Sequence alignment for CL0246

PF13336

Q7P6F4_FUSNV/274-427----------------------------------------------GTRKL-----------------------------
A6LV90_CLOB8/275-428----------------------------------------------GTKRL-----------------------------
B8F9H4_DESAA/272-425----------------------------------------------GTERL-----------------------------
Q7MWD3_PORGI/273-426----------------------------------------------GSEDV-----------------------------
C8PQ47_9SPIO/40-192----------------------------------------------GTKRL-----------------------------
B8CZD4_HALOH/271-424----------------------------------------------GTNRL-----------------------------
C6Q2N6_9CLOT/272-425----------------------------------------------GTKKL-----------------------------
C0GK20_9FIRM/271-424----------------------------------------------GTKRL-----------------------------
C6JPC5_FUSVA/273-426----------------------------------------------GTRKL-----------------------------
C2MAG5_9PORP/269-422----------------------------------------------GTQEL-----------------------------
B9E5E2_CLOK1/272-425----------------------------------------------GTKKL-----------------------------
Q3ACH6_CARHZ/275-428----------------------------------------------GTKKL-----------------------------
D2QBR0_SPILD/268-420----------------------------------------------GSQRV-----------------------------
D7BE02_MEISD/284-437----------------------------------------------GSERL-----------------------------
D3LSY0_9FIRM/272-426----------------------------------------------GTKKL-----------------------------
B1CB66_9FIRM/271-424----------------------------------------------GTQKL-----------------------------
Q898H0_CLOTE/272-425----------------------------------------------GTKKL-----------------------------
A0L8K8_MAGSM/267-420----------------------------------------------GTKRI-----------------------------
Q2QB25_9FIRM/277-430----------------------------------------------GTRKL-----------------------------
A5N390_CLOK5/276-429----------------------------------------------GTKKL-----------------------------
Q0HH24_SHESM/288-441----------------------------------------------GSQKL-----------------------------
C2MDZ9_9PORP/277-430----------------------------------------------GTKEL-----------------------------
Q15V19_PSEA6/267-420----------------------------------------------GSKKL-----------------------------
Q39QG7_GEOMG/278-431----------------------------------------------GTKRL-----------------------------
B3QTM9_CHLT3/265-417----------------------------------------------GSRRL-----------------------------
B2RM12_PORG3/273-426----------------------------------------------GSKEL-----------------------------
A9AXP3_HERA2/264-416----------------------------------------------GTRRL-----------------------------
C7GYK3_9FIRM/272-430----------------------------------------------GTKRL-----------------------------
Q8CXQ9_LEPIN/270-422----------------------------------------------GTRKL-----------------------------
A5URR7_ROSS1/272-425----------------------------------------------GSQRC-----------------------------
Q24WU2_DESHY/311-467----------------------------------------------GTQKT-----------------------------
C3JA15_9PORP/269-422----------------------------------------------GSRDL-----------------------------
C7M4J2_CAPOD/265-417----------------------------------------------GTQEL-----------------------------
Q5QXA2_IDILO/264-417----------------------------------------------GSQAL-----------------------------
B9M8N9_GEOSF/274-427----------------------------------------------GTRRL-----------------------------
B9M9H7_GEOSF/264-417----------------------------------------------GSQKV-----------------------------
Q9RM86_CLOAM/272-430----------------------------------------------GTKRL-----------------------------
A7H923_ANADF/265-417----------------------------------------------GTRRL-----------------------------
A3WLS5_9GAMM/264-417----------------------------------------------GSQAL-----------------------------
C7RL22_ACCPU/274-427----------------------------------------------GSQKL-----------------------------
Q3ANX0_CHLCH/266-418----------------------------------------------GTKRL-----------------------------
B7RTW3_9GAMM/266-419----------------------------------------------GSDRL-----------------------------
B7R990_9THEO/272-425----------------------------------------------GTKKL-----------------------------
A0M1A3_GRAFK/267-419----------------------------------------------GSPKL-----------------------------
Q0IG02_AEDAE/314-468----------------------------------------------GTKKL-----------------------------
D1C4I7_SPHTD/264-417----------------------------------------------GTDRL-----------------------------
A7HKG2_FERNB/273-426----------------------------------------------GSKKM-----------------------------
C3J9R5_9PORP/273-426----------------------------------------------GSQEL-----------------------------
A6GWR2_FLAPJ/265-417----------------------------------------------GSQRL-----------------------------
A8F649_THELT/274-427----------------------------------------------GTKRM-----------------------------
B5ECU8_GEOBB/278-431----------------------------------------------GTKRL-----------------------------
A1KBF4_AZOSB/272-425----------------------------------------------GSRKL-----------------------------
Q2LSP1_SYNAS/286-439----------------------------------------------GKKET-----------------------------
A4ASU6_MARSH/266-418----------------------------------------------GSRRL-----------------------------
Q01VE3_SOLUE/270-423----------------------------------------------GSKVL-----------------------------
B5E7S1_GEOBB/278-431----------------------------------------------GTKRL-----------------------------
B2TLD8_CLOBB/272-425----------------------------------------------GSQRL-----------------------------
A0B6T6_METTP/284-437----------------------------------------------GTRKT-----------------------------
C0CQX9_9FIRM/274-427----------------------------------------------GDQNL-----------------------------
Q2BRL2_9GAMM/269-422----------------------------------------------GSQAL-----------------------------
A4J1E7_DESRM/279-435----------------------------------------------GSQRL-----------------------------
A3P7E3_BURP0/286-437----------------------------------------------GDRAM-----------------------------
A7FIQ3_YERP3/283-434----------------------------------------------GQQEM-----------------------------
B8FV23_DESHD/273-426----------------------------------------------GTKRV-----------------------------
A1ZWE1_9BACT/265-417----------------------------------------------GSQKL-----------------------------
C9XLC1_CLODC/271-427----------------------------------------------GTKKL-----------------------------
D6Z2N5_DESAT/282-435----------------------------------------------GTRKL-----------------------------
Q1IT47_KORVE/273-426----------------------------------------------GTRRM-----------------------------
C5EQI6_9FIRM/275-428----------------------------------------------GSEKF-----------------------------
B5Y607_COPPD/273-426----------------------------------------------GTQRL-----------------------------
D3FVG7_BACPE/268-421----------------------------------------------GTKRL-----------------------------
Q0AVM5_SYNWW/279-434----------------------------------------------GSQEL-----------------------------
Q2FRF0_METHJ/278-431----------------------------------------------GTRRM-----------------------------
D9TPZ5_THETC/317-464----------------------------------------------GLKRF-----------------------------
B2A2S6_NATTJ/273-426----------------------------------------------GSQKL-----------------------------
Q7Z0V8_ARTSF/277-430----------------------------------------------GSKKL-----------------------------
B9JLD2_AGRRK/284-435----------------------------------------------GDQAL-----------------------------
A3HTS6_9BACT/267-419----------------------------------------------GTREL-----------------------------
B8KH63_9GAMM/265-418----------------------------------------------GSDAL-----------------------------
A9GMK9_SORC5/277-430----------------------------------------------GSRAL-----------------------------
C7PPM1_CHIPD/268-420----------------------------------------------GTRKL-----------------------------
C0QJK6_DESAH/274-427----------------------------------------------GSRKL-----------------------------
B3P805_DROER/312-466----------------------------------------------GDKAL-----------------------------
D2VMT8_NAEGR/323-475----------------------------------------------GSRNI-----------------------------
B2HRD6_MYCMM/288-439----------------------------------------------GDRKT-----------------------------
A9BH20_PETMO/279-432----------------------------------------------GTKRM-----------------------------
B0P1X4_9CLOT/279-435----------------------------------------------GTKKL-----------------------------
C0W9X2_9FIRM/281-437----------------------------------------------GTKKL-----------------------------
B8FWN2_DESHD/279-435----------------------------------------------GTQKL-----------------------------
D1N3Y0_9BACT/300-452----------------------------------------------GTQKV-----------------------------
Q0AW71_SYNWW/272-425----------------------------------------------GSRRL-----------------------------
B1C6G2_9FIRM/280-436----------------------------------------------GTKKL-----------------------------
Q4A5M6_MYCS5/287-438----------------------------------------------GNKQM-----------------------------
A4J4L6_DESRM/279-435----------------------------------------------GTQRL-----------------------------
E6VZH2_DESAO/276-429----------------------------------------------GTRDT-----------------------------
C5ENP0_9FIRM/279-432----------------------------------------------GSQKL-----------------------------
Q220T6_RHOFD/272-425----------------------------------------------GSKKL-----------------------------
A4AMZ0_MARSH/269-421----------------------------------------------GSQDL-----------------------------
D4IP35_9BACT/266-418----------------------------------------------GSRRL-----------------------------
C6E210_GEOSM/283-439----------------------------------------------GTKRL-----------------------------
A1U877_MARAV/284-436----------------------------------------------GDRKL-----------------------------
D3LTM8_9FIRM/278-434----------------------------------------------GTKRL-----------------------------
D4J7D4_9FIRM/278-438----------------------------------------------GSQRL-----------------------------
D2VCN4_NAEGR/199-351----------------------------------------------GSKEM-----------------------------
C6X0M3_FLAB3/276-428----------------------------------------------GTRKL-----------------------------
C0QKC6_DESAH/273-426----------------------------------------------GSKQL-----------------------------
C8VZ55_DESAS/277-433----------------------------------------------GSKNL-----------------------------
C0QAD0_DESAH/281-437----------------------------------------------GSQRL-----------------------------
A0LMU1_SYNFM/292-445----------------------------------------------GSREL-----------------------------
A9NFJ4_ACHLI/270-431----------------------------------------------GTQEL-----------------------------
C0ESI0_9FIRM/299-455----------------------------------------------GTKKM-----------------------------
B8FDQ1_DESAA/279-432----------------------------------------------GSEKL-----------------------------
Q3A1S1_PELCD/278-433----------------------------------------------GTRKM-----------------------------
Q21W64_RHOFD/279-435----------------------------------------------GSQKL-----------------------------
B8F9D7_DESAA/274-430----------------------------------------------GSKAT-----------------------------
A4J5F7_DESRM/278-434----------------------------------------------GSQKL-----------------------------
D3TLS8_GLOMM/312-466----------------------------------------------GDQPL-----------------------------
A8MLT0_ALKOO/317-464----------------------------------------------GLKRL-----------------------------
D0Z2A1_LISDA/272-429----------------------------------------------GSQEL-----------------------------
A4J1H7_DESRM/278-434----------------------------------------------GSPRL-----------------------------
A6NQA1_9FIRM/281-437----------------------------------------------GTRRL-----------------------------
Q0AW62_SYNWW/282-438----------------------------------------------GNREL-----------------------------
B0MTL0_9BACT/270-422----------------------------------------------GSQRV-----------------------------
Q1VQ25_9FLAO/298-450----------------------------------------------GTKRI-----------------------------
A8ZXP1_DESOH/277-430----------------------------------------------GSAEL-----------------------------
Q0AZT0_SYNWW/278-433----------------------------------------------GSQRL-----------------------------
A2SP55_METPP/278-433----------------------------------------------GSRHL-----------------------------
D3LTH5_9FIRM/277-433----------------------------------------------GSAEL-----------------------------
D4KHS0_9FIRM/319-466----------------------------------------------GLKRF-----------------------------
Q2RRD2_RHORT/322-473----------------------------------------------GNKEM-----------------------------
C7H5K4_9FIRM/279-436----------------------------------------------GTQKM-----------------------------
A0LHR8_SYNFM/278-431----------------------------------------------GSADL-----------------------------
Q18599_CAEEL/306-460----------------------------------------------GSTKL-----------------------------
A7SYK6_NEMVE/323-477----------------------------------------------GTKKV-----------------------------
Q0AXU7_SYNWW/280-436----------------------------------------------GSEKL-----------------------------
C4Z8H6_EUBR3/279-435----------------------------------------------GTKKM-----------------------------
D3LT91_9FIRM/318-465----------------------------------------------GLQRF-----------------------------
Q1Z538_PHOPR/273-428----------------------------------------------GSQEL-----------------------------
B1C6E5_9FIRM/281-437----------------------------------------------GTQKL-----------------------------
D1B8D5_THEAS/325-472----------------------------------------------GARRM-----------------------------
C6EUD4_FASHE/313-467----------------------------------------------GTRKV-----------------------------
Q0B052_SYNWW/278-434----------------------------------------------GTNKL-----------------------------
B7QJI4_IXOSC/314-468----------------------------------------------GTQRL-----------------------------
Q6AQI5_DESPS/285-438----------------------------------------------GTKKL-----------------------------
D3FFX7_MYCGH/280-431----------------------------------------------GDQDM-----------------------------
C3W9K1_FUSMR/279-435----------------------------------------------GGKEM-----------------------------
A8SVH6_9FIRM/278-433----------------------------------------------GSNEL-----------------------------
B0TCP9_HELMI/277-433----------------------------------------------GTKRL-----------------------------
A4J446_DESRM/283-434----------------------------------------------GTKRL-----------------------------
B3QBE4_RHOPT/324-471----------------------------------------------GYDEF-----------------------------
D1RF94_LEGLO/281-431----------------------------------------------GDKHL-----------------------------
D2XBL0_9BACT/272-425----------------------------------------------GTTEL-----------------------------
C0QDJ7_DESAH/279-431----------------------------------------------GSTTF-----------------------------
A6F750_9GAMM/274-429----------------------------------------------GSQEL-----------------------------
B4W710_9CAUL/282-433----------------------------------------------GDQNT-----------------------------
A1HP35_9FIRM/320-467----------------------------------------------GLKRF-----------------------------
A0R5U0_MYCS2/274-430----------------------------------------------GSPDL-----------------------------
B0N003_9BACT/267-419----------------------------------------------GSKRL-----------------------------
A8U4X9_9LACT/266-423----------------------------------------------GTRKL-----------------------------
C2BE93_9FIRM/280-436----------------------------------------------GSQEL-----------------------------
Q2LPI7_SYNAS/276-429----------------------------------------------GPKEM-----------------------------
D1YS72_9FIRM/320-467----------------------------------------------GLKRF-----------------------------
A8U750_9LACT/270-423----------------------------------------------GSKQL-----------------------------
D4CC53_9CLOT/291-448----------------------------------------------GSQEL-----------------------------
A8WP03_CAEBR/305-459----------------------------------------------GTKEF-----------------------------
D1Y3R2_9BACT/278-433----------------------------------------------GTQRL-----------------------------
B2W452_PYRTR/302-453----------------------------------------------GFQRF-----------------------------
Q0RWG8_RHOSR/538-685----------------------------------------------GIEEL-----------------------------
B0RN66_XANCB/323-470----------------------------------------------GNEEF-----------------------------
B6WBS6_9FIRM/278-434----------------------------------------------GSKEL-----------------------------
A1TGQ6_MYCVP/271-426----------------------------------------------GSTEL-----------------------------
A5E2Y9_LODEL/243-394----------------------------------------------GFKKF-----------------------------
A7HPG3_PARL1/328-491----------------------------------------------GSRAF-----------------------------
D2RM64_ACIFV/277-437----------------------------------------------GSQEL-----------------------------
B0SDE8_LEPBA/320-467----------------------------------------------GLKRF-----------------------------
Q0AY76_SYNWW/278-434----------------------------------------------GTQIL-----------------------------
O29120_ARCFU/297-457----------------------------------------------GSLKL-----------------------------
Q2SL76_HAHCH/439-606----------------------------------------------GPQRF-----------------------------
Q39MJ3_BURS3/277-426----------------------------------------------GSERV-----------------------------
ACH1_YARLI/333-484----------------------------------------------GFKRF-----------------------------
O28424_ARCFU/289-449----------------------------------------------GTRKL-----------------------------
A7HD82_ANADF/326-473----------------------------------------------GQERF-----------------------------
D1VTU7_9FIRM/278-435----------------------------------------------GSKKL-----------------------------
C8PKJ5_9PROT/322-468----------------------------------------------GVEEF-----------------------------
C5DU17_ZYGRC/331-482----------------------------------------------GFDRL-----------------------------
D4JBB9_9FIRM/276-431----------------------------------------------GDKAM-----------------------------
B5EIE5_GEOBB/327-478----------------------------------------------GFQRL-----------------------------
C9LNB4_9FIRM/338-485----------------------------------------------GLKRF-----------------------------
B0DKN0_LACBS/350-501----------------------------------------------GFDHF-----------------------------
B6K306_SCHJY/330-481----------------------------------------------GFEHF-----------------------------
ACH1_SCHPO/330-481----------------------------------------------GFEKF-----------------------------
C9QLV8_VIBOR/273-428----------------------------------------------GSQEV-----------------------------
A0LG92_SYNFM/280-432----------------------------------------------GTKDL-----------------------------
Q74GS1_GEOSL/327-478----------------------------------------------GFKRF-----------------------------
A5V7D2_SPHWW/272-423----------------------------------------------GDQCF-----------------------------
B3QA43_RHOPT/260-409----------------------------------------------GTGRL-----------------------------
Q0AV35_SYNWW/283-439----------------------------------------------GDQAL-----------------------------
D2V812_NAEGR/332-483----------------------------------------------GFKKF-----------------------------
C6RKT5_ACIRA/265-414----------------------------------------------GSSKL-----------------------------
D2RN63_ACIFV/277-434----------------------------------------------GSQEL-----------------------------
B6BXE3_9GAMM/420-583----------------------------------------------GPQRF-----------------------------
B9M8L3_GEOSF/333-484----------------------------------------------GIKRL-----------------------------
Q6LQ13_PHOPR/472-639----------------------------------------------GPKDF-----------------------------
A8ZWK6_DESOH/447-610----------------------------------------------GANRF-----------------------------
A1W2A3_ACISJ/277-426----------------------------------------------GGEKL-----------------------------
E8WNL5_GEOS8/334-485----------------------------------------------GLERL-----------------------------
A6F2B7_9ALTE/443-610----------------------------------------------GPEAF-----------------------------
C6E1J1_GEOSM/332-483----------------------------------------------GFPRF-----------------------------
B1KCQ5_BURCC/265-415----------------------------------------------GGRRI-----------------------------
B6JG54_OLICO/334-497----------------------------------------------GPKSF-----------------------------
Q48PY5_PSE14/293-456----------------------------------------------GPSSF-----------------------------
B7X026_COMTE/264-413----------------------------------------------GGAGL-----------------------------
Q0VNK9_ALCBS/436-599----------------------------------------------GPRDF-----------------------------
A6GMY9_9BURK/440-605----------------------------------------------GPSAM-----------------------------
D3BTR1_POLPA/348-499----------------------------------------------GFNRL-----------------------------
B8FMI7_DESAA/441-604----------------------------------------------GPNGF-----------------------------
B7RUX5_9GAMM/428-591----------------------------------------------GPRDF-----------------------------
C0WBA5_9FIRM/277-434----------------------------------------------GSAEL-----------------------------
A3X024_9BRAD/334-497----------------------------------------------GSQSF-----------------------------
D2I933_9PSED/265-414----------------------------------------------GSQAL-----------------------------
ACH1_DICDI/341-492----------------------------------------------GFNRL-----------------------------
Q7WPS8_BORBR/266-415----------------------------------------------GGARL-----------------------------
Q0BZS7_HYPNA/258-410----------------------------------------------GTPAL-----------------------------
B5JUR7_9GAMM/382-545----------------------------------------------GPRDF-----------------------------
Q1DA17_MYXXD/323-474----------------------------------------------GRQRF-----------------------------
A4BC21_9GAMM/441-604----------------------------------------------GNAHF-----------------------------
A1SHN0_NOCSJ/246-396----------------------------------------------GSPEL-----------------------------
C0QKG0_DESAH/440-603----------------------------------------------GPQAF-----------------------------
B4W858_9CAUL/256-409----------------------------------------------GPTRL-----------------------------
D4HE27_PROAS/229-379----------------------------------------------GTPAL-----------------------------
Q88CB5_PSEPK/319-482----------------------------------------------GPQAF-----------------------------
A8ZT97_DESOH/278-429----------------------------------------------GTENL-----------------------------
A6FHC1_9GAMM/461-628----------------------------------------------GPKAF-----------------------------
D0LM00_HALO1/437-597----------------------------------------------GSRRF-----------------------------
Q0RK43_FRAAA/215-365----------------------------------------------GSAEL-----------------------------
D1A9C8_THECD/271-421----------------------------------------------GSPEL-----------------------------
Q2JCQ5_FRASC/281-431----------------------------------------------GSAEL-----------------------------
Q0C1R5_HYPNA/318-481----------------------------------------------GPQNF-----------------------------
C1BAX8_RHOOB/254-402----------------------------------------------GTAAL-----------------------------
C7LYG5_ACIFD/255-405----------------------------------------------GSAEL-----------------------------
B5WIH5_9BURK/265-416----------------------------------------------GTQAF-----------------------------
Q8PH95_XANAC/342-506----------------------------------------------GSPAF-----------------------------
D2UEK6_XANAP/366-529----------------------------------------------GSTAF-----------------------------
Q1YGK6_MOBAS/339-501----------------------------------------------GPQSF-----------------------------
Q0FWB7_9RHOB/199-349----------------------------------------------GSAEL-----------------------------
C1B5D3_RHOOB/255-406----------------------------------------------GSRRL-----------------------------
B8FN92_DESAA/282-434----------------------------------------------GSQEL-----------------------------
A3TKM8_9MICO/259-409----------------------------------------------GGPRL-----------------------------
B8L3Z6_9GAMM/367-531----------------------------------------------GSPEF-----------------------------
C0QDF6_DESAH/275-427----------------------------------------------GTPDL-----------------------------
C0QHQ8_DESAH/271-423----------------------------------------------GSKAL-----------------------------

PF04223

Q99ZK7_STRP1/45-510DSKLLGSVREAIEKTGLTDGMTISFHHHFREGDFIMNMVLEEIAKMGIKNLSIAPSSIANVH.EPLIDHIKNGVVTNITS
Q9CGA7_LACLA/46-510.NKLVDSLEEVVLKT.VKDGMTISFHHHFREGDYVFNKVMRIIIDHGFKDLRIAPSSLTNVMNDILVEAIEKGVVTNITS
CILA_HAEIN/33-498DRKLCTSLEEAIKRSGLKDGMTVSFHHAFRGGDFVVNMVMNKIAEMGFKNLTLASSSLIDSH.FPIVEHIKNGVVTKIYS
CILA_ECOLI/43-508DRKLCANLEEAIRRSGLQDGMTVSFHHAFRGGDLTVNMVMDVIAKMGFKNLTLASSSLSDCH.APLVEHIRQGVVTRIYT
Q9KTT9_VIBCH/66-531SRKVKSSIREAIVDLGLKDGMTISFHHAFRGGDKTVNLVMEVIAELGIKNLTLASSSLTSCH.SPLIEHIKNGVVSKIYT

PF01144

SCOA_XANCP/13-225------------------------------------------------YAD-----------------------------
GCTB_ACIFV/10-224------------------------------------------------KEM-----------------------------
PCAJ_PSEPU/9-206------------------------------------------------RTE-----------------------------
GCTA_ACIFV/4-241------------------------------------------------VMT-----------------------------
Q9Y916_AERPE/14-262------------------------------------------------TVT-----------------------------
SCOT_CAEEL/300-499------------------------------------------------REI-----------------------------
SCOB_HELPY/2-198------------------------------------------------REA-----------------------------
YODS_BACSU/7-219------------------------------------------------AIS-----------------------------
Q9RZA0_DEIRA/23-234------------------------------------------------VLT-----------------------------
ATOA_HAEIN/4-200------------------------------------------------KEL-----------------------------
CTFA_CLOAB/5-216------------------------------------------------IIR-----------------------------
PCAI_PSEPU/6-219------------------------------------------------YES-----------------------------
CTFB_CLOAB/9-205------------------------------------------------KEI-----------------------------
PCAI_ACIAD/6-219------------------------------------------------AAT-----------------------------
Q9ZAM2_SPHSX/6-218------------------------------------------------YSN-----------------------------
SCOT1_HUMAN/43-272------------------------------------------------YTD-----------------------------
SCOA_MYCTU/5-234------------------------------------------------VAT-----------------------------
Q973S5_SULTO/3-202------------------------------------------------IEH-----------------------------
Q9RZ86_DEIRA/5-217------------------------------------------------YPS-----------------------------
SCOA_BACSU/5-216------------------------------------------------LSS-----------------------------
PCAJ_ACIAD/8-206------------------------------------------------RDQ-----------------------------
SCOT1_HUMAN/302-501------------------------------------------------RER-----------------------------
YDIF_ECOLI/15-253------------------------------------------------VLS-----------------------------
SCOT_CAEEL/40-271------------------------------------------------FNS-----------------------------
Q9KHD5_STRGR/16-242------------------------------------------------ATG-----------------------------
SCOB_BACSU/5-202------------------------------------------------RKR-----------------------------
Q9XAM7_STRCO/5-234------------------------------------------------VAT-----------------------------
Y1199_ARCFU/148-369------------------------------------------------TMS-----------------------------
Q8PDH3_XANCP/7-217------------------------------------------------NEM-----------------------------
Q8RGS9_FUSNN/11-226------------------------------------------------KEM-----------------------------
SCOA_HELPY/5-216------------------------------------------------ITD-----------------------------
ATOD_HAEIN/5-216------------------------------------------------HLK-----------------------------
Q8F685_LEPIN/8-247------------------------------------------------FQN-----------------------------
Y3551_MYCTU/5-233------------------------------------------------RTA-----------------------------
Q9W058_DROME/37-266------------------------------------------------YES-----------------------------
Q97Z51_SULSO/6-206------------------------------------------------VDY-----------------------------
SCOB_MYCTU/8-205------------------------------------------------RDE-----------------------------
ATOA_ECOLI/4-198------------------------------------------------KQR-----------------------------
ATOD_ECOLI/5-216------------------------------------------------LMT-----------------------------
CATJ_PSESB/7-217------------------------------------------------NEM-----------------------------
Q9RPK0_CLOBE/4-215------------------------------------------------LVK-----------------------------
Q98EM4_RHILO/9-219------------------------------------------------NEM-----------------------------
Q92TL1_RHIME/7-217------------------------------------------------TEM-----------------------------

PF00455

Q98FV5_RHILO/85-241-----------------------------DLAV-------------EAKRQ-----------------------------
A9CFA5_AGRT5/77-236-----------------------------SVNI-------------DKKRA-----------------------------
D2AF69_SHIF2/74-232-----------------------------AQNH-------------DEKVR-----------------------------
A3GRG9_VIBCL/64-222-----------------------------TEHY-------------EEKSL-----------------------------
C1HRF0_9ESCH/77-237-----------------------------TLQS-------------VAKRE-----------------------------
B2TV88_SHIB3/73-234-----------------------------SRLV-------------EEKRR-----------------------------
Q74VM8_YERPE/40-201-----------------------------AKQV-------------EEKRR-----------------------------
A9CH78_AGRT5/77-238-----------------------------DSHA-------------TAKAR-----------------------------
Q98JJ0_RHILO/75-236-----------------------------DSHA-------------AAKRE-----------------------------
Q8EUZ1_MYCPE/76-234-----------------------------LENI-------------NQKKE-----------------------------
C8JX63_LISMN/77-238-----------------------------RSNE-------------TSKIR-----------------------------
Q98AQ9_RHILO/73-233-----------------------------VSER-------------AEKST-----------------------------
Q981R3_RHILO/73-234-----------------------------ISEL-------------AEKNV-----------------------------
A5LBQ8_STRPN/73-236-----------------------------GEST-------------RQKRL-----------------------------
F0K641_CLOAE/74-233-----------------------------NINA-------------EGKME-----------------------------
F0K625_CLOAE/77-236-----------------------------KINI-------------EQKKD-----------------------------
F0K630_CLOAE/77-236-----------------------------KINI-------------EQKRH-----------------------------
B2IPU4_STRPS/76-235-----------------------------ALQT-------------AEKQE-----------------------------
A7X580_STAA1/74-235-----------------------------TRQI-------------AEKRY-----------------------------
Q8Y5F7_LISMO/73-231-----------------------------VKQS-------------EQKQK-----------------------------
D4G3X3_BACNA/71-232-----------------------------IQHQ-------------DEKTK-----------------------------
Q8Y9Y5_LISMO/73-234-----------------------------TENH-------------LEKQL-----------------------------
A1EKM8_VIBCL/74-235-----------------------------LINL-------------TAKQR-----------------------------
E7HVG7_ECOLX/61-222-----------------------------VSQT-------------EEKKA-----------------------------
A1KUY5_NEIMF/73-235-----------------------------TRCQ-------------NEKNA-----------------------------
F0AXV7_NEIME/73-235-----------------------------IQCQ-------------NEKNA-----------------------------
Q89SG7_BRAJA/73-234-----------------------------FVAA-------------EEKKA-----------------------------
D1CVD5_9RHIZ/72-233-----------------------------RIAA-------------HEKES-----------------------------
Q98M65_RHILO/72-233-----------------------------KIAA-------------DEKEA-----------------------------
A9CFT8_AGRT5/72-233-----------------------------AIAS-------------VEKQA-----------------------------
A6A9M5_VIBCL/30-192-----------------------------VSYQ-------------NEKEK-----------------------------
B7LSC5_ESCF3/72-233-----------------------------ATQT-------------EEKER-----------------------------
B0HA18_YERPE/72-233-----------------------------VMWS-------------EEKAR-----------------------------
A3KXL0_PSEAI/72-232-----------------------------DQMR-------------DEKQR-----------------------------
Q7VVL2_BORPE/73-234-----------------------------GLHA-------------EGKRR-----------------------------
Q8PQG4_XANAC/70-231-----------------------------ALQA-------------REKQH-----------------------------
Q4UZR5_XANC8/75-236-----------------------------ALQA-------------REKQQ-----------------------------
F0KE27_CLOAE/66-227-----------------------------LSKY-------------EEKLR-----------------------------
A5L9H2_STRPN/66-228-----------------------------SINY-------------ETKRK-----------------------------
E7JQT8_ECOLX/57-218-----------------------------MSNY-------------TLKRE-----------------------------
Q0TE54_ECOL5/35-195-----------------------------KSHY-------------AHKAD-----------------------------
ACCR_AGRT5/76-238-----------------------------VWNR-------------AEKAA-----------------------------
Q9X0F8_THEMA/72-234-----------------------------SINR-------------EAKEK-----------------------------
A8A3I4_ECOHS/72-233-----------------------------LINT-------------HKKEL-----------------------------
A6VF27_PSEA7/73-234-----------------------------QPVS-------------PYKQA-----------------------------
C6RV01_VIBCL/51-212-----------------------------EKVS-------------VRKIS-----------------------------
F0KD65_CLOAE/73-236-----------------------------NANV-------------KEKLI-----------------------------
E8VCQ6_BACST/73-232-----------------------------KTVS-------------EEKNK-----------------------------
Q8EMN4_OCEIH/73-232-----------------------------NIVS-------------DEKKV-----------------------------
A6BYH2_YERPE/90-250-----------------------------EEHP-------------DTKMK-----------------------------
F0KE01_CLOAE/74-232-----------------------------GENK-------------EAKIK-----------------------------
B1XGN1_ECODH/74-234-----------------------------SSFY-------------EEKQL-----------------------------
D8BZ57_ECOLX/76-237-----------------------------ALNT-------------AMKRS-----------------------------
D0JQZ5_YERP1/66-227-----------------------------RRNS-------------GVKSL-----------------------------
A0AL51_LISW6/73-233-----------------------------EVRY-------------EEKQR-----------------------------
B7R6U7_9THEO/72-233-----------------------------KEHI-------------EEKQR-----------------------------
F0K3P1_CLOAE/73-235-----------------------------DEGQ-------------VEKLA-----------------------------
Q8R736_THETN/73-233-----------------------------EVEL-------------EAKRK-----------------------------
A5IQQ2_STAA9/74-233-----------------------------ATNL-------------DEKKM-----------------------------
Q8ES05_OCEIH/73-232-----------------------------IKNV-------------QHKTS-----------------------------
B2DGW4_STRPN/73-230-----------------------------VKNL-------------QEKKL-----------------------------
FRUR_BACSU/73-233-----------------------------SKNL-------------HDKLK-----------------------------
C8JQW1_LISMN/73-231-----------------------------FKNI-------------QSKKV-----------------------------
C8JX72_LISMN/73-234-----------------------------IRNI-------------EEKEA-----------------------------
D4G0K5_BACNA/73-233-----------------------------ITNV-------------IEKKA-----------------------------
Q8ESW8_OCEIH/74-234-----------------------------IMNV-------------REKQK-----------------------------
E0DWD0_9RHIZ/59-219-----------------------------TRQS-------------EEKKL-----------------------------
E2PMQ2_9RHIZ/40-200-----------------------------RQDG-------------EAKLK-----------------------------
Q986N7_RHILO/99-259-----------------------------KQAT-------------EEKQR-----------------------------
Q988Q4_RHILO/54-215-----------------------------DTRH-------------RQKQA-----------------------------
D6EGH9_STRLI/73-234-----------------------------TVAP-------------DGKRK-----------------------------
A9CHG2_AGRT5/74-235-----------------------------TEDA-------------DRKAT-----------------------------
Q98GA9_RHILO/77-238-----------------------------QTMI-------------EERAR-----------------------------
Q7D3J6_AGRT5/73-234-----------------------------TLFV-------------GERER-----------------------------
Q92UW3_RHIME/79-240-----------------------------GENA-------------AAKAA-----------------------------
A3KS48_PSEAI/73-232-----------------------------NEHA-------------QEKRA-----------------------------
Q98BY9_RHILO/72-233-----------------------------RENA-------------DAKRI-----------------------------
A7FKD3_YERP3/73-236-----------------------------SLNH-------------ELKQN-----------------------------
A5VTQ1_BRUO2/73-233-----------------------------ALYH-------------NEKAA-----------------------------
E2WXM3_ECOLX/61-221-----------------------------ALAM-------------TQKAA-----------------------------
C4HNN4_YERPE/24-184-----------------------------MMFS-------------RQKQA-----------------------------
Q986T2_RHILO/73-234-----------------------------QTNL-------------DAKKR-----------------------------
Q9RZP5_DEIRA/81-244-----------------------------QVNH-------------LGKQR-----------------------------
Q9K3L7_STRCO/72-240-----------------------------ARRA-------------SEKQR-----------------------------
Q9AD80_STRCO/61-222-----------------------------HLAT-------------AEKTA-----------------------------
D6EU29_STRLI/80-248-----------------------------GLEP-------------TAKED-----------------------------
Q5UXV7_HALMA/71-231-----------------------------IDNP-------------SGKRA-----------------------------
Q5V513_HALMA/73-232-----------------------------VDHY-------------AEKQA-----------------------------
D6ELC2_STRLI/78-239-----------------------------TSHV-------------PEKRR-----------------------------
Q5YVT8_NOCFA/74-236-----------------------------ATHT-------------AEKER-----------------------------
D6ETC7_STRLI/73-234-----------------------------STAA-------------DEKDR-----------------------------

PF02550

O28424_ARCFU/3-199-----------------------------YQKE-------------YERKL-----------------------------
O29120_ARCFU/9-201-----------------------------YREE-------------YEKKL-----------------------------
P73661_SYNY3/6-196-----------------------------RQEQ-------------LAQLR-----------------------------
ACH1_YEAST/12-230-----------------------------RYAP-------------YLKKV-----------------------------
SCPC_ECOLI/1-213-----------------------------METQ-------------WTRMT-----------------------------

PF01008

EI2BD_MOUSE/219-510-----------------------------LISG-------------SNARC-----------------------------
EI2B2_METJA/22-292-----------------------------EIRG-------------AGRIG-----------------------------
EI2BB_YEAST/33-358-----------------------------QVQG-------------SYAIA-----------------------------
MTNA_BACSU/49-337-----------------------------KVRG-------------APAIG-----------------------------
MTNA_ARCFU/41-327-----------------------------AVRG-------------APALE-----------------------------
EI2BA_HUMAN/15-293-----------------------------KEDP-------------DMASA-----------------------------
MTNA_SYNY3/51-343-----------------------------VVRG-------------APAIG-----------------------------
MTNA_METTH/44-310-----------------------------VVRG-------------APAIG-----------------------------
MTNA_CAEEL/66-357-----------------------------QVRG-------------APLIA-----------------------------
EI2BA_CAEEL/15-293-----------------------------ENDP-------------SKSTS-----------------------------
EI2BA_YEAST/15-292-----------------------------EEDT-------------EMTMP-----------------------------
EI2BD_YEAST/285-637-----------------------------KIVG-------------SIPRC-----------------------------
MTNA_METJA/48-319-----------------------------VVRG-------------APAIG-----------------------------
EI2BB_RABIT/27-333-----------------------------GQRS-------------SEDMA-----------------------------
MTNA_YEAST/49-399-----------------------------QVRG-------------APAIA-----------------------------
EI2BD_SCHPO/156-452-----------------------------KIFG-------------SNQRC-----------------------------
Q5V075_HALMA/195-460-----------------------------RTHG-------------SAWLS-----------------------------
EI2B2_ARCFU/15-284-----------------------------EVRG-------------AARIA-----------------------------

PF04198

YJHU_ECOLI/63-323--VNVFGSIDAALQIRDKFNLQRVIIV..PDGEHAGKRDDT.KLM.RTRLS-----------------------------
Q9WWA6_AGRRK/83-337--SPYVSSPMLEKELVAKFDLRKAVVV..PAPV.....RP..DST.PEAVG-----------------------------
Q9CKH2_PASMU/56-313--YHPIFTSKLEQRLIEQFGIHRALIA..IDTQ.....NE..VEQ.RKQVA-----------------------------
Q98GB2_RHILO/49-296--D.LATPDDITRQLIDGLKLRDAAVV..ETPA.........AGTLAALAA-----------------------------
Q9RT33_DEIRA/86-346--DPQGHPCSLQARLMERWPGVQAQVVGLPPHS.....TQ..DLR.LERVA-----------------------------
Q986P9_RHILO/64-319--GEVSECVELEDELSRRYGLDYCEVV..PDFD.....SE..DLP.LKALG-----------------------------
Q97L54_CLOAB/89-338--REFKGLTDIEEFIRINLNIKKVIIV..PGDI.....DED.STV.MNEIG-----------------------------
CGGR_BACMD/89-339--KEVSGLRLLETTLKEAFSLSEVVVV..SGDS.....DQS.PWV.KNEMG-----------------------------
Q9Z5C6_STAAU/89-337--DIYADDNRLSEGIKNKFQIKEVHVV..PGDA.....DNS.QSV.KTELG-----------------------------
O68117_RHOCA/59-314--HKISACLDLEVALSRRFALKLARVV..PALP.....AG..VDT.ARGTA-----------------------------
Q9CGB1_LACLA/54-307--SPIERSFELEKQFKTLFDIPQIYII..KDVE.....DGN.....SESLI-----------------------------
Q98CZ8_RHILO/62-317--HPIANCLDLAARLKSRFALDLVEVV..PSDP.....NS..SST.TIGIA-----------------------------
Q97SS7_STRPN/56-313--NFDTNMFKLENYVKEKYSLESLEII..PNEF.....DDT.PTILSERIS-----------------------------
Q9L0Z6_STRCO/89-343--VPAELDAERSDALRARYGLRHAVVV..ESPA.....DAEETPD.PENLG-----------------------------
O52721_KLEPN/59-312--HPVANCLDYAQLLQEKYGLIECNVV..PAFS.....E...EST.LDSVS-----------------------------
O30830_RHOSH/62-317--HRVSGCLHLEAALLRRFGLKLARVA..PSLG.....SE..VDP.LPSIA-----------------------------
Q9RGG7_LACCA/60-316--PETTAVSQLVDFFKQKYGLRDAVIV..PASE.....NG..GNE.LNALS-----------------------------
Q99XS9_STRP1/56-314--DYDADLFALEEYVRQQYGLEKLDLV..PNQV.....EDTPMDT.LTNVA-----------------------------
O86289_LEUME/54-309--ENSNRNPQIEHILCDKFKDINFYVV..QDDI.....NN..ITT.SEHLA-----------------------------
O32754_9LACO/124-376--DRLFNASQAEVWLAQALGIDRTIIV..AGDA.....DLQ..SRVYDLAG-----------------------------
Q9CLG2_PASMU/68-318--SRFTGCLELEEALKEHFQLKHIRIL..PALE.....K...NEI.NERLG-----------------------------
Q9ZB29_BRUAO/56-311--GDITECIDLENRLADLYGLDYCEVA..PDIG.....EE..GLP.LMALG-----------------------------
SORC_KLEPN/57-315--YDYNENLWLEQQLKQKFGLKEAVVA..SSDG.....LLE.EEQ.LSAMG-----------------------------
LSRR_ECOLI/66-316--SRFEGCLEYETQLRRQFSLQHVRVI..PGLA.....D...ADV.GGRLG-----------------------------
Q9KER9_BACHD/57-313--DENIHTVELEQRLEKKYHLKEAIVV..PTSG.....LTQ.DMI.KRAIG-----------------------------
DEOR_BACSU/56-311--DPFEDLDALGSILEEKYGLLEAHVVFSPTPD........YAGI.THDLS-----------------------------
Q9KLX0_VIBCH/62-319--YHPVFSAKIEQRLIERFGVRRALIA..LDQP.....ND..EAQ.RQQVA-----------------------------
CGGR_BACSU/89-338--KDVLGLTLLEKTLKERLNLKDAIIV..SGDS.....DQS.PWV.KKEMG-----------------------------
Q9K712_BACHD/89-338--KELLGLRDLEAKLRSRLGVKEAIVV..PGDS.....DAF.TWV.KRELG-----------------------------
Q986M3_RHILO/57-311--TQLFTDDVMARRLEDALKLDAVWIA..PENG.....YI..PDP.STDIA-----------------------------
Q98FV1_RHILO/42-296--SELSEIVRLERALERTFGLQQALVA..PLTA.....PN..ADP.IPAIS-----------------------------

PF01182

B5GBV6_9ACTO/16-220----------------------------------------------MARAA-----------------------------
Q5NMF8_ZYMMO/15-209----------------------------------------------MAKQI-----------------------------
A4S930_OSTLU/38-232----------------------------------------------LARAL-----------------------------
Q1N5N6_9GAMM/18-207----------------------------------------------LAQGL-----------------------------
B8HJV3_CYAP4/14-207----------------------------------------------LIQRG-----------------------------
Q3SH15_THIDA/15-203----------------------------------------------LVAAL-----------------------------
Q9GRG6_9TRYP/16-232----------------------------------------------LSAAG-----------------------------
Q46TU2_CUPPJ/12-206----------------------------------------------HADAM-----------------------------
Q1YRK7_9GAMM/10-201----------------------------------------------LDAAL-----------------------------
B4WRN6_9SYNE/15-208----------------------------------------------LIDRA-----------------------------
D1BS91_XYLCX/15-219----------------------------------------------LAQAA-----------------------------
A3D4S3_SHEB5/16-206----------------------------------------------LEQQL-----------------------------
B1XIZ0_SYNP2/14-205----------------------------------------------LIKRA-----------------------------
B8GMY0_THISH/18-214----------------------------------------------LAATV-----------------------------
A9H335_GLUDA/20-218----------------------------------------------IAQYM-----------------------------
C8X5S3_DESRD/27-227----------------------------------------------LAPSV-----------------------------
B6AXV5_9RHOB/12-202----------------------------------------------MMIDL-----------------------------
A0YMV7_LYNSP/14-207----------------------------------------------LVERA-----------------------------
A4FBN6_SACEN/2-207----------------------------------------------LAAAA-----------------------------
C3Q0C5_9BACE/16-210----------------------------------------------ASQAL-----------------------------
C5B9U1_EDWI9/13-205----------------------------------------------LNIHL-----------------------------
A5BJC3_VITVI/22-226----------------------------------------------LSTDL-----------------------------
D7W1T0_9FLAO/12-207----------------------------------------------LYTKA-----------------------------
G6PE_HUMAN/563-760----------------------------------------------LISKL-----------------------------
C1DDK6_AZOVD/23-215----------------------------------------------LAEEL-----------------------------
B7RZI6_9GAMM/13-205----------------------------------------------LDQAL-----------------------------
Q7NGI9_GLOVI/14-209----------------------------------------------LSLEA-----------------------------
A3JKP2_9ALTE/23-215----------------------------------------------LARKL-----------------------------
B3EG95_CHLL2/16-243----------------------------------------------ITEYA-----------------------------
Q39SD7_GEOMG/11-206----------------------------------------------LSMAA-----------------------------
A8KYS2_FRASN/23-226----------------------------------------------LARAA-----------------------------
A5L2I5_9GAMM/13-205----------------------------------------------VVENL-----------------------------
A0L802_MAGSM/13-211----------------------------------------------SSEEA-----------------------------
A8RIY7_9CLOT/12-210----------------------------------------------LGEKA-----------------------------
A5ZDU8_9BACE/12-206----------------------------------------------TSRAL-----------------------------
B9HIF8_POPTR/22-226----------------------------------------------LGTDL-----------------------------
D7BAW0_MEISD/16-192----------------------------------------------AARAA-----------------------------
D2SF51_GEOOG/32-236----------------------------------------------LARAV-----------------------------
A3JTX7_9RHOB/12-202----------------------------------------------LIASL-----------------------------
C1D789_LARHH/13-209----------------------------------------------AVLAA-----------------------------
Q3A631_PELCD/18-203----------------------------------------------VARNA-----------------------------
A5FY02_ACICJ/17-214----------------------------------------------FAEYG-----------------------------
SOL3_YEAS1/13-213----------------------------------------------LTHQL-----------------------------
A1BIC7_CHLPD/16-245----------------------------------------------LTAIA-----------------------------
B0C6U0_ACAM1/14-207----------------------------------------------LIERA-----------------------------
A0YBK5_9GAMM/13-210----------------------------------------------LFNAL-----------------------------
B7KWH9_METC4/17-217----------------------------------------------TARAA-----------------------------
C0W1H0_9ACTO/16-227----------------------------------------------LYAKV-----------------------------
A4BU42_9GAMM/14-213----------------------------------------------LARAA-----------------------------
A7RLB1_NEMVE/512-711----------------------------------------------VISKL-----------------------------
A8WGH0_XENTR/561-758----------------------------------------------LIEKL-----------------------------
C0WL49_9CORY/13-223----------------------------------------------LISQA-----------------------------
A9WT44_RENSM/14-231----------------------------------------------LAATT-----------------------------
A2C1K7_PROM1/15-207----------------------------------------------LALAA-----------------------------
Q1AZZ4_RUBXD/12-205----------------------------------------------LAAAA-----------------------------
B1VDQ7_CORU7/32-249----------------------------------------------LAAAA-----------------------------
B4S4M1_PROA2/12-237----------------------------------------------VLEKT-----------------------------
A1SJQ5_NOCSJ/16-211----------------------------------------------LATAV-----------------------------
C1BWG3_ESOLU/15-209----------------------------------------------LGPTL-----------------------------
A1U1P6_MARAV/21-213----------------------------------------------VARAL-----------------------------
Q3SP94_NITWN/24-223----------------------------------------------IATEA-----------------------------
Q72QF1_LEPIC/12-197----------------------------------------------FLDHC-----------------------------
Q4RX98_TETNG/585-782----------------------------------------------LVERL-----------------------------
Q0FPX8_9RHOB/14-204----------------------------------------------LAMDL-----------------------------
B8FL61_DESAA/21-219----------------------------------------------LAAYA-----------------------------
C0DYF2_EIKCO/16-207----------------------------------------------QAAAL-----------------------------
B3RVC2_TRIAD/13-206----------------------------------------------LGQDL-----------------------------
Q0F2T0_9PROT/12-198----------------------------------------------LAGYA-----------------------------
Q1IWW4_DEIGD/12-197----------------------------------------------TAQAA-----------------------------
C6XUN5_PEDHD/12-206----------------------------------------------LLEDL-----------------------------
Q2JHW7_SYNJB/15-206----------------------------------------------LIQRA-----------------------------
C3ZBQ0_BRAFL/574-772----------------------------------------------VITQL-----------------------------
B5EPA9_ACIF5/19-206----------------------------------------------LARRL-----------------------------
Q1IMT5_KORVE/24-219----------------------------------------------LCEAT-----------------------------
Q0FAR7_9RHOB/13-202----------------------------------------------LMKTL-----------------------------
B2IE85_BEII9/16-213----------------------------------------------LTERV-----------------------------
A6ED65_9SPHI/12-206----------------------------------------------LFEDL-----------------------------
A4QEF4_CORGB/13-205----------------------------------------------LVAQA-----------------------------
Q83HQ1_TROW8/17-213----------------------------------------------LVEEV-----------------------------
Q165T6_ROSDO/12-202----------------------------------------------AAIGV-----------------------------
C3JSX9_RHOER/15-215----------------------------------------------LVDAA-----------------------------
B2GH88_KOCRD/18-222----------------------------------------------LAAET-----------------------------
C6VSE7_DYAFD/12-207----------------------------------------------LSASL-----------------------------
A1AR88_PELPD/14-209----------------------------------------------LSRAA-----------------------------
A6TTT0_ALKMQ/14-213----------------------------------------------VAKKL-----------------------------
B0NQ39_BACSE/12-207----------------------------------------------TARAL-----------------------------
A9UYD4_MONBE/172-367----------------------------------------------VGQAA-----------------------------
F2G576_ALTMD/14-206----------------------------------------------LTDAF-----------------------------
B3MQE2_DROAN/19-215----------------------------------------------LVQGL-----------------------------
Q31GB5_THICR/17-202----------------------------------------------VAQAL-----------------------------
C5BV30_BEUC1/15-216----------------------------------------------LAEAV-----------------------------
C4FNH5_9FIRM/15-211----------------------------------------------VVQAL-----------------------------
6PGL_DICDI/16-211----------------------------------------------FEDEC-----------------------------
B6XUA3_9BIFI/15-234----------------------------------------------LAQAV-----------------------------
B6APC6_9BACT/25-225----------------------------------------------LAREG-----------------------------
Q0G231_9RHIZ/15-207----------------------------------------------LAEAL-----------------------------
Q6SFD3_9BACT/12-201----------------------------------------------LNTAL-----------------------------
A0JWQ2_ARTS2/16-230----------------------------------------------LMAAI-----------------------------
Q60CQ2_METCA/13-209----------------------------------------------LAPAL-----------------------------
Q47EB6_DECAR/15-199----------------------------------------------VAAQA-----------------------------
Q5YTR6_NOCFA/34-231----------------------------------------------LVTAG-----------------------------
A6E3P5_9RHOB/12-202----------------------------------------------LVMGL-----------------------------
Q5FQ99_GLUOX/19-217----------------------------------------------VALRM-----------------------------
B4M2H3_DROVI/20-214----------------------------------------------LVQSL-----------------------------
C4GM95_9NEIS/14-208----------------------------------------------SAQAL-----------------------------
Q0V513_PHANO/16-221----------------------------------------------LAASL-----------------------------
B2FL79_STRMK/21-214----------------------------------------------WIEAV-----------------------------
A8LLP7_DINSH/12-202----------------------------------------------LMMRL-----------------------------
Q0ALB6_MARMM/20-216----------------------------------------------MADAL-----------------------------
A9E4D3_9RHOB/12-202----------------------------------------------LVMNV-----------------------------
Q133N9_RHOPS/18-217----------------------------------------------LARLA-----------------------------
A3WL22_9GAMM/18-207----------------------------------------------LSSSL-----------------------------
B4FKI4_MAIZE/26-230----------------------------------------------MATDL-----------------------------
B3GY89_ACTP7/12-200----------------------------------------------AVEKI-----------------------------
B3CF61_9BACE/12-206----------------------------------------------TARAL-----------------------------
6PGL_RHILO/22-214----------------------------------------------LAVAL-----------------------------
C7R459_JONDD/14-213----------------------------------------------LARTT-----------------------------
B7RQ64_9RHOB/12-202----------------------------------------------LAEAV-----------------------------
Q48MB6_PSE14/23-214----------------------------------------------LADAL-----------------------------
6PGL_CHLMU/22-212----------------------------------------------FLQIA-----------------------------
Q5WZC2_LEGPL/18-208----------------------------------------------LIHDM-----------------------------
C5E1Z3_LACTC/136-338----------------------------------------------LSRDL-----------------------------
Q6A7F7_PROAC/15-209----------------------------------------------LAEGV-----------------------------
A2TF14_BOMMO/12-204----------------------------------------------IIRKL-----------------------------
6PGL_RAT/18-217----------------------------------------------LGASL-----------------------------
C4LIR1_CORK4/32-257----------------------------------------------VAMRA-----------------------------
B0T0C3_CAUSK/20-213----------------------------------------------LFDAA-----------------------------
Q482L5_COLP3/13-205----------------------------------------------LDNEL-----------------------------
A3HVL3_9BACT/12-204----------------------------------------------LAEEF-----------------------------
C0N6V1_9GAMM/14-209----------------------------------------------LITAA-----------------------------
Q602U1_METCA/18-208----------------------------------------------FEIRV-----------------------------
A3TLE4_9MICO/24-220----------------------------------------------LSDAI-----------------------------
A9BAR0_PROM4/15-206----------------------------------------------AAQLA-----------------------------
A7RMK1_NEMVE/15-211----------------------------------------------LQMSV-----------------------------
A8Y0B4_CAEBR/14-211----------------------------------------------MVTQL-----------------------------
6PGL_XYLFA/20-213----------------------------------------------WAQSV-----------------------------
C1MQ42_MICPC/15-220----------------------------------------------VADAL-----------------------------
B1LXU6_METRJ/16-216----------------------------------------------VAREA-----------------------------
A6X608_OCHA4/14-206----------------------------------------------LAQAL-----------------------------
C6BLU0_RALP1/14-208----------------------------------------------QAKAL-----------------------------
A5FAH5_FLAJ1/11-206----------------------------------------------INTAA-----------------------------
Q0SNU0_BORAP/4-201----------------------------------------------LYSDE-----------------------------
6PGL_TREPA/12-204----------------------------------------------IAAFL-----------------------------
Q65WN8_MANSM/12-200----------------------------------------------AVEKI-----------------------------
Q7UM40_RHOBA/10-203----------------------------------------------LSNAA-----------------------------
Q1H2F6_METFK/26-211----------------------------------------------LYSSA-----------------------------
C3ZB29_BRAFL/15-218----------------------------------------------IGAAL-----------------------------
Q2N8B4_ERYLH/15-185----------------------------------------------IADWL-----------------------------
B3RLE2_TRIAD/571-763----------------------------------------------VIDNL-----------------------------
B4SF86_PELPB/52-278----------------------------------------------ITEHA-----------------------------
A4AJP5_9ACTN/16-217----------------------------------------------LAQAV-----------------------------
A7H493_CAMJD/14-201----------------------------------------------CNFAL-----------------------------
Q6NH39_CORDI/13-208----------------------------------------------VIQEA-----------------------------
Q758H7_ASHGO/106-305----------------------------------------------LAQDL-----------------------------
C7LRB5_DESBD/13-206----------------------------------------------LLQRA-----------------------------
C0XSW9_9CORY/13-210----------------------------------------------LIDAA-----------------------------
D0LCU1_GORB4/14-214----------------------------------------------LVSTA-----------------------------
B0UFD2_METS4/17-214----------------------------------------------VARAA-----------------------------
B8KWX5_9GAMM/13-202----------------------------------------------LDSAL-----------------------------
Q5ZJY1_CHICK/14-209----------------------------------------------LGSAL-----------------------------
A4ERB6_9RHOB/12-202----------------------------------------------LAIEV-----------------------------
Q2IHT3_ANADE/18-216----------------------------------------------LARAA-----------------------------
Q08ZT9_STIAD/14-199----------------------------------------------LAGQA-----------------------------
Q6G154_BARQU/17-209----------------------------------------------LALAL-----------------------------
Q31QV8_SYNE7/14-207----------------------------------------------VVSAA-----------------------------
6PGL1_ORYSJ/43-247----------------------------------------------MATDL-----------------------------
A6WC51_KINRD/17-219----------------------------------------------LAAAT-----------------------------
Q5DCQ0_SCHJA/12-207----------------------------------------------VGQCA-----------------------------
A7BCF7_9ACTO/16-215----------------------------------------------LNEAV-----------------------------
B1MC71_MYCA9/15-216----------------------------------------------LVTAA-----------------------------
Q1NX17_9DELT/12-205----------------------------------------------MAAAA-----------------------------
B8G942_CHLAD/16-214----------------------------------------------LYQAA-----------------------------
B3QKX3_CHLP8/12-238----------------------------------------------LLEKA-----------------------------
Q4K7U0_PSEF5/23-214----------------------------------------------LAEGQ-----------------------------
C1DRP8_AZOVD/23-215----------------------------------------------LATAM-----------------------------
C0VW02_9CORY/14-218----------------------------------------------MCDYA-----------------------------
D7B103_NOCDD/15-218----------------------------------------------LADSV-----------------------------
C1FFY3_MICSR/10-214----------------------------------------------VADAL-----------------------------
B8IN69_METNO/17-215----------------------------------------------VARSA-----------------------------
Q8DJZ4_THEEB/15-208----------------------------------------------LTTAA-----------------------------
B9XC32_9BACT/14-212----------------------------------------------LAEEV-----------------------------
C6XF26_LIBAP/15-208----------------------------------------------LAQKL-----------------------------
B7GTB4_BIFLS/15-250----------------------------------------------MIQAG-----------------------------
Q1VC87_VIBAL/13-205----------------------------------------------VVESL-----------------------------
Q3APN1_CHLCH/17-236----------------------------------------------VTLHA-----------------------------
A2EC78_TRIVA/493-688----------------------------------------------LIHSV-----------------------------
Q4Q8S1_LEIMA/17-233----------------------------------------------ISSAA-----------------------------
Q1NB25_9SPHN/13-203----------------------------------------------AAADI-----------------------------
A8UQU5_9AQUI/13-192----------------------------------------------VSREL-----------------------------
Q3LFH1_PROFR/16-212----------------------------------------------LTTGA-----------------------------
B3DW46_METI4/16-204----------------------------------------------WLNYL-----------------------------
B9WM75_CANDC/14-221----------------------------------------------VANSV-----------------------------
A5EXD3_DICNV/14-202----------------------------------------------RAQSL-----------------------------
A0LDZ7_MAGSM/18-207----------------------------------------------SIATL-----------------------------
A3URA5_VIBSP/13-205----------------------------------------------VVENL-----------------------------
B3EN23_CHLPB/10-239----------------------------------------------IVQQA-----------------------------
Q46LF9_PROMT/15-207----------------------------------------------LALAA-----------------------------
C0CZ03_9CLOT/12-210----------------------------------------------LGRDA-----------------------------
Q04TL9_LEPBJ/16-201----------------------------------------------FLSGC-----------------------------
B9RWU5_RICCO/22-225----------------------------------------------LAVSL-----------------------------
B7FPL4_PHATC/16-217----------------------------------------------LPYHL-----------------------------
D4BM17_BIFBR/15-250----------------------------------------------MIQAG-----------------------------
6PGL_HELPY/14-200----------------------------------------------CHKAL-----------------------------
A2TVY6_9FLAO/12-203----------------------------------------------VAQDF-----------------------------
B8ELV8_METSB/16-213----------------------------------------------LAARA-----------------------------
A6F7Y8_9GAMM/13-205----------------------------------------------VVESL-----------------------------
A5VAC4_SPHWW/15-208----------------------------------------------LAEAV-----------------------------
Q5L5V6_CHLAB/22-212----------------------------------------------FIDLA-----------------------------
C5FTG3_ARTOC/17-223----------------------------------------------LKKQL-----------------------------
Q64V75_BACFR/29-223----------------------------------------------TARAL-----------------------------
Q2Y8J3_NITMU/20-208----------------------------------------------LQDAA-----------------------------
D3Q4S0_STANL/15-218----------------------------------------------LAQSV-----------------------------
B6BUE7_9PROT/16-203----------------------------------------------LESIL-----------------------------
C1FA85_ACIC5/18-218----------------------------------------------LSHAA-----------------------------
C0E339_9CORY/13-209----------------------------------------------VCRAA-----------------------------
B3NVD9_DROER/19-209----------------------------------------------LVQAL-----------------------------
Q46QB1_CUPPJ/12-202----------------------------------------------QAEAL-----------------------------
A9BG97_PETMO/12-207----------------------------------------------FHNEA-----------------------------
A8IFM0_AZOC5/23-215----------------------------------------------LARAL-----------------------------
A6F5Y7_9ALTE/21-213----------------------------------------------TAVAL-----------------------------
B2J9Q0_NOSP7/14-207----------------------------------------------LVARA-----------------------------
Q8QZU3_MOUSE/85-282----------------------------------------------LISKL-----------------------------
SOL4_YEAST/13-220----------------------------------------------LIHEF-----------------------------
Q8KBB8_CHLTE/15-241----------------------------------------------LLEKA-----------------------------
C5B1S2_METEA/18-219----------------------------------------------VAQAA-----------------------------
D0LNM1_HALO1/21-212----------------------------------------------RAQAM-----------------------------
B4GTC9_DROPE/19-215----------------------------------------------LIETL-----------------------------
A0LTY4_ACIC1/14-215----------------------------------------------LAAAV-----------------------------
6PGL_CHLPN/22-212----------------------------------------------FIDLA-----------------------------
B6C1K3_9GAMM/13-208----------------------------------------------LYHSA-----------------------------
Q6FQZ7_CANGA/13-211----------------------------------------------LAHRL-----------------------------
B4UA07_HYDS0/19-183----------------------------------------------SSYFL-----------------------------
Q16H01_AEDAE/14-211----------------------------------------------ICDEI-----------------------------
C1BN63_9MAXI/13-205----------------------------------------------VGKDL-----------------------------
B1S5Y3_9BIFI/15-234----------------------------------------------LAQAV-----------------------------
E2S154_9CORY/13-223----------------------------------------------LISQA-----------------------------
B6U0H2_MAIZE/26-230----------------------------------------------ISTDL-----------------------------
A1R6H4_ARTAT/16-230----------------------------------------------LMAAI-----------------------------
Q11M12_MESSB/15-206----------------------------------------------LAEAL-----------------------------
B0UWD1_HAES2/12-200----------------------------------------------AVEQI-----------------------------
Q3M5C2_ANAVT/14-207----------------------------------------------LIARS-----------------------------
Q1Z513_PHOPR/13-205----------------------------------------------VVQSL-----------------------------
A2G0T4_TRIVA/485-680----------------------------------------------LVQSV-----------------------------
A0QWX6_MYCS2/15-214----------------------------------------------LVAAA-----------------------------
B1LCT8_THESQ/13-199----------------------------------------------YVDFV-----------------------------
Q0BTV3_GRABC/22-218----------------------------------------------LADHV-----------------------------
B9BSQ1_9BURK/13-201----------------------------------------------QSEAL-----------------------------
B9L0S4_THERP/14-212----------------------------------------------AVRQA-----------------------------
Q0YUA1_9CHLB/18-247----------------------------------------------MTEHA-----------------------------
Q82U22_NITEU/18-206----------------------------------------------LSEAL-----------------------------
B8C1W9_THAPS/25-226----------------------------------------------VGTVL-----------------------------
B5HF46_STRPR/16-221----------------------------------------------MAQAA-----------------------------
Q01VT6_SOLUE/14-208----------------------------------------------AAEAC-----------------------------
A2CAC2_PROM3/15-206----------------------------------------------LARRA-----------------------------
A3WEG3_9SPHN/15-187----------------------------------------------IAQWL-----------------------------
D2ZU85_NEIMU/13-206----------------------------------------------ASEAL-----------------------------
A6L9R0_PARD8/12-206----------------------------------------------ALRSM-----------------------------
A8HQW1_CHLRE/10-210----------------------------------------------AQAGL-----------------------------
A0Y025_9GAMM/15-210----------------------------------------------LTKEL-----------------------------
D2Q4L4_KRIFD/15-257----------------------------------------------LAHAV-----------------------------
B5GMF0_STRCL/8-196----------------------------------------------MARDA-----------------------------
Q7P1R7_CHRVO/9-197----------------------------------------------QTDAL-----------------------------
B4RAR4_PHEZH/11-193----------------------------------------------LGEAC-----------------------------
Q210H8_RHOPB/14-212----------------------------------------------LAKTA-----------------------------
B5FXQ3_TAEGU/13-211----------------------------------------------LGAAL-----------------------------
A6FX55_9DELT/14-207----------------------------------------------LGAAV-----------------------------
Q7D149_AGRT5/14-206----------------------------------------------LATAL-----------------------------
Q2SQ14_HAHCH/21-211----------------------------------------------LAHKL-----------------------------
D2QID0_SPILD/12-207----------------------------------------------LAKAA-----------------------------
6PGL_BORBU/4-201----------------------------------------------LYSDE-----------------------------
B0REI8_CLAMS/16-217----------------------------------------------MTGSV-----------------------------
B6WQA9_9DELT/1-197----------------------------------------------MAERA-----------------------------
A3SWE9_9RHOB/12-202----------------------------------------------LAMDL-----------------------------
Q6CXV1_KLULA/13-216----------------------------------------------LASSV-----------------------------
A3ESW2_9BACT/25-225----------------------------------------------LAREG-----------------------------
Q4CQA8_TRYCC/16-230----------------------------------------------LSGVA-----------------------------
Q5LRS8_SILPO/12-202----------------------------------------------LAIDL-----------------------------
A1B3E9_PARDP/14-203----------------------------------------------LFLSL-----------------------------
C1BTN9_9MAXI/11-205----------------------------------------------VSQDL-----------------------------
Q7V1T4_PROMP/23-212----------------------------------------------LSSNV-----------------------------
A5EPZ2_BRASB/17-216----------------------------------------------MARTA-----------------------------
Q89FE0_BRAJA/19-218----------------------------------------------LAQAA-----------------------------
Q0C1F0_HYPNA/14-211----------------------------------------------ASVLA-----------------------------
C7MSN0_SACVD/16-225----------------------------------------------LAAAA-----------------------------
A6FR30_9RHOB/12-202----------------------------------------------LVIDV-----------------------------
B4W8G2_9CAUL/11-207----------------------------------------------WAEAI-----------------------------
C5DTU9_ZYGRC/12-219----------------------------------------------FVRRV-----------------------------
A3K6K0_9RHOB/32-222----------------------------------------------LSIEL-----------------------------
B3PCY8_CELJU/13-208----------------------------------------------MIAAL-----------------------------
A9TLR4_PHYPA/9-215----------------------------------------------VSYVL-----------------------------
Q1PUZ3_9BACT/11-211----------------------------------------------LIKIM-----------------------------
B8KHX3_9GAMM/20-211----------------------------------------------LDKQM-----------------------------
Q28QX5_JANSC/13-203----------------------------------------------MMLDL-----------------------------
D0MEF0_RHOM4/17-193----------------------------------------------ACRMA-----------------------------
D1CEH8_THET1/14-209----------------------------------------------VARAG-----------------------------
6PGL_MYCBO/14-215----------------------------------------------LVAAA-----------------------------
E3D833_GARV3/22-241----------------------------------------------LAAVA-----------------------------
Q1QTX1_CHRSD/12-202----------------------------------------------LAERL-----------------------------
D2AVA1_STRRD/15-217----------------------------------------------LAKAV-----------------------------
Q5HZC7_XENTR/18-208----------------------------------------------LALSL-----------------------------
A7TEX2_VANPO/13-217----------------------------------------------LAGNL-----------------------------
C1EGM8_MICSR/47-244----------------------------------------------LAKAL-----------------------------
A5PAY4_9SPHN/15-184----------------------------------------------IAEWL-----------------------------
D0L091_HALNC/17-218----------------------------------------------LVAQC-----------------------------
Q2H6B6_CHAGB/16-222----------------------------------------------LAPVL-----------------------------
C7MCP6_BRAFD/331-540----------------------------------------------VAAAA-----------------------------
Q7QGR5_ANOGA/17-214----------------------------------------------ICDEV-----------------------------
A6VKW1_ACTSZ/12-200----------------------------------------------AVEKI-----------------------------
B4DAH7_9BACT/11-207----------------------------------------------FAADA-----------------------------
A4SD39_PROVI/13-239----------------------------------------------LTRRT-----------------------------
D5URS5_TSUPD/17-223----------------------------------------------LVTAA-----------------------------
B9Z5J3_9NEIS/12-200----------------------------------------------AAAAL-----------------------------
A9PA91_POPTR/19-223----------------------------------------------VAVSL-----------------------------
6PGL_CAEEL/26-224----------------------------------------------LILQL-----------------------------
Q312M1_DESDG/43-239----------------------------------------------MARQA-----------------------------
A4CNJ0_ROBBH/12-204----------------------------------------------AAEAL-----------------------------
A9F2S9_SORC5/16-210----------------------------------------------LARLG-----------------------------

PF06026

RPIA_MOUSE/119-296----------------------------------------------LICIP-----------------------------
RPIA_STRMU/48-219----------------------------------------------VIGVT-----------------------------
RPIA_XYLFA/45-214----------------------------------------------KGAVS-----------------------------
RPIA_RALSO/51-224----------------------------------------------AGAVS-----------------------------
Q8I3W2_PLAF7/50-228----------------------------------------------VVCIP-----------------------------
RPIA_BRUSU/50-227----------------------------------------------VIGVP-----------------------------
RPIA_XANCP/45-214----------------------------------------------KGAVS-----------------------------
RPIA_METMA/56-227----------------------------------------------ILGVV-----------------------------
RPIA_TREPA/68-247----------------------------------------------IAAVP-----------------------------
RPIA_HAEIN/47-216----------------------------------------------QGAVA-----------------------------
RPIA_BUCAI/47-215----------------------------------------------YGAVS-----------------------------
RPIA_ARATH/81-260----------------------------------------------IVGIP-----------------------------
RPIA_VIBCH/47-215----------------------------------------------KGAVS-----------------------------
RPIA_CAUCR/47-223----------------------------------------------IRGVP-----------------------------
RPIA_CHLTR/61-233----------------------------------------------ITAVA-----------------------------
RPIA2_YERPE/52-231----------------------------------------------LTCTT-----------------------------
RPIA2_OCEIH/49-219----------------------------------------------VVGIP-----------------------------
RPIA_PSEAE/51-219----------------------------------------------DGAVA-----------------------------
Q97J55_CLOAB/49-223----------------------------------------------IKVVT-----------------------------
RPIA_NOSS1/56-230----------------------------------------------IVGIP-----------------------------
Q8L9K5_ARATH/93-272----------------------------------------------IVGIP-----------------------------
RPIA_THEEB/54-228----------------------------------------------IVGVP-----------------------------
RPIA_LACLA/48-220----------------------------------------------ITGVT-----------------------------
RPIA_CAEEL/63-242----------------------------------------------IICVP-----------------------------
RPIA_CHLPN/53-225----------------------------------------------VHAIA-----------------------------
Q8RU73_SPIOL/106-285----------------------------------------------IVGIP-----------------------------
RPIA_BORBU/50-225----------------------------------------------LKFYT-----------------------------
Q8LBQ2_ARATH/77-261----------------------------------------------IIGIP-----------------------------
RPIA_RHILO/49-226----------------------------------------------VIGVP-----------------------------
RPIA_PYRHO/51-225----------------------------------------------IVGVP-----------------------------
RPIA_AGRT5/49-226----------------------------------------------VEGVP-----------------------------
RPIA1_YERPE/47-215----------------------------------------------EGAVS-----------------------------
RPIA_THEAC/51-223----------------------------------------------IRAVC-----------------------------
RPIA_AERPE/51-226----------------------------------------------GVAVP-----------------------------
RPIA_WIGBR/47-215----------------------------------------------KGTVS-----------------------------
A9UNB7_DROME/96-275----------------------------------------------LICVP-----------------------------
RPIA_SCHPO/60-238----------------------------------------------VVFIP-----------------------------
RPIA_LISIN/47-219----------------------------------------------ITGVS-----------------------------
RPIA_STRR6/48-219----------------------------------------------ITAVT-----------------------------
RPIA_ARCFU/49-223----------------------------------------------IYGIP-----------------------------
RPIA_THEVO/51-223----------------------------------------------IKGVC-----------------------------
RPIA1_OCEIH/51-222----------------------------------------------IEGIP-----------------------------
RPIA_BIFLO/53-225----------------------------------------------FTGVT-----------------------------
RPIA_STRP8/48-219----------------------------------------------VVGVT-----------------------------
RPIA_DEIRA/51-222----------------------------------------------IVGVS-----------------------------
RPIA_NEIMA/48-216----------------------------------------------KGAVS-----------------------------
RPIA_STAAW/51-224----------------------------------------------ITGVC-----------------------------
RPIA_STRA5/48-219----------------------------------------------VVGVT-----------------------------
RPIA_YEAST/73-253----------------------------------------------FICIP-----------------------------
RPIA_STAES/51-224----------------------------------------------ITGVC-----------------------------
RPIA_METJA/50-222----------------------------------------------VFGIP-----------------------------
Q8ZXY8_PYRAE/43-220----------------------------------------------VLLVA-----------------------------
RPIA_LISMO/47-219----------------------------------------------ITGVA-----------------------------
RPIA_METTH/51-223----------------------------------------------VMGVP-----------------------------
RPIA_HALSA/51-221----------------------------------------------VSGVA-----------------------------
RPIA_SYNY3/55-229----------------------------------------------VVGIP-----------------------------
RPIA_SHEON/47-215----------------------------------------------EGAVS-----------------------------
RPIA_BUCAP/47-215----------------------------------------------SGAVS-----------------------------

PF02589

Q30YW4_DESDG/23-221----------------------------------------------LAE.A-----------------------------
Q72A59_DESVH/13-211----------------------------------------------LTE.V-----------------------------
A0LET5_SYNFM/13-211----------------------------------------------LSD.L-----------------------------
A8ZY31_DESOH/13-211----------------------------------------------LAQ.V-----------------------------
Q6AQM0_DESPS/13-211----------------------------------------------LRA.V-----------------------------
A5N319_CLOK5/16-217----------------------------------------------ATK.L-----------------------------
A3DDG8_CLOTH/16-211----------------------------------------------APR.I-----------------------------
Q18C30_CLOD6/15-209----------------------------------------------GPH.I-----------------------------
A6LXE8_CLOB8/15-209----------------------------------------------STK.V-----------------------------
A5KQQ3_9FIRM/12-205----------------------------------------------GKR.V-----------------------------
A7B149_RUMGN/7-200----------------------------------------------GAR.V-----------------------------
A6BK24_9FIRM/13-206----------------------------------------------GAK.I-----------------------------
A7VF64_9CLOT/13-206----------------------------------------------AKA.M-----------------------------
B8D0K4_HALOH/12-205----------------------------------------------AEK.L-----------------------------
A4XID0_CALS8/13-207----------------------------------------------LET.L-----------------------------
A5I080_CLOBH/11-201----------------------------------------------LAQKL-----------------------------
Q5CB89_THESQ/49-242----------------------------------------------AEH.V-----------------------------
A7HK56_FERNB/14-207----------------------------------------------AQK.I-----------------------------
A6LMB1_THEM4/14-207----------------------------------------------ANK.V-----------------------------
A8F3V4_THELT/14-204----------------------------------------------CRK.L-----------------------------
Q1EM38_9BACT/45-238----------------------------------------------AQK.L-----------------------------
A5MYV3_CLOK5/13-207----------------------------------------------IKR.T-----------------------------
Q0SPU8_CLOPS/13-207----------------------------------------------INK.V-----------------------------
A7FS45_CLOB1/13-207----------------------------------------------IMR.T-----------------------------
Q97IL7_CLOAB/13-207----------------------------------------------IER.T-----------------------------
Q188D0_CLOD6/13-206----------------------------------------------IEK.T-----------------------------
Q892L7_CLOTE/13-207----------------------------------------------VER.V-----------------------------
A8MGY9_ALKOO/13-207----------------------------------------------VQR.T-----------------------------
A5N989_CLOK5/13-207----------------------------------------------IER.T-----------------------------
A5I1I2_CLOBH/13-207----------------------------------------------VER.T-----------------------------
Q897Y1_CLOTE/13-206----------------------------------------------VQR.T-----------------------------
B8CXT8_HALOH/13-207----------------------------------------------IER.I-----------------------------
A7VSP9_9CLOT/13-219----------------------------------------------IQR.T-----------------------------
B8I8V5_CLOCE/13-218----------------------------------------------IKK.T-----------------------------
Q7MR09_WOLSU/5-199----------------------------------------------VRK.T-----------------------------
Q251U6_DESHY/5-199----------------------------------------------LER.T-----------------------------
Q97M44_CLOAB/13-207----------------------------------------------AKK.I-----------------------------
A1HQE0_9FIRM/13-207----------------------------------------------AAR.V-----------------------------
B5EEH8_GEOBB/16-211----------------------------------------------CNK.A-----------------------------
A5G901_GEOUR/16-211----------------------------------------------CEK.A-----------------------------
Q39QC7_GEOMG/16-211----------------------------------------------CRK.A-----------------------------
A5CYU3_PELTS/16-210----------------------------------------------CKR.A-----------------------------
A0PZA2_CLONN/13-207----------------------------------------------GEK.V-----------------------------
Q6M046_METMP/13-207----------------------------------------------GKK.L-----------------------------
A4J2Z4_DESRM/12-207----------------------------------------------GEK.V-----------------------------
A6TQ94_ALKMQ/5-197----------------------------------------------VEV.I-----------------------------
A8MHS3_ALKOO/5-197----------------------------------------------IEK.V-----------------------------
A7I305_CAMHC/3-194----------------------------------------------MSD.L-----------------------------
A8EV54_ARCB4/1-193----------------------------------------------MKE.F-----------------------------
A6NR40_9FIRM/4-190----------------------------------------------IEK.L-----------------------------
A6LYD8_CLOB8/3-195----------------------------------------------FTK.L-----------------------------
B9LU40_HALLT/27-212----------------------------------------------VEE.T-----------------------------
Q5V6G7_HALMA/27-212----------------------------------------------IEE.T-----------------------------
A3CXV8_METMJ/32-217----------------------------------------------LKK.T-----------------------------
Q8T2H5_DICDI/31-220----------------------------------------------LNE.T-----------------------------
Q8T2H6_DICDI/31-218----------------------------------------------INE.T-----------------------------
Q9BI24_DICDI/30-213----------------------------------------------LME.T-----------------------------
A8LFX8_FRASN/21-203----------------------------------------------IDR.A-----------------------------
Q5YX86_NOCFA/55-213----------------------------------------------VSA.F-----------------------------
Q6ABE0_PROAC/50-223----------------------------------------------VGT.F-----------------------------
A3Q5V6_MYCSJ/41-201----------------------------------------------VAR.F-----------------------------
Q1J3Q0_DEIGD/40-206----------------------------------------------VQQ.F-----------------------------
Q9RT57_DEIRA/45-211----------------------------------------------LHQ.F-----------------------------
Q9XAA8_STRCO/46-212----------------------------------------------VDL.L-----------------------------
A4TC28_MYCGI/41-203----------------------------------------------VDR.F-----------------------------
A7BE65_9ACTO/49-222----------------------------------------------IDE.M-----------------------------
Q6NHV0_CORDI/43-208----------------------------------------------KEL.L-----------------------------
A1ATQ9_PELPD/34-209----------------------------------------------MYELF-----------------------------
B5EIV8_GEOBB/2-175----------------------------------------------YEL.F-----------------------------
A1HPX9_9FIRM/22-195----------------------------------------------FPE.F-----------------------------
B8G046_DESHD/8-180----------------------------------------------YER.F-----------------------------
A4J2C5_DESRM/13-186----------------------------------------------YKE.F-----------------------------
A5D032_PELTS/17-190----------------------------------------------YEE.F-----------------------------
Q2RG46_MOOTA/7-177----------------------------------------------ITS.F-----------------------------
Q39ZY5_PELCD/8-178----------------------------------------------LER.F-----------------------------
Q74CQ2_GEOSL/47-209----------------------------------------------IST.F-----------------------------
Q30WA8_DESDG/6-203----------------------------------------------SRL.M-----------------------------
Q6APH5_DESPS/6-194----------------------------------------------IQL.F-----------------------------
A0LF89_SYNFM/7-180----------------------------------------------IAK.L-----------------------------
Q1ARS5_RUBXD/44-220----------------------------------------------PSR.F-----------------------------
Q67TB5_SYMTH/34-234----------------------------------------------ADR.F-----------------------------
LUTC_BACP2/52-237----------------------------------------------VEQ.L-----------------------------
LUTC_GEOTN/52-237----------------------------------------------LSA.L-----------------------------
LUTC_BACAH/51-236----------------------------------------------LEV.F-----------------------------
A3I780_9BACI/50-235----------------------------------------------LEI.F-----------------------------
Q836K1_ENTFA/52-236----------------------------------------------LTI.V-----------------------------
A2RMF6_LACLM/49-224----------------------------------------------LEI.A-----------------------------
Q2B117_9BACI/51-235----------------------------------------------AEV.L-----------------------------
LUTC_OCEIH/49-232----------------------------------------------IDV.L-----------------------------
LUTC1_BACWK/49-231----------------------------------------------VLQ.L-----------------------------
Q1WT28_LACS1/55-240----------------------------------------------LEI.A-----------------------------
B3XQV7_LACRE/57-241----------------------------------------------LEL.A-----------------------------
A7JU08_PASHA/49-230----------------------------------------------CQE.F-----------------------------
O86990_PROMI/4-116----------------------------------------------LGH..-----------------------------
Q6LPN1_PHOPR/50-245----------------------------------------------KDV.L-----------------------------
Q638X4_BACCZ/48-228----------------------------------------------IEQ.F-----------------------------
Q24VR0_DESHY/42-220----------------------------------------------IDK.F-----------------------------
Q3ISD4_NATPD/6-167----------------------------------------------IET.F-----------------------------
B9LU45_HALLT/6-165----------------------------------------------IAT.F-----------------------------
Q5V6W0_HALMA/5-169----------------------------------------------RAS.F-----------------------------
Q01UG2_SOLUE/41-210----------------------------------------------IES.F-----------------------------
C0A2Z6_9BACT/52-233----------------------------------------------VSPAI-----------------------------
Q1IN29_KORVE/40-207----------------------------------------------MQR.F-----------------------------
A6EDI2_9SPHI/43-210----------------------------------------------LEVIF-----------------------------
A1ZEZ8_9BACT/19-187----------------------------------------------PEVIF-----------------------------
Q11XG5_CYTH3/44-210----------------------------------------------SVV.F-----------------------------
A7NKC6_ROSCS/47-233----------------------------------------------AQQ.F-----------------------------
B9LL37_CHLSY/44-229----------------------------------------------AEQ.F-----------------------------
Q2SMI8_HAHCH/39-216----------------------------------------------VRV.F-----------------------------
Q47V41_COLP3/52-226----------------------------------------------LAQ.F-----------------------------
Q3IEG6_PSEHT/41-215----------------------------------------------LEQ.F-----------------------------
A6D6N6_9VIBR/44-218----------------------------------------------AQR.F-----------------------------
Q1Z553_PHOPR/38-228----------------------------------------------TRQRF-----------------------------
Q7NTM5_CHRVO/41-217----------------------------------------------LRH.W-----------------------------
Q46PZ2_CUPPJ/51-226----------------------------------------------VAS.M-----------------------------
A6F5P7_9ALTE/40-218----------------------------------------------LDM.F-----------------------------
Q4KII4_PSEF5/42-220----------------------------------------------IPQ.L-----------------------------
Q222U5_RHOFD/42-217----------------------------------------------VTR.L-----------------------------
A4U5P4_9PROT/35-201----------------------------------------------LER.F-----------------------------
Q2VZP0_MAGSA/37-213----------------------------------------------KAK.F-----------------------------
Q5F884_NEIG1/42-219----------------------------------------------LKH.W-----------------------------
Q310K5_DESDG/40-217----------------------------------------------EER.F-----------------------------
Q6AIU4_DESPS/43-219----------------------------------------------IAK.F-----------------------------
Q72B57_DESVH/44-220----------------------------------------------IPL.L-----------------------------
Q0PC62_CAMJE/47-218----------------------------------------------LTE.M-----------------------------
A0RPC6_CAMFF/42-213----------------------------------------------YAE.F-----------------------------
Q9ZMU3_HELPJ/38-211----------------------------------------------VEE.Y-----------------------------
Q7VIF4_HELHP/38-218----------------------------------------------VQE.Y-----------------------------
Q2BIJ5_9GAMM/39-219----------------------------------------------IPK..-----------------------------
A5G2K4_ACICJ/57-224----------------------------------------------IEL.F-----------------------------
A7IG69_XANP2/53-223----------------------------------------------LAL.F-----------------------------
Q11LF2_MESSB/52-222----------------------------------------------IAL.F-----------------------------
A4AAA4_9GAMM/47-215----------------------------------------------CEA.L-----------------------------
A1SVG8_PSYIN/32-224----------------------------------------------RQE.A-----------------------------
Q13MB1_BURXL/35-192----------------------------------------------RAR.F-----------------------------
B7KPU3_METC4/37-194----------------------------------------------VAE.F-----------------------------
A4JSB8_BURVG/35-192----------------------------------------------LDA.F-----------------------------
Q5FR86_GLUOX/37-194----------------------------------------------LKALF-----------------------------
Q5NRL0_ZYMMO/38-194----------------------------------------------VSQ.F-----------------------------
A0YX69_LYNSP/37-194----------------------------------------------ISQ.F-----------------------------
A7AFE0_9PORP/35-192----------------------------------------------ILQ.F-----------------------------
A6L9J6_PARD8/35-192----------------------------------------------LAT.F-----------------------------
Q89ZC0_BACTN/36-193----------------------------------------------IEQ.F-----------------------------
Q7MVA4_PORGI/45-204----------------------------------------------VAR.F-----------------------------
A8EQR6_ARCB4/36-193----------------------------------------------FET.F-----------------------------
Q7UNF1_RHOBA/60-220----------------------------------------------LQQ.F-----------------------------
A4A1Q0_9PLAN/35-199----------------------------------------------VAH.F-----------------------------
A6C2P5_9PLAN/41-201----------------------------------------------TEQ.F-----------------------------
A7HA96_ANADF/35-195----------------------------------------------LAQ.L-----------------------------
A3HYU9_9BACT/34-186----------------------------------------------VTV.F-----------------------------
A5FC57_FLAJ1/36-194----------------------------------------------LET.Y-----------------------------
A6EK39_9SPHI/35-193----------------------------------------------VSV.F-----------------------------
A1S8E1_SHEAM/19-189----------------------------------------------AMP.T-----------------------------
A3D2A5_SHEB5/34-189----------------------------------------------VGQ.F-----------------------------
O29447_ARCFU/59-271----------------------------------------------IDK.A-----------------------------
Q97B66_THEVO/50-280----------------------------------------------VKR.T-----------------------------
A8MDI5_CALMQ/50-279----------------------------------------------VDK.A-----------------------------
A4WI65_PYRAR/50-279----------------------------------------------IEE.T-----------------------------
A2BLD6_HYPBU/71-302----------------------------------------------IDM.A-----------------------------
Q9YFI8_AERPE/68-298----------------------------------------------VER.A-----------------------------
B8FYL0_DESHD/68-297----------------------------------------------LAQ.A-----------------------------
A6EK38_9SPHI/68-287----------------------------------------------LLQ.F-----------------------------
A7HA97_ANADF/64-283----------------------------------------------LEE.F-----------------------------
A8G0A4_SHESH/69-288----------------------------------------------LEE.F-----------------------------
Q7MVA5_PORGI/38-257----------------------------------------------LLR.F-----------------------------
A0YX67_LYNSP/67-286----------------------------------------------LEQ.F-----------------------------
C0A2Z5_9BACT/67-291----------------------------------------------LPQ.V-----------------------------
Q47F70_DECAR/78-303----------------------------------------------LEQ.L-----------------------------
Q1CV19_HELPH/71-295----------------------------------------------LEL.F-----------------------------
Q5HX91_CAMJR/68-293----------------------------------------------LLE.F-----------------------------
A3Q5V5_MYCSJ/79-302----------------------------------------------LDE.L-----------------------------
Q6ABE1_PROAC/94-322----------------------------------------------LVE.A-----------------------------
A5TJP2_BURML/67-292----------------------------------------------LEM.F-----------------------------
Q47IA5_DECAR/76-304----------------------------------------------LDI.F-----------------------------
Q62B92_BURMA/72-300----------------------------------------------LER.Y-----------------------------
A1B665_PARDP/69-294----------------------------------------------LEM.F-----------------------------
A5G2K5_ACICJ/68-296----------------------------------------------LER.Y-----------------------------
A4AAA5_9GAMM/71-297----------------------------------------------LET.F-----------------------------
A0LED1_SYNFM/69-293----------------------------------------------LDR.L-----------------------------
A5V1N8_ROSS1/68-292----------------------------------------------LVR.L-----------------------------
Q67TB4_SYMTH/77-301----------------------------------------------LKQ.A-----------------------------
Q1ARS4_RUBXD/86-314----------------------------------------------LGQ.M-----------------------------
Q01UG1_SOLUE/67-291----------------------------------------------LEE.F-----------------------------
A6EBI6_9SPHI/68-292----------------------------------------------LPE.F-----------------------------
Q1IN28_KORVE/68-293----------------------------------------------LEE.F-----------------------------
Q72IY0_THET2/68-291----------------------------------------------LEL.A-----------------------------
A6FAG4_9GAMM/68-293----------------------------------------------LHQ.L-----------------------------
Q4MSC6_BACCE/70-293----------------------------------------------LME.L-----------------------------
LUTB_BACLD/70-295----------------------------------------------LEQ.L-----------------------------
LUTB_OCEIH/70-294----------------------------------------------LHQ.L-----------------------------
Q6D5W9_ERWCT/70-294----------------------------------------------LYQ.L-----------------------------
Q81ND6_BACAN/69-293----------------------------------------------LEQ.L-----------------------------
Q24VR1_DESHY/69-293----------------------------------------------LDM.L-----------------------------
O69147_LACLC/4-174----------------------------------------------LVS.L-----------------------------
A5VIG9_LACRD/70-294----------------------------------------------LEE.F-----------------------------
B9LU44_HALLT/67-296----------------------------------------------IDE.V-----------------------------
Q3ISD5_NATPD/64-299----------------------------------------------IEE.V-----------------------------
A5GDG8_GEOUR/64-287----------------------------------------------AAA.F-----------------------------
A5D031_PELTS/65-292----------------------------------------------AER.F-----------------------------
Q3AEY7_CARHZ/62-279----------------------------------------------VEQ.F-----------------------------
Q24W82_DESHY/65-292----------------------------------------------IEQ.F-----------------------------
Q8RIN1_FUSNN/65-294----------------------------------------------IAE.F-----------------------------
A1HPY0_9FIRM/68-298----------------------------------------------ADR.F-----------------------------
Q726S3_DESVH/69-294----------------------------------------------YAQ.F-----------------------------
Q74CQ3_GEOSL/61-280----------------------------------------------VKE.F-----------------------------
A4J1M6_DESRM/66-295----------------------------------------------ISK.A-----------------------------
A5UNQ3_METS3/51-284----------------------------------------------MDI.A-----------------------------
O26243_METTH/51-280----------------------------------------------IAG.A-----------------------------
A4J1M5_DESRM/47-258----------------------------------------------VGR.A-----------------------------

PF01812

MTHFS_HUMAN/10-198----------------------------------------------KRSLR-----------------------------
Q9SRE0_ARATH/92-290----------------------------------------------KWVIR-----------------------------
Q9Z5G2_MYCLE/6-186----------------------------------------------KATLR-----------------------------
O84655_CHLTR/8-178----------------------------------------------KRCLR-----------------------------
MTHFS_CAEEL/8-197----------------------------------------------KSELR-----------------------------
YQGN_BACSU/2-179----------------------------------------------KSQLR-----------------------------
MTHFS_MYCGE/4-164----------------------------------------------KNSLR-----------------------------
O83692_TREPA/4-207----------------------------------------------KQNAR-----------------------------
Q9RKA5_STRCO/12-197----------------------------------------------KRLLR-----------------------------
Y858_HAEIN/6-187----------------------------------------------RQQIR-----------------------------
Q9RTF0_DEIRA/10-175----------------------------------------------KAEWR-----------------------------
MTHFS_RABIT/10-198----------------------------------------------KRSLR-----------------------------
O68985_CHLTP/8-188----------------------------------------------KPELR-----------------------------
O66124_STRMU/3-175----------------------------------------------KKDYR-----------------------------
Q9Z7E3_CHLPN/8-180----------------------------------------------KSALR-----------------------------
O26306_METTH/134-322----------------------------------------------DGGER-----------------------------
MTHFS_MYCPN/3-163----------------------------------------------KNALR-----------------------------
FTHC_YEAST/4-203----------------------------------------------KQLLR-----------------------------
Q9YFU3_AERPE/7-205----------------------------------------------KQAIR-----------------------------
Q9VN21_DROME/34-232----------------------------------------------KRSLR-----------------------------
P73038_SYNY3/3-179----------------------------------------------KAQLR-----------------------------
O67621_AQUAE/3-175----------------------------------------------KSELR-----------------------------
Q9ZD82_RICPR/3-172----------------------------------------------KQELR-----------------------------
O05575_MYCTU/6-186----------------------------------------------KSALR-----------------------------

PF13336

Q7P6F4_FUSNV/274-427--------------------------------------------------------------------YDYI.....D..
A6LV90_CLOB8/275-428--------------------------------------------------------------------YDYV.....N..
B8F9H4_DESAA/272-425--------------------------------------------------------------------YKFV.....H..
Q7MWD3_PORGI/273-426--------------------------------------------------------------------YHFI.....D..
C8PQ47_9SPIO/40-192--------------------------------------------------------------------YDFV.....N..
B8CZD4_HALOH/271-424--------------------------------------------------------------------YEFL.....D..
C6Q2N6_9CLOT/272-425--------------------------------------------------------------------YDFI.....D..
C0GK20_9FIRM/271-424--------------------------------------------------------------------YDFM.....D..
C6JPC5_FUSVA/273-426--------------------------------------------------------------------YDYV.....D..
C2MAG5_9PORP/269-422--------------------------------------------------------------------YDFA.....H..
B9E5E2_CLOK1/272-425--------------------------------------------------------------------YDFV.....N..
Q3ACH6_CARHZ/275-428--------------------------------------------------------------------YSFL.....N..
D2QBR0_SPILD/268-420--------------------------------------------------------------------YDFI.....D..
D7BE02_MEISD/284-437--------------------------------------------------------------------YRFV.....H..
D3LSY0_9FIRM/272-426--------------------------------------------------------------------YDFI.....D..
B1CB66_9FIRM/271-424--------------------------------------------------------------------YEFV.....H..
Q898H0_CLOTE/272-425--------------------------------------------------------------------YDFV.....D..
A0L8K8_MAGSM/267-420--------------------------------------------------------------------YDYV.....D..
Q2QB25_9FIRM/277-430--------------------------------------------------------------------YDFA.....D..
A5N390_CLOK5/276-429--------------------------------------------------------------------YDFI.....N..
Q0HH24_SHESM/288-441--------------------------------------------------------------------YDYV.....D..
C2MDZ9_9PORP/277-430--------------------------------------------------------------------YDFF.....D..
Q15V19_PSEA6/267-420--------------------------------------------------------------------YDFV.....D..
Q39QG7_GEOMG/278-431--------------------------------------------------------------------YEFM.....N..
B3QTM9_CHLT3/265-417--------------------------------------------------------------------YDFI.....D..
B2RM12_PORG3/273-426--------------------------------------------------------------------YDFV.....N..
A9AXP3_HERA2/264-416--------------------------------------------------------------------YDFV.....D..
C7GYK3_9FIRM/272-430--------------------------------------------------------------------YDFV.....N..
Q8CXQ9_LEPIN/270-422--------------------------------------------------------------------YDFI.....D..
A5URR7_ROSS1/272-425--------------------------------------------------------------------FDWA.....H..
Q24WU2_DESHY/311-467--------------------------------------------------------------------YDFL.....H..
C3JA15_9PORP/269-422--------------------------------------------------------------------YDFV.....N..
C7M4J2_CAPOD/265-417--------------------------------------------------------------------YDFI.....D..
Q5QXA2_IDILO/264-417--------------------------------------------------------------------YDFV.....D..
B9M8N9_GEOSF/274-427--------------------------------------------------------------------YDFI.....D..
B9M9H7_GEOSF/264-417--------------------------------------------------------------------YDFV.....D..
Q9RM86_CLOAM/272-430--------------------------------------------------------------------YDFA.....A..
A7H923_ANADF/265-417--------------------------------------------------------------------YDFL.....H..
A3WLS5_9GAMM/264-417--------------------------------------------------------------------YDFV.....D..
C7RL22_ACCPU/274-427--------------------------------------------------------------------YRFM.....H..
Q3ANX0_CHLCH/266-418--------------------------------------------------------------------YDFV.....D..
B7RTW3_9GAMM/266-419--------------------------------------------------------------------YRFV.....D..
B7R990_9THEO/272-425--------------------------------------------------------------------YDFI.....D..
A0M1A3_GRAFK/267-419--------------------------------------------------------------------YDFV.....D..
Q0IG02_AEDAE/314-468--------------------------------------------------------------------YDFV.....D..
D1C4I7_SPHTD/264-417--------------------------------------------------------------------FSFV.....D..
A7HKG2_FERNB/273-426--------------------------------------------------------------------YEFL.....D..
C3J9R5_9PORP/273-426--------------------------------------------------------------------YKFL.....Q..
A6GWR2_FLAPJ/265-417--------------------------------------------------------------------YDFV.....N..
A8F649_THELT/274-427--------------------------------------------------------------------YQFI.....D..
B5ECU8_GEOBB/278-431--------------------------------------------------------------------YEFM.....H..
A1KBF4_AZOSB/272-425--------------------------------------------------------------------YRHL.....H..
Q2LSP1_SYNAS/286-439--------------------------------------------------------------------YEYI.....H..
A4ASU6_MARSH/266-418--------------------------------------------------------------------YDFM.....D..
Q01VE3_SOLUE/270-423--------------------------------------------------------------------FDFI.....D..
B5E7S1_GEOBB/278-431--------------------------------------------------------------------FDFM.....H..
B2TLD8_CLOBB/272-425--------------------------------------------------------------------YDFL.....D..
A0B6T6_METTP/284-437--------------------------------------------------------------------YEYI.....H..
C0CQX9_9FIRM/274-427--------------------------------------------------------------------YDCL.....D..
Q2BRL2_9GAMM/269-422--------------------------------------------------------------------YDFV.....D..
A4J1E7_DESRM/279-435--------------------------------------------------------------------YDFI.....N..
A3P7E3_BURP0/286-437--------------------------------------------------------------------YDFI.....H..
A7FIQ3_YERP3/283-434--------------------------------------------------------------------YEYL.....N..
B8FV23_DESHD/273-426--------------------------------------------------------------------YDYI.....H..
A1ZWE1_9BACT/265-417--------------------------------------------------------------------YDFI.....D..
C9XLC1_CLODC/271-427--------------------------------------------------------------------YDFA.....N..
D6Z2N5_DESAT/282-435--------------------------------------------------------------------YDFV.....N..
Q1IT47_KORVE/273-426--------------------------------------------------------------------YDYV.....R..
C5EQI6_9FIRM/275-428--------------------------------------------------------------------YEFI.....D..
B5Y607_COPPD/273-426--------------------------------------------------------------------YDFV.....D..
D3FVG7_BACPE/268-421--------------------------------------------------------------------YDFM.....D..
Q0AVM5_SYNWW/279-434--------------------------------------------------------------------YDYI.....D..
Q2FRF0_METHJ/278-431--------------------------------------------------------------------YEFM.....D..
D9TPZ5_THETC/317-464--------------------------------------------------------------------YTNI.....N..
B2A2S6_NATTJ/273-426--------------------------------------------------------------------YDFL.....D..
Q7Z0V8_ARTSF/277-430--------------------------------------------------------------------YDFL.....D..
B9JLD2_AGRRK/284-435--------------------------------------------------------------------YDFL.....N..
A3HTS6_9BACT/267-419--------------------------------------------------------------------YDAV.....H..
B8KH63_9GAMM/265-418--------------------------------------------------------------------YAYV.....D..
A9GMK9_SORC5/277-430--------------------------------------------------------------------YAWA.....H..
C7PPM1_CHIPD/268-420--------------------------------------------------------------------YDFV.....N..
C0QJK6_DESAH/274-427--------------------------------------------------------------------YDYV.....D..
B3P805_DROER/312-466--------------------------------------------------------------------YDFV.....D..
D2VMT8_NAEGR/323-475--------------------------------------------------------------------YDFV.....D..
B2HRD6_MYCMM/288-439--------------------------------------------------------------------YEFM.....D..
A9BH20_PETMO/279-432--------------------------------------------------------------------YEFI.....D..
B0P1X4_9CLOT/279-435--------------------------------------------------------------------YDYL.....N..
C0W9X2_9FIRM/281-437--------------------------------------------------------------------YDYV.....D..
B8FWN2_DESHD/279-435--------------------------------------------------------------------YDFI.....N..
D1N3Y0_9BACT/300-452--------------------------------------------------------------------YDFA.....H..
Q0AW71_SYNWW/272-425--------------------------------------------------------------------YDFL.....D..
B1C6G2_9FIRM/280-436--------------------------------------------------------------------YDYL.....D..
Q4A5M6_MYCS5/287-438--------------------------------------------------------------------YEEL.....H..
A4J4L6_DESRM/279-435--------------------------------------------------------------------YDFI.....D..
E6VZH2_DESAO/276-429--------------------------------------------------------------------FDFM.....H..
C5ENP0_9FIRM/279-432--------------------------------------------------------------------YDFM.....D..
Q220T6_RHOFD/272-425--------------------------------------------------------------------YQFM.....D..
A4AMZ0_MARSH/269-421--------------------------------------------------------------------YDFI.....N..
D4IP35_9BACT/266-418--------------------------------------------------------------------YDYM.....D..
C6E210_GEOSM/283-439--------------------------------------------------------------------YDWA.....H..
A1U877_MARAV/284-436--------------------------------------------------------------------YDFL.....D..
D3LTM8_9FIRM/278-434--------------------------------------------------------------------YDFI.....D..
D4J7D4_9FIRM/278-438--------------------------------------------------------------------YDFI.....N..
D2VCN4_NAEGR/199-351--------------------------------------------------------------------FDFV.....D..
C6X0M3_FLAB3/276-428--------------------------------------------------------------------YDYI.....D..
C0QKC6_DESAH/273-426--------------------------------------------------------------------YDYV.....D..
C8VZ55_DESAS/277-433--------------------------------------------------------------------YDFM.....D..
C0QAD0_DESAH/281-437--------------------------------------------------------------------YDFI.....N..
A0LMU1_SYNFM/292-445--------------------------------------------------------------------YDFV.....D..
A9NFJ4_ACHLI/270-431--------------------------------------------------------------------YDFL.....N..
C0ESI0_9FIRM/299-455--------------------------------------------------------------------YDYL.....D..
B8FDQ1_DESAA/279-432--------------------------------------------------------------------YRQV.....D..
Q3A1S1_PELCD/278-433--------------------------------------------------------------------YDFL.....H..
Q21W64_RHOFD/279-435--------------------------------------------------------------------YDFL.....D..
B8F9D7_DESAA/274-430--------------------------------------------------------------------YEFI.....D..
A4J5F7_DESRM/278-434--------------------------------------------------------------------YDFV.....H..
D3TLS8_GLOMM/312-466--------------------------------------------------------------------YDYV.....H..
A8MLT0_ALKOO/317-464--------------------------------------------------------------------HENM.....K..
D0Z2A1_LISDA/272-429--------------------------------------------------------------------IDFV.....D..
A4J1H7_DESRM/278-434--------------------------------------------------------------------YEFM.....D..
A6NQA1_9FIRM/281-437--------------------------------------------------------------------YDFI.....N..
Q0AW62_SYNWW/282-438--------------------------------------------------------------------WKYI.....D..
B0MTL0_9BACT/270-422--------------------------------------------------------------------YDFI.....D..
Q1VQ25_9FLAO/298-450--------------------------------------------------------------------YNFI.....D..
A8ZXP1_DESOH/277-430--------------------------------------------------------------------YRYV.....D..
Q0AZT0_SYNWW/278-433--------------------------------------------------------------------YDFI.....D..
A2SP55_METPP/278-433--------------------------------------------------------------------YDTI.....D..
D3LTH5_9FIRM/277-433--------------------------------------------------------------------YEFL.....H..
D4KHS0_9FIRM/319-466--------------------------------------------------------------------YENI.....K..
Q2RRD2_RHORT/322-473--------------------------------------------------------------------YEFM.....D..
C7H5K4_9FIRM/279-436--------------------------------------------------------------------YDYL.....N..
A0LHR8_SYNFM/278-431--------------------------------------------------------------------YSFV.....H..
Q18599_CAEEL/306-460--------------------------------------------------------------------YDYL.....N..
A7SYK6_NEMVE/323-477--------------------------------------------------------------------FEFI.....D..
Q0AXU7_SYNWW/280-436--------------------------------------------------------------------YNFM.....D..
C4Z8H6_EUBR3/279-435--------------------------------------------------------------------YDYL.....D..
D3LT91_9FIRM/318-465--------------------------------------------------------------------YDRI.....D..
Q1Z538_PHOPR/273-428--------------------------------------------------------------------IDYI.....D..
B1C6E5_9FIRM/281-437--------------------------------------------------------------------YDFV.....D..
D1B8D5_THEAS/325-472--------------------------------------------------------------------YANM.....D..
C6EUD4_FASHE/313-467--------------------------------------------------------------------FDFL.....D..
Q0B052_SYNWW/278-434--------------------------------------------------------------------YNFL.....D..
B7QJI4_IXOSC/314-468--------------------------------------------------------------------FDFM.....N..
Q6AQI5_DESPS/285-438--------------------------------------------------------------------YDYI.....D..
D3FFX7_MYCGH/280-431--------------------------------------------------------------------YKYL.....D..
C3W9K1_FUSMR/279-435--------------------------------------------------------------------YEYL.....N..
A8SVH6_9FIRM/278-433--------------------------------------------------------------------YEWL.....D..
B0TCP9_HELMI/277-433--------------------------------------------------------------------YDFL.....D..
A4J446_DESRM/283-434--------------------------------------------------------------------YQFI.....N..
B3QBE4_RHOPT/324-471--------------------------------------------------------------------LRNL.....D..
D1RF94_LEGLO/281-431--------------------------------------------------------------------YDFI.....N..
D2XBL0_9BACT/272-425--------------------------------------------------------------------YEFC.....H..
C0QDJ7_DESAH/279-431--------------------------------------------------------------------YDFL.....D..
A6F750_9GAMM/274-429--------------------------------------------------------------------IDYV.....H..
B4W710_9CAUL/282-433--------------------------------------------------------------------YDFL.....D..
A1HP35_9FIRM/320-467--------------------------------------------------------------------YANI.....A..
A0R5U0_MYCS2/274-430--------------------------------------------------------------------YEWL.....D..
B0N003_9BACT/267-419--------------------------------------------------------------------YEYM.....D..
A8U4X9_9LACT/266-423--------------------------------------------------------------------YDFS.....G..
C2BE93_9FIRM/280-436--------------------------------------------------------------------YDYI.....D..
Q2LPI7_SYNAS/276-429--------------------------------------------------------------------YELM.....D..
D1YS72_9FIRM/320-467--------------------------------------------------------------------YANI.....D..
A8U750_9LACT/270-423--------------------------------------------------------------------YEFM.....N..
D4CC53_9CLOT/291-448--------------------------------------------------------------------YRWL.....D..
A8WP03_CAEBR/305-459--------------------------------------------------------------------YKKI.....D..
D1Y3R2_9BACT/278-433--------------------------------------------------------------------YDWV.....D..
B2W452_PYRTR/302-453--------------------------------------------------------------------YDNW.....D..
Q0RWG8_RHOSR/538-685--------------------------------------------------------------------TSNI.....D..
B0RN66_XANCB/323-470--------------------------------------------------------------------KRNI.....D..
B6WBS6_9FIRM/278-434--------------------------------------------------------------------YDFI.....D..
A1TGQ6_MYCVP/271-426--------------------------------------------------------------------YAWL.....D..
A5E2Y9_LODEL/243-394--------------------------------------------------------------------YANW.....D..
A7HPG3_PARL1/328-491--------------------------------------------------------------------YEKLRAMPQE..
D2RM64_ACIFV/277-437--------------------------------------------------------------------YRFL.....H..
B0SDE8_LEPBA/320-467--------------------------------------------------------------------HENI.....S..
Q0AY76_SYNWW/278-434--------------------------------------------------------------------YDFI.....D..
O29120_ARCFU/297-457--------------------------------------------------------------------YEYL.....D..
Q2SL76_HAHCH/439-606--------------------------------------------------------------------YDML.....HGL
Q39MJ3_BURS3/277-426--------------------------------------------------------------------RRFA.....H..
ACH1_YARLI/333-484--------------------------------------------------------------------FDNW.....D..
O28424_ARCFU/289-449--------------------------------------------------------------------YDFL.....D..
A7HD82_ANADF/326-473--------------------------------------------------------------------NKNI.....E..
D1VTU7_9FIRM/278-435--------------------------------------------------------------------YEFL.....D..
C8PKJ5_9PROT/322-468--------------------------------------------------------------------QKNI.....D..
C5DU17_ZYGRC/331-482--------------------------------------------------------------------FKNW.....D..
D4JBB9_9FIRM/276-431--------------------------------------------------------------------YDFM.....D..
B5EIE5_GEOBB/327-478--------------------------------------------------------------------YDNW.....D..
C9LNB4_9FIRM/338-485--------------------------------------------------------------------HANI.....E..
B0DKN0_LACBS/350-501--------------------------------------------------------------------YANW.....A..
B6K306_SCHJY/330-481--------------------------------------------------------------------FNNW.....D..
ACH1_SCHPO/330-481--------------------------------------------------------------------YSNY.....D..
C9QLV8_VIBOR/273-428--------------------------------------------------------------------MDFL.....D..
A0LG92_SYNFM/280-432--------------------------------------------------------------------YEFL.....H..
Q74GS1_GEOSL/327-478--------------------------------------------------------------------YGDW.....D..
A5V7D2_SPHWW/272-423--------------------------------------------------------------------YDWI.....A..
B3QA43_RHOPT/260-409--------------------------------------------------------------------YRFA.....H..
Q0AV35_SYNWW/283-439--------------------------------------------------------------------YDYI.....S..
D2V812_NAEGR/332-483--------------------------------------------------------------------YADW.....D..
C6RKT5_ACIRA/265-414--------------------------------------------------------------------HQFV.....H..
D2RN63_ACIFV/277-434--------------------------------------------------------------------YDWL.....Q..
B6BXE3_9GAMM/420-583--------------------------------------------------------------------YNFLRGLKKE..
B9M8L3_GEOSF/333-484--------------------------------------------------------------------LANW.....E..
Q6LQ13_PHOPR/472-639--------------------------------------------------------------------YEAL.....NTM
A8ZWK6_DESOH/447-610--------------------------------------------------------------------YAYLRRMSEE..
A1W2A3_ACISJ/277-426--------------------------------------------------------------------RRWA.....H..
E8WNL5_GEOS8/334-485--------------------------------------------------------------------FGQW.....E..
A6F2B7_9ALTE/443-610--------------------------------------------------------------------YQRLRDLSPH..
C6E1J1_GEOSM/332-483--------------------------------------------------------------------FDNM.....E..
B1KCQ5_BURCC/265-415--------------------------------------------------------------------HAFA.....H..
B6JG54_OLICO/334-497--------------------------------------------------------------------YRALREMPPD..
Q48PY5_PSE14/293-456--------------------------------------------------------------------YERLRELPAE..
B7X026_COMTE/264-413--------------------------------------------------------------------RRWA.....H..
Q0VNK9_ALCBS/436-599--------------------------------------------------------------------YARLLEMSKQ..
A6GMY9_9BURK/440-605--------------------------------------------------------------------YNTL.....KNM
D3BTR1_POLPA/348-499--------------------------------------------------------------------FNNW.....K..
B8FMI7_DESAA/441-604--------------------------------------------------------------------YDFLRDMSDE..
B7RUX5_9GAMM/428-591--------------------------------------------------------------------YNKLC..ALD..
C0WBA5_9FIRM/277-434--------------------------------------------------------------------YQWL.....N..
A3X024_9BRAD/334-497--------------------------------------------------------------------YRALREMTPD..
D2I933_9PSED/265-414--------------------------------------------------------------------AQFA.....H..
ACH1_DICDI/341-492--------------------------------------------------------------------FNNW.....E..
Q7WPS8_BORBR/266-415--------------------------------------------------------------------RKWA.....H..
Q0BZS7_HYPNA/258-410--------------------------------------------------------------------YARM.....A..
B5JUR7_9GAMM/382-545--------------------------------------------------------------------YQWL.....R..
Q1DA17_MYXXD/323-474--------------------------------------------------------------------LDMF.....E..
A4BC21_9GAMM/441-604--------------------------------------------------------------------YEDLRRMDDE..
A1SHN0_NOCSJ/246-396--------------------------------------------------------------------LEWV.....D..
C0QKG0_DESAH/440-603--------------------------------------------------------------------YTELREMDDD..
B4W858_9CAUL/256-409--------------------------------------------------------------------YAWA.....A..
D4HE27_PROAS/229-379--------------------------------------------------------------------YEWL.....D..
Q88CB5_PSEPK/319-482--------------------------------------------------------------------YQRLREMPLE..
A8ZT97_DESOH/278-429--------------------------------------------------------------------YEFV.....H..
A6FHC1_9GAMM/461-628--------------------------------------------------------------------YKALNTMTED..
D0LM00_HALO1/437-597--------------------------------------------------------------------FERLRALPEA..
Q0RK43_FRAAA/215-365--------------------------------------------------------------------YGWV.....D..
D1A9C8_THECD/271-421--------------------------------------------------------------------YAWM.....H..
Q2JCQ5_FRASC/281-431--------------------------------------------------------------------YSWA.....H..
Q0C1R5_HYPNA/318-481--------------------------------------------------------------------YQDLRD.APD..
C1BAX8_RHOOB/254-402--------------------------------------------------------------------YDRL.....P..
C7LYG5_ACIFD/255-405--------------------------------------------------------------------YAWA.....D..
B5WIH5_9BURK/265-416--------------------------------------------------------------------YDFL.....D..
Q8PH95_XANAC/342-506--------------------------------------------------------------------YQWL.....R..
D2UEK6_XANAP/366-529--------------------------------------------------------------------YAWLREMDSQ..
Q1YGK6_MOBAS/339-501--------------------------------------------------------------------YARLREMAPE..
Q0FWB7_9RHOB/199-349--------------------------------------------------------------------YRWV.....D..
C1B5D3_RHOOB/255-406--------------------------------------------------------------------YDFV.....D..
B8FN92_DESAA/282-434--------------------------------------------------------------------MDWL.....D..
A3TKM8_9MICO/259-409--------------------------------------------------------------------MSWL.....H..
B8L3Z6_9GAMM/367-531--------------------------------------------------------------------YEWLRTLPED..
C0QDF6_DESAH/275-427--------------------------------------------------------------------MAWL.....D..
C0QHQ8_DESAH/271-423--------------------------------------------------------------------MAWL.....D..

PF04223

Q99ZK7_STRP1/45-510SGLRDKVGAAISEGLMENPVVIRSHGGRARAIASGDIHIDVAFLGAPSSDAYGNVNGTKGKATCGSLGYAMIDAKYAD--
Q9CGA7_LACLA/46-510SGMRGTLGDVVSHGALKNPVIFRSHGGRARAIETGEIHIDVAFLGTPNADEMGNANGMDGKAPFGSLGYALMDAQYAD--
CILA_HAEIN/33-498SGLRGELAEQISRGLLNEPVNIHSHGGRVHLVKSGELKIDVAFLGVPCCDTFGNANGFTGKSKCGSLGYARVDAEYAD--
CILA_ECOLI/43-508SGLRGPLAEEISRGLLAEPVQIHSHGGRVHLVQSGELNIDVAFLGVPSCDEFGNANGYTGKACCGSLGYAIVDADNAK--
Q9KTT9_VIBCH/66-531SGIRGALADSISNGLLDEPVHIHSHGGRVHLIQSGELYIDMAFIGVPCCDEFGNANGFKGKSNCGSLGYAKVDAEHAE--

PF01144

SCOA_XANCP/13-225--------------------------------------------------------------------AK----------
GCTB_ACIFV/10-224--------------------------------------------------------------------QA----------
PCAJ_PSEPU/9-206--------------------------------------------------------------------MA----------
GCTA_ACIFV/4-241--------------------------------------------------------------------LK----------
Q9Y916_AERPE/14-262--------------------------------------------------------------------AE----------
SCOT_CAEEL/300-499--------------------------------------------------------------------IA----------
SCOB_HELPY/2-198--------------------------------------------------------------------II----------
YODS_BACSU/7-219--------------------------------------------------------------------ID----------
Q9RZA0_DEIRA/23-234--------------------------------------------------------------------AQ----------
ATOA_HAEIN/4-200--------------------------------------------------------------------IA----------
CTFA_CLOAB/5-216--------------------------------------------------------------------FE----------
PCAI_PSEPU/6-219--------------------------------------------------------------------IA----------
CTFB_CLOAB/9-205--------------------------------------------------------------------IA----------
PCAI_ACIAD/6-219--------------------------------------------------------------------LT----------
Q9ZAM2_SPHSX/6-218--------------------------------------------------------------------PG----------
SCOT1_HUMAN/43-272--------------------------------------------------------------------PV----------
SCOA_MYCTU/5-234--------------------------------------------------------------------AA----------
Q973S5_SULTO/3-202--------------------------------------------------------------------VS----------
Q9RZ86_DEIRA/5-217--------------------------------------------------------------------AA----------
SCOA_BACSU/5-216--------------------------------------------------------------------SK----------
PCAJ_ACIAD/8-206--------------------------------------------------------------------IA----------
SCOT1_HUMAN/302-501--------------------------------------------------------------------II----------
YDIF_ECOLI/15-253--------------------------------------------------------------------AQ----------
SCOT_CAEEL/40-271--------------------------------------------------------------------AE----------
Q9KHD5_STRGR/16-242--------------------------------------------------------------------PD----------
SCOB_BACSU/5-202--------------------------------------------------------------------MV----------
Q9XAM7_STRCO/5-234--------------------------------------------------------------------AG----------
Y1199_ARCFU/148-369--------------------------------------------------------------------AE----------
Q8PDH3_XANCP/7-217--------------------------------------------------------------------MT----------
Q8RGS9_FUSNN/11-226--------------------------------------------------------------------QA----------
SCOA_HELPY/5-216--------------------------------------------------------------------LD----------
ATOD_HAEIN/5-216--------------------------------------------------------------------LN----------
Q8F685_LEPIN/8-247--------------------------------------------------------------------PD----------
Y3551_MYCTU/5-233--------------------------------------------------------------------LD----------
Q9W058_DROME/37-266--------------------------------------------------------------------AI----------
Q97Z51_SULSO/6-206--------------------------------------------------------------------VI----------
SCOB_MYCTU/8-205--------------------------------------------------------------------MA----------
ATOA_ECOLI/4-198--------------------------------------------------------------------IA----------
ATOD_ECOLI/5-216--------------------------------------------------------------------LQ----------
CATJ_PSESB/7-217--------------------------------------------------------------------MT----------
Q9RPK0_CLOBE/4-215--------------------------------------------------------------------LT----------
Q98EM4_RHILO/9-219--------------------------------------------------------------------MT----------
Q92TL1_RHIME/7-217--------------------------------------------------------------------MT----------

PF00455

Q98FV5_RHILO/85-241--------------------------------------------------------------------IA----------
A9CFA5_AGRT5/77-236--------------------------------------------------------------------IA----------
D2AF69_SHIF2/74-232--------------------------------------------------------------------IA----------
A3GRG9_VIBCL/64-222--------------------------------------------------------------------IA----------
C1HRF0_9ESCH/77-237--------------------------------------------------------------------IA----------
B2TV88_SHIB3/73-234--------------------------------------------------------------------AA----------
Q74VM8_YERPE/40-201--------------------------------------------------------------------IG----------
A9CH78_AGRT5/77-238--------------------------------------------------------------------AC----------
Q98JJ0_RHILO/75-236--------------------------------------------------------------------AC----------
Q8EUZ1_MYCPE/76-234--------------------------------------------------------------------IA----------
C8JX63_LISMN/77-238--------------------------------------------------------------------IA----------
Q98AQ9_RHILO/73-233--------------------------------------------------------------------IA----------
Q981R3_RHILO/73-234--------------------------------------------------------------------IA----------
A5LBQ8_STRPN/73-236--------------------------------------------------------------------IA----------
F0K641_CLOAE/74-233--------------------------------------------------------------------AA----------
F0K625_CLOAE/77-236--------------------------------------------------------------------VA----------
F0K630_CLOAE/77-236--------------------------------------------------------------------IA----------
B2IPU4_STRPS/76-235--------------------------------------------------------------------IA----------
A7X580_STAA1/74-235--------------------------------------------------------------------IA----------
Q8Y5F7_LISMO/73-231--------------------------------------------------------------------IA----------
D4G3X3_BACNA/71-232--------------------------------------------------------------------IA----------
Q8Y9Y5_LISMO/73-234--------------------------------------------------------------------IG----------
A1EKM8_VIBCL/74-235--------------------------------------------------------------------IA----------
E7HVG7_ECOLX/61-222--------------------------------------------------------------------IA----------
A1KUY5_NEIMF/73-235--------------------------------------------------------------------IA----------
F0AXV7_NEIME/73-235--------------------------------------------------------------------IA----------
Q89SG7_BRAJA/73-234--------------------------------------------------------------------IG----------
D1CVD5_9RHIZ/72-233--------------------------------------------------------------------IG----------
Q98M65_RHILO/72-233--------------------------------------------------------------------IG----------
A9CFT8_AGRT5/72-233--------------------------------------------------------------------IG----------
A6A9M5_VIBCL/30-192--------------------------------------------------------------------VA----------
B7LSC5_ESCF3/72-233--------------------------------------------------------------------IA----------
B0HA18_YERPE/72-233--------------------------------------------------------------------IA----------
A3KXL0_PSEAI/72-232--------------------------------------------------------------------IA----------
Q7VVL2_BORPE/73-234--------------------------------------------------------------------IA----------
Q8PQG4_XANAC/70-231--------------------------------------------------------------------IA----------
Q4UZR5_XANC8/75-236--------------------------------------------------------------------IA----------
F0KE27_CLOAE/66-227--------------------------------------------------------------------IA----------
A5L9H2_STRPN/66-228--------------------------------------------------------------------IV----------
E7JQT8_ECOLX/57-218--------------------------------------------------------------------LA----------
Q0TE54_ECOL5/35-195--------------------------------------------------------------------IA----------
ACCR_AGRT5/76-238--------------------------------------------------------------------IA----------
Q9X0F8_THEMA/72-234--------------------------------------------------------------------IA----------
A8A3I4_ECOHS/72-233--------------------------------------------------------------------IA----------
A6VF27_PSEA7/73-234--------------------------------------------------------------------IG----------
C6RV01_VIBCL/51-212--------------------------------------------------------------------LA----------
F0KD65_CLOAE/73-236--------------------------------------------------------------------IA----------
E8VCQ6_BACST/73-232--------------------------------------------------------------------IG----------
Q8EMN4_OCEIH/73-232--------------------------------------------------------------------IG----------
A6BYH2_YERPE/90-250--------------------------------------------------------------------IA----------
F0KE01_CLOAE/74-232--------------------------------------------------------------------IA----------
B1XGN1_ECODH/74-234--------------------------------------------------------------------IA----------
D8BZ57_ECOLX/76-237--------------------------------------------------------------------VA----------
D0JQZ5_YERP1/66-227--------------------------------------------------------------------IG----------
A0AL51_LISW6/73-233--------------------------------------------------------------------IA----------
B7R6U7_9THEO/72-233--------------------------------------------------------------------IA----------
F0K3P1_CLOAE/73-235--------------------------------------------------------------------IG----------
Q8R736_THETN/73-233--------------------------------------------------------------------IG----------
A5IQQ2_STAA9/74-233--------------------------------------------------------------------IA----------
Q8ES05_OCEIH/73-232--------------------------------------------------------------------IG----------
B2DGW4_STRPN/73-230--------------------------------------------------------------------LA----------
FRUR_BACSU/73-233--------------------------------------------------------------------IA----------
C8JQW1_LISMN/73-231--------------------------------------------------------------------IA----------
C8JX72_LISMN/73-234--------------------------------------------------------------------IA----------
D4G0K5_BACNA/73-233--------------------------------------------------------------------IA----------
Q8ESW8_OCEIH/74-234--------------------------------------------------------------------IA----------
E0DWD0_9RHIZ/59-219--------------------------------------------------------------------IA----------
E2PMQ2_9RHIZ/40-200--------------------------------------------------------------------MA----------
Q986N7_RHILO/99-259--------------------------------------------------------------------LA----------
Q988Q4_RHILO/54-215--------------------------------------------------------------------LA----------
D6EGH9_STRLI/73-234--------------------------------------------------------------------VA----------
A9CHG2_AGRT5/74-235--------------------------------------------------------------------LA----------
Q98GA9_RHILO/77-238--------------------------------------------------------------------IG----------
Q7D3J6_AGRT5/73-234--------------------------------------------------------------------IA----------
Q92UW3_RHIME/79-240--------------------------------------------------------------------IG----------
A3KS48_PSEAI/73-232--------------------------------------------------------------------VA----------
Q98BY9_RHILO/72-233--------------------------------------------------------------------IA----------
A7FKD3_YERP3/73-236--------------------------------------------------------------------IG----------
A5VTQ1_BRUO2/73-233--------------------------------------------------------------------IG----------
E2WXM3_ECOLX/61-221--------------------------------------------------------------------IG----------
C4HNN4_YERPE/24-184--------------------------------------------------------------------IG----------
Q986T2_RHILO/73-234--------------------------------------------------------------------IA----------
Q9RZP5_DEIRA/81-244--------------------------------------------------------------------LA----------
Q9K3L7_STRCO/72-240--------------------------------------------------------------------VA----------
Q9AD80_STRCO/61-222--------------------------------------------------------------------IA----------
D6EU29_STRLI/80-248--------------------------------------------------------------------IA----------
Q5UXV7_HALMA/71-231--------------------------------------------------------------------IA----------
Q5V513_HALMA/73-232--------------------------------------------------------------------IA----------
D6ELC2_STRLI/78-239--------------------------------------------------------------------IA----------
Q5YVT8_NOCFA/74-236--------------------------------------------------------------------IA----------
D6ETC7_STRLI/73-234--------------------------------------------------------------------IA----------

PF02550

O28424_ARCFU/3-199--------------------------------------------------------------------IS.P--------
O29120_ARCFU/9-201--------------------------------------------------------------------IS.P--------
P73661_SYNY3/6-196--------------------------------------------------------------------SQYP--------
ACH1_YEAST/12-230--------------------------------------------------------------------KE.A--------
SCPC_ECOLI/1-213--------------------------------------------------------------------AN..--------

PF01008

EI2BD_MOUSE/219-510--------------------------------------------------------------------IALL--------
EI2B2_METJA/22-292--------------------------------------------------------------------RAAA--------
EI2BB_YEAST/33-358--------------------------------------------------------------------LETL--------
MTNA_BACSU/49-337--------------------------------------------------------------------ITAA--------
MTNA_ARCFU/41-327--------------------------------------------------------------------AAGA--------
EI2BA_HUMAN/15-293--------------------------------------------------------------------VAAI--------
MTNA_SYNY3/51-343--------------------------------------------------------------------VAAA--------
MTNA_METTH/44-310--------------------------------------------------------------------VTAA--------
MTNA_CAEEL/66-357--------------------------------------------------------------------VVGS--------
EI2BA_CAEEL/15-293--------------------------------------------------------------------LATV--------
EI2BA_YEAST/15-292--------------------------------------------------------------------IAAI--------
EI2BD_YEAST/285-637--------------------------------------------------------------------IAML--------
MTNA_METJA/48-319--------------------------------------------------------------------VSAA--------
EI2BB_RABIT/27-333--------------------------------------------------------------------RETL--------
MTNA_YEAST/49-399--------------------------------------------------------------------IVGS--------
EI2BD_SCHPO/156-452--------------------------------------------------------------------IDLL--------
Q5V075_HALMA/195-460--------------------------------------------------------------------LRAL--------
EI2B2_ARCFU/15-284--------------------------------------------------------------------RFAA--------

PF04198

YJHU_ECOLI/63-323--------------------------------------------------------------------RAGG--------
Q9WWA6_AGRRK/83-337--------------------------------------------------------------------AGIG--------
Q9CKH2_PASMU/56-313--------------------------------------------------------------------ALVN--------
Q98GB2_RHILO/49-296--------------------------------------------------------------------PLGG--------
Q9RT33_DEIRA/86-346--------------------------------------------------------------------LAAA--------
Q986P9_RHILO/64-319--------------------------------------------------------------------IAGA--------
Q97L54_CLOAB/89-338--------------------------------------------------------------------RTAA--------
CGGR_BACMD/89-339--------------------------------------------------------------------RASV--------
Q9Z5C6_STAAU/89-337--------------------------------------------------------------------RQAG--------
O68117_RHOCA/59-314--------------------------------------------------------------------PAAA--------
Q9CGB1_LACLA/54-307--------------------------------------------------------------------KFAA--------
Q98CZ8_RHILO/62-317--------------------------------------------------------------------EAAA--------
Q97SS7_STRPN/56-313--------------------------------------------------------------------QVAA--------
Q9L0Z6_STRCO/89-343--------------------------------------------------------------------EVAA--------
O52721_KLEPN/59-312--------------------------------------------------------------------FGCY--------
O30830_RHOSH/62-317--------------------------------------------------------------------PTAA--------
Q9RGG7_LACCA/60-316--------------------------------------------------------------------VYAS--------
Q99XS9_STRP1/56-314--------------------------------------------------------------------KTAA--------
O86289_LEUME/54-309--------------------------------------------------------------------NFAA--------
O32754_9LACO/124-376--------------------------------------------------------------------EELN--------
Q9CLG2_PASMU/68-318--------------------------------------------------------------------IGAS--------
Q9ZB29_BRUAO/56-311--------------------------------------------------------------------HAGA--------
SORC_KLEPN/57-315--------------------------------------------------------------------QHGA--------
LSRR_ECOLI/66-316--------------------------------------------------------------------IGAA--------
Q9KER9_BACHD/57-313--------------------------------------------------------------------KATS--------
DEOR_BACSU/56-311--------------------------------------------------------------------RYGA--------
Q9KLX0_VIBCH/62-319--------------------------------------------------------------------GLVS--------
CGGR_BACSU/89-338--------------------------------------------------------------------RAAV--------
Q9K712_BACHD/89-338--------------------------------------------------------------------RACI--------
Q986M3_RHILO/57-311--------------------------------------------------------------------VLAA--------
Q98FV1_RHILO/42-296--------------------------------------------------------------------AKTG--------

PF01182

B5GBV6_9ACTO/16-220--------------------------------------------------------------------AARL--------
Q5NMF8_ZYMMO/15-209--------------------------------------------------------------------ADDI--------
A4S930_OSTLU/38-232--------------------------------------------------------------------CLEV--------
Q1N5N6_9GAMM/18-207--------------------------------------------------------------------GIML--------
B8HJV3_CYAP4/14-207--------------------------------------------------------------------LEIT--------
Q3SH15_THIDA/15-203--------------------------------------------------------------------ADAL--------
Q9GRG6_9TRYP/16-232--------------------------------------------------------------------CRKI--------
Q46TU2_CUPPJ/12-206--------------------------------------------------------------------ARAV--------
Q1YRK7_9GAMM/10-201--------------------------------------------------------------------TAKV--------
B4WRN6_9SYNE/15-208--------------------------------------------------------------------YDLT--------
D1BS91_XYLCX/15-219--------------------------------------------------------------------AARL--------
A3D4S3_SHEB5/16-206--------------------------------------------------------------------ASKI--------
B1XIZ0_SYNP2/14-205--------------------------------------------------------------------LRIV--------
B8GMY0_THISH/18-214--------------------------------------------------------------------ASEV--------
A9H335_GLUDA/20-218--------------------------------------------------------------------ARWL--------
C8X5S3_DESRD/27-227--------------------------------------------------------------------AEFL--------
B6AXV5_9RHOB/12-202--------------------------------------------------------------------ANKI--------
A0YMV7_LYNSP/14-207--------------------------------------------------------------------KSII--------
A4FBN6_SACEN/2-207--------------------------------------------------------------------AARL--------
C3Q0C5_9BACE/16-210--------------------------------------------------------------------ITHI--------
C5B9U1_EDWI9/13-205--------------------------------------------------------------------AEAV--------
A5BJC3_VITVI/22-226--------------------------------------------------------------------ADYI--------
D7W1T0_9FLAO/12-207--------------------------------------------------------------------ADAF--------
G6PE_HUMAN/563-760--------------------------------------------------------------------ANDI--------
C1DDK6_AZOVD/23-215--------------------------------------------------------------------AGRV--------
B7RZI6_9GAMM/13-205--------------------------------------------------------------------AAHV--------
Q7NGI9_GLOVI/14-209--------------------------------------------------------------------AQLF--------
A3JKP2_9ALTE/23-215--------------------------------------------------------------------AEQV--------
B3EG95_CHLL2/16-243--------------------------------------------------------------------AGLI--------
Q39SD7_GEOMG/11-206--------------------------------------------------------------------AELF--------
A8KYS2_FRASN/23-226--------------------------------------------------------------------AARL--------
A5L2I5_9GAMM/13-205--------------------------------------------------------------------ANEM--------
A0L802_MAGSM/13-211--------------------------------------------------------------------AQVL--------
A8RIY7_9CLOT/12-210--------------------------------------------------------------------AELI--------
A5ZDU8_9BACE/12-206--------------------------------------------------------------------ILRL--------
B9HIF8_POPTR/22-226--------------------------------------------------------------------AEYI--------
D7BAW0_MEISD/16-192--------------------------------------------------------------------ARLL--------
D2SF51_GEOOG/32-236--------------------------------------------------------------------AAAL--------
A3JTX7_9RHOB/12-202--------------------------------------------------------------------SDIV--------
C1D789_LARHH/13-209--------------------------------------------------------------------ARHL--------
Q3A631_PELCD/18-203--------------------------------------------------------------------ADRI--------
A5FY02_ACICJ/17-214--------------------------------------------------------------------ARLF--------
SOL3_YEAS1/13-213--------------------------------------------------------------------GEFI--------
A1BIC7_CHLPD/16-245--------------------------------------------------------------------AAVI--------
B0C6U0_ACAM1/14-207--------------------------------------------------------------------LELT--------
A0YBK5_9GAMM/13-210--------------------------------------------------------------------ANAC--------
B7KWH9_METC4/17-217--------------------------------------------------------------------ADHL--------
C0W1H0_9ACTO/16-227--------------------------------------------------------------------AKAF--------
A4BU42_9GAMM/14-213--------------------------------------------------------------------AHEF--------
A7RLB1_NEMVE/512-711--------------------------------------------------------------------ARRI--------
A8WGH0_XENTR/561-758--------------------------------------------------------------------ARDI--------
C0WL49_9CORY/13-223--------------------------------------------------------------------ALKF--------
A9WT44_RENSM/14-231--------------------------------------------------------------------AARI--------
A2C1K7_PROM1/15-207--------------------------------------------------------------------SDLI--------
Q1AZZ4_RUBXD/12-205--------------------------------------------------------------------AREF--------
B1VDQ7_CORU7/32-249--------------------------------------------------------------------ARDL--------
B4S4M1_PROA2/12-237--------------------------------------------------------------------AACI--------
A1SJQ5_NOCSJ/16-211--------------------------------------------------------------------AGEL--------
C1BWG3_ESOLU/15-209--------------------------------------------------------------------AHLV--------
A1U1P6_MARAV/21-213--------------------------------------------------------------------ASTV--------
Q3SP94_NITWN/24-223--------------------------------------------------------------------AERI--------
Q72QF1_LEPIC/12-197--------------------------------------------------------------------LDRI--------
Q4RX98_TETNG/585-782--------------------------------------------------------------------AQDM--------
Q0FPX8_9RHOB/14-204--------------------------------------------------------------------ANQI--------
B8FL61_DESAA/21-219--------------------------------------------------------------------AEFF--------
C0DYF2_EIKCO/16-207--------------------------------------------------------------------AEAV--------
B3RVC2_TRIAD/13-206--------------------------------------------------------------------CKYI--------
Q0F2T0_9PROT/12-198--------------------------------------------------------------------ATRV--------
Q1IWW4_DEIGD/12-197--------------------------------------------------------------------AEAF--------
C6XUN5_PEDHD/12-206--------------------------------------------------------------------AAYI--------
Q2JHW7_SYNJB/15-206--------------------------------------------------------------------IEIW--------
C3ZBQ0_BRAFL/574-772--------------------------------------------------------------------ANDI--------
B5EPA9_ACIF5/19-206--------------------------------------------------------------------AAAV--------
Q1IMT5_KORVE/24-219--------------------------------------------------------------------AELI--------
Q0FAR7_9RHOB/13-202--------------------------------------------------------------------SSHV--------
B2IE85_BEII9/16-213--------------------------------------------------------------------ALWI--------
A6ED65_9SPHI/12-206--------------------------------------------------------------------ANYI--------
A4QEF4_CORGB/13-205--------------------------------------------------------------------ASKF--------
Q83HQ1_TROW8/17-213--------------------------------------------------------------------ANRF--------
Q165T6_ROSDO/12-202--------------------------------------------------------------------ADTL--------
C3JSX9_RHOER/15-215--------------------------------------------------------------------AARL--------
B2GH88_KOCRD/18-222--------------------------------------------------------------------ARRA--------
C6VSE7_DYAFD/12-207--------------------------------------------------------------------AEWI--------
A1AR88_PELPD/14-209--------------------------------------------------------------------AEIF--------
A6TTT0_ALKMQ/14-213--------------------------------------------------------------------GVYV--------
B0NQ39_BACSE/12-207--------------------------------------------------------------------IRYI--------
A9UYD4_MONBE/172-367--------------------------------------------------------------------AKWL--------
F2G576_ALTMD/14-206--------------------------------------------------------------------AQDL--------
B3MQE2_DROAN/19-215--------------------------------------------------------------------GELV--------
Q31GB5_THICR/17-202--------------------------------------------------------------------AETL--------
C5BV30_BEUC1/15-216--------------------------------------------------------------------AARL--------
C4FNH5_9FIRM/15-211--------------------------------------------------------------------AEDF--------
6PGL_DICDI/16-211--------------------------------------------------------------------VKFI--------
B6XUA3_9BIFI/15-234--------------------------------------------------------------------AART--------
B6APC6_9BACT/25-225--------------------------------------------------------------------AALF--------
Q0G231_9RHIZ/15-207--------------------------------------------------------------------AAGV--------
Q6SFD3_9BACT/12-201--------------------------------------------------------------------AQNI--------
A0JWQ2_ARTS2/16-230--------------------------------------------------------------------AARL--------
Q60CQ2_METCA/13-209--------------------------------------------------------------------AAAV--------
Q47EB6_DECAR/15-199--------------------------------------------------------------------CRII--------
Q5YTR6_NOCFA/34-231--------------------------------------------------------------------ARRF--------
A6E3P5_9RHOB/12-202--------------------------------------------------------------------VDVL--------
Q5FQ99_GLUOX/19-217--------------------------------------------------------------------ADLL--------
B4M2H3_DROVI/20-214--------------------------------------------------------------------CDVL--------
C4GM95_9NEIS/14-208--------------------------------------------------------------------AEAV--------
Q0V513_PHANO/16-221--------------------------------------------------------------------RAYV--------
B2FL79_STRMK/21-214--------------------------------------------------------------------AAEM--------
A8LLP7_DINSH/12-202--------------------------------------------------------------------ADRI--------
Q0ALB6_MARMM/20-216--------------------------------------------------------------------AGSI--------
A9E4D3_9RHOB/12-202--------------------------------------------------------------------ANKL--------
Q133N9_RHOPS/18-217--------------------------------------------------------------------AQRL--------
A3WL22_9GAMM/18-207--------------------------------------------------------------------SDRI--------
B4FKI4_MAIZE/26-230--------------------------------------------------------------------AEFI--------
B3GY89_ACTP7/12-200--------------------------------------------------------------------AQEF--------
B3CF61_9BACE/12-206--------------------------------------------------------------------IKHI--------
6PGL_RHILO/22-214--------------------------------------------------------------------AGRV--------
C7R459_JONDD/14-213--------------------------------------------------------------------AARL--------
B7RQ64_9RHOB/12-202--------------------------------------------------------------------AEIL--------
Q48MB6_PSE14/23-214--------------------------------------------------------------------AANV--------
6PGL_CHLMU/22-212--------------------------------------------------------------------CYDW--------
Q5WZC2_LEGPL/18-208--------------------------------------------------------------------VEKL--------
C5E1Z3_LACTC/136-338--------------------------------------------------------------------ALYI--------
Q6A7F7_PROAC/15-209--------------------------------------------------------------------AHRL--------
A2TF14_BOMMO/12-204--------------------------------------------------------------------STYI--------
6PGL_RAT/18-217--------------------------------------------------------------------AQLV--------
C4LIR1_CORK4/32-257--------------------------------------------------------------------ARDV--------
B0T0C3_CAUSK/20-213--------------------------------------------------------------------ASVL--------
Q482L5_COLP3/13-205--------------------------------------------------------------------ASTV--------
A3HVL3_9BACT/12-204--------------------------------------------------------------------SYYL--------
C0N6V1_9GAMM/14-209--------------------------------------------------------------------AEHF--------
Q602U1_METCA/18-208--------------------------------------------------------------------VKGI--------
A3TLE4_9MICO/24-220--------------------------------------------------------------------AARL--------
A9BAR0_PROM4/15-206--------------------------------------------------------------------SQLI--------
A7RMK1_NEMVE/15-211--------------------------------------------------------------------CSLI--------
A8Y0B4_CAEBR/14-211--------------------------------------------------------------------KNYL--------
6PGL_XYLFA/20-213--------------------------------------------------------------------TREL--------
C1MQ42_MICPC/15-220--------------------------------------------------------------------ASLT--------
B1LXU6_METRJ/16-216--------------------------------------------------------------------AERI--------
A6X608_OCHA4/14-206--------------------------------------------------------------------SEAI--------
C6BLU0_RALP1/14-208--------------------------------------------------------------------AEAI--------
A5FAH5_FLAJ1/11-206--------------------------------------------------------------------ADLF--------
Q0SNU0_BORAP/4-201--------------------------------------------------------------------ENNL--------
6PGL_TREPA/12-204--------------------------------------------------------------------VSVF--------
Q65WN8_MANSM/12-200--------------------------------------------------------------------AQEF--------
Q7UM40_RHOBA/10-203--------------------------------------------------------------------ADAF--------
Q1H2F6_METFK/26-211--------------------------------------------------------------------VKHI--------
C3ZB29_BRAFL/15-218--------------------------------------------------------------------GALV--------
Q2N8B4_ERYLH/15-185--------------------------------------------------------------------EKSL--------
B3RLE2_TRIAD/571-763--------------------------------------------------------------------VNDI--------
B4SF86_PELPB/52-278--------------------------------------------------------------------AALI--------
A4AJP5_9ACTN/16-217--------------------------------------------------------------------ADRF--------
A7H493_CAMJD/14-201--------------------------------------------------------------------AKAI--------
Q6NH39_CORDI/13-208--------------------------------------------------------------------HRRF--------
Q758H7_ASHGO/106-305--------------------------------------------------------------------GEYI--------
C7LRB5_DESBD/13-206--------------------------------------------------------------------AHHI--------
C0XSW9_9CORY/13-210--------------------------------------------------------------------TERF--------
D0LCU1_GORB4/14-214--------------------------------------------------------------------ARRF--------
B0UFD2_METS4/17-214--------------------------------------------------------------------AERL--------
B8KWX5_9GAMM/13-202--------------------------------------------------------------------AEQV--------
Q5ZJY1_CHICK/14-209--------------------------------------------------------------------AQLV--------
A4ERB6_9RHOB/12-202--------------------------------------------------------------------ASEI--------
Q2IHT3_ANADE/18-216--------------------------------------------------------------------AEEV--------
Q08ZT9_STIAD/14-199--------------------------------------------------------------------ADWL--------
Q6G154_BARQU/17-209--------------------------------------------------------------------ADRV--------
Q31QV8_SYNE7/14-207--------------------------------------------------------------------QTLV--------
6PGL1_ORYSJ/43-247--------------------------------------------------------------------AEYI--------
A6WC51_KINRD/17-219--------------------------------------------------------------------AGRL--------
Q5DCQ0_SCHJA/12-207--------------------------------------------------------------------FEII--------
A7BCF7_9ACTO/16-215--------------------------------------------------------------------GRAF--------
B1MC71_MYCA9/15-216--------------------------------------------------------------------GDRL--------
Q1NX17_9DELT/12-205--------------------------------------------------------------------AELV--------
B8G942_CHLAD/16-214--------------------------------------------------------------------AALV--------
B3QKX3_CHLP8/12-238--------------------------------------------------------------------VAAI--------
Q4K7U0_PSEF5/23-214--------------------------------------------------------------------ALKV--------
C1DRP8_AZOVD/23-215--------------------------------------------------------------------AQRV--------
C0VW02_9CORY/14-218--------------------------------------------------------------------ARAV--------
D7B103_NOCDD/15-218--------------------------------------------------------------------ALKL--------
C1FFY3_MICSR/10-214--------------------------------------------------------------------ASLT--------
B8IN69_METNO/17-215--------------------------------------------------------------------AERL--------
Q8DJZ4_THEEB/15-208--------------------------------------------------------------------KQFV--------
B9XC32_9BACT/14-212--------------------------------------------------------------------ARRW--------
C6XF26_LIBAP/15-208--------------------------------------------------------------------AKKV--------
B7GTB4_BIFLS/15-250--------------------------------------------------------------------AQRF--------
Q1VC87_VIBAL/13-205--------------------------------------------------------------------ANDM--------
Q3APN1_CHLCH/17-236--------------------------------------------------------------------AALI--------
A2EC78_TRIVA/493-688--------------------------------------------------------------------TEQI--------
Q4Q8S1_LEIMA/17-233--------------------------------------------------------------------RDII--------
Q1NB25_9SPHN/13-203--------------------------------------------------------------------ADRI--------
A8UQU5_9AQUI/13-192--------------------------------------------------------------------ARFM--------
Q3LFH1_PROFR/16-212--------------------------------------------------------------------GTLL--------
B3DW46_METI4/16-204--------------------------------------------------------------------CASF--------
B9WM75_CANDC/14-221--------------------------------------------------------------------GKYV--------
A5EXD3_DICNV/14-202--------------------------------------------------------------------ALAI--------
A0LDZ7_MAGSM/18-207--------------------------------------------------------------------AETV--------
A3URA5_VIBSP/13-205--------------------------------------------------------------------ANEM--------
B3EN23_CHLPB/10-239--------------------------------------------------------------------AACI--------
Q46LF9_PROMT/15-207--------------------------------------------------------------------SDLI--------
C0CZ03_9CLOT/12-210--------------------------------------------------------------------AECI--------
Q04TL9_LEPBJ/16-201--------------------------------------------------------------------LSKI--------
B9RWU5_RICCO/22-225--------------------------------------------------------------------AKYT--------
B7FPL4_PHATC/16-217--------------------------------------------------------------------NSAI--------
D4BM17_BIFBR/15-250--------------------------------------------------------------------AQRF--------
6PGL_HELPY/14-200--------------------------------------------------------------------TERF--------
A2TVY6_9FLAO/12-203--------------------------------------------------------------------AKFL--------
B8ELV8_METSB/16-213--------------------------------------------------------------------AAWI--------
A6F7Y8_9GAMM/13-205--------------------------------------------------------------------ANSL--------
A5VAC4_SPHWW/15-208--------------------------------------------------------------------AGDV--------
Q5L5V6_CHLAB/22-212--------------------------------------------------------------------SKDW--------
C5FTG3_ARTOC/17-223--------------------------------------------------------------------RKYV--------
Q64V75_BACFR/29-223--------------------------------------------------------------------ILHL--------
Q2Y8J3_NITMU/20-208--------------------------------------------------------------------VAAI--------
D3Q4S0_STANL/15-218--------------------------------------------------------------------AARL--------
B6BUE7_9PROT/16-203--------------------------------------------------------------------LQDI--------
C1FA85_ACIC5/18-218--------------------------------------------------------------------AQHF--------
C0E339_9CORY/13-209--------------------------------------------------------------------AAEF--------
B3NVD9_DROER/19-209--------------------------------------------------------------------GDLL--------
Q46QB1_CUPPJ/12-202--------------------------------------------------------------------AISI--------
A9BG97_PETMO/12-207--------------------------------------------------------------------VNLI--------
A8IFM0_AZOC5/23-215--------------------------------------------------------------------AAHV--------
A6F5Y7_9ALTE/21-213--------------------------------------------------------------------ADAV--------
B2J9Q0_NOSP7/14-207--------------------------------------------------------------------LELI--------
Q8QZU3_MOUSE/85-282--------------------------------------------------------------------ASDI--------
SOL4_YEAST/13-220--------------------------------------------------------------------GKFI--------
Q8KBB8_CHLTE/15-241--------------------------------------------------------------------VAFI--------
C5B1S2_METEA/18-219--------------------------------------------------------------------AAAF--------
D0LNM1_HALO1/21-212--------------------------------------------------------------------ADDV--------
B4GTC9_DROPE/19-215--------------------------------------------------------------------SNLL--------
A0LTY4_ACIC1/14-215--------------------------------------------------------------------AARL--------
6PGL_CHLPN/22-212--------------------------------------------------------------------SKDW--------
B6C1K3_9GAMM/13-208--------------------------------------------------------------------AEYW--------
Q6FQZ7_CANGA/13-211--------------------------------------------------------------------GEVV--------
B4UA07_HYDS0/19-183--------------------------------------------------------------------LRFF--------
Q16H01_AEDAE/14-211--------------------------------------------------------------------LGLL--------
C1BN63_9MAXI/13-205--------------------------------------------------------------------GGLI--------
B1S5Y3_9BIFI/15-234--------------------------------------------------------------------AART--------
E2S154_9CORY/13-223--------------------------------------------------------------------ALKF--------
B6U0H2_MAIZE/26-230--------------------------------------------------------------------AEYI--------
A1R6H4_ARTAT/16-230--------------------------------------------------------------------AARL--------
Q11M12_MESSB/15-206--------------------------------------------------------------------AEAV--------
B0UWD1_HAES2/12-200--------------------------------------------------------------------AQEF--------
Q3M5C2_ANAVT/14-207--------------------------------------------------------------------LDLI--------
Q1Z513_PHOPR/13-205--------------------------------------------------------------------AKTM--------
A2G0T4_TRIVA/485-680--------------------------------------------------------------------TERL--------
A0QWX6_MYCS2/15-214--------------------------------------------------------------------GDRL--------
B1LCT8_THESQ/13-199--------------------------------------------------------------------VEKI--------
Q0BTV3_GRABC/22-218--------------------------------------------------------------------AAWL--------
B9BSQ1_9BURK/13-201--------------------------------------------------------------------AQAV--------
B9L0S4_THERP/14-212--------------------------------------------------------------------AEAI--------
Q0YUA1_9CHLB/18-247--------------------------------------------------------------------AALI--------
Q82U22_NITEU/18-206--------------------------------------------------------------------AQSV--------
B8C1W9_THAPS/25-226--------------------------------------------------------------------SDTI--------
B5HF46_STRPR/16-221--------------------------------------------------------------------AARL--------
Q01VT6_SOLUE/14-208--------------------------------------------------------------------AHHI--------
A2CAC2_PROM3/15-206--------------------------------------------------------------------AQRI--------
A3WEG3_9SPHN/15-187--------------------------------------------------------------------GECM--------
D2ZU85_NEIMU/13-206--------------------------------------------------------------------ADAV--------
A6L9R0_PARD8/12-206--------------------------------------------------------------------TEDM--------
A8HQW1_CHLRE/10-210--------------------------------------------------------------------VKLV--------
A0Y025_9GAMM/15-210--------------------------------------------------------------------SATL--------
D2Q4L4_KRIFD/15-257--------------------------------------------------------------------AARL--------
B5GMF0_STRCL/8-196--------------------------------------------------------------------STAI--------
Q7P1R7_CHRVO/9-197--------------------------------------------------------------------ANSV--------
B4RAR4_PHEZH/11-193--------------------------------------------------------------------AHAV--------
Q210H8_RHOPB/14-212--------------------------------------------------------------------AQRL--------
B5FXQ3_TAEGU/13-211--------------------------------------------------------------------ARSV--------
A6FX55_9DELT/14-207--------------------------------------------------------------------ARRV--------
Q7D149_AGRT5/14-206--------------------------------------------------------------------AAEV--------
Q2SQ14_HAHCH/21-211--------------------------------------------------------------------ALQT--------
D2QID0_SPILD/12-207--------------------------------------------------------------------ADFI--------
6PGL_BORBU/4-201--------------------------------------------------------------------ENYL--------
B0REI8_CLAMS/16-217--------------------------------------------------------------------AARF--------
B6WQA9_9DELT/1-197--------------------------------------------------------------------AHIL--------
A3SWE9_9RHOB/12-202--------------------------------------------------------------------ANLI--------
Q6CXV1_KLULA/13-216--------------------------------------------------------------------GEFI--------
A3ESW2_9BACT/25-225--------------------------------------------------------------------AALF--------
Q4CQA8_TRYCC/16-230--------------------------------------------------------------------CKKI--------
Q5LRS8_SILPO/12-202--------------------------------------------------------------------ANHL--------
A1B3E9_PARDP/14-203--------------------------------------------------------------------TDRL--------
C1BTN9_9MAXI/11-205--------------------------------------------------------------------SSVI--------
Q7V1T4_PROMP/23-212--------------------------------------------------------------------SNFI--------
A5EPZ2_BRASB/17-216--------------------------------------------------------------------ADLL--------
Q89FE0_BRAJA/19-218--------------------------------------------------------------------AERV--------
Q0C1F0_HYPNA/14-211--------------------------------------------------------------------AELA--------
C7MSN0_SACVD/16-225--------------------------------------------------------------------AARL--------
A6FR30_9RHOB/12-202--------------------------------------------------------------------ANRL--------
B4W8G2_9CAUL/11-207--------------------------------------------------------------------AARL--------
C5DTU9_ZYGRC/12-219--------------------------------------------------------------------GKYI--------
A3K6K0_9RHOB/32-222--------------------------------------------------------------------AQRL--------
B3PCY8_CELJU/13-208--------------------------------------------------------------------QVEC--------
A9TLR4_PHYPA/9-215--------------------------------------------------------------------ADYI--------
Q1PUZ3_9BACT/11-211--------------------------------------------------------------------AGYI--------
B8KHX3_9GAMM/20-211--------------------------------------------------------------------AEDV--------
Q28QX5_JANSC/13-203--------------------------------------------------------------------ADRL--------
D0MEF0_RHOM4/17-193--------------------------------------------------------------------AQRL--------
D1CEH8_THET1/14-209--------------------------------------------------------------------AEQF--------
6PGL_MYCBO/14-215--------------------------------------------------------------------GKRL--------
E3D833_GARV3/22-241--------------------------------------------------------------------AQK.--------
Q1QTX1_CHRSD/12-202--------------------------------------------------------------------ADTV--------
D2AVA1_STRRD/15-217--------------------------------------------------------------------AARV--------
Q5HZC7_XENTR/18-208--------------------------------------------------------------------TQLL--------
A7TEX2_VANPO/13-217--------------------------------------------------------------------GSYV--------
C1EGM8_MICSR/47-244--------------------------------------------------------------------CAEV--------
A5PAY4_9SPHN/15-184--------------------------------------------------------------------EEQL--------
D0L091_HALNC/17-218--------------------------------------------------------------------GHYV--------
Q2H6B6_CHAGB/16-222--------------------------------------------------------------------RAYI--------
C7MCP6_BRAFD/331-540--------------------------------------------------------------------AEGA--------
Q7QGR5_ANOGA/17-214--------------------------------------------------------------------LGLL--------
A6VKW1_ACTSZ/12-200--------------------------------------------------------------------AQEF--------
B4DAH7_9BACT/11-207--------------------------------------------------------------------ARTI--------
A4SD39_PROVI/13-239--------------------------------------------------------------------AALI--------
D5URS5_TSUPD/17-223--------------------------------------------------------------------ADDV--------
B9Z5J3_9NEIS/12-200--------------------------------------------------------------------AEAV--------
A9PA91_POPTR/19-223--------------------------------------------------------------------AKYV--------
6PGL_CAEEL/26-224--------------------------------------------------------------------RRYL--------
Q312M1_DESDG/43-239--------------------------------------------------------------------AELI--------
A4CNJ0_ROBBH/12-204--------------------------------------------------------------------AEQL--------
A9F2S9_SORC5/16-210--------------------------------------------------------------------AELI--------

PF06026

RPIA_MOUSE/119-296--------------------------------------------------------------------TSFQ--------
RPIA_STRMU/48-219--------------------------------------------------------------------TSSR--------
RPIA_XYLFA/45-214--------------------------------------------------------------------SSEQ--------
RPIA_RALSO/51-224--------------------------------------------------------------------SSEA--------
Q8I3W2_PLAF7/50-228--------------------------------------------------------------------TSID--------
RPIA_BRUSU/50-227--------------------------------------------------------------------TSER--------
RPIA_XANCP/45-214--------------------------------------------------------------------SSEQ--------
RPIA_METMA/56-227--------------------------------------------------------------------TSYQ--------
RPIA_TREPA/68-247--------------------------------------------------------------------TSFQ--------
RPIA_HAEIN/47-216--------------------------------------------------------------------ASKE--------
RPIA_BUCAI/47-215--------------------------------------------------------------------SSNS--------
RPIA_ARATH/81-260--------------------------------------------------------------------TSKK--------
RPIA_VIBCH/47-215--------------------------------------------------------------------SSIA--------
RPIA_CAUCR/47-223--------------------------------------------------------------------TSDA--------
RPIA_CHLTR/61-233--------------------------------------------------------------------SSRI--------
RPIA2_YERPE/52-231--------------------------------------------------------------------TSRA--------
RPIA2_OCEIH/49-219--------------------------------------------------------------------ASKK--------
RPIA_PSEAE/51-219--------------------------------------------------------------------SSEA--------
Q97J55_CLOAB/49-223--------------------------------------------------------------------PSIK--------
RPIA_NOSS1/56-230--------------------------------------------------------------------TSFQ--------
Q8L9K5_ARATH/93-272--------------------------------------------------------------------TSKR--------
RPIA_THEEB/54-228--------------------------------------------------------------------TSFQ--------
RPIA_LACLA/48-220--------------------------------------------------------------------TSNV--------
RPIA_CAEEL/63-242--------------------------------------------------------------------TSFL--------
RPIA_CHLPN/53-225--------------------------------------------------------------------SSQN--------
Q8RU73_SPIOL/106-285--------------------------------------------------------------------TSKR--------
RPIA_BORBU/50-225--------------------------------------------------------------------TSSD--------
Q8LBQ2_ARATH/77-261--------------------------------------------------------------------TSTT--------
RPIA_RHILO/49-226--------------------------------------------------------------------TSER--------
RPIA_PYRHO/51-225--------------------------------------------------------------------TSYQ--------
RPIA_AGRT5/49-226--------------------------------------------------------------------TSER--------
RPIA1_YERPE/47-215--------------------------------------------------------------------SSDA--------
RPIA_THEAC/51-223--------------------------------------------------------------------TSRR--------
RPIA_AERPE/51-226--------------------------------------------------------------------SSFE--------
RPIA_WIGBR/47-215--------------------------------------------------------------------SSRI--------
A9UNB7_DROME/96-275--------------------------------------------------------------------SSYQ--------
RPIA_SCHPO/60-238--------------------------------------------------------------------TGFQ--------
RPIA_LISIN/47-219--------------------------------------------------------------------TSIE--------
RPIA_STRR6/48-219--------------------------------------------------------------------TSSV--------
RPIA_ARCFU/49-223--------------------------------------------------------------------SSYQ--------
RPIA_THEVO/51-223--------------------------------------------------------------------TSKK--------
RPIA1_OCEIH/51-222--------------------------------------------------------------------SSNQ--------
RPIA_BIFLO/53-225--------------------------------------------------------------------TSRR--------
RPIA_STRP8/48-219--------------------------------------------------------------------TSSV--------
RPIA_DEIRA/51-222--------------------------------------------------------------------TSEA--------
RPIA_NEIMA/48-216--------------------------------------------------------------------TSKK--------
RPIA_STAAW/51-224--------------------------------------------------------------------TSNK--------
RPIA_STRA5/48-219--------------------------------------------------------------------TSNR--------
RPIA_YEAST/73-253--------------------------------------------------------------------TGFQ--------
RPIA_STAES/51-224--------------------------------------------------------------------TSNK--------
RPIA_METJA/50-222--------------------------------------------------------------------TSFE--------
Q8ZXY8_PYRAE/43-220--------------------------------------------------------------------TSSD--------
RPIA_LISMO/47-219--------------------------------------------------------------------TSEE--------
RPIA_METTH/51-223--------------------------------------------------------------------TSYQ--------
RPIA_HALSA/51-221--------------------------------------------------------------------TSFE--------
RPIA_SYNY3/55-229--------------------------------------------------------------------TSFQ--------
RPIA_SHEON/47-215--------------------------------------------------------------------SSEA--------
RPIA_BUCAP/47-215--------------------------------------------------------------------SSNS--------

PF02589

Q30YW4_DESDG/23-221--------------------------------------------------------------------AESL--------
Q72A59_DESVH/13-211--------------------------------------------------------------------AESL--------
A0LET5_SYNFM/13-211--------------------------------------------------------------------KETL--------
A8ZY31_DESOH/13-211--------------------------------------------------------------------KAVF--------
Q6AQM0_DESPS/13-211--------------------------------------------------------------------QENL--------
A5N319_CLOK5/16-217--------------------------------------------------------------------IKNL--------
A3DDG8_CLOTH/16-211--------------------------------------------------------------------IKAL--------
Q18C30_CLOD6/15-209--------------------------------------------------------------------VTAL--------
A6LXE8_CLOB8/15-209--------------------------------------------------------------------IEAL--------
A5KQQ3_9FIRM/12-205--------------------------------------------------------------------VKAL--------
A7B149_RUMGN/7-200--------------------------------------------------------------------VNAL--------
A6BK24_9FIRM/13-206--------------------------------------------------------------------VKEL--------
A7VF64_9CLOT/13-206--------------------------------------------------------------------INKL--------
B8D0K4_HALOH/12-205--------------------------------------------------------------------IERF--------
A4XID0_CALS8/13-207--------------------------------------------------------------------KKNL--------
A5I080_CLOBH/11-201--------------------------------------------------------------------IEEL--------
Q5CB89_THESQ/49-242--------------------------------------------------------------------ANNL--------
A7HK56_FERNB/14-207--------------------------------------------------------------------KPVL--------
A6LMB1_THEM4/14-207--------------------------------------------------------------------ADEL--------
A8F3V4_THELT/14-204--------------------------------------------------------------------KPIL--------
Q1EM38_9BACT/45-238--------------------------------------------------------------------KKVF--------
A5MYV3_CLOK5/13-207--------------------------------------------------------------------IEAL--------
Q0SPU8_CLOPS/13-207--------------------------------------------------------------------IKAL--------
A7FS45_CLOB1/13-207--------------------------------------------------------------------IESL--------
Q97IL7_CLOAB/13-207--------------------------------------------------------------------IKNL--------
Q188D0_CLOD6/13-206--------------------------------------------------------------------IKSL--------
Q892L7_CLOTE/13-207--------------------------------------------------------------------IKAL--------
A8MGY9_ALKOO/13-207--------------------------------------------------------------------MESL--------
A5N989_CLOK5/13-207--------------------------------------------------------------------INNL--------
A5I1I2_CLOBH/13-207--------------------------------------------------------------------IKNL--------
Q897Y1_CLOTE/13-206--------------------------------------------------------------------IENL--------
B8CXT8_HALOH/13-207--------------------------------------------------------------------LDNI--------
A7VSP9_9CLOT/13-219--------------------------------------------------------------------MESL--------
B8I8V5_CLOCE/13-218--------------------------------------------------------------------MENL--------
Q7MR09_WOLSU/5-199--------------------------------------------------------------------IDNL--------
Q251U6_DESHY/5-199--------------------------------------------------------------------IAGL--------
Q97M44_CLOAB/13-207--------------------------------------------------------------------TETL--------
A1HQE0_9FIRM/13-207--------------------------------------------------------------------VEAL--------
B5EEH8_GEOBB/16-211--------------------------------------------------------------------VENL--------
A5G901_GEOUR/16-211--------------------------------------------------------------------VESL--------
Q39QC7_GEOMG/16-211--------------------------------------------------------------------VASL--------
A5CYU3_PELTS/16-210--------------------------------------------------------------------VEAL--------
A0PZA2_CLONN/13-207--------------------------------------------------------------------VKAL--------
Q6M046_METMP/13-207--------------------------------------------------------------------VENL--------
A4J2Z4_DESRM/12-207--------------------------------------------------------------------VQAL--------
A6TQ94_ALKMQ/5-197--------------------------------------------------------------------LGNL--------
A8MHS3_ALKOO/5-197--------------------------------------------------------------------LKNL--------
A7I305_CAMHC/3-194--------------------------------------------------------------------IRNL--------
A8EV54_ARCB4/1-193--------------------------------------------------------------------LAVL--------
A6NR40_9FIRM/4-190--------------------------------------------------------------------RRNL--------
A6LYD8_CLOB8/3-195--------------------------------------------------------------------KNSL--------
B9LU40_HALLT/27-212--------------------------------------------------------------------VANL--------
Q5V6G7_HALMA/27-212--------------------------------------------------------------------VENL--------
A3CXV8_METMJ/32-217--------------------------------------------------------------------VEAM--------
Q8T2H5_DICDI/31-220--------------------------------------------------------------------IKSL--------
Q8T2H6_DICDI/31-218--------------------------------------------------------------------VKSL--------
Q9BI24_DICDI/30-213--------------------------------------------------------------------VKNL--------
A8LFX8_FRASN/21-203--------------------------------------------------------------------TAAL--------
Q5YX86_NOCFA/55-213--------------------------------------------------------------------LARL--------
Q6ABE0_PROAC/50-223--------------------------------------------------------------------VEKV--------
A3Q5V6_MYCSJ/41-201--------------------------------------------------------------------AETV--------
Q1J3Q0_DEIGD/40-206--------------------------------------------------------------------AEYA--------
Q9RT57_DEIRA/45-211--------------------------------------------------------------------EDRI--------
Q9XAA8_STRCO/46-212--------------------------------------------------------------------AENL--------
A4TC28_MYCGI/41-203--------------------------------------------------------------------IERV--------
A7BE65_9ACTO/49-222--------------------------------------------------------------------IETL--------
Q6NHV0_CORDI/43-208--------------------------------------------------------------------VDRL--------
A1ATQ9_PELPD/34-209--------------------------------------------------------------------KTKA--------
B5EIV8_GEOBB/2-175--------------------------------------------------------------------KTKA--------
A1HPX9_9FIRM/22-195--------------------------------------------------------------------EMRA--------
B8G046_DESHD/8-180--------------------------------------------------------------------QTKL--------
A4J2C5_DESRM/13-186--------------------------------------------------------------------KGKA--------
A5D032_PELTS/17-190--------------------------------------------------------------------KERA--------
Q2RG46_MOOTA/7-177--------------------------------------------------------------------TSQA--------
Q39ZY5_PELCD/8-178--------------------------------------------------------------------CQTA--------
Q74CQ2_GEOSL/47-209--------------------------------------------------------------------TVAA--------
Q30WA8_DESDG/6-203--------------------------------------------------------------------REKA--------
Q6APH5_DESPS/6-194--------------------------------------------------------------------SDRA--------
A0LF89_SYNFM/7-180--------------------------------------------------------------------KERA--------
Q1ARS5_RUBXD/44-220--------------------------------------------------------------------LEEL--------
Q67TB5_SYMTH/34-234--------------------------------------------------------------------QLEL--------
LUTC_BACP2/52-237--------------------------------------------------------------------KMQC--------
LUTC_GEOTN/52-237--------------------------------------------------------------------REQC--------
LUTC_BACAH/51-236--------------------------------------------------------------------KNQC--------
A3I780_9BACI/50-235--------------------------------------------------------------------TKQC--------
Q836K1_ENTFA/52-236--------------------------------------------------------------------KERV--------
A2RMF6_LACLM/49-224--------------------------------------------------------------------KVQS--------
Q2B117_9BACI/51-235--------------------------------------------------------------------IKQC--------
LUTC_OCEIH/49-232--------------------------------------------------------------------EKHC--------
LUTC1_BACWK/49-231--------------------------------------------------------------------MEHC--------
Q1WT28_LACS1/55-240--------------------------------------------------------------------KENS--------
B3XQV7_LACRE/57-241--------------------------------------------------------------------RKNS--------
A7JU08_PASHA/49-230--------------------------------------------------------------------IDFA--------
O86990_PROMI/4-116--------------------------------------------------------------------....--------
Q6LPN1_PHOPR/50-245--------------------------------------------------------------------VNYT--------
Q638X4_BACCZ/48-228--------------------------------------------------------------------IANL--------
Q24VR0_DESHY/42-220--------------------------------------------------------------------MKMY--------
Q3ISD4_NATPD/6-167--------------------------------------------------------------------ERAV--------
B9LU45_HALLT/6-165--------------------------------------------------------------------ESSL--------
Q5V6W0_HALMA/5-169--------------------------------------------------------------------EGAL--------
Q01UG2_SOLUE/41-210--------------------------------------------------------------------ITRL--------
C0A2Z6_9BACT/52-233--------------------------------------------------------------------ASAL--------
Q1IN29_KORVE/40-207--------------------------------------------------------------------LAEC--------
A6EDI2_9SPHI/43-210--------------------------------------------------------------------AEEL--------
A1ZEZ8_9BACT/19-187--------------------------------------------------------------------AENF--------
Q11XG5_CYTH3/44-210--------------------------------------------------------------------AQQF--------
A7NKC6_ROSCS/47-233--------------------------------------------------------------------AAEL--------
B9LL37_CHLSY/44-229--------------------------------------------------------------------VIEL--------
Q2SMI8_HAHCH/39-216--------------------------------------------------------------------TENL--------
Q47V41_COLP3/52-226--------------------------------------------------------------------ISEL--------
Q3IEG6_PSEHT/41-215--------------------------------------------------------------------TTQL--------
A6D6N6_9VIBR/44-218--------------------------------------------------------------------FDMM--------
Q1Z553_PHOPR/38-228--------------------------------------------------------------------IDGL--------
Q7NTM5_CHRVO/41-217--------------------------------------------------------------------AAMM--------
Q46PZ2_CUPPJ/51-226--------------------------------------------------------------------QAAL--------
A6F5P7_9ALTE/40-218--------------------------------------------------------------------ERTI--------
Q4KII4_PSEF5/42-220--------------------------------------------------------------------RKQM--------
Q222U5_RHOFD/42-217--------------------------------------------------------------------RAAL--------
A4U5P4_9PROT/35-201--------------------------------------------------------------------RIML--------
Q2VZP0_MAGSA/37-213--------------------------------------------------------------------KAML--------
Q5F884_NEIG1/42-219--------------------------------------------------------------------AAAM--------
Q310K5_DESDG/40-217--------------------------------------------------------------------VRLL--------
Q6AIU4_DESPS/43-219--------------------------------------------------------------------TEYM--------
Q72B57_DESVH/44-220--------------------------------------------------------------------KKRM--------
Q0PC62_CAMJE/47-218--------------------------------------------------------------------KQKM--------
A0RPC6_CAMFF/42-213--------------------------------------------------------------------TQRI--------
Q9ZMU3_HELPJ/38-211--------------------------------------------------------------------KHFQ--------
Q7VIF4_HELHP/38-218--------------------------------------------------------------------ISLQ--------
Q2BIJ5_9GAMM/39-219--------------------------------------------------------------------RSQL--------
A5G2K4_ACICJ/57-224--------------------------------------------------------------------IANA--------
A7IG69_XANP2/53-223--------------------------------------------------------------------KDMV--------
Q11LF2_MESSB/52-222--------------------------------------------------------------------CQMA--------
A4AAA4_9GAMM/47-215--------------------------------------------------------------------RLNL--------
A1SVG8_PSYIN/32-224--------------------------------------------------------------------LEIL--------
Q13MB1_BURXL/35-192--------------------------------------------------------------------TAAL--------
B7KPU3_METC4/37-194--------------------------------------------------------------------AERL--------
A4JSB8_BURVG/35-192--------------------------------------------------------------------KQAL--------
Q5FR86_GLUOX/37-194--------------------------------------------------------------------QKSL--------
Q5NRL0_ZYMMO/38-194--------------------------------------------------------------------TQAV--------
A0YX69_LYNSP/37-194--------------------------------------------------------------------KTQL--------
A7AFE0_9PORP/35-192--------------------------------------------------------------------TDSL--------
A6L9J6_PARD8/35-192--------------------------------------------------------------------SEVL--------
Q89ZC0_BACTN/36-193--------------------------------------------------------------------CAIS--------
Q7MVA4_PORGI/45-204--------------------------------------------------------------------IEIS--------
A8EQR6_ARCB4/36-193--------------------------------------------------------------------STML--------
Q7UNF1_RHOBA/60-220--------------------------------------------------------------------QETL--------
A4A1Q0_9PLAN/35-199--------------------------------------------------------------------ATVL--------
A6C2P5_9PLAN/41-201--------------------------------------------------------------------AETL--------
A7HA96_ANADF/35-195--------------------------------------------------------------------EAAL--------
A3HYU9_9BACT/34-186--------------------------------------------------------------------GTSL--------
A5FC57_FLAJ1/36-194--------------------------------------------------------------------KTVL--------
A6EK39_9SPHI/35-193--------------------------------------------------------------------ATML--------
A1S8E1_SHEAM/19-189--------------------------------------------------------------------IDIA--------
A3D2A5_SHEB5/34-189--------------------------------------------------------------------ETNL--------
O29447_ARCFU/59-271--------------------------------------------------------------------KDVL--------
Q97B66_THEVO/50-280--------------------------------------------------------------------MDSV--------
A8MDI5_CALMQ/50-279--------------------------------------------------------------------MKSI--------
A4WI65_PYRAR/50-279--------------------------------------------------------------------RKAV--------
A2BLD6_HYPBU/71-302--------------------------------------------------------------------MKSL--------
Q9YFI8_AERPE/68-298--------------------------------------------------------------------VESL--------
B8FYL0_DESHD/68-297--------------------------------------------------------------------MEAV--------
A6EK38_9SPHI/68-287--------------------------------------------------------------------ESNA--------
A7HA97_ANADF/64-283--------------------------------------------------------------------ERNA--------
A8G0A4_SHESH/69-288--------------------------------------------------------------------EKNC--------
Q7MVA5_PORGI/38-257--------------------------------------------------------------------EENA--------
A0YX67_LYNSP/67-286--------------------------------------------------------------------EANA--------
C0A2Z5_9BACT/67-291--------------------------------------------------------------------EARL--------
Q47F70_DECAR/78-303--------------------------------------------------------------------EAKL--------
Q1CV19_HELPH/71-295--------------------------------------------------------------------EKNA--------
Q5HX91_CAMJR/68-293--------------------------------------------------------------------EKNA--------
A3Q5V5_MYCSJ/79-302--------------------------------------------------------------------ERNV--------
Q6ABE1_PROAC/94-322--------------------------------------------------------------------EKNL--------
A5TJP2_BURML/67-292--------------------------------------------------------------------EREA--------
Q47IA5_DECAR/76-304--------------------------------------------------------------------EERA--------
Q62B92_BURMA/72-300--------------------------------------------------------------------EAAV--------
A1B665_PARDP/69-294--------------------------------------------------------------------ERNA--------
A5G2K5_ACICJ/68-296--------------------------------------------------------------------AEQV--------
A4AAA5_9GAMM/71-297--------------------------------------------------------------------THNA--------
A0LED1_SYNFM/69-293--------------------------------------------------------------------ADKI--------
A5V1N8_ROSS1/68-292--------------------------------------------------------------------AENV--------
Q67TB4_SYMTH/77-301--------------------------------------------------------------------ADQI--------
Q1ARS4_RUBXD/86-314--------------------------------------------------------------------ADAV--------
Q01UG1_SOLUE/67-291--------------------------------------------------------------------ERNV--------
A6EBI6_9SPHI/68-292--------------------------------------------------------------------EANF--------
Q1IN28_KORVE/68-293--------------------------------------------------------------------ERKI--------
Q72IY0_THET2/68-291--------------------------------------------------------------------ERRL--------
A6FAG4_9GAMM/68-293--------------------------------------------------------------------SENV--------
Q4MSC6_BACCE/70-293--------------------------------------------------------------------SENV--------
LUTB_BACLD/70-295--------------------------------------------------------------------AENV--------
LUTB_OCEIH/70-294--------------------------------------------------------------------SEQV--------
Q6D5W9_ERWCT/70-294--------------------------------------------------------------------SEKV--------
Q81ND6_BACAN/69-293--------------------------------------------------------------------ATNV--------
Q24VR1_DESHY/69-293--------------------------------------------------------------------IENV--------
O69147_LACLC/4-174--------------------------------------------------------------------ADDM--------
A5VIG9_LACRD/70-294--------------------------------------------------------------------SDNV--------
B9LU44_HALLT/67-296--------------------------------------------------------------------TEAI--------
Q3ISD5_NATPD/64-299--------------------------------------------------------------------RAAV--------
A5GDG8_GEOUR/64-287--------------------------------------------------------------------TRNA--------
A5D031_PELTS/65-292--------------------------------------------------------------------AEKL--------
Q3AEY7_CARHZ/62-279--------------------------------------------------------------------RINA--------
Q24W82_DESHY/65-292--------------------------------------------------------------------EKAV--------
Q8RIN1_FUSNN/65-294--------------------------------------------------------------------TTNC--------
A1HPY0_9FIRM/68-298--------------------------------------------------------------------EAEA--------
Q726S3_DESVH/69-294--------------------------------------------------------------------KAEA--------
Q74CQ3_GEOSL/61-280--------------------------------------------------------------------TASA--------
A4J1M6_DESRM/66-295--------------------------------------------------------------------TLSL--------
A5UNQ3_METS3/51-284--------------------------------------------------------------------VESF--------
O26243_METTH/51-280--------------------------------------------------------------------SERF--------
A4J1M5_DESRM/47-258--------------------------------------------------------------------TTML--------

PF01812

MTHFS_HUMAN/10-198--------------------------------------------------------------------GELK--------
Q9SRE0_ARATH/92-290--------------------------------------------------------------------KK..--------
Q9Z5G2_MYCLE/6-186--------------------------------------------------------------------KQLL--------
O84655_CHLTR/8-178--------------------------------------------------------------------REGL--------
MTHFS_CAEEL/8-197--------------------------------------------------------------------QFMK--------
YQGN_BACSU/2-179--------------------------------------------------------------------KKTL--------
MTHFS_MYCGE/4-164--------------------------------------------------------------------KLML--------
O83692_TREPA/4-207--------------------------------------------------------------------RIAS--------
Q9RKA5_STRCO/12-197--------------------------------------------------------------------RDLL--------
Y858_HAEIN/6-187--------------------------------------------------------------------TEIR--------
Q9RTF0_DEIRA/10-175--------------------------------------------------------------------EWAF--------
MTHFS_RABIT/10-198--------------------------------------------------------------------AELK--------
O68985_CHLTP/8-188--------------------------------------------------------------------KRLL--------
O66124_STRMU/3-175--------------------------------------------------------------------TQVI--------
Q9Z7E3_CHLPN/8-180--------------------------------------------------------------------KLFI--------
O26306_METTH/134-322--------------------------------------------------------------------LVEY--------
MTHFS_MYCPN/3-163--------------------------------------------------------------------KQIL--------
FTHC_YEAST/4-203--------------------------------------------------------------------RQIK--------
Q9YFU3_AERPE/7-205--------------------------------------------------------------------ER..--------
Q9VN21_DROME/34-232--------------------------------------------------------------------VQ..--------
P73038_SYNY3/3-179--------------------------------------------------------------------AQLL--------
O67621_AQUAE/3-175--------------------------------------------------------------------KKVL--------
Q9ZD82_RICPR/3-172--------------------------------------------------------------------FYFK--------
O05575_MYCTU/6-186--------------------------------------------------------------------DQLL--------

PF13336

Q7P6F4_FUSNV/274-427...N.....NPE-IEL.H-----PVD---------------------------------------------YVN......
A6LV90_CLOB8/275-428...G.....NPS-VAM.Y-----PVD---------------------------------------------YVN......
B8F9H4_DESAA/272-425...N.....NPM-VMM.F-----PVD---------------------------------------------YTN......
Q7MWD3_PORGI/273-426...K.....NPD-VEL.Y-----PVD---------------------------------------------YVN......
C8PQ47_9SPIO/40-192...H.....NPD-VDM.R-----PVD---------------------------------------------YVN......
B8CZD4_HALOH/271-424...D.....NPM-VEM.H-----PVS---------------------------------------------YTN......
C6Q2N6_9CLOT/272-425...D.....NPM-VES.Y-----PVS---------------------------------------------YVN......
C0GK20_9FIRM/271-424...D.....NPI-VEM.H-----PVS---------------------------------------------YTN......
C6JPC5_FUSVA/273-426...D.....NPS-VEI.Y-----PVD---------------------------------------------YVN......
C2MAG5_9PORP/269-422...N.....NPT-IEM.R-----PVN---------------------------------------------YVN......
B9E5E2_CLOK1/272-425...N.....NPM-VET.Y-----SVD---------------------------------------------YVN......
Q3ACH6_CARHZ/275-428...N.....NPM-VEM.H-----PVS---------------------------------------------YTN......
D2QBR0_SPILD/268-420...D.....NPE-VAM.K-----QAS---------------------------------------------FTN......
D7BE02_MEISD/284-437...N.....NPL-FEM.R-----PAD---------------------------------------------WVN......
D3LSY0_9FIRM/272-426...H.....NPE-VWI.K-----PVD---------------------------------------------YTN......
B1CB66_9FIRM/271-424...D.....NPA-ISM.M-----DIE---------------------------------------------YVN......
Q898H0_CLOTE/272-425...N.....NPM-VRM.Y-----PVD---------------------------------------------YVN......
A0L8K8_MAGSM/267-420...E.....NPH-FEF.L-----PSE---------------------------------------------YVN......
Q2QB25_9FIRM/277-430...N.....NPA-VEL.H-----PVD---------------------------------------------YVN......
A5N390_CLOK5/276-429...D.....NPM-VEG.Y-----PVD---------------------------------------------YVN......
Q0HH24_SHESM/288-441...D.....NPA-VIF.M-----DIE---------------------------------------------QVN......
C2MDZ9_9PORP/277-430...H.....NED-VEM.Y-----PVS---------------------------------------------YTN......
Q15V19_PSEA6/267-420...N.....NPH-VEF.Y-----PSD---------------------------------------------YLN......
Q39QG7_GEOMG/278-431...E.....NPM-IEM.H-----PVD---------------------------------------------FTN......
B3QTM9_CHLT3/265-417...D.....NPL-IVM.L-----GSD---------------------------------------------YVN......
B2RM12_PORG3/273-426...N.....NPV-IEC.Y-----PVD---------------------------------------------YIN......
A9AXP3_HERA2/264-416...D.....NPQ-IAM.L-----DIT---------------------------------------------YIN......
C7GYK3_9FIRM/272-430...E.....NPA-VEL.R-----PVD---------------------------------------------YVN......
Q8CXQ9_LEPIN/270-422...D.....NPE-VSM.L-----DIG---------------------------------------------YIN......
A5URR7_ROSS1/272-425...N.....NAM-VEM.H-----PTD---------------------------------------------YVN......
Q24WU2_DESHY/311-467...N.....NPS-CAI.Y-----PVD---------------------------------------------YVN......
C3JA15_9PORP/269-422...N.....NPD-VRL.A-----PVN---------------------------------------------WVN......
C7M4J2_CAPOD/265-417...K.....NPS-VEI.A-----EAS---------------------------------------------YTN......
Q5QXA2_IDILO/264-417...D.....NPE-VFF.L-----DVE---------------------------------------------YTN......
B9M8N9_GEOSF/274-427...D.....NTS-IAF.H-----PSD---------------------------------------------FVN......
B9M9H7_GEOSF/264-417...N.....NPH-VEF.H-----GTA---------------------------------------------YVN......
Q9RM86_CLOAM/272-430...N.....NPK-VEL.K-----PVD---------------------------------------------YIN......
A7H923_ANADF/265-417...D.....NPL-VAM.L-----DIA---------------------------------------------YVN......
A3WLS5_9GAMM/264-417...R.....NPH-IGF.Y-----PSE---------------------------------------------YVN......
C7RL22_ACCPU/274-427...R.....NPM-LEM.H-----PVD---------------------------------------------YTN......
Q3ANX0_CHLCH/266-418...D.....NPL-VAM.M-----PSD---------------------------------------------YVN......
B7RTW3_9GAMM/266-419...D.....NPE-VTF.L-----DIE---------------------------------------------FVN......
B7R990_9THEO/272-425...D.....NMG-VEF.H-----RGR---------------------------------------------VVN......
A0M1A3_GRAFK/267-419...D.....NPL-VHF.K-----EAA---------------------------------------------YTN......
Q0IG02_AEDAE/314-468...N.....NPF-IEM.L-----EIN---------------------------------------------YVN......
D1C4I7_SPHTD/264-417...G.....NPF-VEF.H-----PSD---------------------------------------------IVN......
A7HKG2_FERNB/273-426...E.....NPA-VLF.L-----RGR---------------------------------------------YVN......
C3J9R5_9PORP/273-426...G.....NED-VAM.Y-----PVD---------------------------------------------YTN......
A6GWR2_FLAPJ/265-417...D.....NPF-VEM.R-----ESS---------------------------------------------YVN......
A8F649_THELT/274-427...D.....NPS-VFF.L-----RGR---------------------------------------------YVN......
B5ECU8_GEOBB/278-431...E.....NPQ-IEM.H-----PVD---------------------------------------------YVN......
A1KBF4_AZOSB/272-425...R.....NPA-LEM.H-----PVD---------------------------------------------FTN......
Q2LSP1_SYNAS/286-439...D.....NPS-ITF.R-----TID---------------------------------------------YTN......
A4ASU6_MARSH/266-418...D.....NPE-IEM.K-----DIA---------------------------------------------YVN......
Q01VE3_SOLUE/270-423...N.....NPT-FEF.H-----RTA---------------------------------------------YCN......
B5E7S1_GEOBB/278-431...E.....NPM-IEM.H-----PVD---------------------------------------------YVN......
B2TLD8_CLOBB/272-425...D.....NPC-IEM.K-----RCS---------------------------------------------YVN......
A0B6T6_METTP/284-437...D.....NPA-IEF.K-----TID---------------------------------------------YTN......
C0CQX9_9FIRM/274-427...N.....NPA-ILM.L-----PAE---------------------------------------------YVN......
Q2BRL2_9GAMM/269-422...D.....NPA-VRF.L-----DTE---------------------------------------------YVN......
A4J1E7_DESRM/279-435...N.....NPM-CAT.Y-----PVN---------------------------------------------YTN......
A3P7E3_BURP0/286-437...D.....NPA-LES.H-----PVD---------------------------------------------YVN......
A7FIQ3_YERP3/283-434...D.....HPA-IFS.R-----PVD---------------------------------------------YVN......
B8FV23_DESHD/273-426...N.....NPL-FEF.R-----PVD---------------------------------------------YVN......
A1ZWE1_9BACT/265-417...D.....NPL-VRL.L-----ACD---------------------------------------------YVN......
C9XLC1_CLODC/271-427...N.....NPA-VEV.K-----PVD---------------------------------------------YVN......
D6Z2N5_DESAT/282-435...N.....NPL-FSF.R-----PTE---------------------------------------------YVN......
Q1IT47_KORVE/273-426...M.....NSI-FDF.R-----PNS---------------------------------------------YTN......
C5EQI6_9FIRM/275-428...H.....HPL-FAV.Y-----PVD---------------------------------------------YVN......
B5Y607_COPPD/273-426...N.....NLA-VEV.H-----RGR---------------------------------------------IVN......
D3FVG7_BACPE/268-421...Q.....NKQ-VQM.Y-----PVD---------------------------------------------ETN......
Q0AVM5_SYNWW/279-434...D.....NPG-LAS.Y-----SVD---------------------------------------------YTN......
Q2FRF0_METHJ/278-431...D.....NPS-IES.Y-----PAS---------------------------------------------HVC......
D9TPZ5_THETC/317-464...K....YKEK-IIL.R-----PQE---------------------------------------------ISN......
B2A2S6_NATTJ/273-426...N.....NLG-VEF.Q-----RGK---------------------------------------------VVN......
Q7Z0V8_ARTSF/277-430...N.....NPF-VLM.G-----DVQ---------------------------------------------WVN......
B9JLD2_AGRRK/284-435...N.....NPD-VEA.Y-----PVD---------------------------------------------YVN......
A3HTS6_9BACT/267-419...D.....NPE-FSF.H-----EAA---------------------------------------------YVN......
B8KH63_9GAMM/265-418...D.....NPE-VTF.L-----DIE---------------------------------------------FVN......
A9GMK9_SORC5/277-430...E.....NPV-IEM.R-----GSA---------------------------------------------FTN......
C7PPM1_CHIPD/268-420...D.....NPA-LRV.M-----DIS---------------------------------------------YVN......
C0QJK6_DESAH/274-427...D.....NSL-INL.L-----PSE---------------------------------------------YVN......
B3P805_DROER/312-466...N.....NPF-IEM.Y-----AID---------------------------------------------YVN......
D2VMT8_NAEGR/323-475...D.....NPQ-VIF.R-----GAD---------------------------------------------FVN......
B2HRD6_MYCMM/288-439...N.....NPK-LES.Y-----PVD---------------------------------------------YVN......
A9BH20_PETMO/279-432...D.....NPG-ILE.L-----RGR---------------------------------------------FVN......
B0P1X4_9CLOT/279-435...D.....NPE-CMS.A-----PVD---------------------------------------------YTN......
C0W9X2_9FIRM/281-437...N.....NPA-IMA.A-----PVD---------------------------------------------YVN......
B8FWN2_DESHD/279-435...N.....NPQ-VAG.Y-----PVD---------------------------------------------YTN......
D1N3Y0_9BACT/300-452...R.....NRM-VRM.R-----DAA---------------------------------------------YTN......
Q0AW71_SYNWW/272-425...E.....NMA-VEF.H-----RGS---------------------------------------------IVN......
B1C6G2_9FIRM/280-436...N.....NPE-CMS.A-----PVD---------------------------------------------YTN......
Q4A5M6_MYCS5/287-438...L.....NPT-IQS.F-----PVN---------------------------------------------YVN......
A4J4L6_DESRM/279-435...D.....NPI-CAI.Y-----PVN---------------------------------------------YTN......
E6VZH2_DESAO/276-429...D.....NPS-LAS.A-----PSD---------------------------------------------YVM......
C5ENP0_9FIRM/279-432...H.....NPC-VAM.N-----PCS---------------------------------------------YVN......
Q220T6_RHOFD/272-425...H.....NPA-LEI.H-----PVD---------------------------------------------FTN......
A4AMZ0_MARSH/269-421...D.....NPL-VQF.K-----EAA---------------------------------------------YTN......
D4IP35_9BACT/266-418...Y.....RKD-LVM.K-----DVA---------------------------------------------WTN......
C6E210_GEOSM/283-439...N.....NPM-IEL.R-----RTE---------------------------------------------YVN......
A1U877_MARAV/284-436...D.....NPS-IVG.Y-----PAS---------------------------------------------WVN......
D3LTM8_9FIRM/278-434...D.....NQI-VFN.A-----PVD---------------------------------------------YTN......
D4J7D4_9FIRM/278-438...N.....NPS-ILF.K-----SCT---------------------------------------------FTN......
D2VCN4_NAEGR/199-351...D.....NPE-FLF.R-----TSD---------------------------------------------FVN......
C6X0M3_FLAB3/276-428...D.....NPS-FAF.M-----DVE---------------------------------------------HVN......
C0QKC6_DESAH/273-426...N.....NPM-FYF.R-----SSE---------------------------------------------FVN......
C8VZ55_DESAS/277-433...N.....NPV-CAS.Y-----PVD---------------------------------------------YTN......
C0QAD0_DESAH/281-437...N.....NPS-CAS.Y-----PAD---------------------------------------------YTN......
A0LMU1_SYNFM/292-445...N.....NPM-VAF.H-----PIE---------------------------------------------YTN......
A9NFJ4_ACHLI/270-431...N.....NPS-IYF.M-----RGV---------------------------------------------HAN......
C0ESI0_9FIRM/299-455...D.....NPE-CMS.A-----PVD---------------------------------------------YTN......
B8FDQ1_DESAA/279-432...N.....NPL-FYF.R-----GSE---------------------------------------------FVN......
Q3A1S1_PELCD/278-433...N.....NPE-IMS.C-----PVD---------------------------------------------YCN......
Q21W64_RHOFD/279-435...N.....NPV-AAI.F-----PAS---------------------------------------------YTN......
B8F9D7_DESAA/274-430...R.....NPT-LTF.A-----PVY---------------------------------------------YVN......
A4J5F7_DESRM/278-434...A.....NPM-IAT.Y-----PVD---------------------------------------------YCN......
D3TLS8_GLOMM/312-466...D.....NPF-VEL.F-----GVD---------------------------------------------YVN......
A8MLT0_ALKOO/317-464...H....YAKH-CIL.R-----PME---------------------------------------------ISN......
D0Z2A1_LISDA/272-429...G.....NDN-IEI.G-----DVC---------------------------------------------VVN......
A4J1H7_DESRM/278-434...R.....NPM-IAT.Y-----SVD---------------------------------------------YTN......
A6NQA1_9FIRM/281-437...H.....NPT-LMV.A-----PVD---------------------------------------------YVN......
Q0AW62_SYNWW/282-438...H.....NEN-FCF.R-----EVD---------------------------------------------YIN......
B0MTL0_9BACT/270-422...D.....NPG-VLM.M-----DVG---------------------------------------------YTN......
Q1VQ25_9FLAO/298-450...K.....NPI-VNL.K-----DVG---------------------------------------------YVN......
A8ZXP1_DESOH/277-430...K.....NPA-FMF.L-----SSD---------------------------------------------YVN......
Q0AZT0_SYNWW/278-433...N.....NPL-CAS.Y-----PVN---------------------------------------------YTN......
A2SP55_METPP/278-433...R.....NAD-FHF.C-----PVD---------------------------------------------YTN......
D3LTH5_9FIRM/277-433...Y.....NQD-ILS.A-----PMS---------------------------------------------YVN......
D4KHS0_9FIRM/319-466...E....YRKH-LLL.R-----PQE---------------------------------------------ISN......
Q2RRD2_RHORT/322-473...N.....NPS-IVG.Y-----PVG---------------------------------------------WVN......
C7H5K4_9FIRM/279-436...D.....NPE-CMA.A-----PVE---------------------------------------------YTN......
A0LHR8_SYNFM/278-431...N.....NPE-VEI.Y-----PIE---------------------------------------------YVN......
Q18599_CAEEL/306-460...D.....NPL-IEF.G-----DVN---------------------------------------------WVN......
A7SYK6_NEMVE/323-477...N.....NPF-VVM.L-----DVG---------------------------------------------FVN......
Q0AXU7_SYNWW/280-436...R.....NPA-IAS.Y-----PVG---------------------------------------------YTN......
C4Z8H6_EUBR3/279-435...E.....NPE-LMS.A-----PVS---------------------------------------------YTN......
D3LT91_9FIRM/318-465...E....YRKK-IIF.R-----PLE---------------------------------------------ISN......
Q1Z538_PHOPR/273-428...N.....NPD-IEI.G-----NVV---------------------------------------------VVN......
B1C6E5_9FIRM/281-437...A.....NPS-IMA.A-----PVD---------------------------------------------YVN......
D1B8D5_THEAS/325-472...L....YRQR-VIL.R-----PQE---------------------------------------------ISN......
C6EUD4_FASHE/313-467...N.....NPM-VDM.C-----DVA---------------------------------------------WVN......
Q0B052_SYNWW/278-434...G.....NPA-CAI.Y-----PVD---------------------------------------------YTN......
B7QJI4_IXOSC/314-468...C.....NAG-LVM.L-----DVG---------------------------------------------YVN......
Q6AQI5_DESPS/285-438...D.....NPL-FCF.R-----PTE---------------------------------------------YVN......
D3FFX7_MYCGH/280-431...H.....NDK-FKI.A-----RFD---------------------------------------------YVN......
C3W9K1_FUSMR/279-435...N.....NPE-IMA.A-----PVD---------------------------------------------YVN......
A8SVH6_9FIRM/278-433...D.....NPG-IAA.Y-----PLE---------------------------------------------YVN......
B0TCP9_HELMI/277-433...E.....NPF-VAS.Y-----PVD---------------------------------------------YTN......
A4J446_DESRM/283-434...N.....NPL-FEF.H-----SVS---------------------------------------------YTN......
B3QBE4_RHOPT/324-471...F....YRER-IVL.R-----QQE---------------------------------------------ISN......
D1RF94_LEGLO/281-431...N.....NPS-MVC.L-----PVS---------------------------------------------YVN......
D2XBL0_9BACT/272-425...N.....NPL-VSL.R-----PID---------------------------------------------FTH......
C0QDJ7_DESAH/279-431...D.....NPA-IEF.H-----PSD---------------------------------------------YVN......
A6F750_9GAMM/274-429...N.....NPE-IEM.G-----CVS---------------------------------------------TVV......
B4W710_9CAUL/282-433...G.....NRG-LEA.H-----PVS---------------------------------------------YVN......
A1HP35_9FIRM/320-467...E....YRKK-ILL.R-----PQE---------------------------------------------ISN......
A0R5U0_MYCS2/274-430...G.....NRD-VAF.L-----PVE---------------------------------------------IVN......
B0N003_9BACT/267-419...Y.....NED-LIM.K-----DVA---------------------------------------------WTN......
A8U4X9_9LACT/266-423...D.....NDQ-ISI.E-----PLH---------------------------------------------LVN......
C2BE93_9FIRM/280-436...D.....NEE-LMA.A-----PVD---------------------------------------------YVN......
Q2LPI7_SYNAS/276-429...D.....NPT-MES.Y-----SSE---------------------------------------------YIM......
D1YS72_9FIRM/320-467...E....YRKK-IIL.R-----PQE---------------------------------------------ISN......
A8U750_9LACT/270-423...N.....NRD-ILM.L-----PCD---------------------------------------------MTN......
D4CC53_9CLOT/291-448...E.....EPQ-LFCPA-----DVD---------------------------------------------YVH......
A8WP03_CAEBR/305-459...N.....NPE-FYF.A-----PCD---------------------------------------------FTN......
D1Y3R2_9BACT/278-433...R.....NPG-VVV.E-----PLE---------------------------------------------FIN......
B2W452_PYRTR/302-453...R....YAPK-LLL.R-----SQQ---------------------------------------------VSN......
Q0RWG8_RHOSR/538-685...F....YRQH-IRL.R-----PQE---------------------------------------------ISN......
B0RN66_XANCB/323-470...F....YRQR-IVM.R-----TQE---------------------------------------------ISN......
B6WBS6_9FIRM/278-434...N.....NEE-LCA.A-----PVD---------------------------------------------YCN......
A1TGQ6_MYCVP/271-426...G.....NED-VAF.L-----PVE---------------------------------------------IVN......
A5E2Y9_LODEL/243-394...T....YSKK-LCL.R-----SQV---------------------------------------------VSN......
A7HPG3_PARL1/328-491...M.....RDK-IAM.V-----PVA---------------------------------------------YVNDL....
D2RM64_ACIFV/277-437...E.....NRD-ILI.K-----GGY---------------------------------------------YTN......
B0SDE8_LEPBA/320-467...A....WKSK-FVI.R-----PQE---------------------------------------------ISN......
Q0AY76_SYNWW/278-434...D.....NTK-CAI.Y-----PVN---------------------------------------------YTN......
O29120_ARCFU/297-457...R.....NPE-VAT.Y-----PVD---------------------------------------------YTN......
Q2SL76_HAHCH/439-606SDEE.....HQK-FCM.T-----SVN---------------------------------------------FINHLYDHK
Q39MJ3_BURS3/277-426...R.....NPA-LEL.R-----GTE---------------------------------------------YTH......
ACH1_YARLI/333-484...E....FSKK-LLL.R-----SQV---------------------------------------------VSN......
O28424_ARCFU/289-449...R.....NPE-VAT.Y-----PVE---------------------------------------------YTN......
A7HD82_ANADF/326-473...R....YRKQ-IIL.R-----PQD---------------------------------------------VSN......
D1VTU7_9FIRM/278-435...N.....NAQ-AMA.V-----PVD---------------------------------------------YTN......
C8PKJ5_9PROT/322-468...F....YRKH-IIL.R-----SQD---------------------------------------------VSN......
C5DU17_ZYGRC/331-482...F....FKEK-LCL.R-----SQV---------------------------------------------VSN......
D4JBB9_9FIRM/276-431...H.....NEN-IYN.A-----YFS---------------------------------------------FAN......
B5EIE5_GEOBB/327-478...F....YTGK-VVL.R-----PMQ---------------------------------------------ISN......
C9LNB4_9FIRM/338-485...K....YSKK-IIL.R-----PQE---------------------------------------------ISN......
B0DKN0_LACBS/350-501...Q....YKDR-LLL.R-----SQQ---------------------------------------------VAN......
B6K306_SCHJY/330-481...F....YKSR-IIL.R-----QQS---------------------------------------------ITN......
ACH1_SCHPO/330-481...Y....YKER-ILL.R-----PQV---------------------------------------------ISN......
C9QLV8_VIBOR/273-428...G.....NTD-VEM.G-----EIH---------------------------------------------KVV......
A0LG92_SYNFM/280-432...D.....NPG-IEF.H-----PSD---------------------------------------------YVN......
Q74GS1_GEOSL/327-478...K....YSDK-VIM.R-----PLS---------------------------------------------IAN......
A5V7D2_SPHWW/272-423...G.....HAA-WAF.R-----PVS---------------------------------------------HTH......
B3QA43_RHOPT/260-409...Q.....SKS-VLM.Q-----PAA---------------------------------------------YTH......
Q0AV35_SYNWW/283-439...E.....NPS-CQL.Y-----PGS---------------------------------------------YTN......
D2V812_NAEGR/332-483...N....YKNK-IVL.R-----PQT---------------------------------------------ISN......
C6RKT5_ACIRA/265-414...Q.....NSG-IEL.R-----STE---------------------------------------------YTH......
D2RN63_ACIFV/277-434...E.....KPE-LFYPA-----EVD---------------------------------------------YVH......
B6BXE3_9GAMM/420-583...E.....REQ-FCM.K-----RVA---------------------------------------------YVNQL....
B9M8L3_GEOSF/333-484...K....YTSR-TLL.R-----PIQ---------------------------------------------ITN......
Q6LQ13_PHOPR/472-639TDAE.....HDQ-FCM.T-----SVN---------------------------------------------YVNELYDHF
A8ZWK6_DESOH/447-610...E.....RKQ-FIM.T-----GVA---------------------------------------------YVNQL....
A1W2A3_ACISJ/277-426...R.....NPQ-IEL.R-----GTD---------------------------------------------YTH......
E8WNL5_GEOS8/334-485...R....YTKY-TVI.R-----PIQ---------------------------------------------ITN......
A6F2B7_9ALTE/443-610...D.....RQR-ICM.T-----SVN---------------------------------------------YINHLYDHA
C6E1J1_GEOSM/332-483...K....YFDK-IVL.R-----PLS---------------------------------------------ISN......
B1KCQ5_BURCC/265-415...R.....NDA-IEF.R-----STR---------------------------------------------YTH......
B6JG54_OLICO/334-497...R.....LDR-IRM.M-----PVS---------------------------------------------FTNAL....
Q48PY5_PSE14/293-456...R.....LAQ-FNM.T-----AIS---------------------------------------------YINEL....
B7X026_COMTE/264-413...C.....NPR-LQM.R-----DTA---------------------------------------------YTH......
Q0VNK9_ALCBS/436-599...E.....HAQ-INM.T-----RIS---------------------------------------------FINHL....
A6GMY9_9BURK/440-605PLAE.....RNS-IHM.L-----GVE---------------------------------------------HVNQL....
D3BTR1_POLPA/348-499...S....YSTK-FVL.R-----NQS---------------------------------------------ISN......
B8FMI7_DESAA/441-604...E.....RKK-FEM.T-----GVK---------------------------------------------VVN......
B7RUX5_9GAMM/428-591...EE...GHER-ICM.T-----GVQ---------------------------------------------RTNQL....
C0WBA5_9FIRM/277-434...D.....RPD-LFYPA-----DVD---------------------------------------------YIH......
A3X024_9BRAD/334-497...E.....LSR-IQM.T-----AVS---------------------------------------------FTNEL....
D2I933_9PSED/265-414...R.....NRS-VHM.R-----SSA---------------------------------------------YTH......
ACH1_DICDI/341-492...N....YKSK-IIL.R-----NQA---------------------------------------------ISN......
Q7WPS8_BORBR/266-415...R.....NPR-LML.Q-----GTD---------------------------------------------YTH......
Q0BZS7_HYPNA/258-410...T.....AQN-VHF.H-----PVS---------------------------------------------KTH......
B5JUR7_9GAMM/382-545...DASPELLAK-INM.S-----SVG---------------------------------------------LINQL....
Q1DA17_MYXXD/323-474...R....SKDR-LVL.R-----PMW---------------------------------------------LSN......
A4BC21_9GAMM/441-604...Q.....LNE-INM.T-----TVS---------------------------------------------YTNQL....
A1SHN0_NOCSJ/246-396...G.....NER-VEM.V-----RTE---------------------------------------------VTN......
C0QKG0_DESAH/440-603...Q.....LKL-IDM.R-----GVD---------------------------------------------YVNQL....
B4W858_9CAUL/256-409...E.....QDQ-LRV.V-----GCE---------------------------------------------TTH......
D4HE27_PROAS/229-379...E.....NPR-VQL.L-----RCE---------------------------------------------KTN......
Q88CB5_PSEPK/319-482...Q.....RAQ-FVM.T-----RIS---------------------------------------------FINEL....
A8ZT97_DESOH/278-429...D.....NPS-IEF.F-----PAD---------------------------------------------YVS......
A6FHC1_9GAMM/461-628...D.....HAK-FCM.T-----SVK---------------------------------------------YVNDLYDHF
D0LM00_HALO1/437-597...E.....RRR-IFM.T-----GVD---------------------------------------------RVNQLA...
Q0RK43_FRAAA/215-365...R.....NPR-VRL.L-----RTE---------------------------------------------TVN......
D1A9C8_THECD/271-421...R.....NRR-VRM.L-----RTE---------------------------------------------KTN......
Q2JCQ5_FRASC/281-431...R.....NPR-LLL.V-----RTE---------------------------------------------IVN......
Q0C1R5_HYPNA/318-481...D....LLSQ-INM.T-----SVA---------------------------------------------DVNAL....
C1BAX8_RHOOB/254-402...G.....LP.-VAF.R-----PAS---------------------------------------------YTH......
C7LYG5_ACIFD/255-405...R.....NPR-LRL.L-----RTE---------------------------------------------TIN......
B5WIH5_9BURK/265-416...G.....NAA-VEF.H-----PCS---------------------------------------------LTH......
Q8PH95_XANAC/342-506...DLDASTRAA-IGM.R-----RIS---------------------------------------------EINQLY...
D2UEK6_XANAP/366-529...T.....RAG-IGM.H-----RIS---------------------------------------------EINQL....
Q1YGK6_MOBAS/339-501...R.....RAL-LSM.R-----EIS---------------------------------------------FVNALP...
Q0FWB7_9RHOB/199-349...N.....NPD-IAM.A-----SAM---------------------------------------------TTH......
C1B5D3_RHOOB/255-406...S.....NTG-IDF.V-----HLD---------------------------------------------ELL......
B8FN92_DESAA/282-434...K.....NPL-VEF.Q-----ALD---------------------------------------------VLA......
A3TKM8_9MICO/259-409...T.....NSR-VRM.R-----RTE---------------------------------------------IVN......
B8L3Z6_9GAMM/367-531...E.....CRA-IGM.R-----RIS---------------------------------------------EINQLY...
C0QDF6_DESAH/275-427...N.....NPM-VEF.Q-----SID---------------------------------------------QVF......
C0QHQ8_DESAH/271-423...R.....NPL-IEF.Q-----GVG---------------------------------------------QVF......

PF04223

Q99ZK7_STRP1/45-510---------QVV-ILTDN-----LVP---------------------------------------------YPN------
Q9CGA7_LACLA/46-510---------TVV-AITDS-----LVS---------------------------------------------YPN------
CILA_HAEIN/33-498---------KVV-LLTEE-----FVE---------------------------------------------YPH------
CILA_ECOLI/43-508---------QVV-MLTEE-----LLP---------------------------------------------YPH------
Q9KTT9_VIBCH/66-531---------KVV-MLTEA-----IVG---------------------------------------------FPN------

PF01144

SCOA_XANCP/13-225---A-----ALA-G-V-V-----A-D-----------GQ-----------------------TLAVGGFGLCG.------
GCTB_ACIFV/10-224---V-----TIA-K-Q-I-----K-N-----------GQ-----------------------VVTVG....TG.------
PCAJ_PSEPU/9-206---Q-----RVA-A-D-I-----Q-E-----------GA-----------------------YVNLG....IG.------
GCTA_ACIFV/4-241---D-----AIA-K-Y-V-----H-S-----------GD-----------------------HIALGGFTTDR.------
Q9Y916_AERPE/14-262---E-----ALS-.-N-I-----R-D-----------GS-----------------------VVAISGFNMAM.------
SCOT_CAEEL/300-499---A-----RAA-L-E-F-----T-D-----------GM-----------------------YANLG....IG.------
SCOB_HELPY/2-198---K-----RAA-K-E-L-----K-E-----------GM-----------------------YVNLG....IG.------
YODS_BACSU/7-219---T-----AIA-.-D-V-----R-D-----------GS-----------------------VLMFGGFGGVG.------
Q9RZA0_DEIRA/23-234---Q-----AAS-.-R-V-----K-S-----------GQ-----------------------TLLVGGFGMTG.------
ATOA_HAEIN/4-200---R-----RIA-M-E-L-----H-D-----------GD-----------------------IVNLG....IG.------
CTFA_CLOAB/5-216---N-----LRS-.-F-F-----K-D-----------GM-----------------------TIMIGGFLNCG.------
PCAI_PSEPU/6-219---S-----AVE-.-G-I-----T-D-----------GS-----------------------TIMVGGFGTAG.------
CTFB_CLOAB/9-205---K-----RVA-R-E-L-----K-N-----------GQ-----------------------LVNLG....VG.------
PCAI_ACIAD/6-219---E-----ALS-.-Q-I-----H-D-----------GA-----------------------TILIGGFGTAG.------
Q9ZAM2_SPHSX/6-218---A-----ALE-G-L-L-----F-D-----------GM-----------------------TIMSGGFGLSG.------
SCOT1_HUMAN/43-272---E-----AVK-.-D-I-----P-D-----------GA-----------------------TVLVGGFGLCG.------
SCOA_MYCTU/5-234---E-----AVA-.-D-I-----A-N-----------GS-----------------------SLAVGGFGLCG.------
Q973S5_SULTO/3-202---K-----AIS-L-L-L-----E-D-----------GE-----------------------KVYIG....LNS------
Q9RZ86_DEIRA/5-217---E-----ALR-D-I-V-----H-D-----------GQ-----------------------TVAVGGFGLCG.------
SCOA_BACSU/5-216---E-----AAK-.-L-I-----H-D-----------GD-----------------------TLIAGGFGLCG.------
PCAJ_ACIAD/8-206---Q-----RVA-Q-D-I-----P-E-----------GS-----------------------YVNLG....IG.------
SCOT1_HUMAN/302-501---K-----RAA-L-E-F-----E-D-----------GM-----------------------YANLG....IG.------
YDIF_ECOLI/15-253---E-----AVN-.-Y-I-----P-D-----------EA-----------------------TLCVLGAGGGIL------
SCOT_CAEEL/40-271---E-----AVK-.-D-I-----P-D-----------NA-----------------------KLLVGGFGLCG.------
Q9KHD5_STRGR/16-242---D-----LIR-R-F-V-----R-E-----------GD-----------------------HVHAA...ATMS------
SCOB_BACSU/5-202---K-----RAV-Q-E-I-----K-D-----------GM-----------------------NVNLG....IG.------
Q9XAM7_STRCO/5-234---A-----AVA-.-D-V-----A-D-----------GA-----------------------SLAVGGFGLSG.------
Y1199_ARCFU/148-369---E-----AVS-N-F-I-----K-D-----------GM-----------------------YVASGGFGHVR.------
Q8PDH3_XANCP/7-217---V-----AAA-R-R-L-----P-D-----------GA-----------------------VCFVG....IG.------
Q8RGS9_FUSNN/11-226---I-----TIA-K-E-I-----K-D-----------GQ-----------------------IVIVG....TG.------
SCOA_HELPY/5-216---K-----ALS-.-A-L-----K-D-----------GD-----------------------TILVGGFGLCG.------
ATOD_HAEIN/5-216---N-----LNQ-.-H-L-----H-D-----------GM-----------------------SIMFGGFMGIG.------
Q8F685_LEPIN/8-247---E-----MIR-E-T-V-----Q-P-----------KM-----------------------YLHLS...ATMS------
Y3551_MYCTU/5-233---D-----AVA-.-Q-L-----R-S-----------GM-----------------------TIGIAGWGSRR.------
Q9W058_DROME/37-266---D-----AVA-.-D-V-----Q-D-----------GA-----------------------QILFGGFGICG.------
Q97Z51_SULSO/6-206---K-----AIS-T-L-L-----E-D-----------GE-----------------------LVYIG....LNS------
SCOB_MYCTU/8-205---A-----RVA-A-E-F-----E-D-----------GQ-----------------------YVNLG....IG.------
ATOA_ECOLI/4-198---R-----RVA-Q-E-L-----R-D-----------GD-----------------------IVNLG....IG.------
ATOD_ECOLI/5-216---D-----ATG-.-F-F-----R-D-----------GM-----------------------TIMVGGFMGIG.------
CATJ_PSESB/7-217---V-----AAA-R-R-L-----K-N-----------GA-----------------------VCFVG....IG.------
Q9RPK0_CLOBE/4-215---D-----LKR-.-I-F-----K-D-----------GM-----------------------TIMVGGFLDCG.------
Q98EM4_RHILO/9-219---I-----AAS-R-A-L-----R-N-----------DD-----------------------VCFVG....IG.------
Q92TL1_RHIME/7-217---V-----AAA-R-A-L-----S-N-----------DD-----------------------VCFVG....IG.------

PF00455

Q98FV5_RHILO/85-241---A-----IAA-T-M-V-----R-D---.-------GD-----------------------AVIVH----GGS------
A9CFA5_AGRT5/77-236---R-----KAV-D-L-C-----N-D---.-------GD-----------------------AIILN----GGT------
D2AF69_SHIF2/74-232---K-----AAS-Q-L-V-----N-P---.-------GE-----------------------SVVIN----CGS------
A3GRG9_VIBCL/64-222---L-----KAA-E-L-C-----Q-P---.-------GD-----------------------SVVIN----CGS------
C1HRF0_9ESCH/77-237---A-----LAR-T-M-I-----K-D---.-------GD-----------------------CFFLD----SGS------
B2TV88_SHIB3/73-234---K-----LAA-T-L-V-----E-P---.-------DQ-----------------------TLFFD----CGT------
Q74VM8_YERPE/40-201---Q-----LAA-Q-L-I-----I-E---.-------ND-----------------------TVFFD----CGT------
A9CH78_AGRT5/77-238---R-----QAA-V-M-I-----E-P---.-------YD-----------------------TVFID----CGT------
Q98JJ0_RHILO/75-236---A-----HAV-R-K-I-----R-P---.-------DE-----------------------TIFID----CGT------
Q8EUZ1_MYCPE/76-234---K-----KAV-K-L-V-----G-Q---.-------YK-----------------------TIYLD----SGS------
C8JX63_LISMN/77-238---D-----IAK-S-L-I-----R-D---.-------DM-----------------------VIFLD----SSS------
Q98AQ9_RHILO/73-233---E-----IAL-G-L-L-----K-P---.-------GQ-----------------------NLFFG----GGS------
Q981R3_RHILO/73-234---E-----IAL-G-L-L-----K-P---.-------GQ-----------------------NLFFG----GGS------
A5LBQ8_STRPN/73-236---S-----LAK-D-F-I-----R-S---.-------GM-----------------------CIYLD----SST------
F0K641_CLOAE/74-233---R-----LAA-G-L-I-----K-E---.-------ND-----------------------IVYIG----PGT------
F0K625_CLOAE/77-236---K-----IAA-S-M-V-----E-E---.-------ND-----------------------IIYIG----PGT------
F0K630_CLOAE/77-236---K-----LAS-E-M-I-----E-E---.-------ND-----------------------IIYIG----PGT------
B2IPU4_STRPS/76-235---H-----FAG-S-L-V-----E-E---.-------RE-----------------------TIFIG----PGT------
A7X580_STAA1/74-235---R-----KAA-S-L-I-----E-D---.-------GD-----------------------TLFFG----PGT------
Q8Y5F7_LISMO/73-231---Y-----VAG-K-V-I-----K-D---.-------HM-----------------------TIYLD----VST------
D4G3X3_BACNA/71-232---H-----YAS-R-F-I-----E-D---.-------HD-----------------------LVFID----SGT------
Q8Y9Y5_LISMO/73-234---K-----AAA-D-F-I-----E-E---.-------ND-----------------------LIFID----SGT------
A1EKM8_VIBCL/74-235---Q-----RVA-Q-E-L-----P-E---.-------GC-----------------------SIFLG----IGT------
E7HVG7_ECOLX/61-222---E-----AVA-D-Y-I-----P-D---.-------GS-----------------------TIFIT----IGT------
A1KUY5_NEIMF/73-235---R-----LIA-E-H-I-----P-D---.-------GS-----------------------SLFVS----IGT------
F0AXV7_NEIME/73-235---R-----LIA-E-H-I-----P-D---.-------ES-----------------------SLFVS----IGT------
Q89SG7_BRAJA/73-234---A-----AAA-S-L-I-----P-N---.-------GC-----------------------SLFIN----IGT------
D1CVD5_9RHIZ/72-233---R-----ATA-A-I-I-----P-D---.-------GA-----------------------SLFIN----IGT------
Q98M65_RHILO/72-233---R-----AAA-R-L-I-----P-D---.-------NA-----------------------SLFIN----IGT------
A9CFT8_AGRT5/72-233---A-----AAA-A-L-I-----P-N---.-------NS-----------------------SLFIN----IGT------
A6A9M5_VIBCL/30-192---M-----ALV-Q-H-I-----P-D---.-------GA-----------------------TLFID----IGT------
B7LSC5_ESCF3/72-233---R-----KVA-E-Q-I-----P-N---.-------GS-----------------------TLFID----IGT------
B0HA18_YERPE/72-233---Q-----RVA-S-Q-I-----P-D---.-------GA-----------------------TLFID----IGT------
A3KXL0_PSEAI/72-232---E-----AVA-S-L-V-----P-D---.-------NA-----------------------SLFIN----IGT------
Q7VVL2_BORPE/73-234---E-----AVA-R-A-V-----P-D---.-------GC-----------------------SLLIN----IGT------
Q8PQG4_XANAC/70-231---A-----RVA-R-F-I-----P-D---.-------DA-----------------------SLFIN----LGT------
Q4UZR5_XANC8/75-236---T-----QVA-R-F-I-----P-D---.-------DA-----------------------SLFIN----LGT------
F0KE27_CLOAE/66-227---K-----EGI-K-F-V-----D-N---.-------GD-----------------------TILIE----AGS------
A5L9H2_STRPN/66-228---Q-----EAV-K-L-V-----S-D---.-------NE-----------------------TIMIE----SGS------
E7JQT8_ECOLX/57-218---E-----FAA-S-L-V-----Q-P---.-------GE-----------------------TIFIE----NGS------
Q0TE54_ECOL5/35-195---R-----EAL-A-W-I-----E-E---.-------GM-----------------------VIALD----ASS------
ACCR_AGRT5/76-238---G-----VVA-G-M-I-----V-E---.-------GD-----------------------TVLLD----AGT------
Q9X0F8_THEMA/72-234---Q-----LAL-N-F-V-----E-D---.-------GD-----------------------IIFLD----AST------
A8A3I4_ECOHS/72-233---E-----AAV-S-F-I-----H-D---.-------GD-----------------------SIILD----AGS------
A6VF27_PSEA7/73-234---R-----AAA-A-R-I-----R-E---.-------HA-----------------------RIIID----SGS------
C6RV01_VIBCL/51-212---K-----AAA-K-L-I-----R-D---.-------HN-----------------------RIVID----SGS------
F0KD65_CLOAE/73-236---K-----KAF-D-L-I-----E-D---.-------DE-----------------------TIFLD----IST------
E8VCQ6_BACST/73-232---R-----LAA-S-L-I-----H-D---.-------GD-----------------------RVILD----AST------
Q8EMN4_OCEIH/73-232---K-----KAA-S-L-I-----Y-P---.-------GD-----------------------RIILD----AST------
A6BYH2_YERPE/90-250---K-----AAL-Q-F-I-----R-P---.-------GD-----------------------CILLD----NSS------
F0KE01_CLOAE/74-232---K-----KAA-S-L-I-----K-D---.-------DD-----------------------FIFID----SGS------
B1XGN1_ECODH/74-234---R-----KAL-P-F-I-----D-N---.-------KT-----------------------TMAAD----SSS------
D8BZ57_ECOLX/76-237---K-----AAV-E-L-I-----Q-P---.-------GH-----------------------RVILD----SGT------
D0JQZ5_YERP1/66-227---Q-----AAA-K-L-I-----N-S---.-------GD-----------------------TVILD----SGT------
A0AL51_LISW6/73-233---T-----LAA-T-M-V-----K-D---.-------GD-----------------------TIILD----AGT------
B7R6U7_9THEO/72-233---A-----KAV-T-E-I-----K-E---.-------GN-----------------------VIFLD----AGS------
F0K3P1_CLOAE/73-235---K-----YAA-N-M-I-----K-N---.-------GD-----------------------TIILD----SGT------
Q8R736_THETN/73-233---R-----IAA-S-L-I-----E-E---.-------GD-----------------------TILLD----SGT------
A5IQQ2_STAA9/74-233---K-----IAA-N-Q-I-----N-D---.-------NE-----------------------CLFID----AGS------
Q8ES05_OCEIH/73-232---K-----FAA-S-L-I-----E-E---.-------ND-----------------------VIYLD----AGT------
B2DGW4_STRPN/73-230---Q-----KAA-S-L-I-----K-E---.-------KD-----------------------VIFID----AGT------
FRUR_BACSU/73-233---E-----KAA-S-L-L-----E-E---.-------GD-----------------------CIYLD----AGT------
C8JQW1_LISMN/73-231---A-----YCA-S-L-V-----E-E---.-------ND-----------------------CIYLD----AGS------
C8JX72_LISMN/73-234---K-----EAA-T-L-V-----K-N---.-------NQ-----------------------TIILD----ASS------
D4G0K5_BACNA/73-233---H-----EAA-K-Y-V-----K-S---.-------GD-----------------------RIILD----AST------
Q8ESW8_OCEIH/74-234---M-----EAI-K-H-V-----F-E---.-------GD-----------------------KIILD----AST------
E0DWD0_9RHIZ/59-219---E-----AAM-Q-F-V-----E-P---.-------GQ-----------------------AIFFD----DST------
E2PMQ2_9RHIZ/40-200---R-----AAL-E-L-V-----E-P---.-------GM-----------------------TVMVN----DGS------
Q986N7_RHILO/99-259---A-----AAV-A-M-I-----E-P---.-------GQ-----------------------TVIID----DGS------
Q988Q4_RHILO/54-215---Q-----TAA-T-M-I-----E-P---.-------GE-----------------------FIFLD----SGS------
D6EGH9_STRLI/73-234---S-----AAA-G-L-V-----R-P---.-------GG-----------------------VVILD----GGT------
A9CHG2_AGRT5/74-235---R-----AVV-P-L-I-----E-P---.-------GM-----------------------VVFID----AGS------
Q98GA9_RHILO/77-238---R-----GAA-G-L-V-----E-K---.-------GH-----------------------IVMID----GGS------
Q7D3J6_AGRT5/73-234---K-----AAV-Q-I-L-----K-G---.-------AQ-----------------------VLMIG----SGS------
Q92UW3_RHIME/79-240---R-----KAA-E-L-V-----K-D---.-------GM-----------------------VVFLD----SGT------
A3KS48_PSEAI/73-232---R-----YAA-G-L-F-----G-P---.-------GD-----------------------SIFID----TGT------
Q98BY9_RHILO/72-233---R-----MVA-A-T-I-----R-D---.-------GE-----------------------SVMLD----TGT------
A7FKD3_YERP3/73-236---V-----LAA-M-L-I-----E-P---.-------GQ-----------------------TLYLD----AGT------
A5VTQ1_BRUO2/73-233---Q-----LAA-Q-M-I-----R-P---.-------GT-----------------------VIYLD----AGT------
E2WXM3_ECOLX/61-221---K-----LAA-S-L-V-----Q-P---.-------GS-----------------------CIYLD----AGT------
C4HNN4_YERPE/24-184---T-----SAA-L-H-I-----P-R---.-------NS-----------------------CIYLD----AGT------
Q986T2_RHILO/73-234---R-----AAV-E-L-F-----E-D---.-------NQ-----------------------SVIFD----GGS------
Q9RZP5_DEIRA/81-244---G-----RAL-E-L-I-----A-P---.-------GQ-----------------------TLYLD----AGT------
Q9K3L7_STRCO/72-240---Q-----AVA-A-L-V-----A-P---.-------GE-----------------------AVGLT----GGT------
Q9AD80_STRCO/61-222---D-----LAA-G-L-V-----E-E---.-------GE-----------------------AIVVG----AGT------
D6EU29_STRLI/80-248---R-----AAA-E-L-V-----A-P---.-------GA-----------------------AIALS----GGT------
Q5UXV7_HALMA/71-231---K-----RAV-D-E-L-----S-D---.-------GD-----------------------AVFFD----TGP------
Q5V513_HALMA/73-232---E-----RAA-Q-E-V-----R-E---.-------GQ-----------------------VVCFD----AGS------
D6ELC2_STRLI/78-239---S-----AAV-E-L-L-----G-D---.-------AE-----------------------TVFVD----EGF------
Q5YVT8_NOCFA/74-236---K-----AAL-D-Y-L-----P-P---T-------GG-----------------------SVLFD----AGT------
D6ETC7_STRLI/73-234---R-----AAL-A-E-L-----P-A---.-------EG-----------------------TLILD----AGS------

PF02550

O28424_ARCFU/3-199---E-----EAA-N-L-V-----K-D-----------GM-----------------------HIEIGG..SAN-------
O29120_ARCFU/9-201---E-----EAA-G-L-V-----E-S-----------GM-----------------------HIELGG..AAN-------
P73661_SYNY3/6-196---E-----KFA-S-Y-S-----E-I-----------FS-----------------------HIHRGDRLFIS-------
ACH1_YEAST/12-230---H-----ELI-P-L-F-----K-N-----------GQ-----------------------YLGWSGFTGVG-------
SCPC_ECOLI/1-213---.-----EAA-E-I-I-----Q-H-----------ND-----------------------MVAFSGFTPAG-------

PF01008

EI2BD_MOUSE/219-510---H-----ALQ-Q-V-I-----Q-D-----------YT...TPPSEELSR.....DLVNKLKPYISFLTQCRP------
EI2B2_METJA/22-292---K-----ALK-E-Y-A-----L-K-----------IS...HLNEEEF.........KNKMREAGNILISARP------
EI2BB_YEAST/33-358---Q-----LLM-R-F-I-----S-A-----------AR...WNHVNDL.........IEQIRDLGNSLEKAHP------
MTNA_BACSU/49-337---F-----GLA-L-A-A-----K-D-----------IE...TDNVTEF.........RRRLEDIKQYLNSSRP------
MTNA_ARCFU/41-327---Y-----GIA-L-A-A-----R-E-----------RE...FADVDEL.........KEHLKKAADFLASTRP------
EI2BA_HUMAN/15-293---R-----TLL-E-F-L-----K-R-----------DK...GETIQGL.........RANLTSAIETLCGVD.------
MTNA_SYNY3/51-343---Y-----GMY-L-G-A-----R-R-----------IQ...TTELREF.........VVQLEFVADQLRQTRP------
MTNA_METTH/44-310---F-----GVA-M-A-E-----L-A-----------GE.....................DVEVAAEEIKASRP------
MTNA_CAEEL/66-357---L-----GLL-L-E-I-----Q-K-----------AS........EL........DSESIIQKINFLISSRP------
EI2BA_CAEEL/15-293---E-----TLL-E-V-L-----D-R-----------SR...ATTVAEF.........QNELNQVVAALEKTDY------
EI2BA_YEAST/15-292---E-----ALV-T-L-L-----R-I-----------KT...PETAAEM.........INTIKSSTEELIKSIP------
EI2BD_YEAST/285-637---E-----VFQ-I-V-I-----K-D-----------YQ...TPKGTTLSR.....NLTSYLSHQIDLLKKARP------
MTNA_METJA/48-319---Y-----GLA-L-A-E-----I-N-----------GD.....................DIYKAYEVLKNTRP------
EI2BB_RABIT/27-333---G-----LLR-R-I-I-----T-D-----------HR...WSNAGEL.........MELIRREGRRMMAAQP------
MTNA_YEAST/49-399---L-----SVL-T-E-V-----Q-L-----------IKHNPTSDVATLYSLVNWESTKTVLNKRLDFLLSSRP------
EI2BD_SCHPO/156-452---K-----TFK-I-V-I-----Q-D-----------YQ...TPYGTTLSR.....HLTTHINSQIAYLVSTRP------
Q5V075_HALMA/195-460---E-----VLR-D-E-A-----A-L-----------AD...AGRSDDLETAERDGDDWEALAALAAEIREARP------
EI2B2_ARCFU/15-284---E-----TLM-K-F-A-----E-K-----------AS......DEKF.........DEEMRFAAETLLNTRP------

PF04198

YJHU_ECOLI/63-323---M-----YLN-Q.V-I-----E.N-----------GD---------------------..VLGVA----WGR------
Q9WWA6_AGRRK/83-337---Q-----YLN-A.R-L-----S.D-----------Q.---------------------.MSLGII----SGR------
Q9CKH2_PASMU/56-313---A-----YLS-S.T-L-----K.D-----------G.---------------------.MTVAVG----QGR------
Q98GB2_RHILO/49-296---L-----LRQ-A.Q-L-----V.A-----------GS---------------------..VVAIG----WGR------
Q9RT33_DEIRA/86-346---H-----WLG-S.A-L-----R.P-----------GL---------------------..VVGLA----WGN------
Q986P9_RHILO/64-319---Q-----FLK-R.E-I-----E.R-----------GE---------------------EALIGVG----HGR------
Q97L54_CLOAB/89-338---K-----FIQ-S.I-I-----L.D-----------GD---------------------..IVAIT----GGT------
CGGR_BACMD/89-339---S-----CIK-ERL-V-----G.K-----------KN---------------------..TVAVT----GGT------
Q9Z5C6_STAAU/89-337---Q-----LLE-G.I-L-----Q.E-----------DA---------------------..IVAVT----GGS------
O68117_RHOCA/59-314---Q-----LLE-R.Y-L-----A.Q-----------PE---------------------PLIIAFG----TGR------
Q9CGB1_LACLA/54-307---K-----RIE-S.H-I-----L.N-----------SQ---------------------..TVGTV----WGE------
Q98CZ8_RHILO/62-317---A-----EIE-R.R-L-----R.S-----------PT---------------------PIVMGIG----TGR------
Q97SS7_STRPN/56-313---G-----VLR-N.L-I-----D.D-----------NM---------------------..KIGFS----WGK------
Q9L0Z6_STRCO/89-343---D-----LLG-E.L-V-----N.E-----------GD---------------------..VLGLA----WGR------
O52721_KLEPN/59-312---Q-----LMA-R.Y-L-----Q.D-----------DK---------------------EKIICLG----SGL------
O30830_RHOSH/62-317---A-----EVE-R.V-L-----R.S-----------ER---------------------PMVVAFG----TGR------
Q9RGG7_LACCA/60-316---M-----FLS-K.I-I-----K.S-----------DD---------------------..VIGLS----WGS------
Q99XS9_STRP1/56-314---E-----VFR-H.V-V-----K.D-----------GD---------------------..KIGLS----WGA------
O86289_LEUME/54-309---T-----YVD-E.V-L-----QGN-----------NK---------------------..IVGLT----WGE------
O32754_9LACO/124-376---S-----ALS-L.L-L-----PLA-----------DC---------------------..IVTVM----GGK------
Q9CLG2_PASMU/68-318---Q-----MLM-S.M-L-----K.P-----------NQ---------------------..RLAIG----FGE------
Q9ZB29_BRUAO/56-311---N-----FMR-R.E-I-----E.H-----------GD---------------------HEVIGIG----HGR------
SORC_KLEPN/57-315---L-----LVD-R.L-L-----E.P-----------GD---------------------..IIGFS----WGR------
LSRR_ECOLI/66-316---H-----MLM-S.L-L-----Q.P-----------QQ---------------------..MLAIG----FGE------
Q9KER9_BACHD/57-313---Y-----YVS-K.N-I-----K.G-----------MD---------------------..SIGIS----WGT------
DEOR_BACSU/56-311---E-----YMH-E.T-V-----K.D-----------GD---------------------..IVGVS----WGT------
Q9KLX0_VIBCH/62-319---N-----YLT-S.T-L-----K.N-----------G.---------------------.MVVTVG----QGR------
CGGR_BACSU/89-338---A-----CMK-K.R-F-----S.G-----------KN---------------------..IVAVT----GGT------
Q9K712_BACHD/89-338---A-----RMK-E.A-V-----K.P-----------HD---------------------..VIAVM----GGT------
Q986M3_RHILO/57-311---S-----VFL-E.L-V-----K.K-----------GD---------------------..RIGVA----WGR------
Q98FV1_RHILO/42-296---A-----FLS-D.T-M-----K.S-----------GM---------------------..RVGVG----WGR------

PF01182

B5GBV6_9ACTO/16-220---I-----TLI-VEA-Q.....A-E...R.......GS---------------------.ASVALT----GGR------
Q5NMF8_ZYMMO/15-209---E-----FII-KQA-I.....E-K...K.......GR---------------------.ALIIVP----GGS------
A4S930_OSTLU/38-232---E-----ENA-RGC-L.....Q-E...R.......GA---------------------.FTMAVP----GGS------
Q1N5N6_9GAMM/18-207---E-----SAI-EES-L.....A-S...H.......SP---------------------.AMIALS----GGS------
B8HJV3_CYAP4/14-207---L-----ACC-QTA-L.....A-D...R.......GQ---------------------.FSLALA----GGS------
Q3SH15_THIDA/15-203---C-----AEA-EAD-I.....R-A...R.......GS---------------------.FHLVLA----GGN------
Q9GRG6_9TRYP/16-232---V-----EII-EAS-G.....S-Q...Q.......WP---------------------.LSIALA----GGS------
Q46TU2_CUPPJ/12-206---A-----CEL-ERT-L.....A-S...K.......EE---------------------.ACLAIS----GDR------
Q1YRK7_9GAMM/10-201---S-----DLL-KAA-I.....A-A...E.......GK---------------------.ASLVVS----GGR------
B4WRN6_9SYNE/15-208---V-----SVV-KEA-I.....A-S...S.......DQ---------------------.ATLALS----GGS------
D1BS91_XYLCX/15-219---L-----TRI-LDM-Q.....S-V...R.......RP---------------------.VHVVLT----GGT------
A3D4S3_SHEB5/16-206---A-----SQL-QEA-V.....D-A...R.......GK---------------------.ASLVVS----GGS------
B1XIZ0_SYNP2/14-205---M-----GRI-EEA-I.....A-R...R.......GV---------------------.CTIALA----GGS------
B8GMY0_THISH/18-214---L-----DLA-ARC-I.....R-A...H.......GV---------------------.FRIALA----GGR------
A9H335_GLUDA/20-218---T-----EQA-LAK-.......-T...D.......GP---------------------.FVVALS----GGS------
C8X5S3_DESRD/27-227---I-----QRA-FEA-V.....E-D...H.......GA---------------------.FVLGIS----GGS------
B6AXV5_9RHOB/12-202---A-----GDL-NAA-L.....H-H...E.......DR---------------------.ACLAVP----GGT------
A0YMV7_LYNSP/14-207---L-----DKI-EPA-I.....K-Q...R.......GR---------------------.FTLVLA----GGG------
A4FBN6_SACEN/2-207---I-----TAV-VDA-Q.....T-A...R.......GA---------------------.ASVVLT----GGR------
C3Q0C5_9BACE/16-210---L-----EAM-DKE-P......-............ER---------------------PFTIALS----GGT------
C5B9U1_EDWI9/13-205---A-----ERL-RQG-I.....A-A...C.......GQ---------------------.ASLVVS----GGR------
A5BJC3_VITVI/22-226---A-----ELS-EVS-V.....K-E...R.......GV---------------------.FAIALS----GGS------
D7W1T0_9FLAO/12-207---V-----DLS-KKS-I.....Q-K...K.......GS---------------------.FVVALS----GGS------
G6PE_HUMAN/563-760---E-----ATA-VRA-V.....R-R...F.......GQ---------------------.FHLALS----GGS------
C1DDK6_AZOVD/23-215---A-----EVL-RQA-I.....D-S...D.......GR---------------------.ASLLVS----GGR------
B7RZI6_9GAMM/13-205---A-----SRL-NRD-I.....E-I...R.......GA---------------------.ASLAVS----GGS------
Q7NGI9_GLOVI/14-209---E-----EAA-HAA-I.....A-L...H.......NR---------------------.FCVSLA----GGS------
A3JKP2_9ALTE/23-215---A-----LIL-RQR-L.....E-A...A.......PR---------------------.ASLALS----GGS------
B3EG95_CHLL2/16-243---I-----SKA-WQA-A.....A-D...R.......GR---------------------.FTFALS----GGR------
Q39SD7_GEOMG/11-206---A-----TAA-HSA-M.....R-D...T.......GR---------------------.FAVALA----GGD------
A8KYS2_FRASN/23-226---I-----TAL-VDA-Q.....A-A...R.......GE---------------------.ASIVLT----GGG------
A5L2I5_9GAMM/13-205---K-----AYS-EQ.-.......-....G.......KP---------------------.VHISLS----GGS------
A0L802_MAGSM/13-211---A-----QSL-TQA-M....LA-K...G.......DC---------------------PFHLAIS----GGS------
A8RIY7_9CLOT/12-210---A-----QKL-NEA-I.....E-K...K.......GK---------------------.ARIILS----TGA------
A5ZDU8_9BACE/12-206---V-----ELM-NE.-......E-P...D.......RI---------------------.FNIAVS----GGN------
B9HIF8_POPTR/22-226---A-----ELS-EAS-V.....K-E...R.......GV---------------------.FAIAIS----GGS------
D7BAW0_MEISD/16-192---A-----...-.ER-L.....S-A...G.......G.---------------------..RAVLA----GGQ------
D2SF51_GEOOG/32-236---V-----ARL-AAA-Q.....A-V...H.......GT---------------------.ASVVLT----GGG------
A3JTX7_9RHOB/12-202---T-----AEL-GYA-I.....E-K...N.......GA---------------------.ASLSVP----GGT------
C1D789_LARHH/13-209---L-----HLT-EYA-L.....R-A...R.......QT---------------------.ARLALA----GGQ------
Q3A631_PELCD/18-203---L-----AAA-SEA-I.....D-R...Q.......GV---------------------.FRLVLA----GGR------
A5FY02_ACICJ/17-214---A-----EEA-AAA-R......-............GR---------------------.FVAGLA----GGS------
SOL3_YEAS1/13-213---V-----KKQ-DEA-L.....Q-K...K.......SD---------------------.FKVSVS----GGS------
A1BIC7_CHLPD/16-245---I-----SAA-NRA-V.....A-T...H.......GK---------------------.FSLVLA----GGN------
B0C6U0_ACAM1/14-207---L-----AEI-KDA-I.....A-Q...R.......GR---------------------.CTIALA----GGN------
A0YBK5_9GAMM/13-210---R-----DTL-RNA-I.....E-E...K.......QS---------------------.ASLLVS----GGS------
B7KWH9_METC4/17-217---L-----AMA-ESA-.......-E...G.......ER---------------------.IAICLS----GGS------
C0W1H0_9ACTO/16-227---I-----QKI-SEL-S.....Q-Q...R.......SR---------------------.IQLGVS----GGS------
A4BU42_9GAMM/14-213---A-----NRA-ATA-V.....Q-Q...K.......GV---------------------.FSVALA----GGH------
A7RLB1_NEMVE/512-711---I-----KCA-DDA-V.....S-R...Q.......GV---------------------.FHMALS----GGS------
A8WGH0_XENTR/561-758---Q-----LAA-ESA-V.....Q-H...S.......GV---------------------.FHLALS----GGS------
C0WL49_9CORY/13-223---I-----ETI-AGI-Q.....A-G...NGGL.HGDGV---------------------.ARVVLT----GGG------
A9WT44_RENSM/14-231---I-----TKL-LDT-Q.....N-E...R.......GE---------------------.ATVVLT----GGT------
A2C1K7_PROM1/15-207---T-----QII-EST-L.....K-N...K.......TR---------------------.AKISLC----GGS------
Q1AZZ4_RUBXD/12-205---A-----ARA-AHA-V.....R-A...R.......GR---------------------.FAVALA----GGS------
B1VDQ7_CORU7/32-249---V-----RTV-TKV-Q.....R-E...QSGV.HGDGV---------------------.ARVVLT----GGG------
B4S4M1_PROA2/12-237---I-----SKA-LQA-I.....R-Q...H.......GW---------------------.CSLVLA----GGN------
A1SJQ5_NOCSJ/16-211---L-----TRL-ADA-Q.....A-A...G.......GV---------------------.PQIVLT----GGT------
C1BWG3_ESOLU/15-209---A-----SRA-DKA-L.....K-D...R.......GR---------------------.FTVGLS----GGS------
A1U1P6_MARAV/21-213---A-----DVL-ASR-L.....E-Q...A.......SR---------------------.ASLVVS----GGS------
Q3SP94_NITWN/24-223---I-----LRI-TEN-.......-A...T........R---------------------.PAICLT----GGS------
Q72QF1_LEPIC/12-197---K-----EIS-ANK-I.....Q-T...K.......SS---------------------.FHIVLT----GGD------
Q4RX98_TETNG/585-782---Q-----EAA-EAA-V.....R-E...G.......GV---------------------.FHLALS----GGA------
Q0FPX8_9RHOB/14-204---A-----GEL-RAA-L.....S-H...Q.......ER---------------------.AALAVP----GGT------
B8FL61_DESAA/21-219---L-----ECA-SSG-I.....R-E...R.......GR---------------------.FSAAFS----GGK------
C0DYF2_EIKCO/16-207---A-----NCL-RDC-L.....H-T...Q.......GH---------------------.AVLAVS----GGR------
B3RVC2_TRIAD/13-206---A-----EKS-SQA-I.....Q-D...H.......GF---------------------.FTIGFS----GGS------
Q0F2T0_9PROT/12-198---A-----ELC-RDA-V.....S-E...N.......GV---------------------.CHLVLA----GGS------
Q1IWW4_DEIGD/12-197---A-----QAA-REA-V.....A-A...R.......GA---------------------.FRVALS----GGS------
C6XUN5_PEDHD/12-206---I-----KIA-NKA-I.....A-E...Q.......DC---------------------.FNFVLT----GGN------
Q2JHW7_SYNJB/15-206---Q-----ARS-AAA-I.....R-E...R.......GR---------------------.FTVALA----GGS------
C3ZBQ0_BRAFL/574-772---K-----DIA-LQT-L.....Q-T...K.......EL---------------------.FHIAFS----GGK------
B5EPA9_ACIF5/19-206---A-----RMA-REA-I.....T-A...R.......GA---------------------.FHLVVA----GGT------
Q1IMT5_KORVE/24-219---A-----KSA-QEA-I.....A-A...R.......GR---------------------.FTIALS----GGS------
Q0FAR7_9RHOB/13-202---S-----NDL-REA-L.....K-I...........NK---------------------MVSLSVP----GGT------
B2IE85_BEII9/16-213---A-----NCV-ALA-.......-G...R........P---------------------.VSLCLS----GGS------
A6ED65_9SPHI/12-206---I-----TIA-NKA-I.....E-E...Q.......GC---------------------.FNFVLT----GGN------
A4QEF4_CORGB/13-205---I-----EVV-EAA-T.....A-N...N.......GT---------------------.AQVVLT----GGG------
Q83HQ1_TROW8/17-213---L-----LTL-ENV-L.....Q-K...K.......AS---------------------.AHVGLE----GGT------
Q165T6_ROSDO/12-202---A-----SGL-KKA-L.....S-I...Q.......ER---------------------.VSLAVP----GGT------
C3JSX9_RHOER/15-215---V-----TTI-VDA-Q.....K-A...R.......GF---------------------.ASIVLT----GGG------
B2GH88_KOCRD/18-222---L-----EVL-EAA-Q.....D-G...R.......GE---------------------.ATVVLT----GGS------
C6VSE7_DYAFD/12-207---N-----NYI-QQV-L.....A-K...Q.......DR---------------------.FTFVLS----GGS------
A1AR88_PELPD/14-209---A-----LTA-EQA-I.....A-S...Q.......GR---------------------.FSVLLS----GGE------
A6TTT0_ALKMQ/14-213---T-----ALA-MDS-I.....R-K...H.......GG---------------------.FTIGLS----GGS------
B0NQ39_BACSE/12-207---I-----DMM-NR.-......E-P...E.......RI---------------------.FYLAFS----GGT------
A9UYD4_MONBE/172-367---C-----EQA-EAA-I.....A-D...H.......QS---------------------.FSVAFS----GGS------
F2G576_ALTMD/14-206---V-----SIL-KTG-I.....K-T...R.......GR---------------------.ASLIVS----GGR------
B3MQE2_DROAN/19-215---K-----RLA-KEA-F.....T-R...Q.......EQ---------------------.FHVGLS----GGS------
Q31GB5_THICR/17-202---L-----ELA-EKA-I.....A-A...R.......GK---------------------.FLLVTA----GGT------
C5BV30_BEUC1/15-216---A-----LAI-ADA-Q.....A-V...A.......SP---------------------.VHVVLT----GGT------
C4FNH5_9FIRM/15-211---I-----DFT-NDE-I.....S-R...T.......ET---------------------.CIVGIT----GGT------
6PGL_DICDI/16-211---K-----NVI-TDS-I.....N-S...R.......NI---------------------.ATIGLS----GGS------
B6XUA3_9BIFI/15-234---L-----LTI-IDL-L.....A-E....P....GRRR---------------------.VDIAVT----GGT------
B6APC6_9BACT/25-225---V-----ARI-RER-V.....L-A...Q.......GH---------------------.ASVILA----GGG------
Q0G231_9RHIZ/15-207---A-----AVL-AGA-I.....A-T...R.......GS---------------------.ATLAVS----GGS------
Q6SFD3_9BACT/12-201---C-----RRL-QDG-I.....N-A...R.......GK---------------------.ATLVVS----GGS------
A0JWQ2_ARTS2/16-230---I-----TKL-VDV-Q.....D-K...H.......GE---------------------.ATVVLT----GGT------
Q60CQ2_METCA/13-209---A-----EDV-RAA-L.....A-T...D.......PA---------------------.AILAVS----GGR------
Q47EB6_DECAR/15-199---I-----AEA-EAA-I.....R-E...R.......QV---------------------.FRIVLA----GGN------
Q5YTR6_NOCFA/34-231---V-----EVV-VAA-Q.....A-E...R.......GS---------------------.ASVVLT----GGG------
A6E3P5_9RHOB/12-202---S-----TDL-RNA-L.....R-T...R.......DR---------------------.VLFVVP----GGT------
Q5FQ99_GLUOX/19-217---V-----EGI-LAK-.......-T...D.......GP---------------------.FRVALS----GGS------
B4M2H3_DROVI/20-214---Q-----RCA-NRA-L.....E-S...N.......GT---------------------.FRVGLS----GGS------
C4GM95_9NEIS/14-208---A-----QNL-RDT-L.....A-T...Q.......ER---------------------.ATLAVS----GGK------
Q0V513_PHANO/16-221---L-----DAQ-NSS-I.....E-R...H.......SV---------------------.FRVAVS----GGS------
B2FL79_STRMK/21-214---A-----QTL-NHD-I.....N-E...V.......GR---------------------.ARILLS----GGT------
A8LLP7_DINSH/12-202---S-----ADL-KEC-L.....L-T...H.......DR---------------------.ATLCAP----GGT------
Q0ALB6_MARMM/20-216---A-----TTL-ANA-I.....R-E...R.......GE---------------------.AVLAVS----GGS------
A9E4D3_9RHOB/12-202---A-----GKL-KSA-L.....S-G...N.......DR---------------------.VSFAVP----GGS------
Q133N9_RHOPS/18-217---I-----ARI-ELH-.......-R...E........R---------------------.PAICLT----GGS------
A3WL22_9GAMM/18-207---A-----EIL-ACA-I.....E-Q...K.......GE---------------------.ATLVVS----GGR------
B4FKI4_MAIZE/26-230---S-----QAS-EIS-V.....K-E...R.......GC---------------------.FAIALS----GGP------
B3GY89_ACTP7/12-200---V-----LYS-QL.-.......-....N.......RP---------------------.VHISLS----GGS------
B3CF61_9BACE/12-206---I-----SLM-EA.-......E-P...Q.......KI---------------------.FHIAFS----GGS------
6PGL_RHILO/22-214---A-----DRL-TRA-I.....A-E...R.......GT---------------------.AVLAVS----GGT------
C7R459_JONDD/14-213---L-----VTL-IDL-C.....A-V...Q.......DR---------------------.VDVVLT----GGT------
B7RQ64_9RHOB/12-202---A-----AEV-KAA-L.....M-A...D.......GQ---------------------.VSLAVP----GGT------
Q48MB6_PSE14/23-214---A-----ERL-KQA-I.....G-E...N.......GL---------------------.ATLVVS----GGR------
6PGL_CHLMU/22-212---I-----STA-NKA-I.....Q-K...R.......GA---------------------.FYVALS----GGK------
Q5WZC2_LEGPL/18-208---R-----TIL-SDA-I.....K-R...R.......GQ---------------------.AFLVVS----GGR------
C5E1Z3_LACTC/136-338---L-----AQQ-DAA-L.....Q-R...G.......DR---------------------.FNLAVS----GGS------
Q6A7F7_PROAC/15-209---V-----QTI-VRI-Q.....A-A...Q.......ER---------------------.IDLCLT----GGR------
A2TF14_BOMMO/12-204---Q-----KIS-NDA-I.....L-N...R.......NK---------------------.FVVGLS----GGS------
6PGL_RAT/18-217---A-----QRA-ASC-L....EG-N...R.......GR---------------------.FALGLS----GGS------
C4LIR1_CORK4/32-257---E-----NVI-VSI-QEGREGA-S...NTTGVTPDGY---------------------.ARLVVT----GGS------
B0T0C3_CAUSK/20-213---A-----LAL-TDG-V.....A-K...R.......GQ---------------------.AGFAAT----GGT------
Q482L5_COLP3/13-205---S-----DIL-AKA-I.....K-E...K.......GK---------------------.ASIAVS----GGS------
A3HVL3_9BACT/12-204---K-----ELA-DK.-.......-....G.......EK---------------------.VHVALS----GGS------
C0N6V1_9GAMM/14-209---V-----ATA-RAA-I.....A-K...R.......GV---------------------.FYVALA----GGS------
Q602U1_METCA/18-208---L-----RMA-WEA-I.....A-I...R.......GA---------------------.FHIVLA----GGR------
A3TLE4_9MICO/24-220---V-----TSI-ADA-Q.....A-A...R.......GV---------------------.AHVSLT----GGS------
A9BAR0_PROM4/15-206---C-----NHI-RST-L.....T-H...K.......ER---------------------.CQIALS----GGS------
A7RMK1_NEMVE/15-211---A-----EKS-TKA-I.....A-D...H.......GF---------------------.FAVAFS----GGS------
A8Y0B4_CAEBR/14-211---T-----KRL-KYL-L.....D-M...P.......GT---------------------.IGIGVS----GGS------
6PGL_XYLFA/20-213---E-----NIL-LQE-I.....T-Q...R.......GR---------------------.ASLLLS----GGT------
C1MQ42_MICPC/15-220---I-----KAA-EKA-I.....S-E...R.......GS---------------------.FTVALA----GGS------
B1LXU6_METRJ/16-216---I-----VAC-GET-.......-R...S.......ER---------------------.IALCLS----GGS------
A6X608_OCHA4/14-206---A-----NKL-NAA-I.....A-E...R.......GQ---------------------.ATLAVS----GGT------
C6BLU0_RALP1/14-208---A-----STL-THV-I.....N-E...Q.......GR---------------------.ACLAVS----GGR------
A5FAH5_FLAJ1/11-206---T-----AAA-QDA-I.....A-K...R.......GK---------------------.FTAVLT----GGS------
Q0SNU0_BORAP/4-201---K-----NRF-FDF-F.....N-MNIDK.......DK---------------------YTSIGIC----GGR------
6PGL_TREPA/12-204---D-----SRL-KT.-.......-....Q.......EI---------------------.LWLALS----GGS------
Q65WN8_MANSM/12-200---V-----LYS-QL.-.......-....D.......RP---------------------.VHISLS----GGS------
Q7UM40_RHOBA/10-203---C-----KAA-KEA-I.....E-Q...R.......GV---------------------.FRVTLS----GGS------
Q1H2F6_METFK/26-211---E-----EAA-RNA-I.....A-G...H.......GK---------------------.FSIVLA----GGS------
C3ZB29_BRAFL/15-218---A-----AKA-QEA-I.....G-D...R.......GV---------------------.FTIAVS----GGS------
Q2N8B4_ERYLH/15-185---Q-----ASL-AAT-D......-............GP---------------------.IPVTIP----GGS------
B3RLE2_TRIAD/571-763---L-----LSA-TVA-I.....R-N...R.......NV---------------------.FHVAFP----GGS------
B4SF86_PELPB/52-278---V-----AEA-YRA-L.....A-D...H.......GR---------------------.FSLVLA----GGN------
A4AJP5_9ACTN/16-217---L-----RKV-PHI-I.....A-E...F.......DE---------------------.ATIVLT----GGS------
A7H493_CAMJD/14-201---V-----SLI-EKY-L.....L-I...K.......DK---------------------.VNLAFS----GGK------
Q6NH39_CORDI/13-208---L-----QVI-DDV-......V-S...NGGV.HGDGV---------------------.ARIVLT----GGG------
Q758H7_ASHGO/106-305---V-----AQQ-DAA-L.....A-A...H.......GQ---------------------.FAVAVS----GGS------
C7LRB5_DESBD/13-206---G-----EKV-RDV-L.....A-R...R.......GR---------------------.ANIAVP----GGR------
C0XSW9_9CORY/13-210---A-----RTI-SAI-H.....A-D...PVGGVNGDGT---------------------.ARVVLT----GGT------
D0LCU1_GORB4/14-214---V-----DLV-TAA-Q.....R-D...R.......GV---------------------.ASVVLT----GGS------
B0UFD2_METS4/17-214---V-----ALA-AAP-.......-............GT---------------------.CRVALA----GGS------
B8KWX5_9GAMM/13-202---A-----NIL-TDA-V.....S-A...N.......GI---------------------.ARLVVS----GGS------
Q5ZJY1_CHICK/14-209---V-----QRA-A..-......G-S...D.......GR---------------------.FSLGLS----GGS------
A4ERB6_9RHOB/12-202---A-----GDL-ETH-L.....L-H...H.......DG---------------------.ASLAVA----GGT------
Q2IHT3_ANADE/18-216---A-----RRA-EAA-V.....A-A...R.......GR---------------------.FAIALA----GGS------
Q08ZT9_STIAD/14-199---A-----EAL-RQS-L.....A-G...G.......GR---------------------.CSLALS----GGR------
Q6G154_BARQU/17-209---A-----AEL-SVS-I.....L-E...R.......KR---------------------.AILAVS----GGK------
Q31QV8_SYNE7/14-207---L-----ETA-SRA-I.....A-E...R.......GT---------------------.FRLALS----GGS------
6PGL1_ORYSJ/43-247---S-----QVS-EIS-I.....K-E...R.......GY---------------------.FAIALS----GGP------
A6WC51_KINRD/17-219---L-----SAV-ADA-Q.....A-A...R.......GI---------------------.AHVSLT----GGT------
Q5DCQ0_SCHJA/12-207---N-----DVL-LKS-T.....E-H...N.......RT---------------------.VTIGLS----GGS------
A7BCF7_9ACTO/16-215---L-----ARL-NTL-I.....D-EAGAD.......SR---------------------.VNLAIS----GGA------
B1MC71_MYCA9/15-216---A-----SAI-TGA-L.....A-E...R.......GK---------------------.AMIVLT----GGG------
Q1NX17_9DELT/12-205---V-----AEA-QAA-V.....A-A...R.......GL---------------------.FSLVLA----GGG------
B8G942_CHLAD/16-214---S-----EQL-QTA-I.....N-E...R.......GR---------------------.ALVAFS----GGS------
B3QKX3_CHLP8/12-238---T-----DLA-YRA-V.....A-E...R.......GR---------------------.FTLVLS----GGH------
Q4K7U0_PSEF5/23-214---A-----ELL-REA-I.....A-A...R.......GN---------------------.AILVVS----GGR------
C1DRP8_AZOVD/23-215---A-----RAL-QAA-I.....E-A...R.......GR---------------------.ATLVVS----GGR------
C0VW02_9CORY/14-218---V-----NTI-ADV-Q.....Q-D...G.......SP---------------------.AHLVLT----GGT------
D7B103_NOCDD/15-218---V-----NMI-VQA-E.....A-D...K.......RD---------------------.FHLVLT----GGG------
C1FFY3_MICSR/10-214---M-----KAA-EQA-I.....E-E...R.......GS---------------------.FTVALA----GGS------
B8IN69_METNO/17-215---V-----ALA-SGT-.......-............QR---------------------.CAIALS----GGS------
Q8DJZ4_THEEB/15-208---L-----EQA-RGA-I.....A-Q...R.......GR---------------------.FTIALA----GGN------
B9XC32_9BACT/14-212---L-----AEL-AKR-D......-....T.......SV---------------------IYTVALS----GGR------
C6XF26_LIBAP/15-208---A-----EQL-SIG-I.....T-N...K.......GT---------------------.ASIALS----GGL------
B7GTB4_BIFLS/15-250---V-----LAL-LDL-L.....A-E...RLPDGTHRTR---------------------.VDVALS----GGS------
Q1VC87_VIBAL/13-205---K-----AFS-EM.-.......-....G.......RP---------------------.VHISLS----GGS------
Q3APN1_CHLCH/17-236---L-----AAA-HRA-V.....V-E...R.......GS---------------------.FTMVLA----GGQ------
A2EC78_TRIVA/493-688---T-----RLI-TEA-I.....S-E...R.......GI---------------------.CNIALS----GGQ------
Q4Q8S1_LEIMA/17-233---L-----AAI-DAR-V.....D-K...........SA---------------------PVVLALS----GGS------
Q1NB25_9SPHN/13-203---A-----TIL-SDA-I.....A-V...R.......GI---------------------.ATIALS----GGR------
A8UQU5_9AQUI/13-192---E-----EFL-TTV-I.....T-E...K.......GV---------------------.AKLGLA----GGN------
Q3LFH1_PROFR/16-212---V-----SAL-AEM-Q.....R-R...Q.......EY---------------------.VNLCLS----GGP------
B3DW46_METI4/16-204---K-----KIV-ESS-L.....S-N...........AL---------------------LCHVALS----GGK------
B9WM75_CANDC/14-221---I-----EQQ-NKA-I.....E-A...N.......DS---------------------.FKIALS----GGS------
A5EXD3_DICNV/14-202---A-----ADL-RQL-L.....Q-Q...K.......ER---------------------.VVLAVS----GGS------
A0LDZ7_MAGSM/18-207---V-----MRL-QRG-I.....Q-Q...R.......GE---------------------.AGLIVP----GGR------
A3URA5_VIBSP/13-205---K-----AYS-EQ.-.......-....G.......KP---------------------.VHISLS----GGS------
B3EN23_CHLPB/10-239---A-----SRI-FRA-I.....E-K...Q.......GY---------------------.CALVLA----GGN------
Q46LF9_PROMT/15-207---T-----QII-EST-L.....K-N...K.......TR---------------------.AKIALC----GGS------
C0CZ03_9CLOT/12-210---A-----KKL-NEA-I.....A-E...K.......GK---------------------.ARMILS----TGA------
Q04TL9_LEPBJ/16-201---K-----EIS-DYK-I.....Q-N...N.......GV---------------------.FHIVLT----GGD------
B9RWU5_RICCO/22-225---A-----DLS-EKF-A.....K-E...R.......GS---------------------.FAVVLS----GGS------
B7FPL4_PHATC/16-217---M-----KVC-QEA-L.....V-Q...R.......GT---------------------.FTIALS----GGS------
D4BM17_BIFBR/15-250---A-----LAL-LDL-L.....A-E...RLPDSTHRTR---------------------.VDVALS----GGS------
6PGL_HELPY/14-200---K-----EFF-NTA-L.....K-K...H.......HQ---------------------.ISIAFS----GGR------
A2TVY6_9FLAO/12-203---M-----DLA-SD.-.......-....K.......KS---------------------.ITVALS----GGS------
B8ELV8_METSB/16-213---A-----AKI-AAA-.......-P...K........R---------------------.IALNLS----GGS------
A6F7Y8_9GAMM/13-205---V-----EYS-KQ.-.......-....D.......KP---------------------.VHISLS----GGS------
A5VAC4_SPHWW/15-208---G-----FII-ESA-L.....D-A...R.......GQ---------------------.CLLALP----GGQ------
Q5L5V6_CHLAB/22-212---I-----ASA-NKS-I.....K-Q...R.......GA---------------------.FYVALS----GGR------
C5FTG3_ARTOC/17-223---L-----QSQ-NAA-I.....A-R...H.......ST---------------------.FRVAVS----GGS------
Q64V75_BACFR/29-223---V-----KLM-LD.-......E-P...D.......RT---------------------.FCIAFS----GGS------
Q2Y8J3_NITMU/20-208---L-----DSA-ASA-I.....Q-E...R.......GR---------------------.FNLVLA----GGE------
D3Q4S0_STANL/15-218---A-----TTI-IDA-Q.....A-E...R.......GE---------------------.ASIVLT----GGR------
B6BUE7_9PROT/16-203---L-----NIA-KNA-I.....S-E...N.......GS---------------------.FKIVMA----GGS------
C1FA85_ACIC5/18-218---V-----DCA-KAA-V.....A-Q...R.......GK---------------------.ARVAIS----GGS------
C0E339_9CORY/13-209---V-----RVV-REV-......S-K...TGGK.HGDGC---------------------.ARVVLT----GGG------
B3NVD9_DROER/19-209---K-----RCS-QEA-L.....S-R...K.......DK---------------------.FSVGLS----GGS------
Q46QB1_CUPPJ/12-202---G-----NAL-DQA-I.....R-V...N.......GW---------------------.AVLAVS----GSR------
A9BG97_PETMO/12-207---Y-----KLY-EES-I.....E-K...........NK---------------------LFTLMLS----GGR------
A8IFM0_AZOC5/23-215---A-----EAL-RRR-L.....A-T...D.......GR---------------------.AALAVS----GGR------
A6F5Y7_9ALTE/21-213---A-----RHL-SER-L.....L-I...A.......PR---------------------.ASLVVS----GGS------
B2J9Q0_NOSP7/14-207---L-----SKL-DTA-I.....E-Q...R.......GR---------------------.FTIALS----GGS------
Q8QZU3_MOUSE/85-282---E-----AAA-VQA-V.....R-H...F.......GK---------------------.FHLALS----GGS------
SOL4_YEAST/13-220---L-----EKQ-ESA-LT...GD-A...D.......AV---------------------.FNIAIS----GGS------
Q8KBB8_CHLTE/15-241---T-----DTA-YRA-V.....A-E...R.......GR---------------------.FTLVLS----GGN------
C5B1S2_METEA/18-219---R-----DII-ASS-.......-P...G.......DR---------------------.IAVCLS----GGS------
D0LNM1_HALO1/21-212---A-----EVL-RAA-I.....A-E...R.......GA---------------------.ATLVVS----GGS------
B4GTC9_DROPE/19-215---R-----RCS-EQA-K.....D-R...K.......AT---------------------.FSIGLS----GGS------
A0LTY4_ACIC1/14-215---I-----TRL-IDM-L.....A-A...Q.......AE---------------------.AHLALT----GGR------
6PGL_CHLPN/22-212---I-----ASA-NQA-I.....K-Q...R.......GA---------------------.FYVALS----GGK------
B6C1K3_9GAMM/13-208---V-----RTA-KRA-I.....E-R...A.......GT---------------------.FHIALA----GGS------
Q6FQZ7_CANGA/13-211---V-----NAQ-DEA-L.....K-H...S.......DV---------------------.FNLAIS----GGS------
B4UA07_HYDS0/19-183---L-----K..-...-......A-K...K.......IK---------------------.LNIALA----GGS------
Q16H01_AEDAE/14-211---E-----MTA-NET-L.....K-K...Q.......DV---------------------.FRLGVS----GGS------
C1BN63_9MAXI/13-205---S-----KLY-SAS-E.....K-K...D.......GD---------------------.FIIGLS----GGS------
B1S5Y3_9BIFI/15-234---L-----LTI-ADL-L.....A-E....P....NRQR---------------------.VDIAVT----GGT------
E2S154_9CORY/13-223---V-----DTV-ARI-Q.....A-A...GGGL.HHDGV---------------------.ARVVLT----GGG------
B6U0H2_MAIZE/26-230---S-----QVS-EIS-V.....K-E...R.......GY---------------------.FAIALS----GGP------
A1R6H4_ARTAT/16-230---I-----TKL-VDV-Q.....D-K...H.......GE---------------------.ATVVLT----GGT------
Q11M12_MESSB/15-206---A-----QHL-AAA-L.....E-K...R.......GM---------------------.ASIAVS----GGS------
B0UWD1_HAES2/12-200---V-----QYS-KQ.-.......-....N.......RA---------------------.VHISLS----GGS------
Q3M5C2_ANAVT/14-207---L-----TKL-DTA-I.....K-Q...Q.......GR---------------------.FTIALS----GGS------
Q1Z513_PHOPR/13-205---L-----ALS-QE.-.......-....G.......RP---------------------.VHISLS----GGS------
A2G0T4_TRIVA/485-680---T-----RLI-VDT-V.....E-K...K.......GT---------------------.CTIALS----GGL------
A0QWX6_MYCS2/15-214---V-----DAI-SSA-I.....G-E...R.......GQ---------------------.ATIVLT----GGG------
B1LCT8_THESQ/13-199---R-----TKM-EKL-L.....E-E...K.......DK---------------------.IFVILA----GGK------
Q0BTV3_GRABC/22-218---A-----ERI-QKS-.......-....Q.......AP---------------------.VRIALS----GGS------
B9BSQ1_9BURK/13-201---G-----DAL-RAA-R.....A-R...P.......AR---------------------.PLLAVS----GGT------
B9L0S4_THERP/14-212---V-----RIL-RDA-I.....E-E...R.......GW---------------------.ASLALA----GGR------
Q0YUA1_9CHLB/18-247---I-----TEA-YRS-I.....A-D...H.......GR---------------------.FSLVLA----GGN------
Q82U22_NITEU/18-206---T-----VTL-RNA-I.....E-R...Y.......GK---------------------.ASLVVP----GGH------
B8C1W9_THAPS/25-226---V-----QQC-RSA-L.....Q-S...R.......DV---------------------.FTIALS----GGS------
B5HF46_STRPR/16-221---I-----TKI-VDA-Q.....A-A...R.......GS---------------------.ASVVLT----GGR------
Q01VT6_SOLUE/14-208---I-----GRL-DEA-I.....S-G...Q.......EF---------------------.ASFAIS----GGS------
A2CAC2_PROM3/15-206---A-----SHI-DLV-L.....D-Q...R.......DR---------------------.VQIALS----GGT------
A3WEG3_9SPHN/15-187---A-----AAE-AAH-E......-............GG---------------------.YFITMP----GGS------
D2ZU85_NEIMU/13-206---A-----AAL-QNA-L.....D-N...K.......GS---------------------.AVLAVS----GGR------
A6L9R0_PARD8/12-206---M-----AMI-RR.-......K-D...F.......AP---------------------.FNLALS----GGE------
A8HQW1_CHLRE/10-210---E-----EAA-AEA-V.....K-A...K.......GA---------------------.FTLVLS----GGS------
A0Y025_9GAMM/15-210---E-----QSL-IDG-I.....K-D...D.......GR---------------------.AVLMVS----GGS------
D2Q4L4_KRIFD/15-257---I-----TRL-VDV-Q.....S-T...G.......KV---------------------.AQVVLT----GGR------
B5GMF0_STRCL/8-196---A-----RHI-GQT-L.....E-Q...R.......DI---------------------.CVLALT----GGS------
Q7P1R7_CHRVO/9-197---A-----ARL-SAA-I.....E-S...R.......GQ---------------------.AALAVS----GGK------
B4RAR4_PHEZH/11-193---A-----ACL-SEA-L.....K-T...R.......GR---------------------.AGLVAT----GGR------
Q210H8_RHOPB/14-212---L-----ARI-DAQ-.......-R...E........R---------------------.IAVCLT----GGS------
B5FXQ3_TAEGU/13-211---A-----EAA-AEA-V.....A-S...G.......GR---------------------.FTLGLS----GGS------
A6FX55_9DELT/14-207---L-----EAL-GRA-L.....A-S...S.......AS---------------------.ARALVS----GGS------
Q7D149_AGRT5/14-206---A-----KRL-DAA-T.....K-E...R.......GT---------------------.ASIAVS----GGS------
Q2SQ14_HAHCH/21-211---A-----EWL-RAA-L.....Q-E...K.......ER---------------------.ALLVIS----GGR------
D2QID0_SPILD/12-207---V-----KRI-KDT-L.....K-K...Q.......DR---------------------.FTIALS----GGS------
6PGL_BORBU/4-201---K-----DRF-FDF-F.....N-MNVDK.......DK---------------------YTSIGIC----GGR------
B0REI8_CLAMS/16-217---L-----TKL-VDI-L.....D-E...E.......ET---------------------.ANVVLT----GGT------
B6WQA9_9DELT/1-197---A-----AAC-EEA-V.....A-E...R.......GV---------------------.FRIALS----GGQ------
A3SWE9_9RHOB/12-202---A-----GEL-KNA-L.....L-S...H.......DT---------------------.VSFAVP----GGT------
Q6CXV1_KLULA/13-216---V-----AEQ-NKA-L.....E-S...H.......GR---------------------.FNVAIS----GGS------
A3ESW2_9BACT/25-225---A-----GHI-REL-I.....E-R...Q.......GH---------------------.ASVILA----GGG------
Q4CQA8_TRYCC/16-230---V-----EII-HAS-E.....R-T...N.......WP---------------------.LSIALS----GGS------
Q5LRS8_SILPO/12-202---A-----GEL-EAT-L.....F-T...H.......DS---------------------.ATLAVA----GGT------
A1B3E9_PARDP/14-203---A-----GQL-SQH-L.....R-V...N.......DS---------------------.ASLCVP----GGT------
C1BTN9_9MAXI/11-205---K-----NVY-ESN-K....KN-P...D.......ED---------------------.FVIGLS----GGS------
Q7V1T4_PROMP/23-212---E-----NQI-VQT-L.....K-I...K.......DR---------------------.FQFCVS----GGS------
A5EPZ2_BRASB/17-216---L-----ARI-AEN-.......-A...G........R---------------------.IAICLT----GGS------
Q89FE0_BRAJA/19-218---M-----ARI-GAN-.......-P...G........R---------------------.IAICLT----GGS------
Q0C1F0_HYPNA/14-211---S-----LHL-SRA-I.....A-K...D.......GH---------------------.ASFMVS----GGS------
C7MSN0_SACVD/16-225---V-----STL-ADI-Q.....A-R...K.......GS---------------------.ASVVLT----GGG------
A6FR30_9RHOB/12-202---V-----GDL-TAT-L.....E-H...E.......ER---------------------.ALFVVP----GGT------
B4W8G2_9CAUL/11-207---S-----ETL-GGA-V.....R-D...K.......GA---------------------.AVFAGP----GGT------
C5DTU9_ZYGRC/12-219---L-----EAQ-EEA-LK...DD-P...K.......AH---------------------.FIVGIS----GGS------
A3K6K0_9RHOB/32-222---A-----GDL-RLA-L.....Q-H...E.......DR---------------------.AALVVP----GGT------
B3PCY8_CELJU/13-208---E-----AAL-RNA-I.....E-E...R.......GE---------------------.ATFMVS----GGS------
A9TLR4_PHYPA/9-215---A-----RIS-EES-I.....K-A...R.......GY---------------------.FSIVLS----GGS------
Q1PUZ3_9BACT/11-211---V-----QCA-KKA-V.....S-E...R.......NR---------------------.FLVALS----GGS------
B8KHX3_9GAMM/20-211---A-----AVL-QQA-M.....E-S...R.......GK---------------------.ASLVVS----GGS------
Q28QX5_JANSC/13-203---T-----GEL-ADC-L.....R-R...H.......DS---------------------.ATLCVP----GGT------
D0MEF0_RHOM4/17-193---A-----...-.QA-L.....A-Q...G.......G.---------------------..TAALA----GGN------
D1CEH8_THET1/14-209---I-----SRA-KES-I.....D-D...H.......GS---------------------.FFVALS----GGS------
6PGL_MYCBO/14-215---V-----GAI-GAA-V.....A-A...R.......GQ---------------------.ALIVLT----GGG------
E3D833_GARV3/22-241---.-----..L-VTL-I.....M-Q...WQNNVENLNK---------------------PFHLLLT----GGT------
Q1QTX1_CHRSD/12-202---A-----QAL-EAD-L.....A-K...R.......ER---------------------.ALLVVS----GGS------
D2AVA1_STRRD/15-217---I-----TRT-VDV-Q.....S-G...K.......GS---------------------.ASLVLT----GGT------
Q5HZC7_XENTR/18-208---V-----HES-QGT-C......-.............S---------------------.FRLALS----GGS------
A7TEX2_VANPO/13-217---L-----AAQ-EKA-L.....S-S...S.......DR---------------------.FNIAIS----GGS------
C1EGM8_MICSR/47-244---E-----ENA-KAC-L.....A-E...R.......GG---------------------.FTLAVP----GGS------
A5PAY4_9SPHN/15-184---A-----EAL-AAT-E......-............GP---------------------.LTITVP----GGS------
D0L091_HALNC/17-218---Q-----QKL-NLA-I.....A-Q...R.......GI---------------------.ARMALA----GGN------
Q2H6B6_CHAGB/16-222---I-----QSQ-ANG-I.....A-R...H.......GT---------------------.FKVAVS----GGS------
C7MCP6_BRAFD/331-540---A-----QQL-AAA-L.....A-E...R.......PV---------------------.AHLVLT----GGT------
Q7QGR5_ANOGA/17-214---E-----KFA-NET-L.....A-K...Q.......DH---------------------.FRVGVS----GGS------
A6VKW1_ACTSZ/12-200---V-----LYS-QL.-.......-....N.......RP---------------------.VHISLS----GGS------
B4DAH7_9BACT/11-207---L-----DHA-RKA-I.....A-E...R.......GL---------------------.FRLGLT----GGR------
A4SD39_PROVI/13-239---I-----QAA-WQA-A.....S-K...Q.......GH---------------------.CTIALA----GGN------
D5URS5_TSUPD/17-223---A-----TVI-AQA-Q.....A-E...R.......GF---------------------.ASIVLT----GGS------
B9Z5J3_9NEIS/12-200---S-----GAL-ATA-I.....R-E...R.......GE---------------------.AVLAVS----GGR------
A9PA91_POPTR/19-223---A-----DLS-AKF-A.....K-E...R.......GS---------------------.FTVVLS----GGY------
6PGL_CAEEL/26-224---E-----EKL-TYL-L.....D-Q...N.......GT---------------------.VSIGVS----GGS------
Q312M1_DESDG/43-239---I-----ERC-AAA-V.....A-A...H.......DA---------------------.FTIALS----GGS------
A4CNJ0_ROBBH/12-204---S-----EWA-REG-S.....V-E...H.........---------------------...LALS----GGS------
A9F2S9_SORC5/16-210---A-----RAI-AAA-I.....D-A...R.......GV---------------------.ARIALS----GGS------

PF06026

RPIA_MOUSE/119-296---A-----RQL-ILQ-Y-------------------GL--------------------..TLSDLDQH...PE------
RPIA_STRMU/48-219---T-----TAQ-AQA-L-------------------GI--------------------..PLKSIDEV...DS------
RPIA_XYLFA/45-214---S-----TAH-LKQ-H-------------------GI--------------------..EVLELNHT...GT------
RPIA_RALSO/51-224---S-----TRR-LQG-H-------------------GF--------------------..AVLDLNEV...DT------
Q8I3W2_PLAF7/50-228---T-----ELK-ARK-L-------------------GI--------------------..PLTTLEKH...SN------
RPIA_BRUSU/50-227---T-----AKL-CEE-L-------------------GV--------------------..ALTTLEET...PH------
RPIA_XANCP/45-214---S-----TAR-LRQ-H-------------------GI--------------------..EVLDLNHT...GT------
RPIA_METMA/56-227---S-----EML-AID-A-------------------GI--------------------..RLTTLSQD...PE------
RPIA_TREPA/68-247---T-----ALI-CER-Y-------------------NI--------------------..PLFSLSSKRIGGK------
RPIA_HAEIN/47-216---S-----EEL-LRK-Q-------------------GI--------------------..EVFNANDV...SS------
RPIA_BUCAI/47-215---S-----TVL-LKK-H-------------------GI--------------------..EVFDLKNF...SS------
RPIA_ARATH/81-260---T-----QEQ-ALS-L-------------------GI--------------------..PLSDLDAH...PV------
RPIA_VIBCH/47-215---S-----TAK-LEA-L-------------------GI--------------------..RVYDCNDV...SE------
RPIA_CAUCR/47-223---T-----AAL-ARE-L-------------------GI--------------------..PLAALDDV...KT------
RPIA_CHLTR/61-233---S-----QLL-AEA-V-------------------GI--------------------..PLSDHSLL...QD------
RPIA2_YERPE/52-231---T-----SEV-ARD-V-------------------GI--------------------..ELSDPNEM...NE------
RPIA2_OCEIH/49-219---S-----ERL-ATE-L-------------------GI--------------------..PLTTFATY...QN------
RPIA_PSEAE/51-219---T-----AKR-LKE-H-------------------GI--------------------..PVYELNTV...SE------
Q97J55_CLOAB/49-223---T-----RNT-CIE-N-------------------GI--------------------..EVLYTSSV...EH------
RPIA_NOSS1/56-230---S-----EVL-SKQ-Y-------------------GV--------------------..PLTTLDAV...DH------
Q8L9K5_ARATH/93-272---T-----EEQ-ARS-L-------------------GI--------------------..PLVGLDTH...PR------
RPIA_THEEB/54-228---A-----SVL-AKK-Y-------------------GI--------------------..PLVTLDDV...EK------
RPIA_LACLA/48-220---T-----SSQ-ARA-L-------------------GI--------------------..PLASIDEV...DY------
RPIA_CAEEL/63-242---T-----KQW-LIE-S-------------------GL--------------------..PVSDLDSH...PE------
RPIA_CHLPN/53-225---S-----YAL-AKQ-L-------------------AI--------------------..PLLNPEKF...SS------
Q8RU73_SPIOL/106-285---T-----AEQ-AAS-L-------------------GI--------------------..PLSVLDDH...PR------
RPIA_BORBU/50-225---T-----KYL-LSK-E-------------------QI--------------------..P.YESNFSKLNKN------
Q8LBQ2_ARATH/77-261---T-----HEQ-AVS-L-------------------GI--------------------..PLSDLDSH...PV------
RPIA_RHILO/49-226---T-----AAL-CRE-L-------------------GV--------------------..PLSTLEET...PE------
RPIA_PYRHO/51-225---A-----KLL-AIE-H-------------------DI--------------------..PIASLDQV...DA------
RPIA_AGRT5/49-226---T-----ARL-CVE-L-------------------GV--------------------..PLKSLDEL...PE------
RPIA1_YERPE/47-215---S-----TAK-LKS-Y-------------------GI--------------------..PVFDCNDV...DV------
RPIA_THEAC/51-223---T-----EDL-AKQ-N-------------------GI--------------------..EVIQGTK....DQ------
RPIA_AERPE/51-226---T-----AVE-LAG-L-------------------GW--------------------..SVGDPRVY...RG------
RPIA_WIGBR/47-215---S-----SSK-LKD-L-------------------NI--------------------..PLFDLNEV...SL------
A9UNB7_DROME/96-275---A-----RHL-ILD-Y-------------------NL--------------------..NLGDLDRN...PN------
RPIA_SCHPO/60-238---S-----KQL-IVN-N-------------------GL--------------------..RLGDPDCY...PN------
RPIA_LISIN/47-219---T-----EQQ-ART-L-------------------GI--------------------..PLKSLNDV...TK------
RPIA_STRR6/48-219---T-----TKQ-AEG-L-------------------NI--------------------..PLKSIDQV...DF------
RPIA_ARCFU/49-223---S-----YFA-AIR-N-------------------GV--------------------..EIVDLVEF...EP------
RPIA_THEVO/51-223---S-----EEL-ARA-A-------------------GI--------------------..EISE.NPE...QI------
RPIA1_OCEIH/51-222---T-----ATW-AEE-A-------------------GI--------------------..PLTDFSNV...KE------
RPIA_BIFLO/53-225---T-----QAQ-AES-Y-------------------GI--------------------..KIVDIDDV...DH------
RPIA_STRP8/48-219---T-----SKQ-AEV-L-------------------GI--------------------..PLKSIDDI...DS------
RPIA_DEIRA/51-222---S-----EKL-ARE-V-------------------GI--------------------..PTEPLDP....RP------
RPIA_NEIMA/48-216---S-----SEL-LAQ-Y-------------------DI--------------------..PVVSLNEV...SG------
RPIA_STAAW/51-224---I-----AFL-AKE-L-------------------GI--------------------..KICEINDV...DH------
RPIA_STRA5/48-219---T-----TEQ-ARG-L-------------------GI--------------------..PLKSADDI...DV------
RPIA_YEAST/73-253---S-----RNL-ILD-N-------------------KL--------------------..QLGSIEQY...PR------
RPIA_STAES/51-224---T-----AFL-AKE-L-------------------AM--------------------..NIVDVNDV...EK------
RPIA_METJA/50-222---A-----KML-AMQ-Y-------------------EI--------------------..PLVTLDEY....D------
Q8ZXY8_PYRAE/43-220---S-----EIL-AYE-V-------------------GL--------------------GDRLRPMWAV...DR------
RPIA_LISMO/47-219---T-----NKQ-AQN-L-------------------GI--------------------..PLKSLNDV...TE------
RPIA_METTH/51-223---S-----MFL-AAE-S-------------------GI--------------------..KVTSLAEH....D------
RPIA_HALSA/51-221---S-----RRR-AVD-A-------------------GV--------------------..TVTSLEA....AS------
RPIA_SYNY3/55-229---A-----EVL-ARK-Y-------------------GI--------------------..PLTTLDVA...DR------
RPIA_SHEON/47-215---S-----TQK-MKA-L-------------------GI--------------------..PVYDLNSV...DK------
RPIA_BUCAP/47-215---S-----TVL-LKK-N-------------------GI--------------------..RVLDLNTF...DF------

PF02589

Q30YW4_DESDG/23-221---Q-----GNN.FEV-F-----VAA-----------D.----------------------..........CHE------
Q72A59_DESVH/13-211---R-----ANN.FAV-S-----LVD-----------S.----------------------..........CEE------
A0LET5_SYNFM/13-211---E-----ANN.FEV-F-----LAD-----------N.----------------------..........KEQ------
A8ZY31_DESOH/13-211---E-----ANN.FEV-H-----VAQ-----------N.----------------------..........ADA------
Q6AQM0_DESPS/13-211---A-----RNN.FDA-Y-----VAA-----------S.----------------------..........VAD------
A5N319_CLOK5/16-217---Q-----SRK.FEA-Y-----YCD-----------N.----------------------..........AID------
A3DDG8_CLOTH/16-211---N-----QRN.FEA-Y-----FCE-----------T.----------------------..........SEK------
Q18C30_CLOD6/15-209---K-----KRY.FDA-Y-----YCK-----------T.----------------------..........RNE------
A6LXE8_CLOB8/15-209---K-----KRH.FDA-F-----YCK-----------T.----------------------..........KDE------
A5KQQ3_9FIRM/12-205---E-----SRN.MEA-Y-----YAS-----------T.----------------------..........KEE------
A7B149_RUMGN/7-200---K-----SRN.MDA-Y-----YVE-----------T.----------------------..........KEE------
A6BK24_9FIRM/13-206---T-----ARN.MEA-Y-----YTD-----------S.----------------------..........KEE------
A7VF64_9CLOT/13-206---A-----ARN.MEG-F-----YVQ-----------T.----------------------..........KEE------
B8D0K4_HALOH/12-205---A-----KRG.IEG-Y-----YCP-----------T.----------------------..........GEQ------
A4XID0_CALS8/13-207---E-----LRN.FEC-F-----IVD-----------K.----------------------..........KED------
A5I080_CLOBH/11-201---K-----KRN.MEG-F-----YCK-----------T.----------------------..........KDE------
Q5CB89_THESQ/49-242---R-----KKK.HEV-W-----IAR-----------D.----------------------..........REE------
A7HK56_FERNB/14-207---E-----RKG.FEV-Y-----VVN-----------S.----------------------..........TDE------
A6LMB1_THEM4/14-207---N-----KKR.HEV-Y-----IAR-----------N.----------------------..........KDS------
A8F3V4_THELT/14-204---E-----KKA.FEV-Y-----IAD-----------N.----------------------..........TSD------
Q1EM38_9BACT/45-238---E-----SKS.VRV-I-----YLP-----------D.----------------------..........IEM------
A5MYV3_CLOK5/13-207---K-----KNN.MNG-F-----YVK-----------D.----------------------..........RQE------
Q0SPU8_CLOPS/13-207---E-----ENN.ING-Y-----LVN-----------S.----------------------..........KEE------
A7FS45_CLOB1/13-207---Q-----ENN.MNG-Y-----LVK-----------D.----------------------..........KDE------
Q97IL7_CLOAB/13-207---E-----KNN.IEA-Y-----NVK-----------N.----------------------..........SKQ------
Q188D0_CLOD6/13-206---E-----NNN.MKG-Y-----LVS-----------N.----------------------..........KEE------
Q892L7_CLOTE/13-207---E-----KNN.MEG-Y-----YVK-----------D.----------------------..........ENE------
A8MGY9_ALKOO/13-207---A-----KNN.MDA-Y-----YVE-----------T.----------------------..........EKE------
A5N989_CLOK5/13-207---R-----KRN.MAG-F-----FVK-----------D.----------------------..........DVE------
A5I1I2_CLOBH/13-207---N-----SRN.MGG-Y-----YIN-----------N.----------------------..........INQ------
Q897Y1_CLOTE/13-206---E-----KHN.IEA-F-----YVK-----------D.----------------------..........EDE------
B8CXT8_HALOH/13-207---R-----NNN.MKG-F-----YVK-----------T.----------------------..........RED------
A7VSP9_9CLOT/13-219---Q-----KNN.MQA-Y-----YAA-----------T.----------------------..........KED------
B8I8V5_CLOCE/13-218---A-----SNN.MMP-Y-----YVE-----------N.----------------------..........VKD------
Q7MR09_WOLSU/5-199---N-----RNH.MAG-Y-----YTQ-----------S.----------------------..........IQQ------
Q251U6_DESHY/5-199---Q-----RNN.MAG-Y-----FVH-----------N.----------------------..........RQE------
Q97M44_CLOAB/13-207---N-----KRH.FKA-S-----YVE-----------T.----------------------..........LEE------
A1HQE0_9FIRM/13-207---K-----KNN.FNA-V-----YFP-----------N.----------------------..........RQE------
B5EEH8_GEOBB/16-211---K-----KNG.FEA-L-----YCH-----------D.----------------------..........SQE------
A5G901_GEOUR/16-211---G-----KNG.FTA-V-----YCP-----------T.----------------------..........GQE------
Q39QC7_GEOMG/16-211---E-----KNG.FTA-V-----YCG-----------T.----------------------..........GQE------
A5CYU3_PELTS/16-210---N-----RNE.FTA-I-----YCS-----------T.----------------------..........RQE------
A0PZA2_CLONN/13-207---K-----ENY.FDA-I-----YFE-----------K.----------------------..........RED------
Q6M046_METMP/13-207---K-----KNL.FDA-Y-----YFE-----------D.----------------------..........GSE------
A4J2Z4_DESRM/12-207---K-----KNQ.FNA-V-----YFP-----------N.----------------------..........KEE------
A6TQ94_ALKMQ/5-197---K-----KRN.IDA-Q-----YFV-----------T.----------------------..........KEE------
A8MHS3_ALKOO/5-197---G-----KRN.ISA-K-----FFK-----------T.----------------------..........KEE------
A7I305_CAMHC/3-194---K-----NNG.FEV-V-----CAA-----------N.----------------------..........ADE------
A8EV54_ARCB4/1-193---K-----SCG.YDA-Y-----FVK-----------D.----------------------..........KAE------
A6NR40_9FIRM/4-190---E-----DNG.FAT-S-----YFE-----------T.----------------------..........AEE------
A6LYD8_CLOB8/3-195---E-----CLG.YNV-S-----EFS-----------H.----------------------..........ADE------
B9LU40_HALLT/27-212---E-----ERG.FDV-I-----VVD-----------D.----------------------..........TDE------
Q5V6G7_HALMA/27-212---E-----ANG.FEV-I-----VVN-----------S.----------------------..........ADD------
A3CXV8_METMJ/32-217---E-----ARN.FKV-F-----LVD-----------T.----------------------..........AED------
Q8T2H5_DICDI/31-220---E-----SKN.HKV-L-----LVD-----------N.----------------------..........EET------
Q8T2H6_DICDI/31-218---E-----SKN.HIV-H-----VVE-----------D.----------------------..........EAS------
Q9BI24_DICDI/30-213---E-----AKN.HRV-S-----VVE-----------N.----------------------..........EAD------
A8LFX8_FRASN/21-203---R-----ENG.YLV-H-----VVD-----------T.----------------------..........AAQ------
Q5YX86_NOCFA/55-213---A-----RDG.GRG-R-----RVA-----------E.----------------------...........EE------
Q6ABE0_PROAC/50-223---I-----DYK.ATV-V-----RVK-----------G.----------------------...........AD------
A3Q5V6_MYCSJ/41-201---G-----EYR.ARV-H-----RVS-----------G.----------------------............A------
Q1J3Q0_DEIGD/40-206---S-----EYR.AHV-V-----QTC-----------R.----------------------...........AQ------
Q9RT57_DEIRA/45-211---L-----DYG.AAY-T-----HVS-----------A.----------------------...........AE------
Q9XAA8_STRCO/46-212---A-----DYR.ALV-H-----RCT-----------D.----------------------...........GE------
A4TC28_MYCGI/41-203---A-----DYR.AQV-S-----RVD-----------D.----------------------.............------
A7BE65_9ACTO/49-222---E-----DYS.AQV-V-----VVS-----------E.----------------------..........ESK------
Q6NHV0_CORDI/43-208---L-----DYK.AQV-V-----ECT-----------D.----------------------...........AE------
A1ATQ9_PELPD/34-209---E-----AVG.AEV-H-----RFK-----------T.----------------------..........KAD------
B5EIV8_GEOBB/2-175---S-----AVG.AEV-H-----RVG-----------G.----------------------..........KIE------
A1HPX9_9FIRM/22-195---K-----NAA.AEV-I-----RVK-----------T.----------------------..........LVE------
B8G046_DESHD/8-180---Q-----AVS.GES-H-----RVK-----------T.----------------------..........LKE------
A4J2C5_DESRM/13-186---E-----ALS.AEV-Y-----RVP-----------N.----------------------..........MEE------
A5D032_PELTS/17-190---Q-----LLA.AAV-Y-----RYA-----------G.----------------------..........IKE------
Q2RG46_MOOTA/7-177---E-----AMG.ARV-I-----QAA-----------R.----------------------..........PGE------
Q39ZY5_PELCD/8-178---A-----RAG.AEV-V-----RCV-----------S.----------------------..........TSA------
Q74CQ2_GEOSL/47-209---E-----AVG.ATV-K-----RFT-----------D.----------------------..........LNG------
Q30WA8_DESDG/6-203---E-----LVA.ATV-A-----EVK-----------S.----------------------..........IEE------
Q6APH5_DESPS/6-194---E-----AVH.ASV-A-----RVS-----------S.----------------------..........MEE------
A0LF89_SYNFM/7-180---A-----AVQ.SVA-L-----EIG-----------S.----------------------..........FDA------
Q1ARS5_RUBXD/44-220---E-----ALG.GRG-R-----RAE-----------G.----------------------..........WEE------
Q67TB5_SYMTH/34-234---E-----KIS.GVV-H-----RVN-----------DA----------------------SEVAPTVVRILQA------
LUTC_BACP2/52-237---Q-----RIH.TRV-V-----ETT-----------P.----------------------...........EE------
LUTC_GEOTN/52-237---K-----LIH.TDY-I-----ETT-----------S.----------------------...........SE------
LUTC_BACAH/51-236---T-----NIH.TTV-V-----ETT-----------N.----------------------...........DR------
A3I780_9BACI/50-235---A-----NVH.TNI-V-----ISN-----------C.----------------------...........AK------
Q836K1_ENTFA/52-236---E-----TIH.TNL-V-----ETT-----------Q.----------------------...........EN------
A2RMF6_LACLM/49-224---E-----RVS.ATL-V-----ETT-----------S.----------------------...........SE------
Q2B117_9BACI/51-235---E-----IIH.TEV-H-----RTV-----------T.----------------------...........AD------
LUTC_OCEIH/49-232---E-----VIH.TDF-V-----RTS-----------K.----------------------...........QE------
LUTC1_BACWK/49-231---E-----VIH.TEV-K-----RTT-----------K.----------------------...........EN------
Q1WT28_LACS1/55-240---E-----SVN.AKV-I-----IKK-----------K.----------------------...........DE------
B3XQV7_LACRE/57-241---E-----EVH.VDF-H-----VVK-----------S.----------------------...........AD------
A7JU08_PASHA/49-230---R-----VMM.ADV-V-----EAK-----------E.----------------------...........AD------
O86990_PROMI/4-116---.-----....ENI-I-----HAE-----------R.----------------------.............------
Q6LPN1_PHOPR/50-245---R-----TALGSQA-I-----ETT-----------K.----------------------...........AA------
Q638X4_BACCZ/48-228---H-----TLH.TEV-S-----HIH-----------R.----------------------...........SE------
Q24VR0_DESHY/42-220---E-----AMG.GKA-V-----QAS-----------T.----------------------..........AKE------
Q3ISD4_NATPD/6-167---G-----RTA.DGC-H-----RTD-----------T.----------------------...........ET------
B9LU45_HALLT/6-165---E-----DVG.VEL-V-----RTT-----------A.----------------------...........DE------
Q5V6W0_HALMA/5-169---E-----ALG.VTV-S-----STS-----------E.----------------------...........SE------
Q01UG2_SOLUE/41-210---E-----VLA.GKA-V-----RVG-----------T.----------------------..........MEE------
C0A2Z6_9BACT/52-233---T-----GPD.ADL-W-----RAF-----------S.----------------------............E------
Q1IN29_KORVE/40-207---E-----ANL.TRV-H-----RAV-----------S.----------------------..........NVQ------
A6EDI2_9SPHI/43-210---T-----AVS.GNF-I-----YCE-----------N.----------------------..........GIE------
A1ZEZ8_9BACT/19-187---K-----QNN.GDF-Y-----YCE-----------S.----------------------..........TEM------
Q11XG5_CYTH3/44-210---L-----HHK.GEF-Y-----FVE-----------N.----------------------..........EKE------
A7NKC6_ROSCS/47-233---T-----KLQ.AYP-H-----LCT-----------D.----------------------..........DEA------
B9LL37_CHLSY/44-229---T-----RLE.GKA-Y-----RVA-----------T.----------------------..........AED------
Q2SMI8_HAHCH/39-216---H-----AAH.AEV-I-----TAT-----------E.----------------------...........EN------
Q47V41_COLP3/52-226---E-----KNH.AQV-I-----KTT-----------K.----------------------...........EN------
Q3IEG6_PSEHT/41-215---K-----SNH.AQV-I-----SIA-----------R.----------------------...........SE------
A6D6N6_9VIBR/44-218---T-----ANH.ADV-R-----VTT-----------R.----------------------...........AE------
Q1Z553_PHOPR/38-228---S-----ASH.AEI-I-----STE-----------R.----------------------...........DA------
Q7NTM5_CHRVO/41-217---R-----AVK.TEI-L-----WTR-----------E.----------------------...........AE------
Q46PZ2_CUPPJ/51-226---E-----ASH.AEV-W-----RTT-----------T.----------------------...........SA------
A6F5P7_9ALTE/40-218---E-----SVH.GEV-H-----RTT-----------E.----------------------...........SG------
Q4KII4_PSEF5/42-220---E-----AVH.TEI-H-----LST-----------G.----------------------...........AG------
Q222U5_RHOFD/42-217---Q-----AVK.TEV-H-----DVS-----------A.----------------------...........TD------
A4U5P4_9PROT/35-201---E-----AVH.GEV-H-----VIA-----------A.----------------------...........DQ------
Q2VZP0_MAGSA/37-213---E-----ASH.ADV-H-----EVT-----------A.----------------------...........AD------
Q5F884_NEIG1/42-219---R-----AVK.TEI-Y-----WVT-----------K.----------------------...........SN------
Q310K5_DESDG/40-217---E-----TMK.AEV-V-----SVK-----------K.----------------------...........KE------
Q6AIU4_DESPS/43-219---S-----AVQ.TEV-F-----RVG-----------G.----------------------...........DA------
Q72B57_DESVH/44-220---E-----TVR.AEV-H-----VMP-----------E.----------------------...........AE------
Q0PC62_CAMJE/47-218---S-----DNK.YIV-E-----NAT-----------K.----------------------...........DT------
A0RPC6_CAMFF/42-213---V-----ANK.ALL-V-----ESS-----------P.----------------------...........EK------
Q9ZMU3_HELPJ/38-211---V-----LNK.AEL-I-----ESA-----------K.----------------------...........EN------
Q7VIF4_HELHP/38-218---N-----ANK.AIV-V-----ESS-----------P.----------------------...........NT------
Q2BIJ5_9GAMM/39-219---D-----QAGQIQL-F-----RDM-----------A.----------------------...........SG------
A5G2K4_ACICJ/57-224---T-----REY.ATV-Q-----RLA-----------D.----------------------..........MAD------
A7IG69_XANP2/53-223---V-----AAA.ASI-D-----HLP-----------S.----------------------..........AED------
Q11LF2_MESSB/52-222---A-----KVS.ASV-E-----RVK-----------K.----------------------..........PGD------
A4AAA4_9GAMM/47-215---A-----NNG.ATS-A-----AVE-----------T.----------------------..........RSA------
A1SVG8_PSYIN/32-224---K-----ESEFARP-K-----LLS-----------E.----------------------...........DA------
Q13MB1_BURXL/35-192---Q-----AMG.GTC-V-----EVR-----------A.----------------------..........ASD------
B7KPU3_METC4/37-194---G-----KMG.GRV-E-----RAG-----------G.----------------------..........PSD------
A4JSB8_BURVG/35-192---A-----RVG...G-I-----WCE-----------P.----------------------............P------
Q5FR86_GLUOX/37-194---E-----RMG.GKM-L-----TPD-----------A.----------------------..........ADP------
Q5NRL0_ZYMMO/38-194---I-----NMG.GEV-A-----ALE-----------G.----------------------...........QS------
A0YX69_LYNSP/37-194---E-----RMG.GQS-F-----ELS-----------N.----------------------..........IEE------
A7AFE0_9PORP/35-192---K-----AAG.GQV-V-----LMQ-----------P.----------------------..........GDD------
A6L9J6_PARD8/35-192---A-----GAG.GKA-I-----ELK-----------P.----------------------..........GED------
Q89ZC0_BACTN/36-193---R-----AVG.GTV-V-----VLG-----------E.----------------------..........GED------
Q7MVA4_PORGI/45-204---R-----AVG.GDA-I-----ELQ-----------P.----------------------..........GQD------
A8EQR6_ARCB4/36-193---E-----SVG.GKA-L-----VIE-----------K.----------------------...........ED------
Q7UNF1_RHOBA/60-220---A-----SVG.GEA-H-----LVD-----------S.----------------------..........PSE------
A4A1Q0_9PLAN/35-199---A-----AVG.GAA-H-----VVD-----------T.----------------------..........AEE------
A6C2P5_9PLAN/41-201---A-----SVG.GLC-L-----RVK-----------N.----------------------..........VDE------
A7HA96_ANADF/35-195---Q-----AVA.AVP-V-----RVA-----------G.----------------------..........VAA------
A3HYU9_9BACT/34-186---Q-----NNK.GSL-I-----FKE-----------E.----------------------.............------
A5FC57_FLAJ1/36-194---K-----GIG.GDP-V-----EVS-----------N.----------------------..........YQE------
A6EK39_9SPHI/35-193---T-----NIG.GSA-V-----EVS-----------G.----------------------..........FEE------
A1S8E1_SHEAM/19-189---P-----VTTDLKA-Y-----LAQ-----------S.----------------------.............------
A3D2A5_SHEB5/34-189---N-----TVA.GTL-H-----KEG-----------G.----------------------..........LVA------
O29447_ARCFU/59-271---E-----SRG.VNV-Y-----YAE-----------S.----------------------..........AEE------
Q97B66_THEVO/50-280---E-----KLG.GHA-Y-----LAK-----------D.----------------------..........KDE------
A8MDI5_CALMQ/50-279---Q-----AIG.AKA-Y-----FAR-----------D.----------------------..........GDE------
A4WI65_PYRAR/50-279---E-----RIG.GRF-I-----LAS-----------T.----------------------..........ATE------
A2BLD6_HYPBU/71-302---E-----RVH.ARA-Y-----LVH-----------T.----------------------..........AEE------
Q9YFI8_AERPE/68-298---R-----RVG.ANP-Y-----YAE-----------T.----------------------..........AED------
B8FYL0_DESHD/68-297---E-----RNK.GKA-F-----YAK-----------D.----------------------..........KQE------
A6EK38_9SPHI/68-287---Q-----HNG.ITV-H-----WAA-----------D.----------------------..........AAA------
A7HA97_ANADF/64-283---T-----AAG.ARV-H-----WAR-----------D.----------------------..........AEE------
A8G0A4_SHESH/69-288---L-----ENG.IQV-H-----WAK-----------D.----------------------..........GAE------
Q7MVA5_PORGI/38-257---R-----RNG.VIV-H-----WAK-----------D.----------------------..........AKE------
A0YX67_LYNSP/67-286---K-----QNG.IQV-H-----WAK-----------D.----------------------..........GVE------
C0A2Z5_9BACT/67-291---T-----ANG.AQV-H-----WAT-----------D.----------------------..........ADE------
Q47F70_DECAR/78-303---T-----ANG.IQV-H-----WAE-----------T.----------------------..........PDE------
Q1CV19_HELPH/71-295---T-----QNG.FKI-H-----YAK-----------D.----------------------..........GDE------
Q5HX91_CAMJR/68-293---T-----KNG.IKV-H-----WAS-----------S.----------------------..........DED------
A3Q5V5_MYCSJ/79-302---T-----ARG.GVV-H-----WAR-----------D.----------------------..........ADE------
Q6ABE1_PROAC/94-322---T-----ANG.VHV-H-----WAR-----------D.----------------------..........GEE------
A5TJP2_BURML/67-292---A-----RRG.TTV-L-----YAQ-----------T.----------------------..........TQD------
Q47IA5_DECAR/76-304---K-----ATG.AEV-L-----WAR-----------D.----------------------..........GEE------
Q62B92_BURMA/72-300---T-----RAG.GVV-H-----WAS-----------D.----------------------..........AAQ------
A1B665_PARDP/69-294---A-----ARG.AQV-H-----WAA-----------D.----------------------..........DAE------
A5G2K5_ACICJ/68-296---E-----AHG.GQV-H-----WCR-----------T.----------------------..........AED------
A4AAA5_9GAMM/71-297---R-----ENG.STV-N-----FAR-----------N.----------------------..........GEE------
A0LED1_SYNFM/69-293---L-----NRG.GRV-F-----FAR-----------D.----------------------..........ARE------
A5V1N8_ROSS1/68-292---E-----RYG.GHV-C-----WAE-----------D.----------------------..........GAA------
Q67TB4_SYMTH/77-301---R-----KSG.GVV-H-----WAR-----------D.----------------------..........AAE------
Q1ARS4_RUBXD/86-314---E-----ARG.GRV-F-----FAR-----------T.----------------------..........GED------
Q01UG1_SOLUE/67-291---E-----ARG.GKV-I-----YCK-----------D.----------------------..........ATE------
A6EBI6_9SPHI/68-292---Q-----RRG.GKV-I-----WAN-----------D.----------------------..........AAE------
Q1IN28_KORVE/68-293---V-----ARG.GHV-Y-----WAE-----------T.----------------------..........ADD------
Q72IY0_THET2/68-291---R-----ENG.VQV-H-----WAE-----------T.----------------------..........PED------
A6FAG4_9GAMM/68-293---Q-----KTG.GHV-F-----FAE-----------T.----------------------..........SQQ------
Q4MSC6_BACCE/70-293---S-----KRG.GHV-Y-----FAK-----------T.----------------------..........KEE------
LUTB_BACLD/70-295---A-----KKG.GHV-F-----FAQ-----------T.----------------------..........AEE------
LUTB_OCEIH/70-294---E-----KRG.GNV-F-----FAQ-----------T.----------------------..........AEE------
Q6D5W9_ERWCT/70-294---T-----ANG.GQV-Y-----FAK-----------T.----------------------..........KED------
Q81ND6_BACAN/69-293---R-----KNG.GHV-H-----FAF-----------K.----------------------..........AED------
Q24VR1_DESHY/69-293---E-----KNG.GHV-H-----LAK-----------T.----------------------..........PED------
O69147_LACLC/4-174---D-----ILE....-.-----...-----------..----------------------...........TD------
A5VIG9_LACRD/70-294---Q-----KNG.GHV-F-----FAK-----------D.----------------------..........GDE------
B9LU44_HALLT/67-296---E-----DNG.GTV-Y-----IAD-----------D.----------------------..........AAD------
Q3ISD5_NATPD/64-299---E-----ANG.GEV-Y-----VAD-----------D.----------------------..........AAD------
A5GDG8_GEOUR/64-287---E-----ALG.AKV-F-----QTN-----------D.----------------------..........PEK------
A5D031_PELTS/65-292---R-----EKG.AKV-F-----FAS-----------S.----------------------..........GHE------
Q3AEY7_CARHZ/62-279---E-----KNG.ARV-I-----IVH-----------S.----------------------..........AAE------
Q24W82_DESHY/65-292---T-----ARG.AKV-F-----HAA-----------T.----------------------..........GDD------
Q8RIN1_FUSNN/65-294---E-----ARG.GHV-Y-----HAK-----------S.----------------------..........TED------
A1HPY0_9FIRM/68-298---T-----KRG.AKV-F-----RAK-----------D.----------------------..........GAA------
Q726S3_DESVH/69-294---E-----KRG.VKV-H-----LAR-----------T.----------------------..........AAE------
Q74CQ3_GEOSL/61-280---E-----RSG.ATV-H-----LCA-----------T.----------------------..........PEE------
A4J1M6_DESRM/66-295---E-----RKG.CHV-Y-----VAE-----------T.----------------------..........TEQ------
A5UNQ3_METS3/51-284---R-----RNG.IDV-E-----YAK-----------T.----------------------..........KDD------
O26243_METTH/51-280---T-----ENG.VEF-H-----LAA-----------D.----------------------..........ADD------
A4J1M5_DESRM/47-258---K-----VKG.CQV-F-----LAK-----------D.----------------------..........PSE------

PF01812

MTHFS_HUMAN/10-198---Q-----.RL-RAM-S-----AEE---------------------------------------------RLR------
Q9SRE0_ARATH/92-290---.-----.MW-DLM-E-----ARN---------------------------------------------YAM------
Q9Z5G2_MYCLE/6-186---A-----.AR-RSV-A-----DDI---------------------------------------------RAA------
O84655_CHLTR/8-178---A-----.KR-EQL-S-----VQR---------------------------------------------RDE------
MTHFS_CAEEL/8-197---T-----.LL-GKI-S-----KEE---------------------------------------------TQR------
YQGN_BACSU/2-179---E-----.AL-SAL-S-----NED---------------------------------------------ILQ------
MTHFS_MYCGE/4-164---L-----.KR-AEL-N-----DLE---------------------------------------------KSH------
O83692_TREPA/4-207---A-----.RL-RAF-R-----.AS---------------------------------------------PTA------
Q9RKA5_STRCO/12-197---A-----.AR-NRM-T-----PDD---------------------------------------------VRE------
Y858_HAEIN/6-187---K-----.IR-ANL-T-----ALQ---------------------------------------------QHQ------
Q9RTF0_DEIRA/10-175---A-----...-...-V-----RRE---------------------------------------------QPD------
MTHFS_RABIT/10-198---Q-----.RL-RAI-S-----AEE---------------------------------------------RLR------
O68985_CHLTP/8-188---A-----.RR-RAM-T-----LER---------------------------------------------WLS------
O66124_STRMU/3-175---E-----.DL-KKQ-D-----KAK---------------------------------------------KVL------
Q9Z7E3_CHLPN/8-180---S-----.IR-RDL-S-----EER---------------------------------------------KHE------
O26306_METTH/134-322---H-----.IW-DLL-V-----EKG---------------------------------------------VSK------
MTHFS_MYCPN/3-163---Q-----.KR-MAL-S-----TIE---------------------------------------------KSH------
FTHC_YEAST/4-203---R-----.VI-NAL-D-----YDI---------------------------------------------IAA------
Q9YFU3_AERPE/7-205---.-----.VW-RLL-E-----EKG---------------------------------------------VTL------
Q9VN21_DROME/34-232---.-----.TW-KKI-Q-----EGK---------------------------------------------VGI------
P73038_SYNY3/3-179---Q-----.ER-RQL-S-----EAQ---------------------------------------------WQQ------
O67621_AQUAE/3-175---H-----.KR-INL-S-----EEE---------------------------------------------RRR------
Q9ZD82_RICPR/3-172---D-----LLI-KKQ-D-----KIN---------------------------------------------SNL------
O05575_MYCTU/6-186---A-----.AR-RRV-A-----DDV---------------------------------------------RAA------

PF13336

Q7P6F4_FUSNV/274-427...N...PFIIA..QNDNMI----------------------------------------SINSAIQVD-----------
A6LV90_CLOB8/275-428...N...PCVIA..ENYKMV----------------------------------------SINSCIQVD-----------
B8F9H4_DESAA/272-425...S...PAVIA..QNDNMV----------------------------------------SVNSALQVD-----------
Q7MWD3_PORGI/273-426...D...PRVIA..QNDNMV----------------------------------------SINSCIEID-----------
C8PQ47_9SPIO/40-192...N...PFIVA..QNDHLI----------------------------------------SINSCVQVD-----------
B8CZD4_HALOH/271-424...D...PWVIS..QNHKMV----------------------------------------SVNSAIEVD-----------
C6Q2N6_9CLOT/272-425...D...PTVIM..KNSKMI----------------------------------------SINSCVEVD-----------
C0GK20_9FIRM/271-424...D...PYNIG..KNDNMI----------------------------------------AINASIEVD-----------
C6JPC5_FUSVA/273-426...D...PRVIS..KNDNIV----------------------------------------SINSAIQVD-----------
C2MAG5_9PORP/269-422...D...PRIIA..QNDQLV----------------------------------------SINSCIEVD-----------
B9E5E2_CLOK1/272-425...N...PLVIM..KNDNMV----------------------------------------SINSCVQVD-----------
Q3ACH6_CARHZ/275-428...N...PCVIA..QNKKMI----------------------------------------SINTTLEID-----------
D2QBR0_SPILD/268-420...D...TAIIR..RNPKVT----------------------------------------AINSAIEID-----------
D7BE02_MEISD/284-437...N...PFNVA..RNDKMI----------------------------------------AINSALEVD-----------
D3LSY0_9FIRM/272-426...D...PFVIA..QIENIV----------------------------------------AINSAMQVD-----------
B1CB66_9FIRM/271-424...N...PIVIG..QNDNMV----------------------------------------SVNSALQVD-----------
Q898H0_CLOTE/272-425...N...PVVIS..KNDNMV----------------------------------------SINSCIQID-----------
A0L8K8_MAGSM/267-420...N...PAIIG..KNDQVV----------------------------------------AINSAIEVD-----------
Q2QB25_9FIRM/277-430...D...PYVIA..QNERLV----------------------------------------SVNSCVQVD-----------
A5N390_CLOK5/276-429...D...PKVIM..QNSKMV----------------------------------------CINSCVEVD-----------
Q0HH24_SHESM/288-441...D...TAIIR..KNPNVM----------------------------------------AINSALQVD-----------
C2MDZ9_9PORP/277-430...D...PFVVA..SIDNMV----------------------------------------SINSCLEID-----------
Q15V19_PSEA6/267-420...S...PANIA..RNHKMV----------------------------------------AINSALEVD-----------
Q39QG7_GEOMG/278-431...N...PYNIG..QNDKVV----------------------------------------AINATIEVD-----------
B3QTM9_CHLT3/265-417...D...TAVIR..RNPKVT----------------------------------------AINSALEVD-----------
B2RM12_PORG3/273-426...N...PDVIG..KNDRMV----------------------------------------SINSCLEMD-----------
A9AXP3_HERA2/264-416...D...TSVIR..RNPNVT----------------------------------------AINSAIEVD-----------
C7GYK3_9FIRM/272-430...H...PEVIA..KSSNLV----------------------------------------CINACLQVD-----------
Q8CXQ9_LEPIN/270-422...D...PHVIR..KNPKVT----------------------------------------AINSAVEVD-----------
A5URR7_ROSS1/272-425...D...PFVIA..QHKNMV----------------------------------------AVNSALQVD-----------
Q24WU2_DESHY/311-467...N...PWIIA..KNDKVI----------------------------------------AINNCVEVD-----------
C3JA15_9PORP/269-422...D...PVTVM..NFDRMV----------------------------------------SINSCIEVD-----------
C7M4J2_CAPOD/265-417...E...VSVIR..QNPKMI----------------------------------------SINSAIEVD-----------
Q5QXA2_IDILO/264-417...D...TSVIR..QNKQVM----------------------------------------SINSALQVD-----------
B9M8N9_GEOSF/274-427...D...PRVIA..QNDKVV----------------------------------------AINAALQVD-----------
B9M9H7_GEOSF/264-417...N...PSVIA..RNRKMI----------------------------------------SITSATQVD-----------
Q9RM86_CLOAM/272-430...H...PSVVA..QCSKMV----------------------------------------CINACLQVD-----------
A7H923_ANADF/265-417...E...TAVIR..RNPKVT----------------------------------------AINSAIEVD-----------
A3WLS5_9GAMM/264-417...S...PTNVA..RNDNLI----------------------------------------AINSAIEVD-----------
C7RL22_ACCPU/274-427...D...PYLAA..RNDKLV----------------------------------------SINATLQVD-----------
Q3ANX0_CHLCH/266-418...H...TNEIS..KNPKVT----------------------------------------AINSALEID-----------
B7RTW3_9GAMM/266-419...N...PVVIA..KNPQVT----------------------------------------AINSAIQID-----------
B7R990_9THEO/272-425...D...PYVIG..QNYKMV----------------------------------------SINTALQVD-----------
A0M1A3_GRAFK/267-419...D...TAIIR..RNPKVT----------------------------------------AINSAIEID-----------
Q0IG02_AEDAE/314-468...N...VGIIA..RNPKMT----------------------------------------AINSAIEVD-----------
D1C4I7_SPHTD/264-417...D...PREIR..QQSKMV----------------------------------------AINSAIQID-----------
A7HKG2_FERNB/273-426...D...PYVIA..QNEKMV----------------------------------------SINTALMVD-----------
C3J9R5_9PORP/273-426...D...PYVIG..ENDNIV----------------------------------------SINSCIEVD-----------
A6GWR2_FLAPJ/265-417...D...TSKIR..KNPKMV----------------------------------------AINSAIEVD-----------
A8F649_THELT/274-427...D...PYVIC..QNDKMV----------------------------------------SINTALMVD-----------
B5ECU8_GEOBB/278-431...Y...PHNIG..KNDKVV----------------------------------------SINATLQVD-----------
A1KBF4_AZOSB/272-425...D...PYIAA..RNDNLC----------------------------------------AINATLQID-----------
Q2LSP1_SYNAS/286-439...D...PLVIA..QEDNMV----------------------------------------AINSALEID-----------
A4ASU6_MARSH/266-418...D...TAVIR..QNPKVT----------------------------------------AINSAIEID-----------
Q01VE3_SOLUE/270-423...D...PGIIA..QNERMV----------------------------------------AINSAIEVD-----------
B5E7S1_GEOBB/278-431...D...PAVIG..SIDNVV----------------------------------------AINATIQVD-----------
B2TLD8_CLOBB/272-425...N...PYTLA..KNNKMT----------------------------------------SINTSLSVD-----------
A0B6T6_METTP/284-437...N...PLIIA..KNRNMV----------------------------------------SINSAMEVD-----------
C0CQX9_9FIRM/274-427...N...PAVIA..KNDNMV----------------------------------------AINTAIQVD-----------
Q2BRL2_9GAMM/269-422...D...MRSIR..RNPQAM----------------------------------------SINSALQID-----------
A4J1E7_DESRM/279-435...N...PNIIA..QNDKVV----------------------------------------SINNAVEID-----------
A3P7E3_BURP0/286-437...D...PCNIA..RNDNMI----------------------------------------SVNSTIEMD-----------
A7FIQ3_YERP3/283-434...D...PHIIA..QNDNVV----------------------------------------SINSTLQID-----------
B8FV23_DESHD/273-426...N...PCVIA..QHDNMV----------------------------------------AINSALEVD-----------
A1ZWE1_9BACT/265-417...D...TTVIR..QNPNVI----------------------------------------AINSAIEVD-----------
C9XLC1_CLODC/271-427...H...PAIIM..KQHKMV----------------------------------------SINSAIQVD-----------
D6Z2N5_DESAT/282-435...D...DYIIG..RQHKMV----------------------------------------AINMALEID-----------
Q1IT47_KORVE/273-426...D...PYVVA..RHDNMV----------------------------------------AINSALEID-----------
C5EQI6_9FIRM/275-428...D...PYVVG..QNYKQT----------------------------------------SINSCMEVD-----------
B5Y607_COPPD/273-426...D...PYIVA..KNKKMV----------------------------------------SINTALSVD-----------
D3FVG7_BACPE/268-421...D...SCLIA..KINQLV----------------------------------------TINATIEVD-----------
Q0AVM5_SYNWW/279-434...N...PWVVA..QIDDFV----------------------------------------SINACIEVD-----------
Q2FRF0_METHJ/278-431...D...PRIIA..QNDNMI----------------------------------------SINSILEVD-----------
D9TPZ5_THETC/317-464...N...PEIIR..R.LGVI----------------------------------------SINTAIEVD-----------
B2A2S6_NATTJ/273-426...N...PYIIG..HNWKMV----------------------------------------SINTALQVD-----------
Q7Z0V8_ARTSF/277-430...Y...SPIIA..QNPKVT----------------------------------------AINSCIEVD-----------
B9JLD2_AGRRK/284-435...N...PFVIA..QNDRVV----------------------------------------SVNATLQID-----------
A3HTS6_9BACT/267-419...D...TAVIR..KNPKVI----------------------------------------SINSCVEMD-----------
B8KH63_9GAMM/265-418...N...PTVIA..KNSRVT----------------------------------------SINSALQID-----------
A9GMK9_SORC5/277-430...D...PLTIA..RNDRMI----------------------------------------AINAALAVD-----------
C7PPM1_CHIPD/268-420...D...TSIIR..QNPKVT----------------------------------------AINSAIEID-----------
C0QJK6_DESAH/274-427...D...PNVIA..MNNNLI----------------------------------------SISSALEVD-----------
B3P805_DROER/312-466...N...TSIVK..QQPRMT----------------------------------------AINSCIEVD-----------
D2VMT8_NAEGR/323-475...D...INNIK..QNKNMI----------------------------------------AVNSAIEID-----------
B2HRD6_MYCMM/288-439...D...PAVIA..RNDNVV----------------------------------------SVNSTIEMD-----------
A9BH20_PETMO/279-432...D...PYVVC..QNDNMV----------------------------------------SLNTAISVD-----------
B0P1X4_9CLOT/279-435...S...IATIS..SIDNFI----------------------------------------SINNAVDVD-----------
C0W9X2_9FIRM/281-437...D...ARVIA..QIDNFM----------------------------------------SINNCIEVD-----------
B8FWN2_DESHD/279-435...D...RFIAS..RNDNLV----------------------------------------SINNALEID-----------
D1N3Y0_9BACT/300-452...D...PFIIA..KNPKVV----------------------------------------AINSAIQVD-----------
Q0AW71_SYNWW/272-425...D...PAIIG..RNHKMV----------------------------------------SINSMLEID-----------
B1C6G2_9FIRM/280-436...D...VRIIS..AHDNFI----------------------------------------SINNAVDID-----------
Q4A5M6_MYCS5/287-438...D...PYVIS..KIDNLV----------------------------------------SINSTIEID-----------
A4J4L6_DESRM/279-435...N...TRIIA..QNDKVM----------------------------------------SINNAVEID-----------
E6VZH2_DESAO/276-429...H...PAVIA..QNDNMI----------------------------------------AVNSIIQVD-----------
C5ENP0_9FIRM/279-432...N...PHVIA..QNYKMV----------------------------------------SVNTAMGID-----------
Q220T6_RHOFD/272-425...D...PYLAA..KNDKLM----------------------------------------AINATLQID-----------
A4AMZ0_MARSH/269-421...D...TAVIR..RNPKVT----------------------------------------AINSAIEID-----------
D4IP35_9BACT/266-418...D...PFRIR..QNPKVM----------------------------------------AINSAVEVD-----------
C6E210_GEOSM/283-439...D...PFVVA..QNDRMV----------------------------------------SVNAAIEVD-----------
A1U877_MARAV/284-436...N...PDIIR..LNENMV----------------------------------------SVNSALEID-----------
D3LTM8_9FIRM/278-434...N...IHVIA..GIDKFI----------------------------------------SINGCINLD-----------
D4J7D4_9FIRM/278-438...D...PYTIG..KNNKFV----------------------------------------SINATLEMD-----------
D2VCN4_NAEGR/199-351...D...GAVIK..MNNNMI----------------------------------------AINSAIEID-----------
C6X0M3_FLAB3/276-428...Y...PINIM..KNKNMV----------------------------------------AINSAIEID-----------
C0QKC6_DESAH/273-426...D...PNVIA..RNDNFI----------------------------------------SISSALEVD-----------
C8VZ55_DESAS/277-433...V...PHIIA..QNDKVT----------------------------------------SINNCIEID-----------
C0QAD0_DESAH/281-437...K...LSNIA..SNDKTI----------------------------------------SINN