWW/279-434--------------------------------------------------------------------------------
Q2FRF0_METHJ/278-431--------------------------------------------------------------------------------
B2A2S6_NATTJ/273-426--------------------------------------------------------------------------------
B9JLD2_AGRRK/284-435--------------------------------------------------------------------------------
A3HTS6_9BACT/267-419--------------------------------------------------------------------------------
A9GMK9_SORC5/277-430--------------------------------------------------------------------------------
C7PPM1_CHIPD/268-420--------------------------------------------------------------------------------
C0QJK6_DESAH/274-427--------------------------------------------------------------------------------
D2VMT8_NAEGR/323-475--------------------------------------------------------------------------------
B2HRD6_MYCMM/288-439--------------------------------------------------------------------------------
A9BH20_PETMO/279-432--------------------------------------------------------------------------------
Q0AW71_SYNWW/272-425--------------------------------------------------------------------------------
Q4A5M6_MYCS5/287-438--------------------------------------------------------------------------------
A4J4L6_DESRM/279-435--------------------------------------------------------------------------------
E6VZH2_DESAO/276-429--------------------------------------------------------------------------------
Q220T6_RHOFT/272-425--------------------------------------------------------------------------------
A4AMZ0_MARSH/269-421--------------------------------------------------------------------------------
D4IP35_9BACT/266-418--------------------------------------------------------------------------------
A1U877_MARHV/284-436--------------------------------------------------------------------------------
D4J7D4_9FIRM/278-438--------------------------------------------------------------------------------
D2VCN4_NAEGR/199-351--------------------------------------------------------------------------------
C6X0M3_FLAB3/276-428--------------------------------------------------------------------------------
C0QKC6_DESAH/273-426--------------------------------------------------------------------------------
C8VZ55_DESAS/277-433--------------------------------------------------------------------------------
C0QAD0_DESAH/281-437--------------------------------------------------------------------------------
A0LMU1_SYNFM/292-445--------------------------------------------------------------------------------
A9NFJ4_ACHLI/270-431--------------------------------------------------------------------------------
B8FDQ1_DESAA/279-432--------------------------------------------------------------------------------
Q3A1S1_PELCD/278-433--------------------------------------------------------------------------------
Q21W64_RHOFT/279-435--------------------------------------------------------------------------------
B8F9D7_DESAA/274-430--------------------------------------------------------------------------------
A4J5F7_DESRM/278-434--------------------------------------------------------------------------------
A8MLT0_ALKOO/317-464--------------------------------------------------------------------------------
A4J1H7_DESRM/278-434--------------------------------------------------------------------------------
Q0AW62_SYNWW/282-438--------------------------------------------------------------------------------
A8ZXP1_DESOH/277-430--------------------------------------------------------------------------------
Q0AZT0_SYNWW/278-433--------------------------------------------------------------------------------
A2SP55_METPP/278-433--------------------------------------------------------------------------------
D4KHS0_9FIRM/319-466--------------------------------------------------------------------------------
Q2RRD2_RHORT/322-473--------------------------------------------------------------------------------
A0LHR8_SYNFM/278-431--------------------------------------------------------------------------------
Q18599_CAEEL/306-460--------------------------------------------------------------------------------
A7SYK6_NEMVE/323-477--------------------------------------------------------------------------------
Q0AXU7_SYNWW/280-436--------------------------------------------------------------------------------
C4Z8H6_AGARV/279-435--------------------------------------------------------------------------------
D1B8D5_THEAS/325-472--------------------------------------------------------------------------------
Q0B052_SYNWW/278-434--------------------------------------------------------------------------------
B7QJI4_IXOSC/314-468--------------------------------------------------------------------------------
Q6AQI5_DESPS/285-438--------------------------------------------------------------------------------
B0TCP9_HELMI/277-433--------------------------------------------------------------------------------
A4J446_DESRM/283-434--------------------------------------------------------------------------------
C0QDJ7_DESAH/279-431--------------------------------------------------------------------------------
A0R5U0_MYCS2/274-430--------------------------------------------------------------------------------
Q2LPI7_SYNAS/276-429--------------------------------------------------------------------------------
A8WP03_CAEBR/305-459--------------------------------------------------------------------------------
B2W452_PYRTR/302-453--------------------------------------------------------------------------------
Q0RWG8_RHOJR/538-685--------------------------------------------------------------------------------
A1TGQ6_MYCVP/271-426--------------------------------------------------------------------------------
A5E2Y9_LODEL/243-394--------------------------------------------------------------------------------
A7HPG3_PARL1/328-491--------------------------------------------------------------------------------
D2RM64_ACIFV/277-437--------------------------------------------------------------------------------
Q0AY76_SYNWW/278-434--------------------------------------------------------------------------------
O29120_ARCFU/297-457--------------------------------------------------------------------------------
Q2SL76_HAHCH/439-606--------------------------------------------------------------------------------
ACH1_YARLI/333-484--------------------------------------------------------------------------------
O28424_ARCFU/289-449--------------------------------------------------------------------------------
A7HD82_ANADF/326-473--------------------------------------------------------------------------------
C5DU17_ZYGRC/331-482--------------------------------------------------------------------------------
D4JBB9_9FIRM/276-431--------------------------------------------------------------------------------
B5EIE5_GEOBB/327-478--------------------------------------------------------------------------------
B0DKN0_LACBS/350-501--------------------------------------------------------------------------------
B6K306_SCHJY/330-481--------------------------------------------------------------------------------
ACH1_SCHPO/330-481--------------------------------------------------------------------------------
A0LG92_SYNFM/280-432--------------------------------------------------------------------------------
Q74GS1_GEOSL/327-478--------------------------------------------------------------------------------
A5V7D2_SPHWW/272-423--------------------------------------------------------------------------------
Q0AV35_SYNWW/283-439--------------------------------------------------------------------------------
D2V812_NAEGR/332-483--------------------------------------------------------------------------------
D2RN63_ACIFV/277-434--------------------------------------------------------------------------------
B9M8L3_GEODF/333-484--------------------------------------------------------------------------------
Q6LQ13_PHOPR/472-639--------------------------------------------------------------------------------
A8ZWK6_DESOH/447-610--------------------------------------------------------------------------------
A1W2A3_ACISJ/277-426--------------------------------------------------------------------------------
B6JG54_OLICO/334-497--------------------------------------------------------------------------------
Q0VNK9_ALCBS/436-599--------------------------------------------------------------------------------
D3BTR1_POLPA/348-499--------------------------------------------------------------------------------
B8FMI7_DESAA/441-604--------------------------------------------------------------------------------
ACH1_DICDI/341-492--------------------------------------------------------------------------------
Q0BZS7_HYPNA/258-410--------------------------------------------------------------------------------
Q1DA17_MYXXD/323-474--------------------------------------------------------------------------------
A1SHN0_NOCSJ/246-396--------------------------------------------------------------------------------
C0QKG0_DESAH/440-603--------------------------------------------------------------------------------
Q88CB5_PSEPK/319-482--------------------------------------------------------------------------------
A8ZT97_DESOH/278-429--------------------------------------------------------------------------------
D0LM00_HALO1/437-597--------------------------------------------------------------------------------
Q0RK43_FRAAA/215-365--------------------------------------------------------------------------------
D1A9C8_THECD/271-421--------------------------------------------------------------------------------
Q2JCQ5_FRASC/281-431--------------------------------------------------------------------------------
Q0C1R5_HYPNA/318-481--------------------------------------------------------------------------------
C7LYG5_ACIFD/255-405--------------------------------------------------------------------------------
D2UEK6_XANAP/366-529--------------------------------------------------------------------------------
B8FN92_DESAA/282-434--------------------------------------------------------------------------------
C0QDF6_DESAH/275-427--------------------------------------------------------------------------------
C0QHQ8_DESAH/271-423--------------------------------------------------------------------------------
B0SLS6_LEPBP/320-466--------------------------------------------------------------------------------
B2FSG4_STRMK/367-531--------------------------------------------------------------------------------
B4R0Y1_DROSI/312-466--------------------------------------------------------------------------------
B5EES2_GEOBB/332-482--------------------------------------------------------------------------------
B5EIS2_GEOBB/283-439--------------------------------------------------------------------------------
D1BNH2_VEIPT/320-466--------------------------------------------------------------------------------
D3HLY9_LEGLN/281-431--------------------------------------------------------------------------------
D4K633_9FIRM/279-436--------------------------------------------------------------------------------
D4MZL1_ANAHA/279-435--------------------------------------------------------------------------------
D6DE02_CLOSC/291-448--------------------------------------------------------------------------------
F4KMH9_PORAD/277-429--------------------------------------------------------------------------------
F4KN61_PORAD/269-421--------------------------------------------------------------------------------
G4Q2X4_ACIIR/277-434--------------------------------------------------------------------------------
G4Q5N3_ACIIR/281-437--------------------------------------------------------------------------------
CAT2_CLOK5/272-424--------------------------------------------------------------------------------
Q185L2_PEPD6/271-425--------------------------------------------------------------------------------
Q24S37_DESHY/279-435--------------------------------------------------------------------------------
Q24ZX0_DESHY/273-425--------------------------------------------------------------------------------
Q3JAD8_NITOC/444-607--------------------------------------------------------------------------------
Q3SQD4_NITWN/334-497--------------------------------------------------------------------------------
Q63JS7_BURPS/286-433--------------------------------------------------------------------------------
Q6A8E8_PROAC/249-399--------------------------------------------------------------------------------
Q6N157_RHOPA/260-409--------------------------------------------------------------------------------
Q6NCD5_RHOPA/324-470--------------------------------------------------------------------------------
Q7MTJ6_PORGI/273-425--------------------------------------------------------------------------------
Q7NBY9_MYCGA/280-429--------------------------------------------------------------------------------
Q88BB0_PSESM/361-524--------------------------------------------------------------------------------
Q8EG98_SHEON/267-420--------------------------------------------------------------------------------
Q8P4W8_XANCP/323-469--------------------------------------------------------------------------------
Q8RC84_CALS4/272-425--------------------------------------------------------------------------------
Q9ZC36_YERPE/283-434--------------------------------------------------------------------------------
R5BUI5_9FIRM/274-427--------------------------------------------------------------------------------
R5SJH9_9FIRM/335-481--------------------------------------------------------------------------------
R6G778_9FIRM/279-435--------------------------------------------------------------------------------
R6R3R6_9FIRM/277-429--------------------------------------------------------------------------------
R7JML8_9BACT/267-419--------------------------------------------------------------------------------
R7JP79_9BACT/270-422--------------------------------------------------------------------------------

PF04223

Q99ZK7_STRP1/45-510NVH.EPLIDHIKNGVVTNITSSGLRDKVGAAISEGLMENPVVIRSHGGRARAIASGDIHIDVAFLGAPSSDAYGNVNGTK
Q9CGA7_LACLA/46-510NVMNDILVEAIEKGVVTNITSSGMRGTLGDVVSHGALKNPVIFRSHGGRARAIETGEIHIDVAFLGTPNADEMGNANGMD
CILA_HAEIN/33-498DSH.FPIVEHIKNGVVTKIYSSGLRGELAEQISRGLLNEPVNIHSHGGRVHLVKSGELKIDVAFLGVPCCDTFGNANGFT
CILA_ECOLI/43-508DCH.APLVEHIRQGVVTRIYTSGLRGPLAEEISRGLLAEPVQIHSHGGRVHLVQSGELNIDVAFLGVPSCDEFGNANGYT
Q9KTT9_VIBCH/66-531SCH.SPLIEHIKNGVVSKIYTSGIRGALADSISNGLLDEPVHIHSHGGRVHLIQSGELYIDMAFIGVPCCDEFGNANGFK

PF01144

SCOA_XANCP/13-225---------ADAK--------------A-----ALAGV-------V--AD-G------------Q---------------
GCTB_ACIFV/10-224---------EMQA--------------V-----TIAKQ-------I--KN-G------------Q---------------
GCTA_ACIFV/4-241---------MTLK--------------D-----AIAKY-------V--HS-G------------D---------------
Q9Y916_AERPE/14-262---------VTAE--------------E-----ALS.N-------I--RD-G------------S---------------
SCOT_CAEEL/300-499---------EIIA--------------A-----RAALE-------F--TD-G------------M---------------
SCOB_HELPY/2-198---------EAII--------------K-----RAAKE-------L--KE-G------------M---------------
YODS_BACSU/7-219---------ISID--------------T-----AIA.D-------V--RD-G------------S---------------
Q9RZA0_DEIRA/23-234---------LTAQ--------------Q-----AAS.R-------V--KS-G------------Q---------------
ATOA_HAEIN/4-200---------ELIA--------------R-----RIAME-------L--HD-G------------D---------------
CTFA_CLOAB/5-216---------IRFE--------------N-----LRS.F-------F--KD-G------------M---------------
CTFB_CLOAB/9-205---------EIIA--------------K-----RVARE-------L--KN-G------------Q---------------
PCAI_ACIAD/6-219---------ATLT--------------E-----ALS.Q-------I--HD-G------------A---------------
SCOT1_HUMAN/43-272---------TDPV--------------E-----AVK.D-------I--PD-G------------A---------------
Q973S5_SULTO/3-202---------EHVS--------------K-----AISLL-------L--ED-G------------E---------------
Q9RZ86_DEIRA/5-217---------PSAA--------------E-----ALRDI-------V--HD-G------------Q---------------
SCOA_BACSU/5-216---------SSSK--------------E-----AAK.L-------I--HD-G------------D---------------
PCAJ_ACIAD/8-206---------DQIA--------------Q-----RVAQD-------I--PE-G------------S---------------
SCOT1_HUMAN/302-501---------ERII--------------K-----RAALE-------F--ED-G------------M---------------
YDIF_ECOLI/15-253---------LSAQ--------------E-----AVN.Y-------I--PD-E------------A---------------
SCOT_CAEEL/40-271---------NSAE--------------E-----AVK.D-------I--PD-N------------A---------------
SCOB_BACSU/5-202---------KRMV--------------K-----RAVQE-------I--KD-G------------M---------------
Q9XAM7_STRCO/5-234---------ATAG--------------A-----AVA.D-------V--AD-G------------A---------------
Y1199_ARCFU/148-369---------MSAE--------------E-----AVSNF-------I--KD-G------------M---------------
Q8PDH3_XANCP/7-217---------EMMT--------------V-----AAARR-------L--PD-G------------A---------------
Q8RGS9_FUSNN/11-226---------EMQA--------------I-----TIAKE-------I--KD-G------------Q---------------
SCOA_HELPY/5-216---------TDLD--------------K-----ALS.A-------L--KD-G------------D---------------
ATOD_HAEIN/5-216---------LKLN--------------N-----LNQ.H-------L--HD-G------------M---------------
Q8F685_LEPIN/8-247---------QNPD--------------E-----MIRET-------V--QP-K------------M---------------
Q9W058_DROME/37-266---------ESAI--------------D-----AVA.D-------V--QD-G------------A---------------
Q97Z51_SULSO/6-206---------DYVI--------------K-----AISTL-------L--ED-G------------E---------------
ATOD_ECOLI/5-216---------MTLQ--------------D-----ATG.F-------F--RD-G------------M---------------
Q98EM4_RHILO/9-219---------EMMT--------------I-----AASRA-------L--RN-D------------D---------------
Q92TL1_RHIME/7-217---------EMMT--------------V-----AAARA-------L--SN-D------------D---------------
A5VGV2_SPHWW/10-217---------...G--------------A-----ALEGL-------L--FD-G------------M---------------
A6M018_CLOB8/11-214---------....--------------.-----.K.RI-------F--KD-G------------M---------------
Y3551_MYCTU/6-233---------TALD--------------D-----AVA.Q-------L--RS-G------------M---------------
SCOB_MYCTU/9-204---------DEMA--------------A-----RVAAE-------F--ED-G------------Q---------------
SCOA_MYCTU/6-233---------ATAA--------------E-----AVA.D-------I--AN-G------------S---------------
Q88FX5_PSEPK/6-218---------ESIA--------------S-----AVE.G-------I--TD-G------------S---------------
S6BGT4_PSERE/8-217---------EMMT--------------V-----AAARR-------L--KN-G------------A---------------

PF00455

Q98FV5_RHILO/86-240---------RQIA--------------A-----IAATM-------V--RD.G------------D---------------
A9CFA5_AGRFC/78-235---------RAIA--------------R-----KAVDL-------C--ND.G------------D---------------
A9CH78_AGRFC/78-237---------ARAC--------------R-----QAAVM-------I--EP.Y------------D---------------
Q98JJ0_RHILO/76-235---------REAC--------------A-----HAVRK-------I--RP.D------------E---------------
Q8EUZ1_MYCPE/77-233---------KEIA--------------K-----KAVKL-------V--GQ.Y------------K---------------
Q98AQ9_RHILO/74-232---------STIA--------------E-----IALGL-------L--KP.G------------Q---------------
Q8Y5F7_LISMO/74-230---------QKIA--------------Y-----VAGKV-------I--KD.H------------M---------------
Q8Y9Y5_LISMO/74-233---------QLIG--------------K-----AAADF-------I--EE.N------------D---------------
Q89SG7_BRADU/74-233---------KAIG--------------A-----AAASL-------I--PN.G------------C---------------
Q98M65_RHILO/73-232---------EAIG--------------R-----AAARL-------I--PD.N------------A---------------
Q7VVL2_BORPE/74-233---------RRIA--------------E-----AVARA-------V--PD.G------------C---------------
ACCR_AGRFC/77-237---------AAIA--------------G-----VVAGM-------I--VE.G------------D---------------
Q9X0F8_THEMA/73-233---------EKIA--------------Q-----LALNF-------V--ED.G------------D---------------
Q8EMN4_OCEIH/74-231---------KVIG--------------K-----KAASL-------I--YP.G------------D---------------
Q8R736_CALS4/74-232---------RKIG--------------R-----IAASL-------I--EE.G------------D---------------
Q8ES05_OCEIH/74-231---------TSIG--------------K-----FAASL-------I--EE.N------------D---------------
FRUR_BACSU/74-232---------LKIA--------------E-----KAASL-------L--EE.G------------D---------------
Q8ESW8_OCEIH/75-233---------QKIA--------------M-----EAIKH-------V--FE.G------------D---------------
Q986N7_RHILO/100-258---------QRLA--------------A-----AAVAM-------I--EP.G------------Q---------------
Q988Q4_RHILO/55-214---------QALA--------------Q-----TAATM-------I--EP.G------------E---------------
A9CHG2_AGRFC/75-234---------ATLA--------------R-----AVVPL-------I--EP.G------------M---------------
Q98GA9_RHILO/78-237---------ARIG--------------R-----GAAGL-------V--EK.G------------H---------------
Q7D3J6_AGRFC/74-233---------ERIA--------------K-----AAVQI-------L--KG.A------------Q---------------
Q92UW3_RHIME/80-239---------AAIG--------------R-----KAAEL-------V--KD.G------------M---------------
Q98BY9_RHILO/73-232---------RIIA--------------R-----MVAAT-------I--RD.G------------E---------------
Q986T2_RHILO/74-233---------KRIA--------------R-----AAVEL-------F--ED.N------------Q---------------
Q9RZP5_DEIRA/82-243---------QRLA--------------G-----RALEL-------I--AP.G------------Q---------------
Q9K3L7_STRCO/73-239---------QRVA--------------Q-----AVAAL-------V--AP.G------------E---------------
Q9AD80_STRCO/62-221---------TAIA--------------D-----LAAGL-------V--EE.G------------E---------------
Q5UXV7_HALMA/72-230---------RAIA--------------K-----RAVDE-------L--SD.G------------D---------------
Q5V513_HALMA/74-231---------QAIA--------------E-----RAAQE-------V--RE.G------------Q---------------
Q5YVT8_NOCFA/75-235---------ERIA--------------K-----AALDY-------L--PPTG------------G---------------
YULB_BACSU/74-232---------KAIA--------------H-----EAAKY-------V--KS.G------------D---------------
LACR_STAA8/75-234---------RFIA--------------K-----KAASL-------I--ED.G------------D---------------
ULAR_ECOLI/75-231---------VRIA--------------K-----AASQL-------V--NP.G------------E---------------
AGAR_ECOLI/88-247---------RSVA--------------K-----AAVEL-------I--QP.G------------H---------------
DEOR_ECOLI/76-232---------RRAA--------------K-----LAATL-------V--EP.D------------Q---------------
FUCR_ECOLI/75-233---------ADIA--------------R-----EALAW-------I--EE.G------------M---------------
YIHW_ECOLI/78-237---------KAIA--------------E-----AVADY-------I--PD.G------------S---------------
SGCR_ECOLI/79-236---------REIA--------------A-----LARTM-------I--KD.G------------D---------------
IOLR_BACSU/72-231---------TKIA--------------H-----YASRF-------I--ED.H------------D---------------
YGBI_ECOLI/75-232---------AAIG--------------K-----LAASL-------V--QP.G------------S---------------
YDJF_ECOLI/76-233---------QLIA--------------R-----KALPF-------I--DN.K------------T---------------
GLCR_BACSU/75-231---------NKIG--------------R-----LAASL-------I--HD.G------------D---------------
Q2G240_STAA8/76-232---------KMIA--------------K-----IAANQ-------I--ND.N------------E---------------
Q2YIQ5_BRUA2/76-232---------LKMA--------------R-----AALEL-------V--EP.G------------M---------------
Q2YIY1_BRUA2/81-239---------KLIA--------------E-----AAMQF-------V--EP.G------------Q---------------
Q2YLA3_BRUA2/76-232---------AAIG--------------Q-----LAAQM-------I--RS.G------------T---------------
Q32AN5_SHIDS/73-232---------ERIA--------------R-----KVAEQ-------I--PN.G------------S---------------
Q32CM1_SHIDS/74-232---------ELIA--------------E-----AAVSF-------I--HD.G------------D---------------
Q32GP8_SHIDS/68-227---------RELA--------------E-----FAASL-------V--QP.G------------E---------------
GLPR_PSEAE/74-231---------QRIA--------------E-----AVASL-------V--PD.N------------A---------------
Q7CFX9_YERPE/75-232---------ARIA--------------Q-----RVASQ-------I--PD.G------------A---------------
Q7CGX6_YERPE/76-234---------SLIG--------------Q-----AAAKL-------I--NS.G------------D---------------
Q7CHA9_YERPE/76-237---------QNIG--------------V-----LAAML-------I--EP.G------------Q---------------
Q7CHG1_YERPE/76-235---------RRIG--------------Q-----LAAQL-------I--IE.N------------D---------------
Q7CKA8_YERPE/91-249---------MKIA--------------K-----AALQF-------I--RP.G------------D---------------
Q8DN15_STRR6/75-235---------RLIA--------------S-----LAKDF-------I--RS.G------------M---------------
Q8DPP7_STRR6/78-234---------QEIA--------------H-----FAGSL-------V--EE.R------------E---------------
Q8DQ97_STRR6/74-227---------KLLA--------------Q-----KAASL-------I--KE.K------------D---------------
Q8DRC4_STRR6/83-243---------RKIV--------------Q-----EAVKL-------V--SD.N------------E---------------
Q8PDH7_XANCP/77-235---------QQIA--------------T-----QVARF-------I--PD.D------------A---------------
Q8R8Q0_CALS4/73-230---------QRIA--------------A-----KAVTE-------I--KE.G------------N---------------
Q8Y4U4_LISMO/74-229---------KVIA--------------A-----YCASL-------V--EE.N------------D---------------
Q8YA06_LISMO/78-236---------IRIA--------------D-----IAKSL-------I--RD.D------------M---------------
Q8YA14_LISMO/74-233---------EAIA--------------K-----EAATL-------V--KN.N------------Q---------------
Q928R7_LISMO/75-232---------QRIA--------------T-----LAATM-------V--KD.G------------D---------------
Q97EY9_CLOAB/77-234---------MEAA--------------R-----LAAGL-------I--KE.N------------D---------------
Q97F00_CLOAB/78-235---------RHIA--------------K-----LASEM-------I--EE.N------------D---------------
Q97F05_CLOAB/78-235---------KDVA--------------K-----IAASM-------V--EE.N------------D---------------
Q97J56_CLOAB/68-226---------LRIA--------------K-----EGIKF-------V--DN.G------------D---------------
Q97J82_CLOAB/75-231---------IKIA--------------K-----KAASL-------I--KD.D------------D---------------
Q97MG7_CLOAB/76-233---------LAIG--------------K-----YAANM-------I--KN.G------------D---------------
Q97MS8_CLOAB/74-235---------LIIA--------------K-----KAFDL-------I--ED.D------------E---------------
Q9HT24_PSEAE/78-233---------QAIG--------------R-----AAAAR-------I--RE.H------------A---------------
Q9I3M2_PSEAE/74-231---------RAVA--------------R-----YAAGL-------F--GP.G------------D---------------
Q9JYJ2_NEIMB/75-234---------NAIA--------------R-----LIAEH-------I--PD.G------------S---------------
Q9K3N4_STRCO/82-247---------EDIA--------------R-----AAAEL-------V--AP.G------------A---------------
Q9KL10_VIBCH/75-233---------EKVA--------------M-----ALVQH-------I--PD.G------------A---------------
Q9KMS3_VIBCH/75-231---------SLIA--------------L-----KAAEL-------C--QP.G------------D---------------
Q9KRT3_VIBCH/76-234---------QRIA--------------Q-----RVAQE-------L--PE.G------------C---------------
Q9KUM9_VIBCH/81-237---------ISLA--------------K-----AAAKL-------I--RD.H------------N---------------
Q9KYU7_STRCO/74-233---------DRIA--------------R-----AALAE-------L--PA.E------------G---------------
Q9S2D1_STRCO/76-233---------RKVA--------------S-----AAAGL-------V--RP.G------------G---------------
Q9X9X5_STRCO/79-237---------RRIA--------------S-----AAVEL-------L--GD.A------------E---------------
Q9ZC48_YERPE/76-232---------QAIG--------------T-----SAALH-------I--PR.N------------S---------------

PF02550

O28424_ARCFU/3-199---------RKLI--------------S.P-E-EAANL-------V--KD-G------------M---------------
O29120_ARCFU/9-201---------KKLI--------------S.P-E-EAAGL-------V--ES-G------------M---------------
P73661_SYNY3/6-196---------QLRS--------------QYP-E-KFASY-------S--EI-F------------S---------------
ACH1_YEAST/12-230---------KKVK--------------E.A-H-ELIPL-------F--KN-G------------Q---------------
SCPC_ECOLI/1-213---------RMTA--------------N..-.-EAAEI-------I--QH-N------------D---------------

PF01008

EI2BD_MOUSE/219-510---------ARCI--------------ALL-H-ALQQV-------I--QD-Y------------T...TPPSEELSR...
R15PI_METJA/22-292---------RIGR--------------AAA-K-ALKEY-------A--LK-I------------S...HLNEEEF.....
EI2BB_YEAST/33-358---------AIAL--------------ETL-Q-LLMRF-------I--SA-A------------R...WNHVNDL.....
MTNA_BACSU/49-337---------AIGI--------------TAA-F-GLALA-------A--KD-I------------E...TDNVTEF.....
MTNA_ARCFU/41-327---------ALEA--------------AGA-Y-GIALA-------A--RE-R------------E...FADVDEL.....
EI2BA_HUMAN/15-293---------ASAV--------------AAI-R-TLLEF-------L--KR-D------------K...GETIQGL.....
MTNA_SYNY3/51-343---------AIGV--------------AAA-Y-GMYLG-------A--RR-I------------Q...TTELREF.....
MTNA_METTH/44-310---------AIGV--------------TAA-F-GVAMA-------E--LA-G------------E...............
MTNA_CAEEL/66-357---------LIAV--------------VGS-L-GLLLE-------I--QK-A------------S........EL.....
EI2BA_CAEEL/15-293---------STSL--------------ATV-E-TLLEV-------L--DR-S------------R...ATTVAEF.....
EI2BA_YEAST/15-292---------TMPI--------------AAI-E-ALVTL-------L--RI-K------------T...PETAAEM.....
EI2BD_YEAST/285-637---------PRCI--------------AML-E-VFQIV-------I--KD-Y------------Q...TPKGTTLSR...
MTNA_METJA/48-319---------AIGV--------------SAA-Y-GLALA-------E--IN-G------------D...............
EI2BB_RABIT/27-333---------DMAR--------------ETL-G-LLRRI-------I--TD-H------------R...WSNAGEL.....
MTNA_YEAST/49-399---------AIAI--------------VGS-L-SVLTE-------V--QL-I------------KHNPTSDVATLYSLVN
EI2BD_SCHPO/156-452---------QRCI--------------DLL-K-TFKIV-------I--QD-Y------------Q...TPYGTTLSR...
Q5V075_HALMA/195-460---------WLSL--------------RAL-E-VLRDE-------A--AL-A------------D...AGRSDDLETAER
R15PI_ARCFU/15-284---------RIAR--------------FAA-E-TLMKF-------A--EK-A------------S......DEKF.....

PF06026

B3MF62_DROAN/94-270---------YQA.--------------HHL-I-LDYNL....N..L--GDL.------------D---------------
B4KS42_DROMO/101-277---------FQA.--------------RQL-I-LDHNL....T..L--GDL.------------D---------------
RPIA_BURPS/53-222---------VAT.--------------TER-L-KSHGI....K..V--FDL.------------N---------------
RPIA_METJA/51-220---------FEA.--------------KML-A-MQYEI....P..L--VTL.------------D---------------
K4L1A8_SIMAS/53-215---------EAS.--------------AER-L-KAHGI....P..V--YDL.------------N---------------
D0KYM3_HALNC/50-214---------EAS.--------------TKR-L-RAHGI....E..V--FDL.------------N---------------
D5MHI2_9BACT/41-208---------QVT.--------------AAL-A-VQLGI....P..L--ATL.------------E---------------
G7M4M9_9CLOT/48-219---------VKT.--------------KML-C-IENGL....E..V--LHT.------------S---------------
V5UL52_9BURK/53-222---------EAS.--------------TER-L-RKHGI....E..V--FDL.------------N---------------
RPIA_STAEQ/52-222---------NKT.--------------AFL-A-KELAM....N..I--VDV.------------N---------------
RPIA_CHLAA/55-225---------EGT.--------------AQL-A-RELGI....P..L--TTL.------------D---------------
E8WXH2_GRATM/47-217---------DAS.--------------FNL-G-AELGL....D..M--MTL.------------N---------------
RPIA_RHOPB/50-225---------EVT.--------------RAD-A-LRCGI....A..L--TTL.------------D---------------
H8MW96_CORCM/57-227---------HAT.--------------ETL-A-ASLGV....P..L--TTL.------------D---------------
RPIA_SHELP/49-213---------EAS.--------------TEK-M-KALGI....P..V--FDL.------------N---------------
C6XGM4_LIBAP/50-224---------RNT.--------------ENF-C-KIHHI....P..L--HSP.------------E---------------
U5H8J3_USTV1/122-297---------FQS.--------------KEL-I-VKAGL....N..L--GDV.------------D---------------
N0BJC6_9EURY/47-217---------YQS.--------------HML-A-VENGI....T..V--TDL.------------I---------------
H0PXY1_9RHOO/49-213---------EAS.--------------SRR-L-ASYGI....P..V--IDL.------------N---------------
RPIA_RHILO/50-224---------ERT.--------------AAL-C-RELGV....P..L--STL.------------E---------------
I3UDK7_ADVKW/56-221---------ERS.--------------AAR-L-RGHGV....R..V--LDL.------------A---------------
E4X352_OIKDI/53-229---------FQA.--------------RQL-I-IEHGL....L..L--SDL.------------E---------------
C7R992_KANKD/49-211---------EAS.--------------TER-L-KKHGI....E..V--FEL.------------N---------------
K9ZYM6_DEIPD/53-221---------NAS.--------------EQL-A-REVGV....P..V--EEF.------------D---------------
RPIA_LEPCP/49-214---------VRS.--------------TER-L-QALGI....P..V--LDL.------------S---------------
A0RTM4_CENSY/52-220---------LQI.--------------RLV-A-EECGI....S..L--RDP.------------G---------------
RPIA_HAEIN/49-214---------KES.--------------EEL-L-RKQGI....E..V--FNA.------------N---------------
S2J2W4_MUCC1/53-230---------FQS.--------------KLL-I-LEGGL....T..L--GSV.------------E---------------
RPIA_LACRD/52-220---------NRT.--------------AKQ-A-RDLGI....T..I--KDI.------------D---------------
RPIA_PHOPR/49-213---------VAS.--------------TER-L-EKLGI....P..V--FEA.------------N---------------
G4RF46_PELHB/49-224---------EAT.--------------AAQ-A-RGLGI....P..L--TTL.------------D---------------
A9V4I9_MONBE/88-261---------FQA.--------------RQL-I-LENKL....V..L--GDL.------------N---------------
F2I5Y3_AERUA/48-215---------IKS.--------------IDQ-A-KALGI....E..V--LPI.------------D---------------
G2MHG7_9ARCH/54-222---------FQA.--------------RQL-A-QEAGI....P..L--TTL.------------E---------------
C6XK92_HIRBI/49-225---------EVT.--------------EAQ-A-RSLNI....P..M--ADL.------------D---------------
C4R764_PICPG/66-245---------FQS.--------------KEL-I-LSNGL....R..L--GSV.------------E---------------
D3E2P7_METRM/49-218---------FQS.--------------SLL-A-RKWNI....P..I--TSL.------------D---------------
W8KJT3_HALHR/50-214---------EVS.--------------AER-L-RKHGI....P..V--MDL.------------N---------------
E0SPG1_IGNAA/58-230---------IDT.--------------ALY-L-LNMGI....ENIE--SGLP------------R---------------
RPIA_HALWD/54-223---------FAT.--------------RDR-A-IEAGI....P..L--TRI.------------E---------------
T0N5R5_9EURY/50-215---------LET.--------------MYL-L-NSGGL....R..T--STEF------------H---------------
D2A0V2_TRICA/53-227---------FQA.--------------RQL-I-IQHRL....H..L--TDL.------------E---------------
R7ELE2_9BACE/67-233---------AEI.--------------SMT-C-IQLGL....P..Q--TTLW------------N---------------
T0LRI8_9EURY/54-219---------ERT.--------------TEK-A-LKLGL....N..V--NQQY------------K---------------
A4YX18_BRASO/48-223---------EAT.--------------RAQ-A-EACGV....P..L--TTL.------------D---------------
W1Q6V8_OGAPD/53-229---------FQS.--------------RQL-I-IDNGL....R..L--GST.------------E---------------
J7Q837_METSZ/64-239---------ERT.--------------RAQ-A-ESLGI....T..L--STL.------------D---------------
S5YAN5_PARAH/56-230---------KAT.--------------AEL-A-QSLGL....S..I--ETL.------------D---------------
RPIA_RHOPA/50-225---------EVT.--------------RAD-A-ERCGI....R..L--TSL.------------D---------------
W0JVE5_9EURY/51-218---------FQS.--------------RQR-A-IEAGI....P..L--TTL.------------E---------------
RPIA_PEDPA/51-220---------DRT.--------------AEQ-A-RSLGI....N..V--KSV.------------D---------------
S2JUJ5_MUCC1/54-231---------FQS.--------------KLL-I-LDNGL....K..L--GSI.------------E---------------
U3U6Y6_9ENTR/49-214---------NSS.--------------TKQ-L-KSLGI....P..V--LDL.------------N---------------
RPIA_BAUCH/49-214---------EQS.--------------TTK-L-KSMGI....L..L--FNL.------------N---------------
K9SSM9_9SYNE/57-227---------FES.--------------IVL-G-KKYGV....P..I--RSL.------------D---------------
D5EB20_METMS/56-224---------YQS.--------------EML-A-IQAGI....P..L--TSL.------------A---------------
J9W6I1_LACBU/52-220---------ERT.--------------REQ-A-NSLGI....K..T--KGL.------------D---------------
G0VA31_NAUCC/62-239---------FQS.--------------KKL-I-LDNGL....Q..L--STV.------------E---------------
A1B891_PARDP/56-230---------KAT.--------------AEL-A-TSLGL....G..V--EEL.------------D---------------
RPIA_DICNV/49-213---------ETS.--------------SKA-L-EAAGF....R..V--RDL.------------N---------------
K7SFG2_GLUOY/48-220---------EDS.--------------ARK-A-EKAGI....P..L--TDF.------------A---------------
C5M9K4_CANTT/70-245---------FQS.--------------KQL-I-IDNGL....N..L--GAI.------------E---------------
C7JF40_ACEP3/57-228---------SVT.--------------EKQ-A-KEEGI....P..L--TTF.------------G---------------
RPIA_LACC3/51-220---------VRT.--------------RKQ-A-ESLGI....P..M--KAL.------------D---------------
A9SR64_PHYPA/70-245---------KRT.--------------AEQ-A-ASLGI....P..L--SVL.------------D---------------
F3Y8A6_MELPT/48-218---------KET.--------------EKQ-A-LSLGI....P..L--KSI.------------D---------------
D8RIH7_SELML/81-253---------YQS.--------------RIL-A-RQYGV....K..T--VDL.------------N---------------
RPIA_STRMU/49-217---------SRT.--------------TAQ-A-QALGI....P..L--KSI.------------D---------------
Q2FVT0_STAA8/52-222---------NKI.--------------AFL-A-KELGI....K..I--CEI.------------N---------------
E2BIQ5_HARSA/33-208---------FQA.--------------RQL-I-VKNHL....T..L--GDL.------------E---------------
RPIA_BACSK/48-216---------RKT.--------------EAL-A-KACGI....H..I--IDF.------------P---------------
R9T971_9EURY/48-216---------IET.--------------EKQ-A-RSLNI....P..L--TEL.------------E---------------
RPIA_DEBHA/69-245---------FQS.--------------KQL-I-IDAGL....R..L--GTI.------------E---------------
E9G3C7_DAPPU/53-228---------FQA.--------------KQL-I-IQYGL....K..L--GDL.------------E---------------
M1XYN2_NATM8/55-227---------HQS.--------------RAL-A-REAGI....P..L--LTL.------------E---------------
B7VHI7_VIBTL/94-259---------VRS.--------------SRA-L-SSAGL....N..E--ISI.------------S---------------
Q8I3W2_PLAF7/51-226---------IDT.--------------ELK-A-RKLGI....P..L--TTL.------------E---------------
A3DN78_STAMF/53-223---------YAT.--------------HNY-L-YKHGIDAYTP...--....------------.---------------
K5XRW6_AGABU/63-240---------FQS.--------------KLL-I-IEAGL....N..L--GDV.------------D---------------
U5QS13_9CYAN/54-225---------ERT.--------------AQQ-A-RSLGI....P..L--ATL.------------E---------------
E3NWK8_CAERE/55-230---------RST.--------------IEV-A-QQVGI....E..I--TDP.------------N---------------
D7EAR3_METEZ/57-226---------YQS.--------------EML-A-IDAGI....P..L--TSL.------------S---------------
R5EWG7_9GAMM/48-213---------NKT.--------------TEA-L-TKIGV....K..V--VDP.------------N---------------
A6X0Q4_OCHA4/51-225---------ERT.--------------AKL-C-KELGV....P..L--TTL.------------D---------------
K4AIV0_SETIT/101-286---------VLS.--------------ASE-A-DKAGI....R..A--SSYQ------------E---------------
D6S665_9LACO/56-223---------SRS.--------------KKQ-L-ESYGF....K..V--DEL.------------A---------------
D3RQX1_ALLVD/48-212---------EVS.--------------TER-L-KRHGI....P..V--FDL.------------N---------------
D5X4J8_THIK1/49-213---------ERS.--------------TER-L-RAHGI....T..V--YDL.------------N---------------
R5VQ59_9PORP/67-230---------FES.--------------TMA-C-LRFGI....P..L--TTLW------------E---------------
D1Z1V9_METPS/54-222---------YAS.--------------EAL-A-IECNI....P..L--STL.------------A---------------
A1RX06_THEPD/46-219---------IDT.--------------SLY-A-AGKGL....L..E--VPLH------------E---------------
Q4UBE3_THEAN/56-233---------QST.--------------HLK-A-EELEI....P..L--LTL.------------D---------------
V5WM65_9SPIO/65-247---------FST.--------------QAL-C-QEKGI....P..V--FSLN------------D---------------
D2RI11_ARCPA/48-216---------YQS.--------------HFL-A-LKAGI....R..I--VDL.------------F---------------
RPIA_PROMP/47-218---------FQS.--------------EVL-A-LELNI....P..L--IDL.------------A---------------
B2IHK8_BEII9/53-228---------ERT.--------------RTQ-A-DTYKI....P..L--STL.------------D---------------
RPIA_OLICO/50-225---------EGT.--------------RAD-A-ERCGV....P..L--TTL.------------D---------------
RPIA_PICGU/64-240---------FQS.--------------KQL-I-IDNGL....T..L--GAI.------------E---------------
K1VP09_TRIAC/61-234---------FQS.--------------KQL-I-IDAGL....Q..L--GDV.------------D---------------
I4YBK0_WALMC/145-321---------FQA.--------------KEL-I-VGNGL....T..L--GDV.------------D---------------
RPIA_CAUSK/47-220---------EAT.--------------ANL-A-RELGI....A..L--TAL.------------D---------------
F6HTS6_VITVI/101-277---------KRT.--------------EEQ-A-LSLGI....P..L--SVL.------------D---------------
M4DCW1_BRARP/79-256---------KKT.--------------QEQ-A-LSLGI....P..L--SDL.------------D---------------
RPIA_METRJ/50-224---------EAT.--------------RAQ-A-ESLGI....R..L--ATL.------------D---------------
B5Y3N7_PHATC/98-280---------IRT.--------------KEQ-A-ESLGI....P..L--VTL.------------D---------------
H9UGB7_SPIAZ/58-234---------MQT.--------------RQL-C-QELLL....P..V--RSM.------------N---------------
RPIA_THERP/50-221---------QRT.--------------AAL-A-RRVGIELRDP...--....------------D---------------
RPIA_METPP/49-213---------VKS.--------------TER-L-REKGI....R..V--FEA.------------A---------------
L0I9N5_HALRX/54-222---------AES.--------------AQL-A-RESGI....P..L--TTL.------------A---------------
X2H3T4_9NEIS/50-214---------ALT.--------------SET-L-KKFGI....P..E--VTL.------------N---------------
D7DSD0_METV3/58-228---------FDA.--------------KML-A-SQCGI....P..L--VSL.------------D---------------
T1HW83_RHOPR/84-259---------FQA.--------------QML-I-VKNNL....V..L--RNL.------------D---------------
A9RL35_PHYPA/31-216---------SAS.--------------AAA-A-AQAGV....P..L--TTFE------------D---------------
V9VTU6_9RHOB/56-231---------SRT.--------------AAL-A-RDVGI....N..V--VSL.------------D---------------
Q4MZ63_THEPA/56-234---------QAT.--------------YLK-A-KELEI....P..L--ISL.------------D---------------
RPIA_SODGM/49-213---------EAS.--------------SAK-L-QSLGI....P..L--FDL.------------N---------------
K9XKW8_9CHRO/57-227---------FQA.--------------EVL-A-KQYGI....P..L--TTL.------------D---------------
K5W1L5_PHACS/65-241---------FQS.--------------KEL-I-VDAHL....R..L--GDV.------------D---------------
RPIA_ALKEH/50-214---------EAS.--------------TAR-L-RQYGI....P..V--LDL.------------N---------------
E8UX17_TERSS/51-221---------EDS.--------------AKL-G-AELGI....P..I--IDF.------------H---------------
RPIA_KORCO/48-217---------KQI.--------------EEV-A-RNQGL....E..V--IYPD------------G---------------
U5T5D8_9GAMM/49-213---------EVS.--------------AAR-L-RRHGI....E..V--RDA.------------N---------------
RPIA_VIBPA/49-213---------VAS.--------------TER-L-KELGI....E..V--FEC.------------N---------------
E5SAM9_TRISP/143-319---------YQA.--------------RTL-I-LQNGL....P..L--GDL.------------E---------------
F2UBB3_SALR5/70-247---------FQA.--------------IQL-I-RQHNL....P..L--SDL.------------S---------------
E1QRN8_VULDI/53-227---------TET.--------------EIE-I-VRLGL....ANLL--RYP.------------W---------------
RPIA_BURXL/53-222---------LAT.--------------TAR-L-QSHGF....K..V--LDL.------------N---------------
C1CUX0_DEIDV/53-221---------EAS.--------------DQL-A-RQLGI....P..V--EPL.------------D---------------
E1VFV9_9GAMM/49-213---------EET.--------------RRR-L-VAKGV....P..V--FDL.------------N---------------
D9Q2B6_ACIS3/51-222---------LST.--------------ALS-L-SGEGV....D..V--IYYP------------A---------------
S6C126_9GAMM/49-213---------EAS.--------------TER-L-KAIGI....P..V--LDL.------------N---------------
F6HFJ9_VITVI/87-263---------KKT.--------------HEQ-A-VSLGI....P..L--SDL.------------D---------------
U1N8Y7_ASCSU/112-290---------FLT.--------------RKW-L-LDAGL....S..V--TNL.------------E---------------
Q8SR79_ENCCU/35-195---------IRT.--------------ALI-L-SEKGFTVSSP..L--A...------------H---------------
RPIA_THEEB/55-223---------FQA.--------------SVL-A-KKYGI....P..L--VTL.------------D---------------
Q11IC0_CHESB/51-225---------ERT.--------------AAL-C-RELSV....P..L--STL.------------D---------------
A6LVZ7_CLOB8/47-215---------KST.--------------ESL-A-RELKI....P..L--LSI.------------D---------------
B9I0V6_POPTR/93-277---------VTS.--------------ASE-A-AKAGI....P..L--DVYQ------------D---------------
RPIA_LARHH/50-214---------QAT.--------------ADR-L-KAIGI....Q..V--FDL.------------N---------------
RPIA_DESAA/53-223---------TPT.--------------EEV-A-RSLGI....P..L--VGF.------------E---------------
RPIA_DINSH/56-231---------TRT.--------------AEL-A-RDLKL....H..V--TTL.------------D---------------
R5PSN2_9BURK/55-218---------ERS.--------------TKR-L-EALGF....K..V--LDM.------------N---------------
H8GLH3_METAL/47-217---------MVS.--------------AIK-A-RELGL....P..Q--IPI.------------E---------------
K3Y9J6_SETIT/66-248---------LKT.--------------ELH-A-ARAGI....P..L--LPL.------------D---------------
RPIA_BUCBP/49-213---------NFS.--------------TAC-L-KRIGI....P..I--YDL.------------S---------------
U5N777_9BURK/52-220---------PAS.--------------TAL-L-RELGI....P..V--LDP.------------N---------------
RPIA_METB6/55-226---------YQT.--------------AMK-A-REYGI....P..L--TTL.------------D---------------
F9VP11_SULTO/46-214---------IDT.--------------ELE-I-SKREG....I..V--ITLY------------S---------------
RPIA_RHOFT/60-228---------EAS.--------------TLR-L-KALGI....P..V--FDA.------------N---------------
D9S606_FIBSS/55-226---------WST.--------------TLQ-C-RSLGI....P..L--KEM.------------G---------------
A8I636_AZOC5/111-286---------EQT.--------------KAQ-A-LSLGV....P..L--ATL.------------D---------------
R9SLS4_9EURY/48-217---------YQS.--------------ALL-A-QQWNI....P..L--TSL.------------D---------------
G8ZWF9_TORDC/75-252---------FQS.--------------KQL-I-IDNGL....S..Y--GII.------------E---------------
R5JU55_9BACE/67-230---------MEI.--------------SMT-C-VQLGI....P..Q--TTLW------------E---------------
E6U2Y3_ETHHY/42-213---------TRT.--------------AAL-C-AEHGL....P..V--LPT.------------W---------------
F7XM76_METZD/57-225---------YQS.--------------EML-S-IEAGI....P..L--TTL.------------S---------------
RPIA_RUTMC/49-214---------KAT.--------------RQR-L-ESYDI....K..V--FDL.------------N---------------
RPIA_YARLI/58-236---------FQS.--------------KQL-I-QNAGL....R..L--GCI.------------D---------------
V5SCR1_9RHIZ/50-225---------EET.--------------QRL-A-EQHGI....P..L--TTL.------------C---------------
G4QMA8_GLANF/49-213---------DAS.--------------TQR-L-KKLGI....E..V--FDL.------------N---------------
RPIA_THIDA/48-212---------EAT.--------------AAR-L-KSHGI....Q..V--LDL.------------N---------------
A8IRQ1_CHLRE/82-257---------IRT.--------------YEQ-A-LSLGI....P..L--ATL.------------D---------------
Q8ZXY8_PYRAE/44-218---------SDS.--------------EIL-A-YEVGL....GDRL--RPM.------------W---------------
W8RXL1_9RHOB/56-231---------TRT.--------------ADL-A-REVGI....T..V--KTL.------------D---------------
R6UK51_9FIRM/42-213---------LET.--------------ETL-C-IKLGL....P..L--LPL.------------R---------------
K8ENG0_CARML/47-216---------NRT.--------------AEQ-A-KALGI....P..L--KSV.------------D---------------
B8ELA7_METSB/53-228---------EET.--------------RAQ-A-AALGV....A..L--TTI.------------D---------------
H3CYY4_TETNG/53-228---------FQA.--------------RQL-I-LQHSL....A..L--SDL.------------D---------------
F8J7J2_HYPSM/50-225---------EAT.--------------RAQ-A-AALDI....P..L--TTL.------------D---------------
U6B5B2_9RHIZ/50-224---------VDT.--------------ENF-C-KKNNI....P..L--LSI.------------E---------------
RPIA_HALMA/53-220---------FQS.--------------RQL-A-RDCGI....P..L--ADL.------------D---------------
C7PIS1_CHIPD/51-219---------VAS.--------------EQQ-A-IALGI....P..I--TSF.------------S---------------
I1MGA3_SOYBN/93-278---------VSS.--------------ASE-A-AKAGI....P..L--DTYQ------------G---------------
M1MZH8_9CLOT/50-221---------DNT.--------------KNL-C-IKKGI....E..V--LPI.------------F---------------
RPIA_LACPL/51-219---------DRT.--------------AAQ-A-KALGI....P..M--KSV.------------D---------------
D3HMT7_LEGLN/47-211---------KAT.--------------EAL-L-RQEGI....P..V--IDL.------------N---------------
Q0C4A9_HYPNA/53-230---------NQT.--------------REL-A-RSLGV....P..L--IPF.------------E---------------
U9SW08_RHIID/55-228---------FQS.--------------RLL-I-TEGGL....N..L--GDI.------------D---------------
J3LWN1_ORYBR/36-221---------LKT.--------------EAH-A-ARVGI....P..M--LPL.------------G---------------
Q4FT49_PSYA2/48-213---------QVT.--------------EDR-L-RALGI....E..I--VDL.------------N---------------
R6B3B3_9CLOT/67-229---------YEI.--------------KML-C-TYLGI....P..T--ATLE------------E---------------
E4NRI2_HALBP/54-223---------FAS.--------------REL-A-REEGI....P..L--VAV.------------D---------------
D0N1R6_PHYIT/55-229---------FQA.--------------KQL-I-VQHKL....T..L--SSL.------------D---------------
A7AMM8_BABBO/53-227---------VAT.--------------FRL-M-SELGI....P..S--LEF.------------D---------------
R4K5G7_CLOPA/48-219---------FKT.--------------KLL-C-IENGL....E..V--LHT.------------F---------------
A3CVB5_METMJ/49-220---------YQA.--------------AIR-A-RRYGI....P..L--TSL.------------D---------------
E6X8C9_CELAD/51-219---------EAT.--------------EKF-A-LKNGI....K..I--LSL.------------E---------------
F4LL35_TREBD/63-237---------FQT.--------------TIA-C-EQLDI....P..V--YSL.------------N---------------
F4B7Z8_ACIHW/47-219---------IDS.--------------EIE-L-SKRGF....S..V--ISLF------------S---------------
G3ARG1_SPAPN/52-227---------FQS.--------------QQL-I-IDNGL....R..L--GTI.------------E---------------
F8HYA4_WEIKK/48-216---------NRT.--------------AAR-G-AELGM....K..I--VDV.------------D---------------
E3F3G7_KETVY/65-240---------ERT.--------------AEQ-A-RAEGI....D..V--VTL.------------Q---------------
A4YJ22_METS5/48-219---------TDT.--------------DLL-A-SSKGA....L..V--LSPF------------S---------------
I1XM21_METNJ/57-227---------VIS.--------------RVK-A-EQAGL....K..V--MAI.------------E---------------
RPIA_BACAN/47-216---------KET.--------------EAL-A-QQLNI....P..L--ISL.------------N---------------
RPIA_BORBU/52-221---------SDT.--------------KYL-L-SKEQIPYESN..F--SKL.------------N---------------
B9SKS7_RICCO/78-256---------KKT.--------------QKQ-A-LSLGI....P..L--SDL.------------D---------------
G2SRP4_LACRR/51-220---------IRT.--------------ANQ-A-KSLGI....P..L--KSV.------------D---------------
RPIA_CAEEL/64-240---------FLT.--------------KQW-L-IESGL....P..V--SDL.------------D---------------
K0SNV8_THAOC/54-236---------IRT.--------------KEQ-A-ESLGI....P..L--VTL.------------D---------------
I6NDH1_ERECY/69-246---------FQS.--------------QEL-I-ISNGL....R..L--GSI.------------E---------------
Q1H2B3_METFK/48-218---------VAS.--------------TIQ-A-QTHGL....P..L--VAL.------------E---------------
RPIA_THISH/49-213---------EAS.--------------AQR-L-RGHGI....Q..V--MDL.------------N---------------
RPIA2_OCEIH/50-216---------KKS.--------------ERL-A-TELGI....P..L--TTF.------------A---------------
G2KTC4_LACSM/362-530---------VGT.--------------EKL-A-EKLGM....R..M--LDV.------------N---------------
W8X9J3_CASDE/54-218---------ERS.--------------TRR-L-RAAGI....E..V--LDL.------------N---------------
I0A1J3_FERFK/50-220---------FDS.--------------TLR-L-KQKGA....K..V--LSI.------------D---------------
K9Z869_CYAAP/56-224---------FQA.--------------EVL-A-KKYGI....P..L--TTL.------------D---------------
Q3IDN5_PSEHT/83-247---------EAS.--------------TAR-L-KALGI....E..V--FEL.------------N---------------
L0JQT2_NATP1/54-229---------FQS.--------------RQL-A-LEVGI....E..L--TDL.------------D---------------
RPIA_ARCFU/50-221---------YQS.--------------YFA-A-IRNGV....E..I--VDL.------------V---------------
G7LZ92_9CLOT/50-221---------DNT.--------------KNL-C-IKYGI....E..V--IPT.------------C---------------
D8PA73_9BACT/59-229---------HDT.--------------AAL-A-RQSGI....P..L--IES.------------D---------------
G0W6N5_NAUDC/71-248---------FQS.--------------KKL-I-LDNGL....Q..L--SNM.------------E---------------
G4SXW6_META2/48-217---------VVS.--------------AIK-A-GEMGL....P..L--QSI.------------E---------------
RPIA_METCA/49-213---------QAS.--------------SER-L-KKIGI....P..V--LDL.------------N---------------
F7PF08_9EURY/53-222---------FQA.--------------REI-A-IEKGI....D..L--TTL.------------D---------------
D8LDV8_ECTSI/54-228---------IRT.--------------KEQ-A-ESLDI....P..L--VTL.------------D---------------
A0A023B5X1_GRENI/97-274---------QDT.--------------VTK-A-RAEGL....Q..V--VEV.------------Q---------------
R7L548_9CLOT/66-232---------YEM.--------------KVL-C-QDLKI....P..T--TSIL------------S---------------
A8Q7R0_MALGO/62-237---------FQA.--------------KNL-I-IERNL....N..L--GDM.------------D---------------
RPIA_LACAC/56-223---------NRS.--------------KKQ-L-ESLGF....E..V--SEL.------------A---------------
Q1AY26_RUBXD/56-224---------EYT.--------------AAL-A-RECGV....P..L--VSLS------------E---------------
G7LY74_9CLOT/48-219---------MKT.--------------QML-C-IKNGL....E..V--LHT.------------S---------------
B0UBT0_METS4/49-223---------EAT.--------------HRA-A-QAAGI....P..L--TTL.------------D---------------
Q0SCN2_RHOJR/56-232---------TAT.--------------RDL-A-LSVGI....T..L--VDL.------------N---------------
D3PRM8_MEIRD/53-219---------EAT.--------------ARL-A-QSQGI....P..L--VELE------------A---------------
G4RM57_THETK/46-222---------VDS.--------------ELK-A-AEVGL....DKYL--APL.------------W---------------
C4Y2N7_CLAL4/69-244---------FQS.--------------KQL-I-IDNGL....T..L--GTI.------------E---------------
Q0W3M2_METAR/58-226---------YST.--------------EAL-A-IECGI....P..L--TSL.------------A---------------
M9S9J2_9EURY/54-223---------QQT.--------------EDI-A-VENGI....E..V--VDI.------------N---------------
S2JGP9_MUCC1/65-242---------FQT.--------------RQL-I-LQSNL....R..L--GSL.------------D---------------
RPIA_CUPNH/53-222---------EAS.--------------TRR-L-QQHGF....K..V--LDL.------------N---------------
RPIA_PICST/55-230---------FQS.--------------KQL-I-IDNGL....K..L--GAI.------------E---------------
RPIA_MARHV/53-217---------EAT.--------------AER-L-KKHGI....P..V--YDL.------------N---------------
Q035R3_LACC3/44-210---------EVT.--------------LAY-C-QTLGL....P..T--TTQ.------------.---------------
Q2FLE9_METHJ/57-228---------IQT.--------------TMR-A-GALGI....P..L--IGL.------------E---------------
Q97ZD9_SULSO/48-216---------IDT.--------------EIE-L-SKRGF....K..V--LSLF------------S---------------
RPIA_AROAE/49-213---------EAS.--------------ARR-L-QAHGI....P..V--LDL.------------N---------------
D5U1E6_THEAM/52-228---------FDT.--------------AIY-L-VNMGY....SNIR--DPIT------------A---------------
J0DZG3_LOALO/63-242---------FST.--------------RQW-L-IDSGL....Q..V--IDL.------------E---------------
B9QKE6_TOXGO/54-249---------EAT.--------------RKQ-A-ESLGI....P..L--TTL.------------D---------------
RPIA_TOLAT/49-213---------EAS.--------------TAR-L-QALGI....T..V--VDL.------------N---------------
G0EH21_PYRF1/55-229---------LDT.--------------LLR-L-KSLGA....S..S--VSLG------------V---------------
A0A0D2VTJ8_CAPO3/132-305---------FQA.--------------RQL-I-VEGGL....V..L--SDL.------------S---------------
K9SHM7_9CYAN/60-232---------FQA.--------------TVL-G-KQAGI....P..I--RSL.------------D---------------
A8A9K9_IGNH4/47-217---------YDT.--------------ALE-L-KKHGL....K..V--LDL.------------.---------------
E5SB58_TRISP/33-210---------FQA.--------------MQL-I-INNKL....P..L--GDL.------------Q---------------
D9QGR4_BRESC/47-221---------EKT.--------------ADL-A-RELGL....P..L--TTL.------------E---------------
B9DLS8_STACT/50-220---------NKT.--------------ALI-A-KELGI....K..I--VDV.------------N---------------
RPIA_ASHGO/71-248---------FQS.--------------RQL-I-LDNGL....R..L--GSI.------------E---------------
RPIA_STRSY/49-217---------HAT.--------------AEH-A-ASLGI....P..L--KNI.------------D---------------
RPIA_THET8/54-221---------RAT.--------------EEL-A-KREGI....P..L--VDLP------------P---------------
M5C6T3_THACB/108-284---------FQS.--------------KEL-I-VKGGL....K..L--GDV.------------D---------------
M0Y9D9_HORVD/96-282---------VIC.--------------ASE-A-EKAGI....K..V--GSHE------------E---------------
F9ZVU0_METMM/51-220---------IKT.--------------TEH-L-QSIGI....K..V--LEL.------------N---------------
T0UHY2_9STRE/43-211---------SQT.--------------TAQ-A-EGLGI....P..L--KAV.------------D---------------
T1IW49_STRMM/51-225---------FQA.--------------HQL-I-LENNL....Q..L--TTL.------------D---------------
Q1D141_MYXXD/60-230---------RAT.--------------EAL-A-RSLGV....P..V--STL.------------D---------------
RPIA_PSEF5/53-217---------EAT.--------------AAR-L-KGHGI....P..V--YEL.------------N---------------
M0TZ20_MUSAM/31-216---------VSS.--------------ASE-A-AKAGI....P..L--NNYQ------------E---------------
I6SWV8_ENTHA/48-217---------NAT.--------------KEQ-A-EKLGI....P..L--KSI.------------D---------------
RPIA_METAC/57-225---------YQS.--------------EML-A-IEAGI....R..L--TTL.------------A---------------
RPIA_RHOS4/56-231---------TRT.--------------AEL-A-RALGI....Q..V--VTL.------------D---------------
R6M617_9BACE/67-231---------NEI.--------------SMT-C-IQLNI....P..Q--TTLW------------N---------------
F2GCW9_ALTMD/49-213---------EAS.--------------TAR-L-KALGI....E..V--FAL.------------N---------------
X1X1C6_ACYPI/49-213---------EAS.--------------TEK-L-KALGI....H..V--FDL.------------N---------------
D8LXP9_BLAHO/52-223---------IET.--------------DTH-A-RSLNI....P..M--TDI.------------D---------------
C9A9E9_ENTCA/48-217---------WAS.--------------KKQ-A-EGLGI....P..I--RTI.------------D---------------
W0JTR2_9EURY/54-238---------FQS.--------------RQL-A-LEVGI....P..L--TSL.------------D---------------
K0IFH0_NITGG/62-228---------FQI.--------------KLE-A-ECSGL....K..L--VGE.------------N---------------
E8SF16_STAPH/51-221---------ERT.--------------ENQ-A-KSLNI....P..I--AHI.------------N---------------
RPIA_POLSJ/62-234---------VAS.--------------TER-L-QAIGI....K..V--FDA.------------T---------------
F4PQH6_DICFS/53-227---------FQS.--------------TQL-I-IAAGL....E..L--SDL.------------S---------------
M9SAJ3_9EURY/47-210---------LQT.--------------ASY-A-QMHGL....E..I--SDI.------------D---------------
G7MC82_9CLOT/47-215---------KGT.--------------EKL-A-KELKI....P..L--VKI.------------D---------------
C5AQI6_METEA/50-225---------EAT.--------------RIA-C-EREGI....P..L--ATL.------------E---------------
F9VGE3_LACGL/49-217---------NVT.--------------SQQ-A-ASLNI....P..L--KSI.------------D---------------
F8F3R8_TRECH/53-227---------FQT.--------------VIA-C-EQWGI....P..L--YTL.------------N---------------
H9IUK6_BOMMO/52-227---------FQA.--------------KQL-I-IKHGL....N..L--GEL.------------E---------------
L0HHU8_METFS/55-226---------FQT.--------------AMR-A-REYAI....P..L--TTL.------------D---------------
I1YH59_METFJ/55-224---------VIS.--------------HNR-A-IKAGL....S..V--LSI.------------N---------------
W0RDQ8_9BACT/54-222---------EAT.--------------ERQ-A-AALGI....P..L--STL.------------D---------------
C7P232_HALMD/53-220---------FQS.--------------REL-A-REAGI....P..L--TDL.------------D---------------
D7CXV5_TRURR/54-220---------EAT.--------------GAL-A-RSLGI....P..V--IDLP------------R---------------
RPIA_RHISN/50-224---------ERT.--------------ARL-C-LELGV....P..L--KSL.------------D---------------
RPIA_CANGA/75-252---------YQS.--------------RNL-I-QDNGL....I..L--GSI.------------E---------------
F3YU57_DESAF/56-226---------RRV.--------------EEE-A-RRLAI....P..L--ATL.------------D---------------
RPIA_STRA5/49-217---------NRT.--------------TEQ-A-RGLGI....P..L--KSA.------------D---------------
Q1LN72_CUPMC/49-213---------NAT.--------------TAR-L-RGHGI....R..V--LEA.------------G---------------
E0VP73_PEDHC/118-294---------FQA.--------------EQL-I-TENKL....N..L--GSL.------------S---------------
K4B7U4_SOLLC/96-281---------VSS.--------------ASE-A-AKAGI....P..L--EQYD------------D---------------
R7BZ16_9BURK/48-213---------ERS.--------------RKK-L-EALGF....K..V--IDL.------------N---------------
B5IA06_ACIB4/51-219---------IAT.--------------EKL-A-KEMGI....K..L--GSI.------------N---------------
RPIA_HALSA/52-219---------FES.--------------RRR-A-VDAGV....T..V--TSL.------------E---------------
C5DMD9_LACTC/92-269---------FQS.--------------KEL-I-LTNGL....R..L--GSV.------------E---------------
L0AA43_CALLD/51-220---------NST.--------------SLF-L-SSLGL....E..T--KEF.------------.---------------
D7A674_STAND/52-227---------EVT.--------------RAQ-A-ESLNV....P..L--GTL.------------D---------------
I3TCM9_THEC1/55-227---------IST.--------------ALL-L-RREGF....R..V--LDA.------------S---------------
G0L9M6_ZOBGA/50-218---------NVT.--------------ARL-A-KQAGI....S..L--ISL.------------E---------------
RPIA_ROSDO/56-231---------TRT.--------------AEL-A-REVGI....D..I--ITL.------------D---------------
M5DVR1_9GAMM/53-217---------EAS.--------------AQR-L-RDHGI....H..V--YDL.------------N---------------
W0EYB5_9SPHI/49-217---------EET.--------------KRL-A-MELSI....P..L--IDI.------------N---------------
E5AQX1_BURRH/75-245---------VAT.--------------TNR-L-LSHGF....R..V--FEL.------------G---------------
RPIA_CHLTR/62-231---------RIS.--------------QLL-A-EAVGI....P..L--SDH.------------S---------------
RPIA_STRGC/49-217---------SVT.--------------SQQ-A-EGLGI....P..L--KSI.------------D---------------
S0EY17_CHTCT/49-220---------SRS.--------------REM-A-AEWGI....P..L--IDL.------------C---------------
D5ALR5_RHOCB/56-231---------SRT.--------------ADL-A-RQIGI....S..V--VGL.------------D---------------
C6VYP5_DYAFD/51-218---------EKT.--------------RAL-A-ESLNI....P..L--LSI.------------E---------------
RPIA_NITHX/50-225---------EAT.--------------RAD-A-ERCGI....P..L--TTL.------------D---------------
RPIA2_YERPE/53-229---------RAT.--------------SEV-A-RDVGI....E..L--SDP.------------N---------------
D1CC48_THET1/51-220---------ERT.--------------VAA-A-KAAGV....E..L--TTL.------------E---------------
T0V876_9STRE/49-217---------SVT.--------------YDQ-A-ESLGI....P..L--KSI.------------D---------------
RPIA_ENTFA/48-217---------KET.--------------EKQ-A-LALGI....P..L--KSI.------------D---------------
RPIA_CHRVO/50-214---------EAS.--------------TAR-L-KAHHI....Q..V--FDL.------------N---------------
RPIA_BLOFL/50-215---------QHS.--------------SNQ-L-KKLGI....P..L--YNL.------------N---------------
A8NMB3_COPC7/98-275---------FQS.--------------RQL-I-VAAGL....T..L--GDV.------------D---------------
C4ZP88_THASP/49-213---------EAS.--------------TQR-L-RAHGI....E..V--FDL.------------D---------------
D3S1R9_FERPA/46-214---------YDT.--------------EIL-A-VKNGL....K..V--SSL.------------L---------------
RPIA_MARMM/50-225---------QRT.--------------AQI-A-AENGV....P..L--IDV.------------D---------------
A8MCS2_CALMQ/49-224---------TET.--------------EYE-I-VKLGL....GELL--RYP.------------W---------------
H1YW83_9EURY/51-222---------YQA.--------------MRR-A-REYGI....P..L--GTL.------------D---------------
K0RC06_THAOC/94-276---------VRT.--------------KEQ-A-ESLGI....P..L--VTL.------------D---------------
A5FY01_ACICJ/53-221---------DLT.--------------AAR-A-EFLGL....R..L--VPL.------------D---------------
A0A068XPT4_HYMMI/82-258---------FQA.--------------LQL-I-KDANL....P..L--TSL.------------T---------------
A5K9L2_PLAVS/51-226---------IDT.--------------EIK-A-RNLGI....P..L--TTL.------------K---------------
M4EY56_BRARP/82-268---------ARS.--------------ASE-A-AKYGV....P..L--KHFR------------D---------------
W0BAQ9_9GAMM/47-211---------NAT.--------------ETR-L-RSLGI....P..V--IDL.------------N---------------
J3TF98_9ENTR/49-213---------EAS.--------------SAK-L-KRLGI....R..I--FDL.------------N---------------
G2IZW6_PSEUL/50-214---------EAS.--------------TER-L-KAHHI....P..V--YDL.------------N---------------
RPIA_XYLFA/47-210---------EQS.--------------TAH-L-KQHGI....E..V--LEL.------------N---------------
G7V788_THELD/48-218---------KKM.--------------ELW-A-KECGV....P..S--TDLD------------D---------------
A2SQC5_METLZ/52-219---------NQT.--------------AMR-A-EEYGI....P..L--TTL.------------S---------------
C7PJG1_CHIPD/49-221---------FDT.--------------TAL-L-HEKGF....K..L--VAP.------------.---------------
C5CXD5_VARPS/68-236---------VAS.--------------TER-L-RALGI....P..V--FDS.------------N---------------
F8KWT0_PARAV/52-221---------ERS.--------------ATL-A-REQKI....P..L--LQT.------------D---------------
U5MRI4_CLOSA/54-225---------VKT.--------------KMI-C-VENGV....E..V--LHT.------------C---------------
I0AN47_IGNAJ/47-215---------NRT.--------------TKY-A-NDFGI....I..I--HEF.------------D---------------
Q47A42_DECAR/63-227---------EAT.--------------RKR-L-EGHGI....A..V--YDL.------------N---------------
A9A2Y6_NITMS/51-216---------LQI.--------------KLI-A-EKVGI....P..L--IEA.------------D---------------
I2FUT0_USTH4/82-257---------FQS.--------------REL-I-IDAGL....R..L--GDV.------------D---------------
F4BTP9_METCG/55-220---------FQA.--------------EQL-A-IESNI....R..L--TSL.------------N---------------
RPIA_LACBA/51-220---------DRS.--------------AKQ-A-ESLGI....T..I--KEL.------------D---------------
G8PQ27_PSEUV/49-223---------SYS.--------------QAL-C-DELGV....P..L--TTL.------------D---------------
A9H338_GLUDA/56-227---------EHS.--------------AEQ-A-RAHGI....T..L--VTF.------------A---------------
D1C4M5_SPHTD/55-227---------LRS.--------------ERL-A-RSLGI....P..L--IDLQ------------D---------------
W1NXJ9_AMBTC/82-258---------KQT.--------------LDQ-A-VALGI....P..L--SDL.------------D---------------
C6CYP4_PAESJ/48-216---------VQS.--------------EQL-A-KELGI....P..M--MPF.------------A---------------
A7IKA7_XANP2/69-244---------EQT.--------------LSQ-A-VSLGV....P..I--ATL.------------D---------------
RPIA_STRMK/47-210---------EQS.--------------TAR-L-KQHGI....E..V--IEL.------------N---------------
G8QPQ4_DECSP/53-217---------EAT.--------------AAR-L-KGHGI....P..V--LDL.------------N---------------
RPIA_GLOVI/50-220---------ERT.--------------ARQ-A-EAEGI....V..L--GTL.------------A---------------
RPIA_THICR/49-214---------EAT.--------------AER-L-KDHGI....P..V--MEL.------------N---------------
L0PFR9_PNEJ8/65-240---------FQS.--------------RQL-I-LDASL....S..L--GDV.------------D---------------
RPIA_FRATT/54-219---------EDS.--------------TRK-L-KALGF....D..V--VDL.------------N---------------
L0EWH5_LIBCB/45-219---------KRT.--------------ESL-C-HHLRI....P..L--VSM.------------D---------------
W5JTH8_ANODA/99-275---------FQA.--------------RQL-I-IENGL....V..L--GDL.------------E---------------
I0HZU4_CALAS/53-223---------TAT.--------------LRE-A-MELGI....P..L--LSD.------------D---------------
G4L3E1_TETHN/48-216---------TTS.--------------KKQ-A-EEIGV....P..I--KSI.------------D---------------
M1MGW5_9CLOT/47-215---------RST.--------------ENL-A-KELHI....P..L--VEI.------------D---------------
D4G7S8_RIEPU/49-213---------TSS.--------------TNK-L-KEIGV....S..I--IDS.------------N---------------
RPIA_DEIRA/52-220---------EAS.--------------EKL-A-REVGI....P..T--EPL.------------D---------------
F9ZXG6_METMM/48-216---------IVS.--------------TLK-A-QQLEL....K..L--RGI.------------E---------------
D0MER0_RHOM4/56-228---------YAA.--------------EQL-A-RAEGI....P..L--VTL.------------A---------------
RPIA_TREDE/58-234---------FQT.--------------SIE-C-EKLGI....P..I--YSL.------------S---------------
X6MIV2_RETFI/61-244---------FQS.--------------EEL-V-LKSRL....P..L--GNL.------------K---------------
F4GMC6_PUSST/54-218---------ERS.--------------SAR-M-ASLGI....Q..V--LDL.------------N---------------
Q0BTU6_GRABC/50-222---------LRT.--------------AEQ-A-QAGGI....P..L--TDL.------------G---------------
W6RAI3_9RHIZ/50-224---------ERT.--------------ARL-C-LELGV....P..L--KSL.------------D---------------
W1Q961_OGAPD/51-223---------FQA.--------------REL-I-LSHRL....H..L--GRV.------------D---------------
F7QLK3_9BRAD/51-226---------EAT.--------------RAD-A-ERCGV....P..L--TTL.------------E---------------
E8UAB6_DEIML/52-220---------EAS.--------------DAL-A-RAVGI....T..V--EDL.------------D---------------
T2GAB9_DESGI/59-229---------MLV.--------------ERE-A-RALGI....P..L--KQL.------------D---------------
J7S9W0_KAZNA/74-251---------FQS.--------------QDL-I-LKNGL....Q..L--SSI.------------E---------------
M4CUR6_BRARP/74-251---------TTT.--------------HEQ-A-VSLGI....P..L--SDL.------------D---------------
Q12XU6_METBU/57-225---------YQA.--------------EML-A-IEAGV....P..L--TSL.------------A---------------
J3TZ31_9ENTR/49-213---------EES.--------------SIK-L-QKLKI....P..L--FDL.------------N---------------
RPIA_METTH/52-221---------YQS.--------------MFL-A-AESGI....K..V--TSL.------------A---------------
M4FG93_BRARP/93-269---------KRT.--------------EEQ-A-RSLGI....P..L--VAL.------------D---------------
G2KV06_LACSM/53-221---------KYT.--------------REH-A-ERLGI....M..M--KNV.------------D---------------
C4XRS4_DESMR/57-226---------RYM.--------------AQA-L-RAAGL....P..V--ACL.------------D---------------
D8J531_HALJB/54-221---------YQS.--------------ADL-A-REVGI....P..L--TTL.------------D---------------
G8TEW3_NIAKG/51-220---------KKT.--------------AAL-A-AQQNI....P..L--AEL.------------N---------------
J1L527_9EURY/55-219---------YQS.--------------AIR-A-RAAGI....R..V--ADL.------------A---------------
G2SRV1_LACRR/44-202---------LET.--------------MEI-L-NNLNY....Q..I--VAL.------------D---------------
U6EAE1_9EURY/63-232---------YQS.--------------FYL-A-RDCGI....P..L--TTL.------------D---------------
Q31QQ3_SYNE7/62-233---------FQS.--------------SVL-A-NEYGI....P..L--TTL.------------N---------------
H3ZMP8_THELN/50-221---------HQS.--------------RLL-A-LESGV....P..V--VSL.------------D---------------
S6A8V6_9SPIO/62-238---------FQT.--------------SIE-C-ENLGI....P..V--YSL.------------S---------------
I2GY20_TETBL/77-255---------FQS.--------------KRL-I-LDNGL....N..F--GVV.------------E---------------
RPIA_SCHPO/61-236---------FQS.--------------KQL-I-VNNGL....R..L--GDP.------------D---------------
K4M6Y4_9EURY/76-244---------YQS.--------------EML-A-IEAGI....T..L--TTL.------------A---------------
C6XCW0_METGS/48-218---------TIS.--------------AIK-A-AEHGL....P..L--LDI.------------S---------------
F9ZME5_ACICS/49-213---------LAT.--------------EAR-L-KSLGL....P..V--LDL.------------N---------------
D3QZ19_MAGIU/64-256---------EAT.--------------AKL-A-AARHI....P..L--LSA.------------D---------------
D3SEL8_THISK/49-213---------EAS.--------------AER-L-RGHGI....E..V--LDL.------------N---------------
E8RQ79_ASTEC/50-224---------NQT.--------------THL-A-QSLGL....E..I--KDI.------------N---------------
F2NWS5_TRES6/60-234---------FQT.--------------TLA-C-EELGI....P..V--YTL.------------N---------------
B6JUX1_SCHJY/63-238---------FQS.--------------KEL-I-VSNGL....R..L--GDP.------------D---------------
G8S1W4_ACTS5/66-231---------IEV.--------------ANA-C-AALGL....R..T--ATLN------------E---------------
M4NK33_9GAMM/49-211---------EQS.--------------TAQ-L-KKLGI....P..V--LDL.------------N---------------
C6WWN6_METML/48-217---------AIS.--------------AHK-A-QSLQL....P..I--VAL.------------E---------------
RPIA_SPHAL/51-218---------QAT.--------------EAL-A-LRLAV....P..L--VPF.------------Q---------------
E8UD73_TAYEM/55-219---------VKS.--------------EEL-L-TKFGI....P..V--VDL.------------N---------------
RPIA1_OCEIH/52-220---------NQT.--------------ATW-A-EEAGI....P..L--TDF.------------S---------------
D3SVA8_NATMM/69-244---------FQS.--------------RQL-A-LEYDI....P..L--TTL.------------D---------------
A0B633_METTP/29-193---------YQS.--------------EAL-A-IECGI....P..L--TTL.------------S---------------
I3ZAW8_TERRK/54-224---------QDS.--------------ENL-A-RSLGI....P..I--TDF.------------T---------------
RPIA_PICTO/49-211---------KKS.--------------EEL-C-RSFNI....P...--....------------.---------------
RPIA_PARL1/50-225---------ERT.--------------AKL-A-ASLGI....P..L--TNL.------------D---------------
D5CP37_SIDLE/51-215---------EAS.--------------AKR-L-QGHGI....E..V--LSL.------------N---------------
R5TAR3_9CLOT/56-224---------EQT.--------------RSL-A-SQLNI....P..L--LST.------------D---------------
RPIA_SYNPW/54-226---------FQG.--------------EVL-A-AELGI....P..L--RSL.------------N---------------
RPIA_NITEU/49-213---------EVT.--------------ANR-L-KQHGI....E..V--LDL.------------N---------------
RPIA_POLSQ/52-230---------NAT.--------------TER-L-LKHGF....K..V--LDP.------------N---------------
R5YZJ2_9FIRM/42-213---------EDT.--------------MNL-C-VKAGI....E..V--LPL.------------E---------------
RPIA_DICDI/49-225---------FQS.--------------TQL-I-VEAGL....E..L--SDL.------------S---------------
E7KIH3_YEASA/23-200---------FQS.--------------RNL-I-LDNKL....Q..L--GSI.------------E---------------
E4U7T3_OCEP5/52-221---------RAT.--------------EAL-M-RRVGI....P..V--VELD------------E---------------
M1A5R9_SOLTU/83-260---------SIT.--------------HEQ-A-VSLGI....P..L--SDL.------------N---------------
H6NMT6_9BACL/47-215---------QHS.--------------EDL-A-REWGI....P..L--VAF.------------D---------------
RPIA_EXIS2/49-214---------NET.--------------VEQ-A-KRLNI....P..L--LSL.------------E---------------
W1NX77_AMBTC/31-216---------VSA.--------------ASE-A-AKAGI....P..L--DNHL------------D---------------
F6QWW6_CIOIN/61-235---------FQA.--------------REL-I-LKYKL....S..L--SDL.------------D---------------
J3LTE4_ORYBR/98-282---------TIS.--------------ATE-A-EKAGI....Q..V--SSYK------------E---------------
F2J5C1_POLGS/81-255---------ERT.--------------ETL-A-RSEGI....Q..M--TTL.------------D---------------
RPIA_PROMA/54-224---------FQG.--------------EVL-A-SQLGI....P..L--RAF.------------S---------------
Q4XZ68_PLACH/43-218---------IDT.--------------EMK-A-KSLGI....P..L--TGL.------------T---------------
T0M835_9EURY/55-221---------IES.--------------SER-A-RAAGV....N..V--EEDY------------A---------------
A7SX61_NEMVE/50-223---------FQA.--------------QQL-I-TENKL....V..L--SDL.------------E---------------
RPIA_COLP3/49-213---------EES.--------------TKR-L-KAHGI....E..V--FDL.------------N---------------
C3YIZ9_BRAFL/53-227---------FQS.--------------KQL-L-TEKGL....A..V--SDL.------------E---------------
I4Y6Z4_WALMC/89-265---------FQS.--------------KEL-I-VKNNL....V..L--GDV.------------D---------------
D3E7P8_GEOS4/51-220---------DAS.--------------EKL-A-MEQGI....P..L--TPV.------------H---------------
RPIA_AERHH/49-213---------VAS.--------------TER-L-KGFGI....T..V--YDL.------------N---------------
F2NQH9_MARHT/52-220---------EAS.--------------ARL-A-REVGI....P..L--VELG------------P---------------
Q97J55_CLOAB/50-221---------IKT.--------------RNT-C-IENGI....E..V--LYT.------------S---------------
RPIA_BORPE/54-218---------ERS.--------------AAR-L-AGHGL....A..V--LDL.------------N---------------
F8L7D9_SIMNZ/50-220---------IRS.--------------FEQ-A-QKGGI....P..T--ANM.------------N---------------
RPIA_LODEL/87-262---------FQS.--------------KQL-I-IDNGL....K..L--GQI.------------E---------------
RPIA_BUCAI/49-213---------NSS.--------------TVL-L-KKHGI....E..V--FDL.------------K---------------
A5WDJ0_PSYWF/48-213---------QVT.--------------QDK-L-EALGI....E..V--MDL.------------N---------------
C5E421_ZYGRC/103-280---------YQS.--------------KQL-I-MDNGL....T..Y--AIL.------------E---------------
R6KAA0_9BACE/67-232---------AEI.--------------SMT-C-IQLGI....P..Q--TTLW------------N---------------
RPIA_CRYNJ/105-288---------FQS.--------------KEL-I-VKAGL....T..L--GDV.------------D---------------
R4I0M9_9ENTR/27-192---------DAS.--------------TAK-L-QSLDI....R..V--FDS.------------N---------------
F2KNC4_ARCVS/49-218---------YQS.--------------HIL-A-TNNGI....K..V--VDL.------------I---------------
RPIA_BIFAA/54-223---------RRT.--------------QEQ-A-EGYGI....K..I--VNI.------------D---------------
Q2NFM0_METST/52-220---------YQS.--------------LIK-A-REAGI....N..T--TTL.------------D---------------
A2BLS3_HYPBU/56-231---------FDT.--------------LLE-L-RRLGI....E..A--YDF.------------L---------------
E1ZSN1_CHLVA/75-268---------DAA.--------------AGE-A-AFLGV....P..L--TTLQ------------E---------------
X4ZZX6_9BACL/47-215---------RAS.--------------EQQ-A-RELGI....P..L--VSF.------------G---------------
RPIA_NEIMB/50-214---------KKS.--------------GEL-L-AQYDI....P..V--VSL.------------N---------------
I2GXY8_TETBL/82-259---------FQS.--------------IQL-I-LDNGL....Q..L--GSI.------------E---------------
H2B0V5_KAZAF/71-248---------FQS.--------------RML-I-KENGL....Q..L--GSI.------------E---------------
F0XSQ4_GROCL/58-244---------DQS.--------------MAL-I-EDAGL....R..L--SSI.------------A---------------
K0IAH2_NITGG/43-211---------LQI.--------------KLE-A-ERSAL....R..L--VGE.------------E---------------
G0GBX5_SPITZ/48-222---------FAS.--------------EME-A-HRLGI....P..V--RSL.------------N---------------
Q2S577_SALRD/94-266---------FAT.--------------ERR-A-RTHGI....P..L--TSL.------------D---------------
H1YDM0_9SPHI/67-233---------IEI.--------------SMF-C-AKLGI....P..L--TTLF------------E---------------
M9R6A5_9RHOB/107-282---------TRT.--------------AEL-A-RDVGI....D..V--ISL.------------D---------------
RPIA_MARMS/53-217---------EAS.--------------AER-L-KKHGI....P..V--YDL.------------N---------------
N0B2Z0_9RHIZ/50-225---------EAT.--------------RAQ-A-AALGI....P..L--GTL.------------D---------------
H8GNV1_METAL/49-213---------VGT.--------------SER-L-KKVGI....P..V--LDL.------------N---------------
RPIA_SACD2/53-217---------EAS.--------------SEQ-L-KGHGI....P..V--YDL.------------N---------------
I0HPM0_RUBGI/49-214---------VQS.--------------TER-L-RRHGI....P..V--VEA.------------A---------------
E3I3Z1_RHOVT/52-227---------EQT.--------------KRF-A-EERGI....K..I--ADF.------------N---------------
B3S327_TRIAD/82-257---------FQA.--------------RQL-I-IENKL....T..L--SDL.------------E---------------
E1V466_HALED/53-217---------EAT.--------------AER-L-RGHGI....D..V--FEL.------------N---------------
RPIA_LISMO/48-217---------EET.--------------NKQ-A-QNLGI....P..L--KSL.------------N---------------
K0HYL3_9BURK/55-223---------VAS.--------------TER-L-KALGI....A..V--FDA.------------N---------------
L0DB73_SINAD/52-222---------GAT.--------------EEL-A-RSLAI....P..L--REL.------------D---------------
I1GB43_AMPQE/96-272---------FQA.--------------KEL-I-ISNGL....V..L--SNL.------------E---------------
F7WZV0_9ENTR/48-215---------TIS.--------------YNY-L-RELNI....P..I--IEL.------------N---------------
RPIA_AZOSB/49-213---------EAS.--------------SKR-L-AAHGI....A..L--LDL.------------N---------------
F0Y5F5_AURAN/53-236---------VRT.--------------KEQ-A-EELGI....P..L--TTL.------------D---------------
V2WV49_MONRO/117-294---------FQS.--------------KEL-I-VQSGL....T..L--GDV.------------D---------------
F4NUT5_BATDJ/57-224---------FQA.--------------QQL-I-LEAGL....P..L--V...------------.---------------
I6ZP08_MELRP/52-241---------KKT.--------------EEL-A-AGLGI....P..L--LSL.------------N---------------
RPIA_TERTT/53-217---------EAS.--------------ARQ-L-EGHGI....P..V--YDL.------------N---------------
F6D5Q0_METPW/48-217---------YQS.--------------FFL-A-KESGI....P..V--TTL.------------N---------------
RPIA_THEAC/52-221---------RRT.--------------EDL-A-KQNGI....E..V--I...------------Q---------------
M9WWF3_MANHA/49-214---------KAS.--------------EQR-L-RDIGI....E..V--FSA.------------N---------------
K0KIV4_WICCF/89-265---------FQS.--------------KNL-I-VDNGL....R..L--GAI.------------E---------------
F5XWJ8_RAMTT/49-217---------EAS.--------------TQR-L-RALGI....R..V--FDA.------------N---------------
F1P520_CHICK/51-225---------FQA.--------------RQL-I-LQNGL....T..L--SDL.------------D---------------
Q8A699_BACTN/68-231---------QEI.--------------SMT-C-IQLGI....P..Q--TTLW------------D---------------
RPIA_WIGBR/49-213---------RIS.--------------SSK-L-KDLNI....P..L--FDL.------------N---------------
RPIA_ACIAD/51-216---------EAT.--------------AKR-L-KELGI....E..V--VDM.------------N---------------
RPIA_ALCBS/49-213---------EAT.--------------AER-L-KQHGI....E..V--FSL.------------N---------------
R7KJK7_9BURK/49-212---------VRS.--------------TNK-L-QAYGF....K..V--LDL.------------N---------------
D7DIR1_METV0/48-216---------TIS.--------------AIT-A-QSLNL....P..I--VAL.------------E---------------
RPIA_COXBU/49-213---------VAT.--------------ENR-L-KEHRI....P..V--VDL.------------N---------------
R6DID1_9BACE/67-232---------KEI.--------------SMT-C-IQLGI....P..Q--TTLW------------N---------------
G8YN53_PICSO/70-246---------FQS.--------------KEL-I-ISNGL....R..L--GSI.------------E---------------
RPIA_NITMU/49-213---------EAT.--------------ARR-L-SAHGI....E..V--MDL.------------N---------------
G8NWP6_GRAMM/50-220---------DAS.--------------HNL-A-ASLGM....D..I--TTL.------------D---------------
Q2JK16_SYNJB/60-231---------ERT.--------------AEQ-A-RSLGI....P..L--ATL.------------E---------------
E4RMI9_HALHG/47-215---------KET.--------------AEL-A-LEEGI....E..L--IEL.------------S---------------
RPIA_STRU0/49-217---------SAT.--------------TKQ-A-ESLGI....P..L--KAV.------------D---------------
M4YU37_9EURY/54-224---------NAS.--------------EDL-A-KECGI....T..T--LDL.------------N---------------
E1SRT4_FERBD/49-213---------EAS.--------------TER-L-KALGI....E..V--FDM.------------N---------------
G2TNQ6_BACCO/47-213---------RAT.--------------EKL-A-RECGI....P..I--ADL.------------N---------------
T0LJI5_9EURY/46-210---------LAS.--------------EKL-A-RDVGI....K..I--VDI.------------D---------------
R4VWQ3_9EURY/50-228---------HQS.--------------REI-A-LNVGI....P..V--VDL.------------D---------------
D7BFY7_MEISD/53-219---------EAT.--------------ALL-A-RDAGI....E..L--LELG------------P---------------
A6LDT5_PARD8/67-229---------LEI.--------------RMT-C-AQLGI....P..V--TSLF------------S---------------
RPIA_BRADU/50-229---------EAT.--------------RLD-A-TRCGV....P..L--TTL.------------D---------------
RPIA_PSYIN/49-213---------DES.--------------TAR-L-QSYGI....D..V--FDL.------------N---------------
G4LWP8_SCHMA/56-232---------FQA.--------------RQL-L-INHKL....P..V--TEL.------------D---------------
D6YRJ4_WADCW/55-225---------QES.--------------ELQ-A-RLAGI....P..I--ADL.------------D---------------
B3PGI3_CELJU/53-218---------DAS.--------------AQR-L-QTLGI....E..V--LDC.------------N---------------
RPIA_HALLT/54-234---------FAS.--------------REL-A-AECGI....P..L--LDL.------------D---------------
G3B6X8_CANTC/51-227---------FQS.--------------KNL-I-IDNGL....Q..L--GSI.------------E---------------
X4ZKY5_9BACL/47-218---------VKT.--------------RLL-C-IEQGL....E..V--LYT.------------S---------------
M7NVH6_PNEMU/63-238---------FQS.--------------RQL-I-LDFGL....Y..L--GDV.------------D---------------
T1G2H1_HELRO/34-210---------YQAL--------------RSL-Q-SFESL....Q..I--STL.------------D---------------
B8GFA6_METPE/54-225---------FQT.--------------AIR-A-RGCGI....P..L--ATL.------------N---------------
D5VCE7_MORCR/51-215---------QVT.--------------EDK-L-KALGI....E..I--YDL.------------N---------------
RPIA_AERPE/52-223---------FET.--------------AVE-L-AGLGW....S..V--GD.P------------R---------------
E3GWJ6_METFV/52-219---------YQS.--------------FLL-A-KNCGI....P..L--TTL.------------E---------------
RPIA_LEGPH/46-211---------KAT.--------------EAL-L-RAEGI....P..V--IDL.------------N---------------
M0SLL9_MUSAM/77-246---------EWA.--------------AAR-A-ASAGI....P..L--TDL.------------N---------------
E3KHK5_PUCGT/92-267---------FQS.--------------KEL-I-VKAGL....N..L--GDV.------------D---------------
F6I3G7_VITVI/31-214---------VAS.--------------ASE-A-AKVGI....P..L--GHYQ------------D---------------
G8BV63_TETPH/74-250---------FQS.--------------RAL-I-LDNGL....K..L--GTV.------------D---------------
RPIA_VANPO/73-250---------FQS.--------------RAL-I-LDNGL....Q..L--DSI.------------D---------------
Q5L9R3_BACFN/67-232---------MEI.--------------SME-C-VRLGI....P..Q--TTLW------------M---------------
B8D3V9_DESK1/56-231---------HDT.--------------LLH-L-VSLGL....NTAV--DPAG------------V---------------
C1DG96_AZOVD/53-217---------EAT.--------------AAR-L-RSHGI....E..V--HDL.------------N---------------
J0DD48_AURST/58-235---------FQS.--------------KNL-I-VDAGL....V..L--GDI.------------E---------------
F9UTV2_LACPL/44-213---------PTT.--------------RQL-A-TVLGY....T..V--VDT.------------.---------------
D3EQA2_ATETH/54-222---------FQA.--------------EVL-A-KQYNI....P..L--STL.------------D---------------
E3EIW3_PAEPS/47-215---------QAS.--------------EDQ-A-RGLGI....P..I--IPF.------------D---------------
B4RDL0_PHEZH/48-222---------QAT.--------------GEL-A-ASLGI....R..I--AEL.------------G---------------
E8R3Z4_ISOPI/46-223---------QRT.--------------EAL-A-RTLGI....P..L--IEL.------------D---------------
Q03Y20_LEUMM/48-216---------TIT.--------------SQR-C-AELNI....P..I--VDI.------------D---------------
H8L3T4_FRAAD/49-212---------VQS.--------------TEH-L-HRLQI....P..V--LDL.------------N---------------
K1QVV1_CRAGI/53-228---------FQA.--------------NQL-I-QEHRL....N..L--GTL.------------E---------------
G0S4N8_CHATD/70-253---------SQS.--------------EEL-I-EAAGL....N..L--QYI.------------S---------------
B9SV71_RICCO/31-216---------IAS.--------------ASE-A-AKAGI....R..L--DRYQ------------D---------------
K8GIM2_9CYAN/57-226---------FQG.--------------EVL-A-RECGI....P..L--TTL.------------D---------------
F0YD86_AURAN/31-218---------DAT.--------------ARL-L-ETLKL....PTLR--HDS.------------D---------------
RPIA_PARUW/56-226---------ERS.--------------MRQ-A-RLVGI....P..I--VDS.------------D---------------
RPIA_PROMT/53-224---------FQG.--------------EVL-A-SELGI....P..L--KSL.------------S---------------
D8QJZ8_SCHCM/98-277---------FQS.--------------KAL-I-LNSKL....N..L--GDV.------------E---------------
E0WTW1_9ENTR/49-211---------VAS.--------------TEK-L-TSLGI....P..T--IDC.------------N---------------
I0DQJ4_PROSM/49-213---------EAS.--------------TAK-L-KSLGI....P..V--LDC.------------N---------------
C8WXS2_ALIAD/47-215---------RET.--------------ERL-A-RELGI....P..L--TDF.------------R---------------
Q057H5_BUCCC/48-211---------KKS.--------------EKL-L-KKINI....P..I--YDL.------------N---------------
R7IB62_9BURK/49-212---------VRS.--------------TEH-L-ERLGF....K..V--LDP.------------N---------------
RPIA_NATPD/54-221---------YQS.--------------RQL-A-READI....P..L--TTL.------------E---------------
RPIA_AGRVS/50-224---------ERT.--------------ARL-C-LELGV....P..L--MSL.------------D---------------
A9FJ44_SORC5/54-221---------ERS.--------------EAL-A-RRENI....P..T--VSL.------------E---------------
C4K7U6_HAMD5/49-213---------EDS.--------------TRK-L-NNIGI....P..V--LDT.------------N---------------
E1RIV4_METP4/53-224---------FQA.--------------SMR-A-REYGI....P..L--SVI.------------D---------------
E0TBP1_PARBH/47-221---------EET.--------------ARL-A-EAVGI....S..L--ITP.------------D---------------
A5UJW1_METS3/48-217---------FQS.--------------LLL-A-KQWNI....P..V--TSL.------------E---------------
Q4J990_SULAC/47-214---------IDT.--------------ELE-I-SQRGG....L..I--LSLY------------S---------------
RPIA_NITOC/49-213---------EAS.--------------TAR-L-KALNI....P..V--YEL.------------N---------------
L0KVT8_METHD/75-244---------YQS.--------------EML-A-IEAGI....P..L--TTL.------------A---------------
U4LD71_PYROM/74-243---------YQS.--------------LQL-L-LDNNL....R..V--SSI.------------D---------------
Q04HC0_OENOB/54-221---------IFT.--------------AQQ-A-KSLGI....K..I--VDL.------------D---------------
C4WVS8_ACYPI/93-269---------YQA.--------------RQL-I-IDYKL....T..L--GNL.------------D---------------
RPIA_METMP/63-233---------FDS.--------------RMM-A-SNSGI....P..L--ISL.------------D---------------
A9TPW9_PHYPA/30-202---------YQS.--------------RVL-S-RQFGV....K..T--MDL.------------N---------------
W4X032_ATTCE/11-187---------FQS.--------------RQL-I-LDNHL....T..L--GDL.------------E---------------
K0C3P7_CYCSP/48-212---------EAS.--------------TER-L-LALGI....P..V--LDL.------------N---------------
G7UTB3_PSEUP/49-212---------EQS.--------------TQR-L-KSHGI....E..V--LDL.------------N---------------
R6FYM5_9FIRM/44-214---------DDT.--------------AEL-C-KNLGL....M..V--LSL.------------E---------------
RPIA_IDILO/51-215---------EAS.--------------TER-L-KSHGI....E..V--FEL.------------N---------------
B9H933_POPTR/302-473---------YQS.--------------RVL-A-TQFGV....T..V--VDL.------------S---------------
E6N4F6_9ARCH/47-216---------WQS.--------------YYE-A-IELGL....M..V--SSL.------------D---------------
Q38UZ2_LACSS/51-220---------IRT.--------------AEQ-A-TSLGI....P..V--KAL.------------N---------------
G7WLJ5_METH6/55-219---------YQA.--------------QEL-A-IAAGI....P..L--TSL.------------D---------------
R6UYF7_9FIRM/64-231---------LAS.--------------KLL-A-QQAGLCVVEP...--....------------D---------------
G0AB06_COLFT/70-238---------EAT.--------------AAR-L-RAHDI....E..V--YDL.------------N---------------
C8XJ99_NAKMY/47-205---------PRT.--------------ATA-A-GELGL....R..I--VDF.------------S---------------
E3DMJ6_HALPG/47-216---------KET.--------------ADL-A-LSEGI....E..L--IDL.------------A---------------
D8IPP5_HERSS/49-217---------EAT.--------------AER-L-RSHGI....T..V--FDL.------------N---------------
F8DCN0_HALXS/54-229---------FQS.--------------RQL-A-LEVGI....P..L--TDL.------------D---------------
RPIA_META3/58-228---------FES.--------------RMM-A-IQYGI....P..L--VSL.------------D---------------
RPIA_ROSS1/52-222---------EVT.--------------AAL-A-RELGI....P..L--TTL.------------D---------------
C7RN75_ACCPU/49-213---------EAT.--------------RQR-L-ASHGI....A..V--FDL.------------D---------------
RPIA_TREPA/69-245---------FQT.--------------ALI-C-ERYNI....P..L--FSL.------------S---------------

PF04198

YJHU_ECOLI/63-323---------IDAA--------------LQI-R-DKFNLQRVII--V..PDGEHAGKR-------D---------------
Q9WWA6_AGRRK/83-337---------PMLE--------------KEL-V-AKFDLRKAVV--V..PAPV.....-------R---------------
Q9CKH2_PASMU/56-313---------SKLE--------------QRL-I-EQFGIHRALI--A..IDTQ.....-------N---------------
Q98GB2_RHILO/49-296---------DDIT--------------RQL-I-DGLKLRDAAV--V..ETPA.....-------.---------------
Q9RT33_DEIRA/86-346---------CSLQ--------------ARL-M-ERWPGVQAQV--VGLPPHS.....-------T---------------
Q986P9_RHILO/64-319---------VELE--------------DEL-S-RRYGLDYCEV--V..PDFD.....-------S---------------
Q97L54_CLOAB/89-338---------TDIE--------------EFI-R-INLNIKKVII--V..PGDI.....-------D---------------
Q9CGB1_LACLA/54-307---------FELE--------------KQF-K-TLFDIPQIYI--I..KDVE.....-------D---------------
Q98CZ8_RHILO/62-317---------LDLA--------------ARL-K-SRFALDLVEV--V..PSDP.....-------N---------------
Q9L0Z6_STRCO/89-343---------AERS--------------DAL-R-ARYGLRHAVV--V..ESPA.....-------D---------------
Q99XS9_STRP1/56-314---------FALE--------------EYV-R-QQYGLEKLDL--V..PNQV.....-------E---------------
Q9CLG2_PASMU/68-318---------LELE--------------EAL-K-EHFQLKHIRI--L..PALE.....-------K---------------
LSRR_ECOLI/66-316---------LEYE--------------TQL-R-RQFSLQHVRV--I..PGLA.....-------D---------------
Q9KER9_BACHD/57-313---------VELE--------------QRL-E-KKYHLKEAIV--V..PTSG.....-------L---------------
DEOR_BACSU/56-311---------DALG--------------SIL-E-EKYGLLEAHV--VFSPTPD.....-------.---------------
Q9KLX0_VIBCH/62-319---------AKIE--------------QRL-I-ERFGVRRALI--A..LDQP.....-------N---------------
CGGR_BACSU/89-338---------TLLE--------------KTL-K-ERLNLKDAII--V..SGDS.....-------D---------------
Q9K712_BACHD/89-338---------RDLE--------------AKL-R-SRLGVKEAIV--V..PGDS.....-------D---------------
Q986M3_RHILO/57-311---------DVMA--------------RRL-E-DALKLDAVWI--A..PENG.....-------Y---------------
Q98FV1_RHILO/42-296---------VRLE--------------RAL-E-RTFGLQQALV--A..PLTA.....-------P---------------
A6TBJ1_KLEP7/59-311---------LDYA--------------QLL-Q-EKYRLIECNV--V..PAFS.....-------E---------------
A6TGS9_KLEP7/60-317---------LWLE--------------QQL-K-QKFGLKEAVV--A..SSDG.....-------L---------------
D5AUX6_RHOCB/60-314---------LDLE--------------VAL-S-RRFALKLARV--V..PALP.....-------A---------------
Q1GB28_LACDA/125-376---------SQAE--------------VWL-A-QALGIDRTII--V..AGDA.....-------D---------------
Q2G033_STAA8/91-337---------NRLS--------------EGI-K-NKFQIKEVHV--V..PGDA.....-------D---------------
Q2YIQ4_BRUA2/58-310---------IDLE--------------NRL-A-DLYGLDYCEV--A..PDIG.....-------E---------------
Q3J1R9_RHOS4/62-317---------LHLE--------------AAL-I-RRFGLKLARV--A..PSLG.....-------S---------------
Q8DRC3_STRR6/59-313---------FKLE--------------NYV-K-EKYGLESLEI--I..PNEF.....-------D---------------

PF16957

G8NWE8_GRAMM/11-551---------IHDL--------------HLI-I-SSISR----PEHLTLFELGIAKKV-------DFAFAGPQSLRVAQLL
A4G553_HERAR/3-550---------VHDL--------------HML-L-SVLAL----PEHLDIFDKGIASRL-------DFSFSGPQAVRLARLV
F2F9P2_SOLSS/9-549---------VHDL--------------HMI-M-SSVSR----PEHLDIFEEGIAKKI-------DLSFAGPQSLRIAQMI
R5PZQ8_9BURK/9-554---------IHGL--------------HMI-M-PSVSL----PEHMDLFEKGIAKRL-------DFSYAGSQSLRIAQLL
H0Q3G8_9RHOO/10-553---------VRDL--------------HLV-Q-SVLAL----PEHVDIIESGQVSRI-------DFSFSGPQAGRLARLV
D7A7S5_STAND/12-556---------VNDL--------------HIV-Q-SGVVL----AEHLDLFEAGVAKRL-------DFSYSGPQGGAIARAL
A1T0S7_PSYIN/7-551---------VNNL--------------HMI-M-PSVSL----PEHMNIFEKGIASKL-------DFAFAGQQSVRISQML
Q21AG5_RHOPB/6-554---------INNL--------------HMV-Q-SCVPL----PVHLDMFEKGIAKKL-------DFAFGGPQAARVAKFI
Q20XM1_RHOPB/13-552---------IHDL--------------KAV-I-WAIAR----PDHMEIFELGIASEV-------DFSFAGPQSLRLAQML
Q478I4_DECAR/8-554---------INHL--------------SMV-Q-SVLAL----PSHVDLFERGLATRL-------DFSFSGPQGARLAKLV
D3FW15_BACPE/11-551---------LHDL--------------HMI-M-SSISR----PEHLDIFEKGIAHTV-------DFAYAGPQSLRIAQMI
A4VRZ1_PSEU5/10-555---------LHDL--------------HMI-M-PSVSR----AEHLDLFERQIARKL-------DFSFAGPQSLRISQLL
B2JLU6_BURP8/23-563---------VHDV--------------HLL-I-SSISR----PEHLTLFEKNIAHKV-------DFSFAGPQSLRVAQLL
B6JFK2_OLICO/14-556---------IHGL--------------HIV-Q-SNIAL----PTHLDVFENGLAEKL-------DFCYSGPQGVRISRLV
C5APL2_METEA/4-548---------VHDL--------------HMV-Q-SGIVL----PEHLDIFEQGIARRL-------DYSYSGPQGARIARML
C9A847_ENTCA/7-547---------VNNL--------------HMI-M-SSISR----PEHLTIFEKGIAAKI-------DFSYAGAQSTRVAQMI
E0SJB1_DICD3/11-551---------VHDL--------------HMI-M-PSVGR----SEHLDIFEKGIAHKL-------DFSFSGTQSLRISQLL
Q5ZSU0_LEGPH/3-548---------IYGL--------------HML-Q-SAVTL----SEHLDLFERGIAEKI-------DFAFAGPQSTRLAIMI
Q63VB2_BURPS/4-548---------VHGL--------------HMV-Q-SGVVL----PEHLDVFERGIAKRL-------DYAYSGPQSQRIAKLL
Q8P4U7_XANCP/4-548---------VHDL--------------HMV-Q-SVLSL----PAHLDVFERGIAKRL-------DFSFSGPQAARLAGLV
R7CR99_9FIRM/10-557---------VHDL--------------HMI-Q-STLSI----PEHLDVFEKGIAHKL-------DFAYAGSQGKRLAQMV

PF01182

Q3SH15_THIDA/10-221---------VAAL--------------ADA-L-CAEAE----------ADI.....R...---.A---------------
B8HJV3_CYAP4/9-228---------IQRG--------------LEI-T-LACCQ----------TAL.....A...---.D---------------
6PGL1_ORYSJ/38-272---------ATDL--------------AEY-I-SQVSE----------ISI.....K...---.E---------------
D0LNM1_HALO1/16-236---------AQAM--------------ADD-V-AEVLR----------AAI.....A...---.E---------------
B1XIZ0_SYNP2/9-227---------IKRA--------------LRI-V-MGRIE----------EAI.....A...---.R---------------
B4M2H3_DROVI/15-234---------VQSL--------------CDV-L-QRCAN----------RAL.....E...---.S---------------
B8GMY0_THISH/13-236---------AATV--------------ASE-V-LDLAA----------RCI.....R...---.A---------------
A8KYS2_FRASN/18-247---------ARAA--------------AAR-L-ITALV----------DAQ.....A...---.A---------------
Q5NMF8_ZYMMO/10-233---------AKQI--------------ADD-I-EFIIK----------QAI.....E...---.K---------------
C1EGM8_MICSR/42-262---------AKAL--------------CAE-V-EENAK----------ACL.....A...---.E---------------
C5B9U1_EDWI9/8-229---------NIHL--------------AEA-V-AERLR----------QGI.....A...---.A---------------
Q7NGI9_GLOVI/9-228---------SLEA--------------AQL-F-EEAAH----------AAI.....A...---.L---------------
C7MSN0_SACVD/11-245---------AAAA--------------AAR-L-VSTLA----------DIQ.....A...---.R---------------
Q39SD7_GEOMG/6-227---------SMAA--------------AEL-F-ATAAH----------SAM.....R...---.D---------------
A0L802_MAGMM/12-233---------AQVL--------------AQS-L-TQAML----------AKG.........---..---------------
Q7V1T4_PROMP/18-234---------SSNV--------------SNF-I-ENQIV----------QTL.....K...---.I---------------
C1D789_LARHH/8-223---------VLAA--------------ARH-L-LHLTE----------YAL.....R...---.A---------------
A5FY02_ACICJ/12-233---------AEYG--------------ARL-F-AEEAA----------AAR.........---..---------------
Q3A631_PELCD/13-221---------ARNA--------------ADR-I-LAAAS----------EAI.....D...---.R---------------
B0C6U0_ACAM1/9-229---------IERA--------------LEL-T-LAEIK----------DAI.....A...---.Q---------------
A1BIC7_CHLPD/11-265---------TAIA--------------AAV-I-ISAAN----------RAV.....A...---.T---------------
D2Q4L4_KRIFD/10-274---------AHAV--------------AAR-L-ITRLV----------DVQ.....S...---.T---------------
D0LCU1_GORB4/9-234---------VSTA--------------ARR-F-VDLVT----------AAQ.....R...---.D---------------
A9WT44_RENSM/9-251---------AATT--------------AAR-I-ITKLL----------DTQ.....N...---.E---------------
Q1AZZ4_RUBXD/7-229---------AAAA--------------ARE-F-AARAA----------HAV.....R...---.A---------------
B8FL61_DESAA/16-238---------AAYA--------------AEF-F-LECAS----------SGI.....R...---.E---------------
B4S4M1_PROA2/7-257---------LEKT--------------AAC-I-ISKAL----------QAI.....R...---.Q---------------
A1SJQ5_NOCSJ/11-231---------ATAV--------------AGE-L-LTRLA----------DAQ.....A...---.A---------------
B3RVC2_TRIAD/8-226---------GQDL--------------CKY-I-AEKSS----------QAI.....Q...---.D---------------
D0L091_HALNC/12-236---------VAQC--------------GHY-V-QQKLN----------LAI.....A...---.Q---------------
D5URS5_TSUPD/12-243---------VTAA--------------ADD-V-ATVIA----------QAQ.....A...---.E---------------
Q1IWW4_DEIGD/7-212---------AQAA--------------AEA-F-AQAAR----------EAV.....A...---.A---------------
C3ZBQ0_BRAFL/569-794---------ITQL--------------AND-I-KDIAL----------QTL.....Q...---.T---------------
B1VDQ7_CORU7/27-269---------AAAA--------------ARD-L-VRTVT----------KVQ.....R...---.E---------------
Q2JHW7_SYNJB/10-224---------IQRA--------------IEI-W-QARSA----------AAI.....R...---.E---------------
A2G0T4_TRIVA/480-702---------VQSV--------------TER-L-TRLIV----------DTV.....E...---.K---------------
B2IE85_BEII9/11-231---------TERV--------------ALW-I-ANCVA----------LA..........---.G---------------
A9UYD4_MONBE/167-386---------GQAA--------------AKW-L-CEQAE----------AAI.....A...---.D---------------
A1U1P6_MARHV/16-235---------ARAL--------------AST-V-ADVLA----------SRL.....E...---.Q---------------
A4S930_OSTLU/33-252---------ARAL--------------CLE-V-EENAR----------GCL.....Q...---.E---------------
Q165T6_ROSDO/7-221---------AIGV--------------ADT-L-ASGLK----------KAL.....S...---.I---------------
C6VSE7_DYAFD/7-229---------SASL--------------AEW-I-NNYIQ----------QVL.....A...---.K---------------
B2GH88_KOCRD/13-243---------AAET--------------ARR-A-LEVLE----------AAQ.....D...---.G---------------
Q3SP94_NITWN/19-240---------ATEA--------------AER-I-ILRIT----------EN..........---.A---------------
A1AR88_PELPD/9-231---------SRAA--------------AEI-F-ALTAE----------QAI.....A...---.S---------------
A6TTT0_ALKMQ/9-234---------AKKL--------------GVY-V-TALAM----------DSI.....R...---.K---------------
Q31GB5_THICR/12-219---------AQAL--------------AET-L-LELAE----------KAI.....A...---.A---------------
C5BV30_BEUC1/10-236---------AEAV--------------AAR-L-ALAIA----------DAQ.....A...---.V---------------
Q89FE0_BRADU/14-235---------AQAA--------------AER-V-MARIG----------AN..........---.P---------------
6PGL_DICDI/11-234---------EDEC--------------VKF-I-KNVIT----------DSI.....N...---.S---------------
E3D833_GARV3/17-261---------AAVA--------------AQK-.-...LV----------TLI.....M...---.Q---------------
A0JWQ2_ARTS2/11-250---------MAAI--------------AAR-L-ITKLV----------DVQ.....D...---.K---------------
Q60CQ2_METCA/8-232---------APAL--------------AAA-V-AEDVR----------AAL.....A...---.T---------------
D3Q4S0_STANL/10-238---------AQSV--------------AAR-L-ATTII----------DAQ.....A...---.E---------------
B0T0C3_CAUSK/15-233---------FDAA--------------ASV-L-ALALT----------DGV.....A...---.K---------------
B9RWU5_RICCO/17-246---------AVSL--------------AKY-T-ADLSE----------KFA.....K...---.E---------------
Q0V513_PHANO/11-243---------AASL--------------RAY-V-LDAQN----------SSI.....E...---.R---------------
A8LLP7_DINSH/7-222---------MMRL--------------ADR-I-SADLK----------ECL.....L...---.T---------------
C5E1Z3_LACTC/131-360---------SRDL--------------ALY-I-LAQQD----------AAL.........---.Q---------------
Q6A7F7_PROAC/10-227---------AEGV--------------AHR-L-VQTIV----------RIQ.....A...---.A---------------
6PGL_RAT/13-237---------GASL--------------AQL-V-AQRAA----------SCL....EG...---.N---------------
A3HVL3_9BACT/7-226---------AEEF--------------SYY-L-KELAD----------KGE.........---..---------------
Q482L5_COLP3/8-229---------DNEL--------------AST-V-SDILA----------KAI.....K...---.E---------------
Q602U1_METCA/13-226---------EIRV--------------VKG-I-LRMAW----------EAI.....A...---.I---------------
A7RMK1_NEMVE/10-232---------QMSV--------------CSL-I-AEKST----------KAI.....A...---.D---------------
A8Y0B4_CAEBR/9-229---------VTQL--------------KNY-L-TKRLK----------YLL.....D...---.M---------------
C1MQ42_MICPC/10-239---------ADAL--------------ASL-T-IKAAE----------KAI.....S...---.E---------------
B4SF86_PELPB/47-298---------TEHA--------------AAL-I-VAEAY----------RAL.....A...---.D---------------
B1LXU6_METRJ/11-233---------AREA--------------AER-I-IVACG----------ET..........---.R---------------
A6X608_OCHA4/9-230---------AQAL--------------SEA-I-ANKLN----------AAI.....A...---.E---------------
Q2SQ14_HAHCH/16-233---------AHKL--------------ALQ-T-AEWLR----------AAL.....Q...---.E---------------
C7R459_JONDD/9-233---------ARTT--------------AAR-L-LVTLI----------DLC.....A...---.V---------------
C1DRP8_AZOVD/18-236---------ATAM--------------AQR-V-ARALQ----------AAI.....E...---.A---------------
A5FAH5_FLAJ1/6-228---------NTAA--------------ADL-F-TAAAQ----------DAI.....A...---.K---------------
A9PA91_POPTR/14-244---------AVSL--------------AKY-V-ADLSA----------KFA.....K...---.E---------------
6PGL_TREPA/7-224---------AAFL--------------VSV-F-DSRLK----------TQE.........---..---------------
Q7UM40_RHOBA/5-223---------SNAA--------------ADA-F-CKAAK----------EAI.....E...---.Q---------------
C3ZB29_BRAFL/10-239---------GAAL--------------GAL-V-AAKAQ----------EAI.....G...---.D---------------
B8C1W9_THAPS/20-270---------GTVL--------------SDT-I-VQQCR----------SAL.....Q...---.S---------------
Q5FQ99_GLUOX/14-235---------ALRM--------------ADL-L-VEGIL----------AK..........---.T---------------
Q6NH39_CORDI/8-228---------IQEA--------------HRR-F-LQVID----------DV......V...---.S---------------
A8IFM0_AZOC5/18-239---------ARAL--------------AAH-V-AEALR----------RRL.....A...---.T---------------
B0UFD2_METS4/12-231---------ARAA--------------AER-L-VALAA----------AP..........---..---------------
Q08ZT9_STIAD/9-213---------AGQA--------------ADW-L-AEALR----------QSL.....A...---.G---------------
Q2IHT3_ANADE/13-235---------ARAA--------------AEE-V-ARRAE----------AAV.....A...---.A---------------
D1CEH8_THET1/9-231---------ARAG--------------AEQ-F-ISRAK----------ESI.....D...---.D---------------
Q31QV8_SYNE7/9-229---------VSAA--------------QTL-V-LETAS----------RAI.....A...---.E---------------
C1DDK6_AZOVD/18-235---------AEEL--------------AGR-V-AEVLR----------QAI.....D...---.S---------------
A6WC51_KINRD/12-239---------AAAT--------------AGR-L-LSAVA----------DAQ.....A...---.A---------------
B1MC71_MYCA9/10-236---------VTAA--------------GDR-L-ASAIT----------GAL.....A...---.E---------------
D2SF51_GEOOG/27-257---------ARAV--------------AAA-L-VARLA----------AAQ.....A...---.V---------------
D1BS91_XYLCX/10-239---------AQAA--------------AAR-L-LTRIL----------DMQ.....S...---.V---------------
Q5YTR6_NOCFA/29-251---------VTAG--------------ARR-F-VEVVV----------AAQ.....A...---.E---------------
Q0BTV3_GRABC/17-236---------ADHV--------------AAW-L-AERIQ----------KS..........---..---------------
B2FL79_STRMK/16-238---------IEAV--------------AAE-M-AQTLN----------HDI.....N...---.E---------------
A5BJC3_VITVI/17-249---------STDL--------------ADY-I-AELSE----------VSV.....K...---.E---------------
B8IN69_METNO/12-232---------ARSA--------------AER-L-VALAS----------GT..........---..---------------
Q8DJZ4_THEEB/10-227---------TTAA--------------KQF-V-LEQAR----------GAI.....A...---.Q---------------
D2AVA1_STRRD/10-237---------AKAV--------------AAR-V-ITRTV----------DVQ.....S...---.G---------------
Q4Q8S1_LEIMA/12-256---------SSAA--------------RDI-I-LAAID----------ARV.....D...---.K---------------
Q312M1_DESAG/38-260---------ARQA--------------AEL-I-IERCA----------AAV.....A...---.A---------------
A5EXD3_DICNV/9-224---------AQSL--------------ALA-I-AADLR----------QLL.....Q...---.Q---------------
A0LDZ7_MAGMM/13-230---------IATL--------------AET-V-VMRLQ----------RGI.....Q...---.Q---------------
C4LIR1_CORK4/27-277---------AMRA--------------ARD-V-ENVIV----------SIQEGREGA...---.S---------------
B3EN23_CHLPB/5-259---------VQQA--------------AAC-I-ASRIF----------RAI.....E...---.K---------------
B7FPL4_PHATC/11-262---------PYHL--------------NSA-I-MKVCQ----------EAL.....V...---.Q---------------
B8ELV8_METSB/11-231---------AARA--------------AAW-I-AAKIA----------AA..........---.P---------------
G6PE_HUMAN/558-782---------ISKL--------------AND-I-EATAV----------RAV.....R...---.R---------------
A5VAC4_SPHWW/10-232---------AEAV--------------AGD-V-GFIIE----------SAL.....D...---.A---------------
Q4K7U0_PSEF5/18-235---------AEGQ--------------ALK-V-AELLR----------EAI.....A...---.A---------------
C5FTG3_ARTOC/12-245---------KKQL--------------RKY-V-LQSQN----------AAI.....A...---.R---------------
C7LRB5_DESBD/8-228---------LQRA--------------AHH-I-GEKVR----------DVL.....A...---.R---------------
D2QID0_SPILD/7-229---------AKAA--------------ADF-I-VKRIK----------DTL.....K...---.K---------------
C1FA85_ACIC5/13-240---------SHAA--------------AQH-F-VDCAK----------AAV.....A...---.Q---------------
B4GTC9_DROPE/14-235---------IETL--------------SNL-L-RRCSE----------QAK.....D...---.R---------------
6PGL_CAEEL/21-242---------ILQL--------------RRY-L-EEKLT----------YLL.....D...---.Q---------------
6PGL_XYLFA/15-237---------AQSV--------------TRE-L-ENILL----------QEI.....T...---.Q---------------
F2G576_ALTMD/9-228---------TDAF--------------AQD-L-VSILK----------TGI.....K...---.T---------------
A9BG97_PETMO/7-228---------HNEA--------------VNL-I-YKLYE----------ESI.........---.E---------------
C7MCP6_BRAFD/326-560---------AAAA--------------AEG-A-AQQLA----------AAL.....A...---.E---------------
B2J9Q0_NOSP7/9-228---------VARA--------------LEL-I-LSKLD----------TAI.....E...---.Q---------------
D7B103_NOCDD/10-238---------ADSV--------------ALK-L-VNMIV----------QAE.....A...---.D---------------
B3RLE2_TRIAD/566-785---------IDNL--------------VND-I-LLSAT----------VAI.....R...---.N---------------
SOL4_YEAST/8-241---------IHEF--------------GKF-I-LEKQE----------SAL.....TGDA---DA---------------
C5B1S2_METEA/13-236---------AQAA--------------AAA-F-RDIIA----------SS..........---.P---------------
Q2Y8J3_NITMU/15-226---------QDAA--------------VAA-I-LDSAA----------SAI.....Q...---.E---------------
A0LTY4_ACIC1/9-232---------AAAV--------------AAR-L-ITRLI----------DML.....A...---.A---------------
Q6FQZ7_CANGA/8-232---------AHRL--------------GEV-V-VNAQD----------EAL.........---.K---------------
Q16H01_AEDAE/9-231---------CDEI--------------LGL-L-EMTAN----------ETL.....K...---.K---------------
Q11M12_CHESB/10-230---------AEAL--------------AEA-V-AQHLA----------AAL.....E...---.K---------------
A0QWX6_MYCS2/10-234---------VAAA--------------GDR-L-VDAIS----------SAI.....G...---.E---------------
B9L0S4_THERP/9-234---------VRQA--------------AEA-I-VRILR----------DAI.....E...---.E---------------
B5HF46_STRPR/11-241---------AQAA--------------AAR-L-ITKIV----------DAQ.....A...---.A---------------
Q01VT6_SOLUE/9-230---------AEAC--------------AHH-I-IGRLD----------EAI.....S...---.G---------------
A2EC78_TRIVA/488-712---------IHSV--------------TEQ-I-TRLIT----------EAI.....S...---.E---------------
A6L9R0_PARD8/7-228---------LRSM--------------TED-M-MAMIR----------RKD.........---..---------------
A8HQW1_CHLRE/5-232---------QAGL--------------VKL-V-EEAAA----------EAV.....K...---.A---------------
Q210H8_RHOPB/9-229---------AKTA--------------AQR-L-LARID----------AQ..........---.R---------------
Q7D149_AGRFC/9-230---------ATAL--------------AAE-V-AKRLD----------AAT.....K...---.E---------------
B0REI8_CLAMS/11-237---------TGSV--------------AAR-F-LTKLV----------DIL.....D...---.E---------------
Q6CXV1_KLULA/8-237---------ASSV--------------GEF-I-VAEQN----------KAL.....E...---.S---------------
Q4CQA8_TRYCC/11-251---------SGVA--------------CKK-I-VEIIH----------ASE.....R...---.T---------------
Q5LRS8_RUEPO/7-221---------AIDL--------------ANH-L-AGELE----------ATL.....F...---.T---------------
C8X5S3_DESRD/22-247---------APSV--------------AEF-L-IQRAF----------EAV.....E...---.D---------------
Q0C1F0_HYPNA/9-234---------SVLA--------------AEL-A-SLHLS----------RAI.....A...---.K---------------
Q1IMT5_KORVE/19-241---------CEAT--------------AEL-I-AKSAQ----------EAI.....A...---.A---------------
C5DTU9_ZYGRC/7-240---------VRRV--------------GKY-I-LEAQE----------EAL.....KDDP---KA---------------
B3PCY8_CELJU/8-232---------IAAL--------------QVE-C-EAALR----------NAI.....E...---.E---------------
A9TLR4_PHYPA/4-237---------SYVL--------------ADY-I-ARISE----------ESI.....K...---.A---------------
Q28QX5_JANSC/8-222---------MLDL--------------ADR-L-TGELA----------DCL.....R...---.R---------------
Q0ALB6_MARMM/15-240---------ADAL--------------AGS-I-ATTLA----------NAI.....R...---.E---------------
Q1QTX1_CHRSD/7-223---------AERL--------------ADT-V-AQALE----------ADL.....A...---.K---------------
A7TEX2_VANPO/8-238---------AGNL--------------GSY-V-LAAQE----------KAL.........---.S---------------
Q2H6B6_CHAGB/11-242---------APVL--------------RAY-I-IQSQA----------NGI.....A...---.R---------------
Q7QGR5_ANOGA/12-234---------CDEV--------------LGL-L-EKFAN----------ETL.....A...---.K---------------
A7RLB1_NEMVE/507-732---------ISKL--------------ARR-I-IKCAD----------DAV.....S...---.R---------------
B3MQE2_DROAN/14-235---------VQGL--------------GEL-V-KRLAK----------EAF.....T...---.R---------------
Q1H2F6_METFK/21-229---------YSSA--------------VKH-I-EEAAR----------NAI.....A...---.G---------------
A9F2S9_SORC5/11-231---------ARLG--------------AEL-I-ARAIA----------AAI.....D...---.A---------------
A4CNJ0_ROBBH/7-226---------AEAL--------------AEQ-L-SEWAR----------EGS.........---..---------------
Q758H7_ASHGO/101-325---------AQDL--------------GEY-I-VAQQD----------AAL.....A...---.A---------------
6PGL_RHILO/17-236---------AVAL--------------AGR-V-ADRLT----------RAI.....A...---.E---------------
A1A127_BIFAA/13-255---------AEAV--------------AAR-T-LLTII----------DLL.....AE..---PN---------------
A3N1V8_ACTP2/9-222---------AQQA--------------VEK-I-AQEFV----------LYS.....Q...---.L---------------
A6L429_BACV8/12-221---------SQTL--------------ITH-I-LEAMD----------KEL.....E...---..---------------
B2UK49_RALPJ/10-223---------AKAL--------------AEA-I-ASTLT----------HVI.....N...---.E---------------
B7J926_ACIF2/14-216---------ARRL--------------AAA-V-ARMAR----------EAI.....T...---.A---------------
B7VN92_VIBTL/13-227---------...V--------------VEN-L-ANEMK----------AYS.....E...---.Q---------------
C0ZZG4_RHOE4/11-231---------VDAA--------------AAR-L-VTTIV----------DAQ.....R...---.A---------------
D7GEP6_PROFC/12-230---------TTGA--------------GTL-L-VSALA----------EMQ.....R...---.R---------------
E7QFR9_YEASZ/10-234---------THQL--------------GEF-I-VKKQD----------EAL.....Q...---.K---------------
F7BV51_XENTR/350-572---------IEKL--------------ARD-I-QLAAE----------SAV.....Q...---.H---------------
H9JWK2_BOMMO/8-220---------IRKL--------------STY-I-QKISN----------DAI.....L...---.N---------------
J9ZCI7_LEPFM/20-235---------AREG--------------AAL-F-VARIR----------ERV.....L...---.A---------------
M1F8P0_9ALTE/19-237---------ARKL--------------AEQ-I-ALILR----------QRL.....E...---.A---------------
C6XF26_LIBAP/11-223---------AQKL--------------AKK-V-AEQLS----------IGI.....T...---.N---------------
6PGL_MYCTU/10-235---------VAAA--------------GKR-L-VGAIG----------AAV.....A...---.A---------------
Q385D6_TRYB2/12-245---------SAAG--------------CRK-I-VEIIE----------TSG.....S...---.Q---------------
Q3JBF3_NITOC/9-228---------YHSA--------------AEY-W-VRTAK----------RAI.....E...---.R---------------
Q46LF9_PROMT/11-224---------ALAA--------------SDL-I-TQIIE----------STL.....K...---.N---------------
Q59PZ6_CANAL/10-232---------ANSV--------------GKY-V-IEQQN----------KAI.....E...---.A---------------
Q5LE34_BACFN/13-219---------...A--------------RAL-I-LHLVK----------LML.....D...---.E---------------
Q5ZYF5_LEGPH/14-220---------IHDM--------------VEK-L-RTILS----------DAI.....K...---.R---------------
Q6LS72_PHOPR/10-227---------SDHV--------------VQS-L-AETML----------AFS.....Q...---.E---------------
Q7V812_PROMM/11-220---------ARRA--------------AQK-L-ASHID----------LVL.....D...---.Q---------------
Q83GH9_TROWT/52-269---------VEEV--------------ANR-F-LLTLE----------NVL.....Q...---.K---------------
Q887J1_PSESM/19-235---------ADAL--------------AGN-V-AARLK----------QAI.....S...---.E---------------
Q8EE99_SHEON/12-226---------EQQL--------------ANK-I-ASQLQ----------EAV.....D...---.A---------------
Q8G730_BIFLO/41-300---------IQAG--------------AQR-F-VLALL----------DLL.....A...---.E---------------
Q8NQ61_CORGL/9-224---------VAQA--------------ASK-F-IEVVE----------AAT.....A...---.N---------------
6PGL_DROME/15-227---------VQAL--------------GDL-L-QRCSQ----------EAL.....A...---.K---------------
6PGL_THEMA/14-216---------VDFV--------------VEK-I-RTKME----------KLL.....E...---.E---------------
R5U357_9BACE/14-221---------.RAL--------------ILR-L-VELMN----------EEP.........---..---------------
R6K673_9BACE/10-218---------ARAL--------------IKH-L-ISLME----------EEP.........---..---------------

PF02589

Q30YW4_DESAG/23-221---------ESLQ--------------GNN.F-EVFVA----------ADC-------------H---------------
Q72A59_DESVH/13-211---------ESLR--------------ANN.F-AVSLV----------DSC-------------E---------------
A0LET5_SYNFM/13-211---------ETLE--------------ANN.F-EVFLA----------DNK-------------E---------------
A8ZY31_DESOH/13-211---------AVFE--------------ANN.F-EVHVA----------QNA-------------D---------------
Q6AQM0_DESPS/13-211---------ENLA--------------RNN.F-DAYVA----------ASV-------------A---------------
A5N319_CLOK5/16-217---------KNLQ--------------SRK.F-EAYYC----------DNA-------------I---------------
A3DDG8_CLOTH/16-211---------KALN--------------QRN.F-EAYFC----------ETS-------------E---------------
Q18C30_PEPD6/15-209---------TALK--------------KRY.F-DAYYC----------KTR-------------N---------------
A6LXE8_CLOB8/15-209---------EALK--------------KRH.F-DAFYC----------KTK-------------D---------------
B8D0K4_HALOH/12-205---------ERFA--------------KRG.I-EGYYC----------PTG-------------E---------------
A4XID0_CALS8/13-207---------KNLE--------------LRN.F-ECFIV----------DKK-------------E---------------
A5I080_CLOBH/11-201---------EELK--------------KRN.M-EGFYC----------KTK-------------D---------------
A7HK56_FERNB/14-207---------PVLE--------------RKG.F-EVYVV----------NST-------------D---------------
A6LMB1_THEM4/14-207---------DELN--------------KKR.H-EVYIA----------RNK-------------D---------------
A8F3V4_PSELT/14-204---------PILE--------------KKA.F-EVYIA----------DNT-------------S---------------
A5MYV3_CLOK5/13-207---------EALK--------------KNN.M-NGFYV----------KDR-------------Q---------------
Q97IL7_CLOAB/13-207---------KNLE--------------KNN.I-EAYNV----------KNS-------------K---------------
Q188D0_PEPD6/13-206---------KSLE--------------NNN.M-KGYLV----------SNK-------------E---------------
Q892L7_CLOTE/13-207---------KALE--------------KNN.M-EGYYV----------KDE-------------N---------------
A8MGY9_ALKOO/13-207---------ESLA--------------KNN.M-DAYYV----------ETE-------------K---------------
A5N989_CLOK5/13-207---------NNLR--------------KRN.M-AGFFV----------KDD-------------V---------------
A5I1I2_CLOBH/13-207---------KNLN--------------SRN.M-GGYYI----------NNI-------------N---------------
Q897Y1_CLOTE/13-206---------ENLE--------------KHN.I-EAFYV----------KDE-------------D---------------
B8CXT8_HALOH/13-207---------DNIR--------------NNN.M-KGFYV----------KTR-------------E---------------
B8I8V5_CLOCE/13-218---------ENLA--------------SNN.M-MPYYV----------ENV-------------K---------------
Q7MR09_WOLSU/5-199---------DNLN--------------RNH.M-AGYYT----------QSI-------------Q---------------
Q251U6_DESHY/5-199---------AGLQ--------------RNN.M-AGYFV----------HNR-------------Q---------------
Q97M44_CLOAB/13-207---------ETLN--------------KRH.F-KASYV----------ETL-------------E---------------
B5EEH8_GEOBB/16-211---------ENLK--------------KNG.F-EALYC----------HDS-------------Q---------------
A5G901_GEOUR/16-211---------ESLG--------------KNG.F-TAVYC----------PTG-------------Q---------------
A5CYU3_PELTS/16-210---------EALN--------------RNE.F-TAIYC----------STR-------------Q---------------
A0PZA2_CLONN/13-207---------KALK--------------ENY.F-DAIYF----------EKR-------------E---------------
Q6M046_METMP/13-207---------ENLK--------------KNL.F-DAYYF----------EDG-------------S---------------
A4J2Z4_DESRM/12-207---------QALK--------------KNQ.F-NAVYF----------PNK-------------E---------------
A6TQ94_ALKMQ/5-197---------GNLK--------------KRN.I-DAQYF----------VTK-------------E---------------
A8MHS3_ALKOO/5-197---------KNLG--------------KRN.I-SAKFF----------KTK-------------E---------------
A7I305_CAMHC/3-194---------RNLK--------------NNG.F-EVVCA----------ANA-------------D---------------
A8EV54_ARCB4/1-193---------AVLK--------------SCG.Y-DAYFV----------KDK-------------A---------------
A6LYD8_CLOB8/3-195---------NSLE--------------CLG.Y-NVSEF----------SHA-------------D---------------
B9LU40_HALLT/27-212---------ANLE--------------ERG.F-DVIVV----------DDT-------------D---------------
Q5V6G7_HALMA/27-212---------ENLE--------------ANG.F-EVIVV----------NSA-------------D---------------
A3CXV8_METMJ/32-217---------EAME--------------ARN.F-KVFLV----------DTA-------------E---------------
Q8T2H5_DICDI/31-220---------KSLE--------------SKN.H-KVLLV----------DNE-------------E---------------
Q8T2H6_DICDI/31-218---------KSLE--------------SKN.H-IVHVV----------EDE-------------A---------------
Q9BI24_DICDI/30-213---------KNLE--------------AKN.H-RVSVV----------ENE-------------A---------------
A8LFX8_FRASN/21-203---------AALR--------------ENG.Y-LVHVV----------DTA-------------A---------------
Q6ABE0_PROAC/50-223---------EKVI--------------DYK.A-TVVRV----------KG.-------------A---------------
A1ATQ9_PELPD/34-209---------TKAE--------------AVG.A-EVHRF----------KTK-------------A---------------
B5EIV8_GEOBB/2-175---------TKAS--------------AVG.A-EVHRV----------GGK-------------I---------------
A4J2C5_DESRM/13-186---------GKAE--------------ALS.A-EVYRV----------PNM-------------E---------------
A5D032_PELTS/17-190---------ERAQ--------------LLA.A-AVYRY----------AGI-------------K---------------
Q30WA8_DESAG/6-203---------EKAE--------------LVA.A-TVAEV----------KSI-------------E---------------
Q6APH5_DESPS/6-194---------DRAE--------------AVH.A-SVARV----------SSM-------------E---------------
A0LF89_SYNFM/7-180---------ERAA--------------AVQ.S-VALEI----------GSF-------------D---------------
Q1ARS5_RUBXD/44-220---------EELE--------------ALG.G-RGRRA----------EGW-------------E---------------
LUTC_BACP2/52-237---------MQCQ--------------RIH.T-RVVET----------TP.-------------E---------------
Q836K1_ENTFA/52-236---------ERVE--------------TIH.T-NLVET----------TQ.-------------E---------------
LUTC_OCEIH/49-232---------KHCE--------------VIH.T-DFVRT----------SK.-------------Q---------------
Q1WT28_LACS1/55-240---------ENSE--------------SVN.A-KVIIK----------KK.-------------D---------------
Q6LPN1_PHOPR/50-245---------NYTR--------------TALGS-QAIET----------TK.-------------A---------------
Q24VR0_DESHY/42-220---------KMYE--------------AMG.G-KAVQA----------STA-------------K---------------
Q2SMI8_HAHCH/39-216---------ENLH--------------AAH.A-EVITA----------TE.-------------E---------------
Q47V41_COLP3/52-226---------SELE--------------KNH.A-QVIKT----------TK.-------------E---------------
Q3IEG6_PSEHT/41-215---------TQLK--------------SNH.A-QVISI----------AR.-------------S---------------
Q7NTM5_CHRVO/41-217---------AMMR--------------AVK.T-EILWT----------RE.-------------A---------------
Q4KII4_PSEF5/42-220---------KQME--------------AVH.T-EIHLS----------TG.-------------A---------------
Q2VZP0_MAGSA/37-213---------AMLE--------------ASH.A-DVHEV----------TA.-------------A---------------
Q5F884_NEIG1/42-219---------AAMR--------------AVK.T-EIYWV----------TK.-------------S---------------
Q310K5_DESAG/40-217---------RLLE--------------TMK.A-EVVSV----------KK.-------------K---------------
Q6AIU4_DESPS/43-219---------EYMS--------------AVQ.T-EVFRV----------GG.-------------D---------------
Q72B57_DESVH/44-220---------KRME--------------TVR.A-EVHVM----------PE.-------------A---------------
Q0PC62_CAMJE/47-218---------QKMS--------------DNK.Y-IVENA----------TK.-------------D---------------
A0RPC6_CAMFF/42-213---------QRIV--------------ANK.A-LLVES----------SP.-------------E---------------
Q7VIF4_HELHP/38-218---------SLQN--------------ANK.A-IVVES----------SP.-------------N---------------
A7IG69_XANP2/53-223---------DMVV--------------AAA.A-SIDHL----------PSA-------------E---------------
Q11LF2_CHESB/52-222---------QMAA--------------KVS.A-SVERV----------KKP-------------G---------------
A1SVG8_PSYIN/32-224---------EILK--------------ESEFA-RPKLL----------SE.-------------D---------------
A8MDI5_CALMQ/50-279---------KSIQ--------------AIG.A-KAYFA----------RDG-------------D---------------
A2BLD6_HYPBU/71-302---------KSLE--------------RVH.A-RAYLV----------HTA-------------E---------------
Q9YFI8_AERPE/68-298---------ESLR--------------RVG.A-NPYYA----------ETA-------------E---------------
A7HA97_ANADF/64-283---------RNAT--------------AAG.A-RVHWA----------RDA-------------E---------------
Q7MVA5_PORGI/38-257---------ENAR--------------RNG.V-IVHWA----------KDA-------------K---------------
Q47F70_DECAR/78-303---------AKLT--------------ANG.I-QVHWA----------ETP-------------D---------------
Q6ABE1_PROAC/94-322---------KNLT--------------ANG.V-HVHWA----------RDG-------------E---------------
Q47IA5_DECAR/76-304---------ERAK--------------ATG.A-EVLWA----------RDG-------------E---------------
A1B665_PARDP/69-294---------RNAA--------------ARG.A-QVHWA----------ADD-------------A---------------
A5G2K5_ACICJ/68-296---------EQVE--------------AHG.G-QVHWC----------RTA-------------E---------------
A0LED1_SYNFM/69-293---------DKIL--------------NRG.G-RVFFA----------RDA-------------R---------------
A5V1N8_ROSS1/68-292---------ENVE--------------RYG.G-HVCWA----------EDG-------------A---------------
Q67TB4_SYMTH/77-301---------DQIR--------------KSG.G-VVHWA----------RDA-------------A---------------
Q1ARS4_RUBXD/86-314---------DAVE--------------ARG.G-RVFFA----------RTG-------------E---------------
Q01UG1_SOLUE/67-291---------RNVE--------------ARG.G-KVIYC----------KDA-------------T---------------
Q1IN28_KORVE/68-293---------RKIV--------------ARG.G-HVYWA----------ETA-------------D---------------
LUTB_BACLD/70-295---------ENVA--------------KKG.G-HVFFA----------QTA-------------E---------------
LUTB_OCEIH/70-294---------EQVE--------------KRG.G-NVFFA----------QTA-------------E---------------
Q6D5W9_PECAS/70-294---------EKVT--------------ANG.G-QVYFA----------KTK-------------E---------------
Q81ND6_BACAN/69-293---------TNVR--------------KNG.G-HVHFA----------FKA-------------E---------------
Q24VR1_DESHY/69-293---------ENVE--------------KNG.G-HVHLA----------KTP-------------E---------------
A5VIG9_LACRD/70-294---------DNVQ--------------KNG.G-HVFFA----------KDG-------------D---------------
B9LU44_HALLT/67-296---------EAIE--------------DNG.G-TVYIA----------DDA-------------A---------------
Q3ISD5_NATPD/64-299---------AAVE--------------ANG.G-EVYVA----------DDA-------------A---------------
A5GDG8_GEOUR/64-287---------RNAE--------------ALG.A-KVFQT----------NDP-------------E---------------
A5D031_PELTS/65-292---------EKLR--------------EKG.A-KVFFA----------SSG-------------H---------------
Q3AEY7_CARHZ/62-279---------INAE--------------KNG.A-RVIIV----------HSA-------------A---------------
Q24W82_DESHY/65-292---------KAVT--------------ARG.A-KVFHA----------ATG-------------D---------------
Q8RIN1_FUSNN/65-294---------TNCE--------------ARG.G-HVYHA----------KST-------------E---------------
Q726S3_DESVH/69-294---------AEAE--------------KRG.V-KVHLA----------RTA-------------A---------------
Q74CQ3_GEOSL/61-280---------ASAE--------------RSG.A-TVHLC----------ATP-------------E---------------
A4J1M6_DESRM/66-295---------LSLE--------------RKG.C-HVYVA----------ETT-------------E---------------
A5UNQ3_METS3/51-284---------ESFR--------------RNG.I-DVEYA----------KTK-------------D---------------
O26243_METTH/51-280---------ERFT--------------ENG.V-EFHLA----------ADA-------------D---------------
A4J1M5_DESRM/47-258---------TMLK--------------VKG.C-QVFLA----------KDP-------------S---------------
A5HZY1_CLOBH/14-207---------ESLQ--------------ENN.M-NGYLV----------KDK-------------D---------------
A5VIG8_LACRD/58-241---------KNSE--------------EVH.V-DFHVV----------KS.-------------A---------------
A9WGW7_CHLAA/44-229---------IELT--------------RLE.G-KAYRV----------ATA-------------E---------------
C6XV06_PEDHD/69-292---------ANFQ--------------RRG.G-KVIWA----------NDT-------------Q---------------
M9X3V9_MANHA/50-227---------DFAR--------------VMM.A-DVVEA----------KE.-------------A---------------
O24950_HELPY/71-295---------KNAT--------------QNG.F-KIHYA----------KDG-------------D---------------
Q0PC61_CAMJE/70-292---------KNAT--------------KNG.I-KVHWA----------SSD-------------E---------------
Q24WP5_DESHY/68-297---------EAVE--------------RNK.G-KAFYA----------KDK-------------Q---------------
Q5SIK3_THET8/69-291---------RRLR--------------ENG.V-QVHWA----------ETP-------------E---------------
Q63NH7_BURPS/72-300---------AAVT--------------RAG.G-VVHWA----------NDA-------------A---------------
Q63SM7_BURPS/67-292---------REAA--------------RRG.T-TVLYA----------QTT-------------Q---------------
Q6LSA7_PHOPR/40-218---------DGLS--------------ASH.A-EIIST----------DR.-------------G---------------
LUTB_BACCR/71-293---------ENVS--------------KRG.G-HVYFA----------KTK-------------E---------------
Q81ND7_BACAN/48-228---------ANLH--------------TLH.T-EVSHI----------HR.-------------S---------------
LUTC_BACAN/51-236---------NQCT--------------NIH.T-TVVET----------TN.-------------D---------------
Q8XH83_CLOPE/14-207---------KALE--------------ENN.M-NGYLV----------NSK-------------E---------------
Q9WXZ9_THEMA/17-208---------NNLR--------------KKK.H-EVWIA----------RDR-------------E---------------
R5KLF2_9CLOT/15-206---------NKLA--------------TRN.M-EGFYV----------QTK-------------E---------------
R5QY75_9FIRM/13-205---------KALE--------------SRN.M-EAYYA----------STK-------------E---------------
R5UE40_9FIRM/14-205---------NALK--------------SRN.M-DAYYV----------ETK-------------E---------------
R6MWQ8_9CLOT/13-227---------ESLQ--------------KNN.M-QAYNA----------ATK-------------E---------------
R7FYW0_9FIRM/15-206---------KELT--------------ARN.M-EAYYT----------DSK-------------E---------------
U5L6H3_9BACI/52-235---------KQCE--------------IIH.T-EVHRT----------VT.-------------A---------------

PF01812

MTHFS_HUMAN/10-198---------ELKQ-------------.RLRAM-SAEER----------LRQ-------------S---------------
5FCLL_ARATH/92-290---------K...-------------.MWDLM-EARNY----------AMS-------------P---------------
MTHFS_CAEEL/8-197---------FMKT-------------.LLGKI-SKEET----------QRQ-------------T---------------
YQGN_BACSU/2-179---------KTLE-------------.ALSAL-SNEDI----------LQK-------------T---------------
O83692_TREPA/4-207---------IASA-------------.RLRAF-R.ASP----------TAP-------------A---------------
Q9RKA5_STRCO/12-197---------DLLA-------------.ARNRM-TPDDV----------RES-------------A---------------
5FCL_HAEIN/6-187---------EIRK-------------.IRANL-TALQQ----------HQA-------------E---------------
MTHFS_RABIT/10-198---------ELKQ-------------.RLRAI-SAEER----------LRC-------------Q---------------
O26306_METTH/134-322---------VEYH-------------.IWDLL-VEKGV----------SKR-------------P---------------
FTHC_YEAST/4-203---------QIKR-------------.VINAL-DYDII----------AAE-------------S---------------
Q9YFU3_AERPE/7-205---------R...-------------.VWRLL-EEKGV----------TLP-------------P---------------
P73038_SYNY3/3-179---------QLLQ-------------.ERRQL-SEAQW----------QQQ-------------S---------------
O67621_AQUAE/3-175---------KVLH-------------.KRINL-SEEER----------RRL-------------S---------------
Q9ZD82_RICPR/3-172---------YFKD-------------LLIKKQ-DKINS----------NLV-------------K---------------
O05575_MYCTU/6-186---------QLLA-------------.ARRRV-ADDVR----------AAE-------------A---------------
H2VFJ2_CHLTE/8-188---------RLLA-------------.RRRAM-TLERW----------LSD-------------S---------------
Q7AQM9_MYCLE/6-186---------QLLA-------------.ARRSV-ADDIR----------AAE-------------T---------------
Q8DVY5_STRMU/3-174---------QVIE-------------.DLKKQ-DKAKK----------VLR-------------D---------------

PF13336

A6LV90_CLOB8/275-428---------YDYV.....N.....G.NPSVAM.YPVDY----------VN.........N...PC---------------
B8F9H4_DESAA/272-425---------YKFV.....H.....N.NPMVMM.FPVDY----------TN.........S...PA---------------
Q7MWD3_PORGI/273-426---------YHFI.....D.....K.NPDVEL.YPVDY----------VN.........D...PR---------------
B8CZD4_HALOH/271-424---------YEFL.....D.....D.NPMVEM.HPVSY----------TN.........D...PW---------------
Q3ACH6_CARHZ/275-428---------YSFL.....N.....N.NPMVEM.HPVSY----------TN.........N...PC---------------
D2QBR0_SPILD/268-420---------YDFI.....D.....D.NPEVAM.KQASF----------TN.........D...TA---------------
D7BE02_MEISD/284-437---------YRFV.....H.....N.NPLFEM.RPADW----------VN.........N...PF---------------
Q898H0_CLOTE/272-425---------YDFV.....D.....N.NPMVRM.YPVDY----------VN.........N...PV---------------
A0L8K8_MAGMM/267-420---------YDYV.....D.....E.NPHFEF.LPSEY----------VN.........N...PA---------------
A5N390_CLOK5/276-429---------YDFI.....N.....D.NPMVEG.YPVDY----------VN.....