Sequence alignment for CL0249

PF05100

O68727_YERPE/35-242SNTTSGGKLFFHA.......G.TNELME........PVV----WQGVSYEPWP-----------IKASGFDKT----GQG
Q9I5S8_PSEAE/24-229TGFGG.EMLRFHG..........HLQQG........PIH----WQGNAYQAWP-----------LEARGFEQR----GDG
O64332_BPN15/24-249TAFGMSDVLRFHAHNIAHTPEEIEAAGGDENKLPAKSIW----WQGEEYKAWP-----------CQVEGIEAT----TDG
TIPL_LAMBD/29-230TEVGG.ERYFFCN........EQNEKGE........PVT----WQGRQYQPYP-----------IQGSGFELN----GKG
H9L422_SALTY/29-230TAIGG.ERFFFCN........EPNEKGE........PLT----WQGRQYEPYP-----------IQVQDFEMN----GKG

PF08875

Q88MJ3_PSEPK/2-148-----SILKRLYA---SSGPEIIHEVLEIT..DGITTYWMTKGWDELTITLET......GQVVVCTPCGMDLALPARNDD
Q6LHT4_PHOPR/8-149-----NARINLNA---TTADEPFLILVEIHHQSFSEPARIVADTQDITHAGYR...........YTALPIDVTLPDEGEG
V6F5D3_9PROT/9-164-----ALKEAFAS---APAGTVILDTLEIWHPTFDEPIRVVRDHADLTARLEAGAPRDGGKRVTFAALAFEFSPPPVDTA

PF05100

O68727_YERPE/35-242TLPRPKIQVSNFAGTVSAEVQANDYLVGCRIIRKMTLARFLDAANFKDGNPTADPNQHFPDEMWFVEQKTLETHEVVEFE
Q9I5S8_PSEAE/24-229RASSPTLSVGNIDGSISALCLFFDGLVGARLIVRETYAHYLDAANFAEGNPQADPSQER.LNIWFLEQKTAENSVQVTWE
O64332_BPN15/24-249TSPQPKLTVANLDSSISALCLAYDDLLQAKVTIHDTLAKYLDARNFPQGNPTADPSQEK.LKVFYIDARNTETDEVVEFI
TIPL_LAMBD/29-230TSTRPTLTVSNLYGMVTGMAEDMQSLVGGTVVRRKVYARFLDAVNFVNGNSYADPEQEV.ISRWRIEQCSELSAVSASFV
H9L422_SALTY/29-230ASPRPNLVVANLFGLVTGMAEDLQSLVGASVVRHQVYSKFLDAVNFSNGNPDADPEQEA.VARYNVEQLSELDSSTATII

PF08875

Q88MJ3_PSEPK/2-148GTQDLTFALSNIDGIAS------GFVRAALRDGRRMSLVYRAYTSDDLGAPA.HAPHRF---------------------
Q6LHT4_PHOPR/8-149KLPQAKLIIDNVGRVLT------DEIDGTRGFE...GGTCVIMQVMRSNPSHVEWGIEL---------------------
V6F5D3_9PROT/9-164PVPEITVTLDNVGSDIT------DALEGAAVSQQVIEITWRPYLSTDLNGPHMDPPITM---------------------

PF05100

O68727_YERPE/35-242LSSVFDLMGVQLPYRQIIKNTCPW..K..YR.GPECGYTG.PYFDKNNQQTTMSGADYCTKRYDSCNARRNYFANGVIHF
Q9I5S8_PSEAE/24-229LSAPPDFQGQQIPARQITS.LCHWCITNEYR.GQDCNYTGTAMFDADGNPVDDPALDRCGGRVSDCKLR..FGADNPLSH
O64332_BPN15/24-249LSSPMDLQGRMIPTRQ.LHSLCSWCIRNKYRTGDGCDYAGTRYFDKHNNPVDDPSLDECNGTLTACKLR..HGDSNELPF
TIPL_LAMBD/29-230LSTPTETDGAVFPGRIMLANTCTWT....YR.GDECGYSGPAVADEYDQPTSDITKDKCSKCLSGCKFR.....NNVGNF
H9L422_SALTY/29-230LASPAETDGSVVPGRTMLADSCPWD....YR.DENCGYDGPPVADEFDKPTSDPKKDKCSHCMKGCEMR.....NNLVNA

PF08875

Q88MJ3_PSEPK/2-148-----KIKGGSVTAAQVSVTA--------------------GYFDLLDTR------------------------------
Q6LHT4_PHOPR/8-149-----DVLDVSIDQLKISATL--------------------GYEDMLNKP------------------------------
V6F5D3_9PROT/9-164-----TLTDVEADTMRVTGRA--------------------RMLDAGNKS------------------------------

PF05100

O68727_YERPE/35-242GGFIGATRY
Q9I5S8_PSEAE/24-229GGFAGAGLV
O64332_BPN15/24-249GGFPGTSLI
TIPL_LAMBD/29-230GGFLSINKL
H9L422_SALTY/29-230GFFASINKL

PF08875

Q88MJ3_PSEPK/2-148---WPRNTY
Q6LHT4_PHOPR/8-149---AVTMRF
V6F5D3_9PROT/9-164---FPSITY

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window