Sequence alignment for CL0259

PF03968

Q83DI4_COXBU/10-123-----HVRSIE-V.IYRR-..PDH...ITLYHGDVYATQGTTWISGDKVIVYHNPT........................
Q8EAE7_SHEON/31-142-----KIKAVS-Q.TADI-..KNN...QIIFFGPVEVVQGSIKINADQLRAFSAEG........................
LPTD_HAEIN/51-189-----YIEADN-A.EINQ-..PND....ATYQGNVDLKQGNRHLLAQSVQVKQSGNQSTPLRMAYVRN..GFDYKDNQIN
Q5P773_AROAE/35-149-----NIEANR-L.TVDD-..RNK...VHVFEGNVVLTQGSLVIKGDRLVVTQGPD........................
LPTA_HAEIN/33-146-----NIVSDN-Q.SLDM-..EKS...VVTFTDNVVITQGSIVIKANKVVITRPAE........................
Q7W010_BORPE/43-162-----LILSDT-L.HYDD-..IKR...QSIFTGNVILTRGLMTLTSDKLEVNEDAA........................
Q6NDQ7_RHOPA/57-184-----QIESDT-L.EVRD-..KNK...EATFTGNVKVVQGDTTMTSQTLVVFYDQDQAPAKGAKGK......PMPAAAPG
LPTD_VIBVY/55-188-----VIQADN-L.QAIN-..GDK....AIYSGDVEVTQGNKKITAESVTLHQQENIVVAEGNVT........FNDGEVK
LPTD_VIBF1/66-199-----LIQADS-V.EASN-..NSK....AVYKGNVHIIKGRQEIKADSITLHQQENIAIAEGNVD........YSSMEMR
Q7MQR6_WOLSU/25-137-----EITAKH-F.VADE-..AKK...TTLITGDVVVVRGDDRLITDKLTVFFDDK........................
Q8Y2C6_RALSO/38-157-----VLEADN-A.SYDD-..LKQ...VYHLSGNVVLTKGTMVLRSDTADLRTDPE........................
LPTD_ECOLI/53-195-----TINADH-A.KGDY-..PDD....AVFTGSVDIMQGNSRLQADEVQLHQKEAPGQPEPVRTVDALGNVHYDDNQVI
Q60AV1_METCA/39-150-----YIEADT-A.TYDE-..ATG...QTVYVGHVRSTQGSLIVDSDKMIVYQKEG........................
Q7NSU0_CHRVO/32-144-----EITSDN-GCTMEQ-..TKG...ISTCTGNVVVVQGTLRLNADKVVATQDQQ........................
Q5NQV4_ZYMMO/49-163-----DIDADH-S.EVLY-..NDN...RAIYSGHVRARQADMTITAAYVRIAYTMPKNSK...................T
Q7VQS3_BLOFL/35-147-----EIHSEY-Q.SINK-..LTN...VIHFTDNVICKYKNIKLYADKVIITHNQK........................
Y383_RHIME/50-164-----QIESDK-L.EIKD-..PES...KAIFTGNVKVVQGTTTLQAGNMTVFYKAGGGS....................V
Q5LWN1_RUEPO/41-147-----EVTADS-L.DVSQ-..EDG...SAEFQGNVLVSQGEMRLSAKRVLVIYNQE........................
Q9A2G4_CAUCR/38-152-----DVSADN-Q.ETIN-..SKC...LIIFTGNVEILQNRSRLRAEKVTIYNAKRPTAE...................N
LPTD_PHOPR/70-206-----KVTADH-A.EALD-..KTK....VTYTGDVVVQQGNRTIAADQAYLRQPENIVVAEGNVY........FHDGTIE
LPTD_MANSM/52-190-----YIEADK-A.ELNH-..PTK....GVYQGNVDIKQGNRHLITETAEIIQSGQDENVQRYAYAKG..GFDYKDNIIN
Q63XK5_BURPS/49-169-----NVEADN-L.TYDD-..LKQ...VTVATGNVVITKGTILIKGDRVEVRQDPQ........................
LPTD_PASMU/52-190-----YIEADQ-A.RLNQ-..SVS....ASYEGNVEIQQGNRQLRAQRADISQQKQPNGLQRLAHVRG..GFEYQDHQIQ
Q5R0J0_IDILO/35-147-----EVESSK-E.ELDI-..KNN...RLVLTDNVIIRQGTLLIRADRLEASASES........................
Q9KP50_VIBCH/45-157-----YIDSDS-Q.QLDM-..KSN...RVTFLGDVKLKQGSININADKLIVIRNAE........................
Q98GS3_RHILO/46-170-----QIESDK-L.EVRQ-..AEN...LAVFTGNVTVVQGPTLLKAGKMMVYYVKDPNAAAKGT..........EAAGAA
Q7VGJ3_HELHP/21-132-----EVSAKV-F.QSDL-..KNG...LTELSGEVLVVKGEDKLWADKVVIETNKK........................
Q7MPB4_VIBVY/35-147-----YIDSDS-Q.QLDM-..RSN...QVIFDGDVSLKQGSININADKIVVTRDPE........................
O26088_HELPY/35-147-----EITGNQ-F.VAND-..KTK...TAVIQGNVQIKKGKDRLFADKVSVFLNDK........................
Q5E7W2_VIBF1/30-142-----HINSNS-Q.NFDM-..QSN...QVTFTGNVTLKQGSIEIFADKIVVIRPQG........................
O67922_AQUAE/20-125-----TITGEA-N.SLEF-..LKD...RLIYKGNVILHRDSSTLKADEVVILLDKE........................
LPTD_HAEDU/51-186-----EIEADR-A.VINQ-..PKE....ANYSGNVTIKQGNRSIFADNVRIEQQAPQHRKAFLIGRY.....QYQDNLIQ
Q74BY9_GEOSL/33-139-----TVKSNE-L.SADS-..RNR...TATFSGKVTARQGDLTIYSDRLIVHYRDD........................
Q5F6F3_NEIG1/32-143-----QIEADQ-G.SLDQ-..ANQ...STTFSGNVIIRQGTLNISASRVNVTRGGK........................
Q6AR55_DESPS/32-143-----YIEANH-M.TSTE-..NTN...TVFFEGDVDAKQDDVRIRSNKMTVFYSKASK......................
Q6LMB8_PHOPR/30-142-----YIDSDN-Q.ELDI-..QKN...IVTFTGNVILRQGSIDIRADKVVITRPNG........................
Q87WU2_PSESM/34-146-----HIQSDD-A.QLDD-..KKG...VATYKGNVIITQGSMKITGNTVTITRNAQ........................
Q82Y25_NITEU/53-169-----HLEADH-A.TVED-YKRKGEFRTSIFTGNVVLTQGTLVLRADKVIMKEDAA........................
Q0PAL9_CAMJE/22-131-----EVKALN-F.YSDE-..NKG...ESILSGNVEVIRGDDILNSEKLIIYTDKN........................
Q2YP15_BRUA2/46-170-----KIDADK-L.EMRD-..KEG...VAVFTGNVAVSQGDALLKAGQMTVYYSKAKKGAEAPEP.........ANAGVG
Q32BD3_SHIDS/37-149-----HIESDQ-Q.SLDM-..QGN...VVTFTGNVIVTQGTIKINADKVVVTRPGG........................
Q5ZX95_LEGPH/33-147-----QVVSDS-A.DLNQ-..KNH...QGVYIGNVEFVQGSTNLRAEKAITQGDAK........................
Q8P714_XANCP/33-143-----.IDSNS-N.DCNM-LDDSG...KCRFSGKVVITQGTLEIHADTADIFQKNG........................
LPTD_YERPE/53-193-----.INADK-T.EANY-..PDN....ALFTGNVIVQQGNSTLTANQVELTQVQKPGEVIPLRTVTATGDVNYDDPQIK

PF13100

A6KXH5_BACV8/45-203KSKVYLLHSDV-L-KKSPLNPDPD---AQILIGNVAFRHDSVYMYCDSACFYEKTNSLEAFDNVK------------MVQ
C6VSH9_DYAFD/72-229EDLVEILKSDE-L-EIIN.QPGDD---SRRVTNGV.FKHKGALLYSNLAIQHINSNVIEAFGNVR------------IVQ
C6Y022_PEDHD/22-179KTKIIVERWDA-T-TTNA.ADKAN---RISYFRKPVFRQDNARLFCDSAVFYPDKNIFDAFGNVH------------INQ
A5FGP3_FLAJ1/21-178PKQIHVEHADN-F-ERNE.PLVPG---AVLLSGNVKVDHDGIVLTCNKAYIFEGENYLKAFGNVQ------------LVQ
A6LEK0_PARD8/40-197KTKVFLEHANT-L-SFDK.ERNAE---AQVLNGDVCFRHDSSYMYCDSAYFFEQTNSLEAFSNVR------------MEQ
Q7MX13_PORGI/44-201KTHVILEHADE-L-RYDR.LYNPD---VQRLLGNVVIKHEGAVMRCDSAHLNQEENTFEAFGQVS------------MQQ
D3ICV2_9BACT/46-203.QKVYLEHADE-L-KRDIYGTNPD---AQILKGNVRLKHNGATLTCDSAYLYQESNSVRAFGRVS------------FRQ
R5ME27_9BACE/44-200.TRVDLLHAEE-A-QADK.VLHPD---IQILIRSVKLRHDSMYMYCDSALIYEKTNSVEAFGNVR------------MEQ
R6CKV9_9BACT/28-185.DRVYLLHADE-L-YYDMFGNNPD---AQILKGKVSFLHQGSHLTCDSAYFYQASNSVKAFGHVH------------YRQ

PF06835

Q9HVV8_PSEAE/12-188ALIALLLIVAGYYWNVGL---ELFN.....EQPTRPGQDNTIDYYAENAHSLQYQE----------------D.GS.LDY
Q7MPB3_VIBVY/8-183YLLLFFVVSWS.CYYLYG---QREA.....QSVQVAPNLELPMFSGESLNNISYNS----------------D.GI.RSH
Q2KUD4_BORA1/8-184LIALFLLVSLV.ISTWWA---ADYAQR.AIPIDPPRRITHEKDAWSRDFVMLRTDA----------------Q.GK.PIN
Q65RT9_MANSM/10-187GTIALVLLAWF.YTLNQD---KPDL.......TRLIKAPESPEYTGHKMETTIFSP----------------A.GK.KQY
A6VMU7_ACTSZ/14-198GVIALALLAWF.YSLNQE---DGSL.......NHLIKRSDSPEYIGRNMETTIFSP----------------T.GQ.KQY
Q6FC68_ACIAD/7-179YIAAVVIASIS.GGYYYY---SGKA......KKLDVDSARNMTYSAEGVNLTQTDD----------------Q.GH.LYV
Q5F6F2_NEIG1/13-189LILAVALGSLS.AWLGRI---SEVE......IEEVRLNPDEPQYTMDGLDGRRFDE----------------Q.GY.LKE
Q7W009_BORPE/13-191LLLALV......VGTWWA---ADYAQR.AVQVDPPRRLTHEMDSWARDFVMLRTDV----------------Q.GH.PIN
Q9A926_CAUCR/44-207AATVIVQAAWR.SLASSK---LQTQ.............AATAPLVLDKPRFTGVLK----------------D.GR..PF
Q83DI3_COXBU/10-185LLIVAACLSTL.LILRKT---TSDE......RPSQAQLNHRPNAFMRDVNYYQYDE----------------G.GL.LHS
Q8Y2C5_RALSO/23-203ILLMAVVCGVT.FLLVQV---NTPQ....TEETANQAKRHVADYTMDGISATALDE----------------R.GV.TKY
Q7N059_PHOLL/13-184VLIILALIGWN.LSDSDE---IKSS.........SATDNSQPTYQSQEAITFVYDP----------------T.GK.LTY
Q3IG36_PSEHT/6-184IVLSVLFIGCM.VWLWYP---YFTQV..NTVAKADSEVIAKPDYTAIELKQTAFDE----------------N.GE.ISH
Q1QVD4_CHRSD/15-188LLLILVVLGIG.LAIVEQ---RNAT....TPGPVPSDDAGEPDYYLEGVTMTRFDA----------------Q.GI.PHQ
Q1LRN4_RALME/18-199LLLMAIVAGST.FWLVQI---NSPH....EATAQAQVKRHVPDYYMDRFSATELAE----------------D.GN.TKI
Q7NSU1_CHRVO/12-188PVLLIGLTALL.TVWLDQ---ISRW.....DSHRRELDPDKPEYVAENLVATRYDK----------------Q.GM.LMD
Q2LSM5_SYNAS/26-198AVLCFAVLSIV.SGVIYK---VSGNR...PQKTLLKIMDSTVDLQVMNVHYTEATD----------------E.G..VKW
Q8D2M9_WIGBR/15-186FYLIIIFIIYF.QIFFSF---ECIG..........EYSSIKDNSQINNYNMRIYNI----------------N.GS.IKY
Q82Y24_NITEU/13-186LTVLLLLTLWL.DKNLQR---PDSQ........QDSGTQQEIDYIIENLDGIQINH----------------E.LK.VNR
Q3J7F9_NITOC/4-178LMLIATLTAWE.LLHEES---AYIP........RSDLNKRTTDYFMEKFTSTLMDQ----------------Q.GL.PLY
Q31H03_THICR/9-187LLFVAALVVLT.IAFKQS---VNRD....STSVQTKPLALTHSWQIFKSTSWQVSK----------------Q.DPNTKQ
Q4KI84_PSEF5/13-188GTIALLFAAVG.YWNISP---ERFL.....DKPVAQVDESAIDYYVINARSVQYLP----------------D.GK.LQY
A3QI76_SHELP/7-183AIIAFFGTALI.LYWQVQ---SKKG.....SEELALDNVDRPDYIVRDLKSVQYND----------------E.GG.INS
Q74BY8_GEOSL/20-186LYLVASLAIRL.VGGNEK---EAGL..........PKLPRNIDLSLKTLHYAE.TR----------------E.GV.KKW
Q2NWJ8_SODGM/13-184GLLVLVLIGWN.LADTDT---APAQ.........TPVNAGEPTYQSEYTTTVVYNP----------------A.GG.LNY
Q3B209_PELLD/22-189AFILFFSAGCT.APKGNE---PRPDAPVVKNNSPVQESWSFRFTVTEEGIRKSLIT----------------A.GHAAEY
Q9CP81_PASMU/10-189AGLALALLAWF.YSLNQG---EPSL.......NTLIKKPDSPEYVGQKMKTTVFSP----------------T.GK.KHY
Q21FU6_SACD2/6-194LYIAFVVTLVI.GLLFYG---DSPEQL.LGSGQDKKAAKIYPYAIAHHASTRHFAN----------------D.GT.LDY
Q2SBI4_HAHCH/14-189AALAAILVIYL.AAYQDE---ANVP.....FFEEEQLLKDEPDAFVINAVYTTYNK----------------E.GV.LTS
Q3SLC6_THIDA/11-186LAILLLLAALS.FAIERA---VQVT......PAPEHAAESDPEGIMENFDALRTDA----------------T.GR.PQY
Q2YCX5_NITMU/11-187FVIVALFASLL.TLLNQD---GPTP.....LLAPESISVRAPDYVVEDFSAIRTDE----------------N.DA.GYK
LPTC_HAEIN/15-205GVIALCALAWF.YSLNQE---TADL.......SELVKKPDSPDYVGYKMETTVFSP----------------D.GK.KQY
Q6DAG2_PECAS/13-184ALLVLILIGWN.IADDDT---VVAP.........DANDPAVPVYTSEKTNTQVYSP----------------A.GK.LSY
Q47VI4_COLP3/8-184ALFVLLLSALI.YGIIEW---RSAS....IEQDTLIVDEQRPDFIAEQLESKIYSD----------------L.GQ.LSH
Q9KP51_VIBCH/8-183YVLLLFIASWS.LYYLLG---QEQD.....SKIQVAPNLELPMFSGENLENISYDE----------------Q.GI.RNY
LPTC_ECOLI/13-183SLAVLVMIGIN.MAEKDD---TAQV..........VVNNNDPTYKSEHTDTLVYNP----------------E.GA.LSY
Q5E7W1_VIBF1/8-183MAVLLMICSWS.GYNLYY---DYVK.....GEQQTTPDQQVPVFTGKGITNNNYDV----------------S.GI.RNY
Q47AI2_DECAR/11-187IIMLALLAGLT.FWLQST---IDSG.....NEKHDGKFRHDPDAIAENFTVRRFDA----------------T.GE.VRY
Q5R0I9_IDILO/8-184ILILLFGAGLL.LVWRPF---SDDA....DGNNAATTRTMQPDFTAFGLETRIFES----------------D.GL.LAH
Q7VQS2_BLOFL/22-198YMVLFILIYYF.HIHTTH---STMH......PYISLLDNEIYTHQGKEVITNMYNI----------------I.EKNLTL
G1UBB2_HAEDU/10-185LIIVAILGGWY.MNQHKP---TDYS......LTQLIKKEGTPDYSGRNISTMIYDV----------------N.GQ.PQY
Q4FT81_PSYA2/11-180.LIIAGLAGWF.FKQQGE---ITPP.........VNIETSDVDYEATDIKAVQTNE----------------Q.GE.TEY
Q5NG31_FRATT/16-206.IIVIIFSMLY.ISYNAL---DGGK......PLKNIPQKNRVELKAFDFNYNKYDS----------------S.GN.LAM
Q5ZX94_LEGPH/14-185.LLILAGSGWY.YAHFNQ---AIIN.........KKSLSNEVDTTISQLTVKQFNS----------------E.GV.LIN
Q63XK4_BURPS/14-190.AAMAALAGGT.YWLLQA---TLPP....PGEAVVRPKSHTPDYFADNFSVTELDQ----------------T.GS.TQY
Q6LMB9_PHOPR/9-183.ALLIVICAWF.GYYLLE---NRWK.....DDIQVEPDAEKPLFTGSIVTNTAFNE----------------S.GM.RSY
Q7CL87_YERPE/13-184ALIALALIGWN.MSGFNQ---QGAP.........VVADDNEPSSQSQHTVTTVFNP----------------V.GQ.LNY
Q87LE5_VIBPA/9-183.LLLVFVVAWC.GYYLLT---PKGN.....DAIQVAPDTELPLFSGTGLENITYGE----------------D.GV.RSY
Q87WU3_PSESM/14-188.VLAVLLAAVG.YWNISP---ESFM.....DRPISSVDDTVIDYYAINTRSVQYLP----------------D.GT.LQY
Q88P97_PSEPK/14-188.AIAALLVAIG.YWNVSP---ESFL.....DKPVTQVDESAIDYYAINAHSVQFLP----------------D.GK.LQY
Q8F3J5_LEPIN/12-176....FLISVVC.GFFLII---FENCKK.VNYERVEKERESGSSISIRNFKREAYDS----------------S.GQ.LQW
Q9PDG8_XYLFA/11-184LLLAAIVSGWS.AWHQRK---HTQA.........TPLRDIAADYTLQDFKLVALDT----------------QTGK.ESL

PF03968

Q83DI4_COXBU/10-123...TNRIVRLKAIG..---------.HPAHYS-TMPDNQK------------------ARLYAQAETILYF..PAKAQVL
Q8EAE7_SHEON/31-142....ENSKILVATG..---------.NPATYS-QILD.DG------------------RPASASAKEIRYE..MATRTLT
LPTD_HAEIN/51-189MLGKDAEFNLDSHD..---------..GNLTN-SEYEFVG------------------RQGRGKADNITLH..NNYR..V
Q5P773_AROAE/35-149.....GFQTGVATGSD---------KRPATFR-QKREGSN------------------EFVEGEAERIEYD..SRAERAR
LPTA_HAEIN/33-146..KSGKKETVEAFG..---------.TPVTFH-QQLD.NG------------------KPVDGKANKVHYD..LGNEFLT
Q7W010_BORPE/43-162...GNQFGVATADKG.---------.KIVTIR-QDRPETF------------------ELIEGKGLRAEYE..SSKSQFD
Q6NDQ7_RHOPA/57-184PDGASSIRRLEAKG..---------.......-.HVVVTQ------------------KDQVVTGDKAVFE..TKTNLVT
LPTD_VIBVY/55-188ASSSKVTNNMTSET..---------..FSLEN-TEYQFLC------------------QQGRGQAAYIAKT...GQAVYE
LPTD_VIBF1/66-199TTSDKVTTNLSTED..---------..TTMVN-TAYKMSC------------------QPIRGQAGRVLKT...GQEIYQ
Q7MQR6_WOLSU/25-137....NRPLKYEAQG..---------...NVKF-AITLADG------------------RKLKGYSNNALYD..APKNEYH
Q8Y2C6_RALSO/38-157.....GYNYAVAIAKP---------GNLAFIR-QKRDNVD------------------EYIQGWGERIEYD..GKQEISK
LPTD_ECOLI/53-195LKGPKGWANLNTKD..---------..TNVWE-GDYQMVG------------------RQGRGKADLMKQR..GENRYTI
Q60AV1_METCA/39-150.....KTEKVVAWA..---------.NPVRLK-QTPDGGK------------------EDIHGTGQRAEYF..PETGILI
Q7NSU0_CHRVO/32-144.....GNQTLQATG..---------.RIVTFR-QKLDNNS------------------GWIEGQSSKLDYD..SAKHFAV
Q5NQV4_ZYMMO/49-163GEASPQMQRLDASG..---------.......-.GVTIQT------------------PDEMAKGEIAIYD..VPKRLVT
Q7VQS3_BLOFL/35-147...KYKSSILTAYG..---------..HPATI-HYIQTSK------------------NITSASAEVIFFD..SIDNIIT
Y383_RHIME/50-164TSGNADIDRIEVSN..---------.......-.KVFLSS------------------GAQQATGESGIVN..LTNQTIV
Q5LWN1_RUEPO/41-147...ASGIERLEATG..---------.......-.DVVLVS------------------GSDAAQAQRADYT..IGTGVIV
Q9A2G4_CAUCR/38-152ANACGNAQRMEAEG..---------.......-.GVYLVN------------------EQQNARGDRAVYT..FSNNTAV
LPTD_PHOPR/70-206VDSERLQSDLDTED..---------..SEMDH-AVYNLTC------------------EPGRGEARRITKTHAQGTQFYR
LPTD_MANSM/52-190LTGDDAKVHLNTKD..---------..TDVKN-ADYQFVG------------------RQGRGSAQSAEVR..EDYR..L
Q63XK5_BURPS/49-169.....GYQYATATASG---------KKHASFR-QKREGLD------------------EYIDGDAERIDYD..GKQDLTT
LPTD_PASMU/52-190LKGEEAQVQLNTKN..---------..TDIKN-ADYQLVD------------------RQGRGKAESIALR..EDYR..L
Q5R0J0_IDILO/35-147...AEQADIFIAEG..---------.TPATYS-QTLD.DG------------------NEINAEAKKITYF..QSEQRLE
Q9KP50_VIBCH/45-157...NGKIEEIEGYG..---------.NVATFS-QLTD.EG------------------KTLYGEAKELYYK..VRDDELV
Q98GS3_RHILO/46-170MTGSANIDHLEVSS..---------.......-.KVYIKS------------------DDQVATGDNGTFD..MKTQVLV
Q7VGJ3_HELHP/21-132....NKPQKYTATG..---------....NVR-FYAKMPN------------------KEMRGKAKKAVYN..VIKDEYQ
Q7MPB4_VIBVY/35-147...SNTIKKIEAFG..---------.QPATFS-QLMD.DG------------------KTLSGSAKQLDYS..IDNDQLT
O26088_HELPY/35-147....RKPERYEATG..---------...NTHF-NIFTEDN------------------REISGSADKLIYN..ALNGEYK
Q5E7W2_VIBF1/30-142...KEGREVLEAYG..---------.KPTRFS-QLTD.DG------------------KTLKGKANKLRYE..LENEFLK
O67922_AQUAE/20-125....NKPYKLIAKG..---------.......-.NVKFRE------------------NGRKAEAEFAEYD..LRKEIIH
LPTD_HAEDU/51-186AEGHNALLDLQSKD..---------..AEVAN-TTYQLVG------------------RQGRGEAESGQFT..PQTR..R
Q74BY9_GEOSL/33-139...GGDVEKVEAVG..---------.......-.NVKIVQ------------------GNRLATAKEGVYY..NTEQKIV
Q5F6F3_NEIG1/32-143.....GGESVRAEG..---------.SPVRFS-QTLDGGK------------------GTVRGQANNVTYS..SAGSTVV
Q6AR55_DESPS/32-143GEKSQQVKKIICTG..---------.......-.NTEVTR------------------GEWLGTGQRMVYT..TKDKKIV
Q6LMB8_PHOPR/30-142...QDGQETIDAYG..---------.KPATFH-QIMD.DG------------------KPIDGASLKMRYE..TAIDFLK
Q87WU2_PSESM/34-146....GEVDVFTSVG..---------.NLAYYE-QKPAVDK------------------PIVQAYAITIQYY..AGQDRIV
Q82Y25_NITEU/53-169.....GYRYATAYG..---------.DLVSYR-QKRDGVN------------------EYVEAWSKRAEYD..DKTDKIE
Q0PAL9_CAMJE/22-131....RKPIRYEAMQ..---------....NAR-FKIVLKG------------------KTYKGSGDKFIYN..VIKDTYE
Q2YP15_BRUA2/46-170GIGSSSIDHIDIAG..---------.......-.KVYLKS------------------GTQVATGDTGRYD..AKNQIMV
Q32BD3_SHIDS/37-149...EQGKEVIDGYG..---------.KPATFY-QMQD.NG------------------KPVEGHASQMHYE..LAKDFVV
Q5ZX95_LEGPH/33-147....NQLTLAVAEGSK---------DKQAHYW-TTTAPDK------------------PPFHAYADTIKYY..PLKHLIE
Q8P714_XANCP/33-143.....QTDRVVLNG..---------.KQATLK-QEMD.DG------------------AMMNGQADNIEYK..VADEIII
LPTD_YERPE/53-193LKGPKGWSNLNTKD..---------..TDMDK-GKYQMVG------------------RQGRGDADLMKLR..DQSRYTI

PF13100

A6KXH5_BACV8/45-203GDTLFLYGDYLFYDGN---------TQIAQVR.YNVRMEN------------------KNTTLLTDSLNYD--RIYNLGY
C6VSH9_DYAFD/72-229GDTVTVTGDTLYYYGN---------TRLAIVSGKKTVLKD------------------TKKTLTTRKIEYD--MANGIAY
C6Y022_PEDHD/22-179ADTINIYSDRLNYNGN---------TKMAHLT.SNVRMVD------------------NENVLTTNILDYN--MASKVGT
A5FGP3_FLAJ1/21-178GDTLFLNSKYAEYSGN---------LKQAFAT.GDAVMTS------------------PDATLQTDTIHFD--RNIQQAY
A6LEK0_PARD8/40-197GDTLFVYGNYLFYDGN---------TQIAYLR.ENVRMEN------------------GQVTLFTDSLNYE--RIPDIGY
Q7MX13_PORGI/44-201GDTVSMFARYLHYDGN---------IKYARLR.HEVRLEN------------------RSATLFTDSLDYD--RVMNLGY
D3ICV2_9BACT/46-203GDTLSLKGERGFYDGV---------TQILEVR.KNVVLKH------------------RNQTLYTDSLNYD--RMYKNAY
R5ME27_9BACE/44-200GDTLFIYGDYLYYDGM---------SQLAMLR.ENVRMIN------------------RNTTLTTDSLNYD--RLYNLGY
R6CKV9_9BACT/28-185GDTLSLTCNRAEYDGQ---------MQMMRAR.KNVVLHH------------------RRQTLRTDSLDFD--RLYNMAN

PF06835

Q9HVV8_PSEAE/12-188EMTAVKLEHQK.ATDI.........TFVTTPDLLLFRGNV..................QPWHIQSARAEVG--PKGKEVE
Q7MPB3_VIBVY/8-183QISSSHLDHYA.KSGD.........TVFENPSLVIYRDGD.................TIEWKITARRAVLD--E.EQVLT
Q2KUD4_BORA1/8-184RMEGVYGEHFP.DDDS.........YHVVSPRAIGQQANN..................PVTVAVSKTAIME--EGGKRVV
Q65RT9_MANSM/10-187QAYSDTARHYD.QDGH.........TEFVNPVVFALEVETEN.............QGKQSWKLTAKSATLT--K.DNLLY
A6VMU7_ACTSZ/14-198IAKSDKVEYYS.EDGH.........TDFFNPVVFVLDDPTSDESEQ......SETDLKQSWKLTAVKAKLT--K.DNMLN
Q6FC68_ACIAD/7-179RATVDRLEQNM.QNQT.........SKLENLNASTYKAGN..................VDSTFFSKYAYGY--NDNEKVV
Q5F6F2_NEIG1/13-189HLSAKGAKQFP.ENSD.........IHFDSPHLVFFQEGR..................LLYEVGSDEAVYH--TENKQVL
Q7W009_BORPE/13-191RLEGVYVEHFP.DDDS.........YHVTTPRAIGQQAGN..................PITIGVSKTAIME--QGGQRIV
Q9A926_CAUCR/44-207LITAERAERDAKDQNI.........VRLTAPLLVRGYGEP..................NPSQATAKSGVYR--EAENTLL
Q83DI3_COXBU/10-185HLVSPLITHFP.YQNS.........FQFTRPHYLIYTDKR..................IPWNITANSGKSQ--QGIKRIY
Q8Y2C5_RALSO/23-203RFTGVHMNHYE.DDLT.........YDVTFPALRIYAPDR..................PQVTARADLGKMN--GEGSIID
Q7N059_PHOLL/13-184KLVADDVQNYA.ESKL.........TWFTKPVLITYDSNA.................IATWTVRANKAKLT--N.DKMLY
Q3IG36_PSEHT/6-184KVTAVKTELYE.QLGF.........TLFEKPTFILYDDRQ..................KTWRINADEATLY--D.ERQLI
Q1QVD4_CHRSD/15-188TLTSPRLVHTP.KDDI.........IRAASPVANIRDADG..................RQWDITGDKGRLG--AQRDLLT
Q1LRN4_RALME/18-199RFTGVKMVHFE.DDQT.........YEVTTPAMRNYEPDR..................PPVTANANRGVMN--AEGSIID
Q7NSU1_CHRVO/12-188KLIATRMWQYP.GKPD.........AYFENPDLYQYQQGA..................LQYHVTGETGRYN--NKSQQAY
Q2LSM5_SYNAS/26-198EIKADSAQYRK.KENL.........AVFKNPCIKLIMPNG..................RVYVMTGNEGFVH--QDSKDME
Q8D2M9_WIGBR/15-186KIFAQNIIISS.NQEE.........IFITNPIVIIFNENK.................IPIWSIDSMQAKIS--KKENYLF
Q82Y24_NITEU/13-186FFSADKLTHYP.VGDI.........TQLEHIGLVSIEPDK..................PLLRVTSGRAELA--GGDNDIF
Q3J7F9_NITOC/4-178RLAGTHMAHYL.DNDT.........IEITAPDAVFYQQAT..................ARWKVVAERGLTN--SQGDEID
Q31H03_THICR/9-187TVIYSDEVFYQNETKQ.........SRFKNPYIIQDKET...................SAYTIKSQQGQSI--N.DQSVH
Q4KI84_PSEF5/13-188EMTSDKVEHVK.ASEV.........TLLTKPDLQMYRGTT..................FPWHVQSERGEVN--PDGTEVE
A3QI76_SHELP/7-183RVSASHMEHYA.ERNQ.........TYFTQPIYLVYPDNG.................DAQWRLRSTKGTLD--KNSGRVT
Q74BY8_GEOSL/20-186DLYADRGEYDR.QRDV.........TLLTGVRIVFPGTDK.................TGEITLRSDKAEYF--NATKDVT
Q2NWJ8_SODGM/13-184KLVADHVDHFA.DQHI.........TWFTRPVATTFDESK.................VPTWTVKADKAKLT--Q.DRMLY
Q3B209_PELLD/22-189RIEGGSEQHLD.................EGVAVNFFDADG.................NTTTHISADRAIVY--E.NQDIE
Q9CP81_PASMU/10-189VAMSDSVEHFA.LSGQ.........THFQKPEVYLFELETENQ...........LSNKENWKASANKAILT--K.ENMLY
Q21FU6_SACD2/6-194EFVASRLEHYQLTEDQAPEDENRVYTLIDLPVLTIFQGE...................QPWRVEAKKGKLL--GDGQSIE
Q2SBI4_HAHCH/14-189RLQSQLAKHYP.DTDT.........GVLTRPNLEIFQQGE..................KSWHVESLEGELL--IKQDTLK
Q3SLC6_THIDA/11-186RLSAKRLKHYT.GSRL.........TELELPRFVQIDPEA..................GEIRAAAREATIS--PTGDEVD
Q2YCX5_NITMU/11-187MLLGKKMVHYP.DDDS.........AELEQPRLITIEPGK..................PSVQLQADNAKMS--AEGEDIY
LPTC_HAEIN/15-205LALSDKIEHYT.VNEQ.........TLFTAPLVYLYPTTSNEKEKEKNANQNVDFFSTQSWKLSANQARLT--K.DQILY
Q6DAG2_PECAS/13-184RLISEKAEYFN.DEQL.........SWFTTPVATLFNEQG.................TATWSVRADRAKLT--K.DKMLY
Q47VI4_COLP3/8-184TIEAERMEHYS.DLEV.........SYFELPNYTLYPQKE.................GQPWKVSAQEATLY--K.DNRVE
Q9KP51_VIBCH/8-183VITSIHLDHYA.KSGN.........TLFKAPILKVYREGT.................LQEWEITARRGILS--K.DQVLT
LPTC_ECOLI/13-183RLIAQHVEYYS.DQAV.........SWFTQPVLTTFDKDK.................IPTWSVKADKAKLT--N.DRMLY
Q5E7W1_VIBF1/8-183QINAKALARFG.KTGE.........TNFTTPHLFVFKDGE.................LKEWEIISDLGVLN--K.KHELY
Q47AI2_DECAR/11-187RLTAPYLEHFP.DDDS.........SELKSPILISYRPDA..................PSITVKGNYAKVT--SKGETVY
Q5R0I9_IDILO/8-184KIKSEKMSHYN.QIGL.........TELKRPVYTVFSEQG.................EELWEVSAAQGTFY--D.DQTLI
Q7VQS2_BLOFL/22-198NLIANNVQYHP.NQKT.........ISFTHPSITIFNNKN.................IAIWYITCNQAQLY--HQKKTLN
G1UBB2_HAEDU/10-185FAKATEIKRYE.ATQH.........TEFINPFINLYDTQTR................AKQWNISAEQAEIT--H.EKMLH
Q4FT81_PSYA2/11-180ELSAESLTHNP.VTNK.........DEMKGITMNWEPSDE..................QRYRIEAGTAAIS--QQTGELS
Q5NG31_FRATT/16-206SFFAKELQRYL.NQD..........LYMTDITEKSYDKATE................KLDWQVQAKHAQQL--ANQNLIH
Q5ZX94_LEGPH/14-185LLTTPQVEYIP.NNNL.........HLLKNPHIIIKQDNQ..................PAWEINSLRAKSF--DGGKQIT
Q63XK4_BURPS/14-190RLTAAGLVHYE.DDET.........SDLTRPALRAFQPGK..................PTVTATAKRGAVN--GDVSIVD
Q6LMB9_PHOPR/9-183QIDSEYLEHFS.VSGD.........TDFDKPVLWVYRDGE.................NTEWRISSNTAKLD--K.DQVLQ
Q7CL87_YERPE/13-184KLVAEEVQNFS.AKEL.........TWFTKPVMTLFGDNA.................VATWTVRADRAKLT--D.DKMLY
Q87LE5_VIBPA/9-183IIRSNNLDYYA.KSGE.........TIFNSPTLMVYREGS.................VVEWKVTATRAVLD--E.DQVLT
Q87WU3_PSESM/14-188DMTADKVEHVM.ATDV.........SLLTTPNLHMYRGGE..................FPWHVTSKRGEVS--SAGDQVE
Q88P97_PSEPK/14-188EMTADRIEHLK.TSEI.........TQVTTPDLHLYRGTE..................YPWHVQSTRAEVN--PDGTEVE
Q8F3J5_LEPIN/12-176ELRANESFVYV.NENK.........TTFYDIDFDQYEAGK..................FKSKLLAEKGEIN--HKTRLML
Q9PDG8_XYLFA/11-184TLLGQQMQHNQ.TDSS.........AEVTAPLFMIPDQAG..................QHWTLQAQTGWIN--KDGTLLR

PF03968

Q83DI4_COXBU/10-123LIK.NARVT......Q-------------KQNILTGPHIWYDIKKQT---------------------------------
Q8EAE7_SHEON/31-142LTG.TATLD......Q-------------AGSQVTGNLIRYNIIQQK---------------------------------
LPTD_HAEIN/51-189MK..NATFTSC.LHGD-------------NAWAVDASEIRQYVKEEY---------------------------------
Q5P773_AROAE/35-149LFN.QARVE......S-------------GGDEVRGHYIEYDALSEK---------------------------------
LPTA_HAEIN/33-146LTN.NAELK......Q-------------LDSKINGSVITYDVKKQQ---------------------------------
Q7W010_BORPE/43-162LIG.QAIVTRY.ICGK-------------PFDTIRGDRVRYNEKTGI---------------------------------
Q6NDQ7_RHOPA/57-184MTG.NVVLT......Q-------------ARNVVRGDRLLVDMTTGV---------------------------------
LPTD_VIBVY/55-188LE..DGSITSC.PADD-------------NAWRLVASSIEVDQDEET---------------------------------
LPTD_VIBF1/66-199LE..DASFTTC.PADD-------------NSWRFKASDIELDQSDEW---------------------------------
Q7MQR6_WOLSU/25-137LLG.NAFMEE....IG-------------KSNTVKGEKIIINRVSGF---------------------------------
Q8Y2C6_RALSO/38-157LIN.RARMERL.QGAT-------------QLDEIRGAVITYDGQKEF---------------------------------
LPTD_ECOLI/53-195LD..NGSFTSC.LPGS-------------DTWSVVGSEIIHDREEQV---------------------------------
Q60AV1_METCA/39-150LYD.KAVVW......Q-------------GGDSTESDRIEYDSHKNF---------------------------------
Q7NSU0_CHRVO/32-144LTG.NARVK......R-------------NGDLVIGNVITYDTQSEV---------------------------------
Q5NQV4_ZYMMO/49-163LVG.HVEMV......R-------------GDSVVHGARLIIDLNTGK---------------------------------
Q7VQS3_BLOFL/35-147FSG.NAHIK......Y-------------LGNSIYSDNIIYSINQKK---------------------------------
Y383_RHIME/50-164LKGKKVVLS......E-------------GKNVFVGCQLNVQMDTGE---------------------------------
Q5LWN1_RUEPO/41-147MTG.DVLLT......Q-------------GKNALSSGKMTVNLTSGT---------------------------------
Q9A2G4_CAUCR/38-152LTG.DVILV......K-------------GNDVARGDRLTVNTKTND---------------------------------
LPTD_PHOPR/70-206MK..DGTYTTC.PAED-------------NSWRFSATTLEREGDSPF---------------------------------
LPTD_MANSM/52-190LN..NATFTSC.LPND-------------NSWQIEAKEMKQYIKEEY---------------------------------
Q63XK5_BURPS/49-169LTT.NATVRRLQGVST-------------IADTVHGSVITYDGQRDF---------------------------------
LPTD_PASMU/52-190MT..NAVFTSC.LPQD-------------NAWSIEAKEMRQHIQEEY---------------------------------
Q5R0J0_IDILO/35-147LSG.DARIS......Q-------------GSSSSSGSLITYDLNKQT---------------------------------
Q9KP50_VIBCH/45-157MIN.KAMLS......Q-------------DDSEIRGSKIRYKISLQK---------------------------------
Q98GS3_RHILO/46-170LSGKEVVLS......Q-------------GPNVLKGCKLTVQMKTGL---------------------------------
Q7VGJ3_HELHP/21-132LID.SAMLEE....IG-------------KKNIIRGNMIVFNPQSQE---------------------------------
Q7MPB4_VIBVY/35-147MKG.QAELA......Q-------------DNNVIKGSSIVYQIALQK---------------------------------
O26088_HELPY/35-147LLQ.NAVVRE....VG-------------KSNVITGDEIILNKTKGY---------------------------------
Q5E7W2_VIBF1/30-142MTD.SAELT......Q-------------DDSIIKGKVITYNMKTQK---------------------------------
O67922_AQUAE/20-125LKG.NAKIE......E-------------NGRVVEADEIIIYKREKR---------------------------------
LPTD_HAEDU/51-186LK..NASFTAC.LLND-------------NAWSIEANEMVQHIKAGY---------------------------------
Q74BY9_GEOSL/33-139LSG.DPKVY......Q-------------GENMISGKVITYFVNEER---------------------------------
Q5F6F3_NEIG1/32-143LTG.NAKVQ......R-------------GGDVAEGAVITYNTKTEV---------------------------------
Q6AR55_DESPS/32-143LTG.NAKAW......Q-------------NQNMVSGETITYFLDQKR---------------------------------
Q6LMB8_PHOPR/30-142MTD.EAILI......Q-------------EGSEIQGNVITYKIDEQR---------------------------------
Q87WU2_PSESM/34-146LID.KAKVV......N-------------DGNTSEGEKIVYDTVRQV---------------------------------
Q82Y25_NITEU/53-169LFG.SARLK......R-------------GADEVEGDYISYDIASDF---------------------------------
Q0PAL9_CAMJE/22-131ING.HAYINE....LG-------------SNQKLFGDKIIVDRKA..---------------------------------
Q2YP15_BRUA2/46-170LQGQKVVLT......D-------------GDNIVTGCKLTAHLDTG.---------------------------------
Q32BD3_SHIDS/37-149LTG.NAYLQ......Q-------------VDSNIKGDKITYLVKEQK---------------------------------
Q5ZX95_LEGPH/33-147LIG.NARIE......Q-------------GPNSLSAAKISYDTQEQ.---------------------------------
Q8P714_XANCP/33-143LTG.NYKVD......S-------------PKGTNAGQRMVYNTKTG.---------------------------------
LPTD_YERPE/53-193LK..NGTFTSC.LPGD-------------NSWSVVGSEVIHDREEQ.---------------------------------

PF13100

A6KXH5_BACV8/45-203YFD-GGTLM------D-------------EENVLTSEWGEYSPATKISVFNYDVKLVNPKF-------------------
C6VSH9_DYAFD/72-229YKQ-PGRTV------D-------------EENVLTSKEGFYNTATKEFTYYQNVKLVNKKY-------------------
C6Y022_PEDHD/22-179YVS-GGKIV------N-------------KDVTLTSKNGYYFSNSRDAYFRYNVVVVTPES-------------------
A5FGP3_FLAJ1/21-178YNT-KGTIV------N-------------KENTLVSKSGRYFAAEKKFQFLTEVTITNPKY-------------------
A6LEK0_PARD8/40-197YFD-GGLIV------D-------------SLNQLSSFYGQYSPSTKLAIFNDSVRLENEQF-------------------
Q7MX13_PORGI/44-201YFE-GGSIV------D-------------SLNTLTSSYGEYSPTTSDAIFRDNVHLENKDY-------------------
D3ICV2_9BACT/46-203FFD-GGKLV------D-------------GKDQLIADWGEYNTQSRQAVFYFRVKLKSKKS-------------------
R5ME27_9BACE/44-200YFE-GGTLT------D-------------EENVLTSEWGEYSPATKISVFNHDVKLVNPKF-------------------
R6CKV9_9BACT/28-185FFD-GGTLI------D-------------GKDKLVADWGEYHTETREAKFVYNVKLRSGKD-------------------

PF06835

Q9HVV8_PSEAE/12-188LID-DVRVARTDAKGQ..............PSILTTTRLTVFPDKNYAQTEQAVKIDAANG..VTTAVGMKAYLKDSRMH
Q7MPB3_VIBVY/8-183LSD-HVRMQNLLPGAS..............FEMLSTDKLEIDLSNRDFHADQPVLLIGPQF..ETTGEAMKGNLKTNTAT
Q2KUD4_BORA1/8-184MNG-DAHVHRNADANN.............DALDVRSQQLILIPDDDLVFTDLPAQVIKGNS..RMNGTGMRYNNKTRQLE
Q65RT9_MANSM/10-187LNG-EVVAQSLDPISR..............LQRIETEAAVVNLKNQDITSDNMVTIRGLNF..TSSGLKLTGNLKQQAAT
A6VMU7_ACTSZ/14-198LTG-RVVAQSLLPESR..............LQRVESERATVNLTTQDITSDKEVTIRGLNF..VSSGLKLDGNLKQQIAT
Q6FC68_ACIAD/7-179LSD-QVVATKLSDHGK...............MQFQTDELTTYPPKKMIETTHQVNVDSPQS..SFISQGLKADLNTGQYE
Q5F6F2_NEIG1/13-189FKN-NVVLTKTADGRR.............QAGKVETEKLHVDTESQYAQTDTPVSFQYGAS..HGQAGGMTYNHKTGMLN
Q7W009_BORPE/13-191MNG-DTHVHRQPDARN.............ETLDVRSQQLILLPDEDVVFTDLPAQVNKGNS..RMNGTGMHYNNKTRQLR
Q9A926_CAUCR/44-207LTD-EVKITSA..................EGFDFDAPRALIDLRTGAVSGDAGIAGSGPKG..STRASAYEVTDKGDRVV
Q83DI3_COXBU/10-185LWD-HVKVHEPPQPTE.............PETTITTSTLTLFPERSFAKTNDPVTITRPNA..VIKATGMTSNLKKGLVH
Q8Y2C5_RALSO/23-203LYD-NAKVVRAQGPDLRQ..........DPLMTADSTYFQVLLNDDVVRTDKPVELHRGPS..VMNANGLVFNNVTRQVQ
Q7N059_PHOLL/13-184LYG-DVQVDSLTNTSQ..............LQRITTENAIINLTTQDVSSDDQVTLIGVGL..KSVGMKMRGNLRNKTAE
Q3IG36_PSEHT/6-184LEG-NVTAQNLIDGAM..............IDKITADNIQVDIMLLTMRSEQPVIITGPNL..KITGKGLEANLTTEVIK
Q1QVD4_CHRSD/15-188LTG-NAQLVQPEQGWR.................LNTDVLHYQASEAHAWSDSDAVLRQHEQ..RVRGNRFDAWLDTDRAR
Q1LRN4_RALME/18-199LYG-NAFIVRQAGTDVSK..........DPRMTAASQYFQLLVNDDIVKTDKPVELTRGPS..VMNANGLIFNNVTREVQ
Q7NSU1_CHRVO/12-188FDK-KVVLIKPADSKQ.............PETRLVSSAMFVDTGKRFASSKAPSVIYQGNS..VANSIGFSYQESLGLLN
Q2LSM5_SYNAS/26-198ISG-NINLTSS..................NGDEFKTNHLSYSGIEKRCYTPAPVTMKNSRI..QVDAKGMSLSLKDEQLT
Q8D2M9_WIGBR/15-186LYG-KTIIKNFIYSLY..............IKKIYTNNAILNLKTHDIFSRKKTILFGSNF..NSTGIRMQGNLKYKIFL
Q82Y24_NITEU/13-186LTR-NVAIIRGEDKDK.............DKVTMLTDFLHLIPDTDIAKTDQPVTVTRMNS..VINAIGLFMNNQTGEIL
Q3J7F9_NITOC/4-178LLG-EVIIRQLGADSKT............SNMKILTQNVRVKPRIKYAETQQPVTLLNSFG..KTHSIGARVYLKDGRIE
Q31H03_THICR/9-187FNG-DVVIQMIEKQTPS............ENKTLKSEQISYNTLSETLTSKVYTEITEPGL..IMSGIGFKANMASGKYR
Q4KI84_PSEF5/13-188LID-SVRVSRTDEHNR..............NLLITTTRMTVFPQKQYAQTEQAVRIDGAGG..VTTAKGMKAYLKDGRMN
A3QI76_SHELP/7-183LEN-NVIIDAISPEEP..............IQTIETTYLELDLNTMIMTSDRSIRITGRDF..LITGEGLYADLNAQNIK
Q74BY8_GEOSL/20-186LTG-NIHARST..................SGMEFTTGRASYRASRQLVVTDDRVSFRDARF..AVEGVGMEFLVPTRTLR
Q2NWJ8_SODGM/13-184LYG-HVQVDSLTDASQ..............LKRITTDNAVVNLVTQDVSSDDEVTLYGTGF..NSTGMKMRGNLRNKTAE
Q3B209_PELLD/22-189GMG-NVVISSK..................DSTVIRTEYARRSGSDRMIRSERFVTIKRPGQ..SINGYGFESDQELKHYR
Q9CP81_PASMU/10-189LEG-NVVVESLLSPSR..............LQRVETESAVINLSTQDISSEHAVKIYGQHF..HSTGLKLTGNLQQQIAT
Q21FU6_SACD2/6-194LWE-DVVIRQKNESGT..............YTQLTTNKLLILPHEKVAQTEETVKINSPRG..EMTGVGMVADLAERKIT
Q2SBI4_HAHCH/14-189LRG-DVEVNGASDDGA..............PILMQTQALDYNNKSRFISTDQPVKITSNIN..QLTAVGMEADIDKKLIV
Q3SLC6_THIDA/11-186LRG-DVNVVRAAHAGQ.............SAMTLRTARLLVFPEQDQLRSPGPVDIRDDLL..TVRAGAMHYDARLRVIK
Q2YCX5_NITMU/11-187LSG-NVVIVRNAGKGR.............GETILTTSLLHLIPDQDIARTDKPVEITETNA..TIRAIGMEMNNRTGHTE
LPTC_HAEIN/15-205LEG-NVVAQNLTSDSR..............LQRIETESAVVNLKTQDITSETQVKIKGKNF..SSTGLKLVGNLRQQVAT
Q6DAG2_PECAS/13-184LYG-HVEVNSLTKDAQ..............LQRITTNNAQVNLVTQDVSSDDEVTLYGTSF..TSSGMKMRGNLRNKTAE
Q47VI4_COLP3/8-184LKN-QVHIKATEIDGL..............IKEIHCKTIALDLKTNIISSEQSVVVVGRDF..TMYGSGLIIDLNTKKMT
Q9KP51_VIBCH/8-183LYD-DVLAKNLLPDSG..............FDTLTTSEMSIQLKSRDFWADKPVELRGPQF..ETHGQAMKGNFADHSAE
LPTC_ECOLI/13-183LYG-HVEVNALVPDSQ..............LRRITTDNAQINLVTQDVTSEDLVTLYGTTF..NSSGLKMRGNLRSKNAE
Q5E7W1_VIBF1/8-183LSG-NVIVKNLLPDAA..............FETMTTDSMKIELTTKDFMTEDVVNLIGPTF..ETTGVGMKGNFTSQEAT
Q47AI2_DECAR/11-187IWE-NVSVTRAGAADR.............LELVARMPDLTAQPDAGFAFTNSPVEITQGQS..WMTGVGAHIDNNNSTFV
Q5R0I9_IDILO/8-184LEH-DVEILALEPDTH..............IEQVLTEYLIVDLKNESMSTEHPVSIHGPRL..LIRGNGMTADLKAERME
Q7VQS2_BLOFL/22-198LHG-QVFINQIVKKIC..............TQSIITNQLLIDLNNQSIISNNKTIIHGHYF..YSIGSCMNINLHTQTTT
G1UBB2_HAEDU/10-185LVG-NVKLKALENNAQ..............LQKIVTDKLTIDLNTQDVFTDSKVTSIGAGF..SSSGIGLKGNLKQQVAT
Q4FT81_PSYA2/11-180LSG-GFSLISEGKTGKPE..........VEPIKITGATLKGNTKSGQVYSNEPVKVEQGMN..RFEASSMKANLETGDYE
Q5NG31_FRATT/16-206LYD-GVNAIMITKKSAANTQKTSDNDSTPDKIYIKSSEMFYNSSSKDFYNNRFTKMYDPKTGNNTTGTGVKGNSETKIIE
Q5ZX94_LEGPH/14-185FIE-QVVVHQNPGEST.............RESTLKTEEITYYPKEKKATTSLFVTFEQPGN..IIQSTGMNAYLDEKRVE
Q63XK4_BURPS/14-190LYD-DARILRAAGAGD.............PPMQADSQHFRVLVNDDVIETEKPVKLQRGLS.IANAAAGMKYNNVTRVIE
Q6LMB9_PHOPR/9-183MTG-NVRIFNLLPESI..............MKVMQTETLRLDLITKDFDTADHVVITGTGF..QNEGTGMKGNMDRSVAT
Q7CL87_YERPE/13-184LYG-HVEVDSLTADAQ..............LKKIRTDNAQVNLITQDVASDDEVTLFGIGF..TSEGMRIRGNLRDKTAE
Q87LE5_VIBPA/9-183LYD-KVLMQNLLPGAS..............FDTMATDKLVINLTNRDFKADQQVMLVGPQF..ETTGGAMQGNLKQHTAT
Q87WU3_PSESM/14-188LID-DVRVERTDEKQR..............TTIITSSRMTVFPQKEYAQTDQDVRIDGAGG..VTTAKGMKAYLKDSRMD
Q88P97_PSEPK/14-188LID-KVRIARTDEKQR..............ETIITSSRMTVFPQKQYAQTEQAVRIDGAGG..TTTGKGMKAYLKEGKMD
Q8F3J5_LEPIN/12-176LEG-KILLKTD....D..............HKILTAKTMEYNMDTKKLVSDSEVSISADGT..TIRGIGLRADKDLNKFT
Q9PDG8_XYLFA/11-184LRH-DVKGDSPTDLGQ.............VPTTFRTQSLDIYPNHHLAKTTDAVTITHQGI..IQTGVGFEVNTKTQQYK

PF03968

Q83DI4_COXBU/10-123--------------
Q8EAE7_SHEON/31-142--------------
LPTD_HAEIN/51-189--------------
Q5P773_AROAE/35-149--------------
LPTA_HAEIN/33-146--------------
Q7W010_BORPE/43-162--------------
Q6NDQ7_RHOPA/57-184--------------
LPTD_VIBVY/55-188--------------
LPTD_VIBF1/66-199--------------
Q7MQR6_WOLSU/25-137--------------
Q8Y2C6_RALSO/38-157--------------
LPTD_ECOLI/53-195--------------
Q60AV1_METCA/39-150--------------
Q7NSU0_CHRVO/32-144--------------
Q5NQV4_ZYMMO/49-163--------------
Q7VQS3_BLOFL/35-147--------------
Y383_RHIME/50-164--------------
Q5LWN1_RUEPO/41-147--------------
Q9A2G4_CAUCR/38-152--------------
LPTD_PHOPR/70-206--------------
LPTD_MANSM/52-190--------------
Q63XK5_BURPS/49-169--------------
LPTD_PASMU/52-190--------------
Q5R0J0_IDILO/35-147--------------
Q9KP50_VIBCH/45-157--------------
Q98GS3_RHILO/46-170--------------
Q7VGJ3_HELHP/21-132--------------
Q7MPB4_VIBVY/35-147--------------
O26088_HELPY/35-147--------------
Q5E7W2_VIBF1/30-142--------------
O67922_AQUAE/20-125--------------
LPTD_HAEDU/51-186--------------
Q74BY9_GEOSL/33-139--------------
Q5F6F3_NEIG1/32-143--------------
Q6AR55_DESPS/32-143--------------
Q6LMB8_PHOPR/30-142--------------
Q87WU2_PSESM/34-146--------------
Q82Y25_NITEU/53-169--------------
Q0PAL9_CAMJE/22-131--------------
Q2YP15_BRUA2/46-170--------------
Q32BD3_SHIDS/37-149--------------
Q5ZX95_LEGPH/33-147--------------
Q8P714_XANCP/33-143--------------
LPTD_YERPE/53-193--------------

PF13100

A6KXH5_BACV8/45-203---------TLTSD
C6VSH9_DYAFD/72-229---------TLTTD
C6Y022_PEDHD/22-179---------RITSD
A5FGP3_FLAJ1/21-178---------VIKSN
A6LEK0_PARD8/40-197---------TLYSD
Q7MX13_PORGI/44-201---------TMDTE
D3ICV2_9BACT/46-203---------DIDTD
R5ME27_9BACE/44-200---------ILTSD
R6CKV9_9BACT/28-185---------VVTTD

PF06835

Q9HVV8_PSEAE/12-188LLSNVR...GQ.HE
Q7MPB3_VIBVY/8-183LYNHVQ...GR.YE
Q2KUD4_BORA1/8-184VHAS........TD
Q65RT9_MANSM/10-187LKEQVK...TH.YE
A6VMU7_ACTSZ/14-198LKEQVK...TH.YE
Q6FC68_ACIAD/7-179FF.NIR...GK.YA
Q5F6F2_NEIG1/13-189FSSKVK...AAIYD
Q7W009_BORPE/13-191VSAAADVEIAG.TE
Q9A926_CAUCR/44-207LKGGVR...TR.LE
Q83DI3_COXBU/10-185LLSHSR...GV.YE
Q8Y2C5_RALSO/23-203LLGNVR...GR.IE
Q7N059_PHOLL/13-184LIEKVN...TY.YE
Q3IG36_PSEHT/6-184LINHTR...TLYYD
Q1QVD4_CHRSD/15-188LTGDVQ...GH.HP
Q1LRN4_RALME/18-199LLGNVR...GTIIM
Q7NSU1_CHRVO/12-188LYSKTK...IV.YV
Q2LSM5_SYNAS/26-198LLSGVR...AV.LN
Q8D2M9_WIGBR/15-186LKDNIT...TL.NE
Q82Y24_NITEU/13-186LQSRVT...AH.DD
Q3J7F9_NITOC/4-178LLSQVR...GN.YD
Q31H03_THICR/9-187FLSDVK...TV.YQ
Q4KI84_PSEF5/13-188LLSNVR...GQ.YE
A3QI76_SHELP/7-183LTSQVE...GT.YE
Q74BY8_GEOSL/20-186ILNDVR...AT.IA
Q2NWJ8_SODGM/13-184LIEKVK...TS.YE
Q3B209_PELLD/22-189IFR......GS.GE
Q9CP81_PASMU/10-189LKEQVN...TY.YE
Q21FU6_SACD2/6-194LLGKVR...GT.HD
Q2SBI4_HAHCH/14-189LLSQVT...GV.YA
Q3SLC6_THIDA/11-186LSGRVH...TR.YL
Q2YCX5_NITMU/11-187LLSQVK...VV.HD
LPTC_HAEIN/15-205LKEQVK...TY.YE
Q6DAG2_PECAS/13-184LIEKVK...TS.YE
Q47VI4_COLP3/8-184LIQHER...TI.YK
Q9KP51_VIBCH/8-183LYNQVQ...GR.YE
LPTC_ECOLI/13-183LIEKVR...TS.YE
Q5E7W1_VIBF1/8-183LLENVQ...GI.YE
Q47AI2_DECAR/11-187LQSQVK...GQ.YI
Q5R0I9_IDILO/8-184LKRHVK...TI.FQ
Q7VQS2_BLOFL/22-198LFGKIY...TQ.YE
G1UBB2_HAEDU/10-185LIKDVK...TH.IE
Q4FT81_PSYA2/11-180F.GQVA........
Q5NG31_FRATT/16-206LSQNVR...SY.YA
Q5ZX94_LEGPH/14-185LLHKAR...GS.YD
Q63XK4_BURPS/14-190LYGNVR...GT.I.
Q6LMB9_PHOPR/9-183LLNNVK...GR.YE
Q7CL87_YERPE/13-184LIEKVK...TS.YE
Q87LE5_VIBPA/9-183LTNEVQ...GR.YE
Q87WU3_PSESM/14-188LLSNVR...GQ.YE
Q88P97_PSEPK/14-188LLSNVR...GQ.YE
Q8F3J5_LEPIN/12-176ILK...........
Q9PDG8_XYLFA/11-184LNSKVN...TR.YE

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window