Sequence alignment for CL0249

PF05100

O68727_YERPE/35-242SNTTSGGKLFFHA.......G........TNELME........PVVWQGVSYEPWPIKASGFDKTGQGTLPRPKIQVSNF
O33795_SALTM/29-230TAIGG.ERFFFCN...............EPNEKGE........PLTWQGRQYEPYPIQVQDFEMNGKGASPRPNLVVANL
Q9I5S8_PSEAE/24-229TGFGG.EMLRFHG.................HLQQG........PIHWQGNAYQAWPLEARGFEQRGDGRASSPTLSVGNI
Q9MCS1_BPHK7/24-250SSFGLTDVLRFHNYSIPHTEA.......EIIAAGGDESKLPAKPIWWQGNEYAAWPYQLEGLEKSTSGSNATPSLTVANI
Q9EYE3_9VIRU/29-230TVQGG.ERYFFCN...............ELNEKGE........AVTWQGREYQAYPIDGSGFEMNGKGSSARPSLTVSNL
Q9FZU6_9VIRU/1-192TERGT......................................AVVWQGQAYEPYPIKADGFESTSQGAGNRPTLTVSNL
O64332_BPN15/24-249TAFGMSDVLRFHA.......HNIAHTPEEIEAAGGDENKLPAKSIWWQGEEYKAWPCQVEGIEATTDGTSPQPKLTVANL
VMTL_LAMBD/29-230TEVGG.ERYFFCN...............EQNEKGE........PVTWQGRQYQPYPIQGSGFELNGKGTSTRPTLTVSNL

PF08875

Q88MJ3_PSEPK/2-148SILKR--------------------------------------------------------LYASSGPEIIHEVLEIT..
Q7TTI7_BORBR/26-187ALKEA--------------------------------------------------------YASAPQDRVVFDTLELRHP
Q7Y5J7_9CAUD/2-143SFVSN--------------------------------------------------------RQRLTDYSGILQVLEISAA
Q6LHT4_PHOPR/8-149NARIN--------------------------------------------------------LNATTADEPFLILVEIHHQ
Q52PL0_9CAUD/3-144TFKER--------------------------------------------------------KQRVRDPSGLLILMELSAN
Q9ZWY6_9CAUD/9-157AYRRK--------------------------------------------------------LASNPDGEMDFITLEIYHP
A4JIW1_BURVG/9-170AIKEA--------------------------------------------------------YASAPSQQIILHTLELRHP
Q3BKF8_9PROT/35-190ALKEA--------------------------------------------------------FASAPAGTVILDTLEIWHP
Q7WLN7_BORBR/8-149QAKRN--------------------------------------------------------VNATSADEPLLELIEITHP
A5W5T1_PSEP1/2-148SLIEE--------------------------------------------------------CYASGRGEL.VDTIEARKE
Q9MC99_BPD3/3-151TALER--------------------------------------------------------FYASDGPDLPIATIEITRP
A5W7W6_PSEP1/2-149TALEV--------------------------------------------------------VYASGGDDI.VPTLEISCP

PF05100

O68727_YERPE/35-242AGTV-------SAEVQANDYLVGCRII---RKMTLARFLDAANFKDG.NPTADPNQHFPDEMWFVEQKTLETH.EVVEFE
O33795_SALTM/29-230FGLV-------TGMAEDLQSLVGASVV---RHQVYSKFLDAVNFSNG.NPDADPEQEA.VARYNVEQLSELDS.STATII
Q9I5S8_PSEAE/24-229DGSI-------SALCLFFDGLVGARLI---VRETYAHYLDAANFAEG.NPQADPSQER.LNIWFLEQKTAENS.VQVTWE
Q9MCS1_BPHK7/24-250ESSI-------SAMCLAYDDLLQAKVT---IHDTKEKYLDARNFADG.NPTADPTQEK.LQVWYIDGKTGELAGETVEFV
Q9EYE3_9VIRU/29-230FGLV-------TGMAEDLQSLVGATVV---RRRVYARFLDAVNFVAG.NPEADPEQEL.SDRWVVEQMSELTA.MTASFV
Q9FZU6_9VIRU/1-192LGLI-------TGAADQFGQLVGVLVV---RRQTYAKFLDAVNFQSGRNPTADPMQEV.VGKYLVERMTALNA.ETATFE
O64332_BPN15/24-249DSSI-------SALCLAYDDLLQAKVT---IHDTLAKYLDARNFPQG.NPTADPSQEK.LKVFYIDARNTETD.EVVEFI
VMTL_LAMBD/29-230YGMV-------TGMAEDMQSLVGGTVV---RRKVYARFLDAVNFVNG.NSYADPEQEV.ISRWRIEQCSELSA.VSASFV

PF08875

Q88MJ3_PSEPK/2-148DGIT......TYWMTKGWDELTITLET......GQVVVCTPCGMDLA-LPARNDDGTQ-DLTFALSNIDG----IASGFV
Q7TTI7_BORBR/26-187AFVDPHGEPTAVRVVLGYEDIRARLETEAPLDGGQDVMFQAGAFRFR-LPGFEEGQVP-SLLIAIDGASE----QIVDHV
Q7Y5J7_9CAUD/2-143YLPD......TLRLVKDVKDWTINGQD...........YIGLEFTIT-LPEDRSGSNG-VLEIKMSNVGR----DVTEDL
Q6LHT4_PHOPR/8-149SFSE......PARIVADTQDITHAGYR...........YTALPIDVT-LPDEGEGKLP-QAKLIIDNVGR----VLTDEI
Q52PL0_9CAUD/3-144SFQE......TLRIANDTDNWTSNGLL...........YYGFPFKFT-GPDDSDGSNA-SSKIVIDNTGR----GMSDDL
Q9ZWY6_9CAUD/9-157LLSK......RWLLVRGVKDLTATLET......GEVVTFEGTPMEAK-NAANNNDMDQ-TASFSLPDVLN----ILDEEM
A4JIW1_BURVG/9-170AFVDEDGQQVAIRVVRDTGDLWARLESQAPLQAGERVQFVAMGFELD-LPPVDTMPVP-EITVTLDNVSR----EIVRHL
Q3BKF8_9PROT/35-190TFDE......PIRVVRDHADLTARLEAGAPRDGGKRVTFAALAFEFS-PPPVDTAPVP-EITVTLDNVGS----DITDAL
Q7WLN7_BORBR/8-149DLAV......PARFVNDTQDIQVEGHA...........FLACRFDLS-IPDDQAEQVP-GARLEVDNIGR----ELTQWL
A5W5T1_PSEP1/2-148GGTV......SHLYCSGWEDRVCTTED......GRTLTFVAMAMDLA-LPKNDNSAFQ-NLVLGLDNVTG----EVQEVV
Q9MC99_BPD3/3-151SRPH......PIFICQGFKDLTCMTED......GRLLTFIAGAIDVS-IPKRDNSGNQ-NVGFAIDNVTG----FAQQYI
A5W7W6_PSEP1/2-149AWDK......TLYLVQDFEDFRATTEA......GKTVTFLASAIDVA-LPAKDNSGAQ-TLTFVIDNVTG----EAQQLI

PF05100

O68727_YERPE/35-242LSSVFDLMGV-QLPYRQIIKNTCPW..K..YR.GPECGYTG.PYFDKNNQQTTMSGADYCTKRYDSCNARRNYFANGVIH
O33795_SALTM/29-230LASPAETDGS-VVPGRTMLADSCPWD....YR.DENCGYDGPPVADEFDKPTSDPKKDKCSHCMKGCEMR.....NNLVN
Q9I5S8_PSEAE/24-229LSAPPDFQGQ-QIPARQITS.LCHWCITNEYR.GQDCNYTGTAMFDADGNPVDDPALDRCGGRVSDCKLR..FGADNPLS
Q9MCS1_BPHK7/24-250LSSPMDLQGQ-MIPTRQ.LHSLCTWCIRNKYRTGDGCDYAGIRYFDKNNNPVSDPSLDECNGTLTACKLR..FGENNELS
Q9EYE3_9VIRU/29-230LATPTETDGA-LFPGRIMLANTCMWD....YR.GDECGYNGPAVADEFDNPTTDIRKDRCSKCMRGCEMR.....GMVAN
Q9FZU6_9VIRU/1-192LAAPSESDGS-VIPARIMLANTCCWQ....YR.GEGCGYTGRAVADRFDMPTDDASKDVCSKTLTGCRAR..FGATAVLP
O64332_BPN15/24-249LSSPMDLQGR-MIPTRQ.LHSLCSWCIRNKYRTGDGCDYAGTRYFDKHNNPVDDPSLDECNGTLTACKLR..HGDSNELP
VMTL_LAMBD/29-230LSTPTETDGA-VFPGRIMLANTCTWT....YR.GDECGYSGPAVADEYDQPTSDITKDKCSKCLSGCKFR.....NNVGN

PF08875

Q88MJ3_PSEPK/2-148RAALRDGRRM.SLVYRAYTSDD-----------LGAPA.HAPHRFKIKGGSVTAAQVSVTAGYFDLLDTR----------
Q7TTI7_BORBR/26-187EAAVQSRFPI.YVTYRPYLSTD-----------LSMPQMNPPITMELNKVTVTGSSVSGTATLSDVHNWA----------
Q7Y5J7_9CAUD/2-143EKRPPDQ....MMTAVLKLSDR-----------ETPGEFYRIIPMPIDRVSIDAQTVTLTASMDSIMRQQ----------
Q6LHT4_PHOPR/8-149DGTRGFE....GGTCVIMQVMR-----------SNPSHVEWGIELDVLDVSIDQLKISATLGYEDMLNKP----------
Q52PL0_9CAUD/3-144ESLQPNE....IILVKLMITDF-----------YNPSAIIRTLYLPMMGATIRVTQMEGRCGVDYIMRQR----------
Q9ZWY6_9CAUD/9-157DRIPYDNKELPKFIFRRYVSTD-----------LTYPC.DGPVVYELQTLTQEKGVFTAETG.TPMLNQR----------
A4JIW1_BURVG/9-170DAAAESQSVI.EVTYRPYLSTD-----------LEGPQMDPPIHLVLTEVEADIFRVTGRARMLDVGNKA----------
Q3BKF8_9PROT/35-190EGAAVSQQVI.EITWRPYLSTD-----------LNGPHMDPPITMTLTDVEADTMRVTGRARMLDAGNKS----------
Q7WLN7_BORBR/8-149EYSQGGK....GAKCRLILLLR-----------SNPSNIELDMTMDLTGLEITNFRVSGDLGFKNTLMQS----------
A5W5T1_PSEP1/2-148EEAKAADDRF.IITFRRYLAED-----------LTFPQ.ER.YRMTLLSREYEDDVAKLTAGFFDLLNTN----------
Q9MC99_BPD3/3-151AEAIDAGEPV.TLVLRIYLESD-----------LTAPA.ERPYRMRVKGADFESLTVQVEAGYYDLINTA----------
A5W7W6_PSEP1/2-149DASLEAEARV.TIVYREYLYSI-----------PGEPA.DRPYRMTSFGGTMDGPTIQIEAGYYDLINMM----------

PF05100

O68727_YERPE/35-242FGGFIGATRY
O33795_SALTM/29-230AGFFASINKL
Q9I5S8_PSEAE/24-229HGGFAGAGLV
Q9MCS1_BPHK7/24-250FGGFPGTSLI
Q9EYE3_9VIRU/29-230FGGFLSINKL
Q9FZU6_9VIRU/1-192FGGFPSSDKV
O64332_BPN15/24-249FGGFPGTSLI
VMTL_LAMBD/29-230FGGFLSINKL

PF08875

Q88MJ3_PSEPK/2-148----WPRNTY
Q7TTI7_BORBR/26-187----FPHERY
Q7Y5J7_9CAUD/2-143----ACRLRF
Q6LHT4_PHOPR/8-149----AVTMRF
Q52PL0_9CAUD/3-144----SVQLAS
Q9ZWY6_9CAUD/9-157----ATGILM
A4JIW1_BURVG/9-170----FPGVSY
Q3BKF8_9PROT/35-190----FPSITY
Q7WLN7_BORBR/8-149----GVAMRF
A5W5T1_PSEP1/2-148----GLRTVL
Q9MC99_BPD3/3-151----ALRHIY
A5W7W6_PSEP1/2-149----WNRFRY

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window