Sequence alignment for CL0250

PF08887

Q7CSZ3_AGRT5/12-119TKWIEELLNAY..EIDHIVKPSAQIV..ERYKDRLPEILV---KFWIEKGWCSWSKGQYWICDPS------IFQPVIDYV
Q1M3G5_RHIL3/9-116TRTLQMPDSSFKVEPKGTIMGIGGWFRGDRGKDRDDQGVT---VELTPIGGPPELDFLFIEVPAV------DILRAIDGW
Q988W1_RHILO/11-115KQPLEAFNARFGSPA.PVGLASSEIL..EPLPPGFPDALG---EYWGQRGFGAYGDQLIWTQPPG------SFDDVIEEW
Q1M3Y0_RHIL3/6-114RRPLQEILDEFGPLKDGMAVAASQ.A..EGYRGKLPDAMV---DFWIEHGRGQWRDGLFWICDPE------PIMPVLHAL
Q7CUQ2_AGRT5/5-113FITYENALKRFGLPENPEIMGEAD.I..ARYKNRIPETYL---DFIRHAGLGIWKQGYFQFCNPE------KYKSIVALA
Q883B0_PSESM/3-111DESFEIFVDAMGEPVKVCPASESV.I..DKYKGVLPDVLL---DYWRSEGWCGYADGLFWTVNPD------EYKHLLDMW
A5W0Y1_PSEP1/2-110DVIFSIFLETFGEPIGQQPVPPAA.I..DHYQGKLPNRLL---EYWQDHGWCGYGGGLFWLVNPQ------EYQGVVASW
A5VYL0_PSEP1/2-110DKVFASLIENFGPPIDRREVPGSS.I..ERYRDKLPPKLL---EYWSEHGWGGYGEGIFWLVNPQ------EYDAVVSCW
Q88F70_PSEPK/2-110DEVFSIFLDNIGAPFSRREVPPSS.I..DRYNGKPPELLL---AYWKEHGWCGFGEGIFWLVNPQ------EYEGVVSSW
Q88PR4_PSEPK/2-110DEVFSLFVEQVGEPFFRQEVPPSS.L..DRYRGILPNKLL---AYWSEHGWCGYGDGIFWTVNPQ------EYEGVTASL
Q4ZYL5_PSEU2/2-110DKVFARFLEKFGGPVDRQEVPASS.I..ERYRGKLPSQLL---EYWTEHGWCGYGDGIFWIVNPQ------EYEGVVASW
Q48PQ0_PSE14/2-110DEDFAFFLEKFGPAIEHHAVPEAS.I..AKYKNKLPEQLL---QYWSLYGWCGYASGLFWSVNPQ------DYDQLLNRW
Q48PP9_PSE14/14-122DEDYAFFLKKFGPAIEQQAVPTSS.I..ERYKKRLPEQLL---KYWEDFGWCGYAKGLFWTVNPQ------DYEDLLTDW
Q64WJ2_BACFR/3-103DKFLDKSLNSTRQTIDDTF......I..AKYANAVSEQII---ELWKEVGLGTFCDGLFRIINPD------KYKTIVDDS

PF02938

SYD_MYCCT/306-395--FLDS..Q..NKYIRAVCIDQ..----.LLTKKQLEELN...QQAKQFH----FNSIAFIKVEN.....NAWSGSLASQ
SYD_SYNY3/315-415--FSAAVSS..GGSIKAIRVPGGN----ETISNVRIKPGGDLFKEATEAG----AKGIAYIRVRD.....NGEIDTIGAI
O81892_ARATH/362-461--FTEALES..GGIIKVLCVPLGA----KKYSNSALKKGDI.YNEAMKSG----AKGLPFLKVLD.....NGEIEGIAAL
SYD_BUCAP/306-404--FQINLKK..KNRIALLCFGQG.----NKISQKKIDEYS...NYVKKFG----AKKLFYIKINKIENRFQDIQSSIKNI
SYD_MYCTU/309-398--FQAP.......YVGAVVMPGG.----ASQPRRTLDGWQ...DWAKQRG----HRGLAYVLVAED....GTLGGPVAKN
SYD_RICPR/315-409--FRENIKK..GSVVHAIPAPQ.A----ASLPRSFFDKMI...EFAISKG----ARGLGYIQFSES....GEAKGPLSKF
SYD_HELPY/307-403--FSNTAKDPKNKRIKALNVKGAD----ALFSRSVLKELE...EFVRQFG----AKGLAYLQIKE.....DEIKGPLVKF
SYD_PSEAE/310-409--FSGPAND.PKGRVAALRVPG.A----ASMPRSQIDDYT...KFVGIYG----AKGLAYIKVNERAKGVEGLQSPIVKF
SYD_ECOLI/307-406--FAGPAND.PKGRVAALRVPGG.----ASLTRKQIDEYG...NFVKIYG----AKGLAYIKVNERAKGLEGINSPVAKF
SYD_HAEIN/308-407--FNEPANN.PNGRVAVIRVPNG.----AEITRKQIDEYT...QFVGIYG----AKGLAWAKVNDINAGLEGVQSPIAKF
SYD_AQUAE/319-411--FKSVVEA..GGIIKAINFKG..----SNLSRKEIDELT...KFVQSLG----AKGLAWIKVEK.....DKLTSPIVKF
SYD_BACSU/314-408--FSSAVAN..GGVVKAINVKGGA----GDYSRKDIDALG...AFAANYG----AKGLAWVKVEA.....DGVKGPIAKF
SYD_CHLPN/313-406--FLDQLAH..GGTIKGFCVPGG.----ATMSRKQLDGYT...EFVKRYG----AMGLVWIKNQE.....GKVASNIAKF
SYD_CHLTR/313-406--FLDQLAY..GGTVKGFCVPGG.----ADMSRKQLDIYT...DFVKRYG----AMGLVWIKKQD.....GGVSSNVAKF
SYD_THEMA/308-401--IRNVLNE..GGSVKGFIVPGFA----SEMSRKKGEELM...ARMKELG----LGGLIWFKLDG......GITSPHLKH
SYD_THETH/314-400--FQEA......ESVKALALPKA.----..LSRKEVAELE...EVAKRHK----AQGLAWARVEE.....GGFSGGVAKF
SYD_DEIRA/309-394--FASA......PSVKVLVAPE..----..LTRKQIDELE...RVAKQNG----AGGLAWLRRDG.....EGFTGGISKF
SYD_TREPA/328-422--FEEVVAQ..GGSIRALVLPGKA----RCYSRRQIEALE...SIARAHE----AHHLFWLKATG.....GGLEGGIARF
SYD_BORBU/309-403--FKDTLKN..KGSIKILIVKDKA----DKFSRAKINNLE...EIAKLYK----TQGLYFTKIEN.....NKFSGGIAKF
GATE_ARCFU/294-382--IRN.......KTVKAILLRG.F----GGIVGREIQPGR...RLGTEFA----DIAKTY.GLGG.....VFHTDELPAY
GATE_METTH/292-381--ISSA......ESVLAVKLRG.F----DGLIGVEIQPGR...RLGTEMA----DYAKKR.GVSG.....IFHTDELPAY
GATE_METJA/295-390--IQNALKK.KNGKVKAVLLKG.F----AGLVGKEIQPGR...RLGTEFS----DRAKVIAGVGG.....LFHTDELPKY
GATE_PYRHO/301-393--IARAIKK..GGKVLAIKLPK.F----RGLIGREIQPGR...RLGTEFA----DRARKY..VPG.....IFHIDELPNY
GATE_AERPE/299-394--IKKVLSS..GGKVIAVKLPR.M----KGIIGMEIMPGR...RFGTELA----DYARFWGGVGG.....IIHSDELPGY

PF08887

Q7CSZ3_AGRT5/12-119FLGDSELDPTRMVAFGYNAFG-NVDIWYGDATIRLNLPNGMV
Q1M3G5_RHIL3/9-116....KWLSLVGLTVIAVSAFG-EVFLRDGTGAVFQIDTIEGK
Q988W1_RHILO/11-115IG....TGAKDSVLLVRFSFG-DFVVWARGRTFFVNVHRGYA
Q1M3Y0_RHIL3/6-114FAGDPEFDAARMVPFMRDAFG-EVSVWHPKFKLITLKMNLGT
Q7CUQ2_AGRT5/5-113LGGDKQLNPVRTHALGFSAFG-KILAWNEDYKTTEINILLHR
Q883B0_PSESM/3-111LSGTKFSGIDNYHVIARSAFG-DLYAWGEKYGRKIIVSCPGD
A5W0Y1_PSEP1/2-110LAGTHFEACDTYHLIARSAFG-DLYLWGEKTGSVLTIAAYHS
A5VYL0_PSEP1/2-110IAGTALASHDSYHLVARSAFG-DLYLWGEKTGFSLEITSVGS
Q88F70_PSEPK/2-110TEGTLLENRDTYHLIARSAFG-DLYLWGENSGFSVKITSLLS
Q88PR4_PSEPK/2-110IEGTILEKRDRYHLIARGAFG-DLYLFGEQTGFSVKILAHIS
Q4ZYL5_PSEU2/2-110LEGTKFEKRDNYHLIARGAFG-DLYLWGEKTGFSLKITSVFS
Q48PQ0_PSE14/2-110LATTPLHQRDNYRVIARSAFG-ILYVWGENSGYCLTLNSYIS
Q48PP9_PSE14/14-122LVGKEAFKNDNYHVIARSAFG-ELYLWGEKSADSLSITSYMS
Q64WJ2_BACFR/3-103Y...PLYEYETVTPFMSTVFG-DIFAYVKNPVIGNYVVFINV

PF02938

SYD_MYCCT/306-395...LTEVQKKQLIEEFNIQNK.ATIILNIGK.YEEISQLM--
SYD_SYNY3/315-415KENLDEAQVKTLLQLTQAEAG.DLLLFGAGD.TATVDKSL--
O81892_ARATH/362-461VSSLDSAGKINFVKQCGAAPG.DLILFGVGP.VTSVNKTL--
SYD_BUCAP/306-404...LDKNTLENILRKTNAKNG.NILFLLADE.EKIVNKSL--
SYD_MYCTU/309-398...LTEAERTGLADHVGAKPG.DCIFFSAGP.VKSSRALL--
SYD_RICPR/315-409...LTGQQLEILKATANTSNG.DAVFFVSDK.KDEAVKLC--
SYD_HELPY/307-403...LSEKGLKNILERTDAQVG.DIVFFGAGD.KKIVLDYM--
SYD_PSEAE/310-409...IPEANLNVILDRVGAVDG.DIVFFGADK.AKIVCDAL--
SYD_ECOLI/307-406...LNAEIIEDILDRTAAQDG.DMIFFGADN.KKIVADAM--
SYD_HAEIN/308-407...LNEDVWKGLAERVNAQTG.DILFFGADK.WQTTTDAM--
SYD_AQUAE/319-411...FTEEETQKLLERTKAEPG.DVILFSADK.KEMVYKIL--
SYD_BACSU/314-408...FDEEKQSKLIEALDAAEG.DLLLFGADQ.FEVVAASL--
SYD_CHLPN/313-406...MDEEVFHELFAYFDAKDQ.DILLLIAAP.ESVANQSL--
SYD_CHLTR/313-406...ASEDVFQEMFEAFEAKDQ.DILLLIAAP.EAVANQAL--
SYD_THEMA/308-401....LEKEFRKIAETENMNEG.DVCLIAAHTDRNLLNEAL--
SYD_THETH/314-400....LEPVREALLQATEARPG.DTLLFVAGP.RKVAATAL--
SYD_DEIRA/309-394....VGGIAPQLIEQTGVAQG.GTLLFAAGE.WKKAVTAL--
SYD_TREPA/328-422....FAGVESEVRRRLSAQDE.DLLLFVADCRHRVCCVAL--
SYD_BORBU/309-403....LKTEEQELIKTYSLENN.DIIFFTANNNWETACKAM--
GATE_ARCFU/294-382G..ISEEEVSRLRDAVGAEDG.DAVVMAAGD.AVRVERAL--
GATE_METTH/292-381G..ITEEEVRGLRDAVGASQG.DAVVMVAHE.RVTAENAL--
GATE_METJA/295-390G..ITEEEVKKLKEFVNAEEN.DAVIIVADE.ESKVDRAL--
GATE_PYRHO/301-393G..ITQEEVNEVIKRLGLGEE.DAFVLVAAE.EERAKNAL--
GATE_AERPE/299-394G..ITGDEVEKIYEAVGGDPGVDAFALVADK.PSNALRAA--

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window