Sequence alignment for CL0259

PF03968

Q83DI4_COXBU/10-123-----HVRSIE-V.IYRR-..PDH...ITLYHG---DVYATQGTTWISGDKVIVYHNPT.....................
Q8EAE7_SHEON/31-142-----KIKAVS-Q.TADI-..KNN...QIIFFG---PVEVVQGSIKINADQLRAFSAEG.....................
LPTA_SHIFL/37-149-----HIESDQ-Q.SLDM-..QGN...VVTFTG---NVIVTQGTIKINADKVVVTRPGG.....................
Q57FM0_BRUAB/46-171-----KIDADK-L.EMRD-..KEG...VAVFTG---NVAVSQGDALLKAGQMTVYYSKAKKGAEAPEP.........ANA
LPTD_HAEIN/51-189-----YIEADN-A.EINQ-..PND....ATYQG---NVDLKQGNRHLLAQSVQVKQSGNQSTPLRMAYVRN..GFDYKDN
Q5P773_AROAE/35-149-----NIEANR-L.TVDD-..RNK...VHVFEG---NVVLTQGSLVIKGDRLVVTQGPD.....................
P72709_SYNY3/57-131-----TVRSDI-Q.EANS-..QTG...VVTARG---NVQVYYPARNLQA...............................
LPTA_HAEIN/33-146-----NIVSDN-Q.SLDM-..EKS...VVTFTD---NVVITQGSIVIKANKVVITRPAE.....................
Q7W010_BORPE/43-162-----LILSDT-L.HYDD-..IKR...QSIFTG---NVILTRGLMTLTSDKLEVNEDAA.....................
Q6NDQ7_RHOPA/57-184-----QIESDT-L.EVRD-..KNK...EATFTG---NVKVVQGDTTMTSQTLVVFYDQDQAPAKGAKGK......PMPAA
LPTD_VIBVY/55-188-----VIQADN-L.QAIN-..GDK....AIYSG---DVEVTQGNKKITAESVTLHQQENIVVAEGNVT........FNDG
Q5HVC2_CAMJR/22-133-----EVKALN-F.YSDE-..NKG...ESILSG---NVEVIRGDDILNSEKLIIYTDKN.....................
LPTD_VIBF1/66-199-----LIQADS-V.EASN-..NSK....AVYKG---NVHIIKGRQEIKADSITLHQQENIAIAEGNVD........YSSM
Q7MQR6_WOLSU/25-137-----EITAKH-F.VADE-..AKK...TTLITG---DVVVVRGDDRLITDKLTVFFDDK.....................
Q8Y2C6_RALSO/38-157-----VLEADN-A.SYDD-..LKQ...VYHLSG---NVVLTKGTMVLRSDTADLRTDPE.....................
LPTD_ECOLI/53-195-----TINADH-A.KGDY-..PDD....AVFTG---SVDIMQGNSRLQADEVQLHQKEAPGQPEPVRTVDALGNVHYDDN
Q60AV1_METCA/39-150-----YIEADT-A.TYDE-..ATG...QTVYVG---HVRSTQGSLIVDSDKMIVYQKEG.....................
Q7NSU0_CHRVO/32-144-----EITSDN-GCTMEQ-..TKG...ISTCTG---NVVVVQGTLRLNADKVVATQDQQ.....................
Q5NQV4_ZYMMO/49-163-----DIDADH-S.EVLY-..NDN...RAIYSG---HVRARQADMTITAAYVRIAYTMPKNSK.................
Q6G1C4_BARQU/38-165-----ELYADS-L.EIRD-..KEG...IALFNG---DVSVVQGECLLRTAKLVVYYDKTQKVADRDRVD.......TKAE
Q7VQS3_BLOFL/35-147-----EIHSEY-Q.SINK-..LTN...VIHFTD---NVICKYKNIKLYADKVIITHNQK.....................
Y383_RHIME/50-164-----QIESDK-L.EIKD-..PES...KAIFTG---NVKVVQGTTTLQAGNMTVFYKAGGGS..................
Q5LWN1_SILPO/41-147-----EVTADS-L.DVSQ-..EDG...SAEFQG---NVLVSQGEMRLSAKRVLVIYNQE.....................
Q9A2G4_CAUCR/38-152-----DVSADN-Q.ETIN-..SKC...LIIFTG---NVEILQNRSRLRAEKVTIYNAKRPTAE.................
LPTD_PHOPR/70-206-----KVTADH-A.EALD-..KTK....VTYTG---DVVVQQGNRTIAADQAYLRQPENIVVAEGNVY........FHDG
Q5WY71_LEGPL/33-148-----QVVSDS-A.DLNQ-..KNH...QGVYIG---NVEFVQGSTNLRAEKAITQGDAK.....................
LPTD_MANSM/52-190-----YIEADK-A.ELNH-..PTK....GVYQG---NVDIKQGNRHLITETAEIIQSGQDENVQRYAYAKG..GFDYKDN
Q63XK5_BURPS/49-169-----NVEADN-L.TYDD-..LKQ...VTVATG---NVVITKGTILIKGDRVEVRQDPQ.....................
LPTD_PASMU/52-190-----YIEADQ-A.RLNQ-..SVS....ASYEG---NVEIQQGNRQLRAQRADISQQKQPNGLQRLAHVRG..GFEYQDH
Q8KYW6_9PROT/41-146-----EMLADR-L.TVSQ-..TDG...AARFEG---NVVIAQGDMRLSADLVDVTYLEA.....................
Q5R0J0_IDILO/35-147-----EVESSK-E.ELDI-..KNN...RLVLTD---NVIIRQGTLLIRADRLEASASES.....................
Q9KP50_VIBCH/45-157-----YIDSDS-Q.QLDM-..KSN...RVTFLG---DVKLKQGSININADKLIVIRNAE.....................
Q98GS3_RHILO/46-170-----QIESDK-L.EVRQ-..AEN...LAVFTG---NVTVVQGPTLLKAGKMMVYYVKDPNAAAKGT..........EAA
Q7VGJ3_HELHP/21-132-----EVSAKV-F.QSDL-..KNG...LTELSG---EVLVVKGEDKLWADKVVIETNKK.....................
Q7MPB4_VIBVY/35-147-----YIDSDS-Q.QLDM-..RSN...QVIFDG---DVSLKQGSININADKIVVTRDPE.....................
Q5H3D1_XANOR/32-144-----AIDSNA-N.DCNM-LDDSG...KCRFSG---NVVITQGTLEIHADTADIFQKNG.....................
O26088_HELPY/35-147-----EITGNQ-F.VAND-..KTK...TAVIQG---NVQIKKGKDRLFADKVSVFLNDK.....................
Q8YPX3_NOSS1/50-125-----TIRSDI-Q.EYDA-..KNQ...VITARG---NVQMLYPARQIQA...............................
Q5E7W2_VIBF1/30-142-----HINSNS-Q.NFDM-..QSN...QVTFTG---NVTLKQGSIEIFADKIVVIRPQG.....................
O67922_AQUAE/20-125-----TITGEA-N.SLEF-..LKD...RLIYKG---NVILHRDSSTLKADEVVILLDKE.....................
LPTD_YERPS/52-194-----RINADK-T.EANY-..PDN....ALFTG---NVIVQQGNSTLTANQVELTQVQKPGEVIPLRTVTATGDVNYDDP
LPTD_HAEDU/51-186-----EIEADR-A.VINQ-..PKE....ANYSG---NVTIKQGNRSIFADNVRIEQQAPQHRKAFLIGRY.....QYQDN
Q74BY9_GEOSL/33-139-----TVKSNE-L.SADS-..RNR...TATFSG---KVTARQGDLTIYSDRLIVHYRDD.....................
Q5F6F3_NEIG1/32-143-----QIEADQ-G.SLDQ-..ANQ...STTFSG---NVIIRQGTLNISASRVNVTRGGK.....................
LPTD_VIBPA/57-190-----VVEADN-L.QAIN-..GDK....AQYSG---NVQVTQGPKKITADSVTLHQQDNVVVAEGNVT........FNDG
Q6AR55_DESPS/32-143-----YIEANH-M.TSTE-..NTN...TVFFEG---DVDAKQDDVRIRSNKMTVFYSKASK...................
Q5N3C4_SYNP6/48-123-----TLFSDI-Q.EANS-..KTG...VVTARG---NVVILYPARQLRA...............................
Q6LMB8_PHOPR/30-142-----YIDSDN-Q.ELDI-..QKN...IVTFTG---NVILRQGSIDIRADKVVITRPNG.....................
Q87WU2_PSESM/34-146-----HIQSDD-A.QLDD-..KKG...VATYKG---NVIITQGSMKITGNTVTITRNAQ.....................
Q82Y25_NITEU/53-169-----HLEADH-A.TVED-YKRKGEFRTSIFTG---NVVLTQGTLVLRADKVIMKEDAA.....................

PF13100

A6KXH5_BACV8/45-203KSKVYLLHSDV-L-KKSPLNPDPD---AQILIG...NVAFRHDSVYMYCDSACFYEKTNSLEAFDNVK------------
D1VZZ9_9BACT/49-207SNRVELLHADE-L-RYDMYGPNPE---AQILKG...KVSFRHQGARLTCDSAYFYEADNSMKAFGHVR------------
C6VSH9_DYAFD/72-229EDLVEILKSDE-L-EIIN.QPGDD---SRRVTN...GV.FKHKGALLYSNLAIQHINSNVIEAFGNVR------------
A7AJW0_9PORP/66-223KTKVYLIHSNT-L-SFDK.AVKPD---AQILNG...DVCFRHDSSYMYCDSAYFFEQTNSLEAFSNVR------------
C2MC35_9PORP/61-218KRLIILDHADI-L-SHDQ.AILPD---VVILSG...NVRLRHGSWIMTCDSANLNEVTNSFDAFGHVR------------
C3RC63_9BACE/45-203KSKVYLLHSDV-L-KKSPLNPDPD---AQILIG...NVAFRHDSVYMYCDSACFYEKTNSLEAFDNVK------------
D1PEJ9_9BACT/45-203GDRVYLLHADE-L-YYDMFGNNPD---AQILKG...KVSFLHQGSHLTCDSAYFYQASNSVKAFGHVH------------
C6Y022_PEDHD/22-179KTKIIVERWDA-T-TTNA.ADKAN---RISYFR...KPVFRQDNARLFCDSAVFYPDKNIFDAFGNVH------------
Q1VX17_9FLAO/22-181GKKIDY.TSDR-T-RVDE.VNYPG---AFILSKVNNQVYFLHDGIEVWCDRAIFYQTDDFFRAFGNVR------------
A7V611_BACUN/62-219KTRVDLLYADE-A-QADK.QLRPD---VQVLIG...SVRMKHDSMYMFCDSALIFEKINSVEAFGNVR------------
A5FGP3_FLAJ1/21-178PKQIHVEHADN-F-ERNE.PLVPG---AVLLSG...NVKVDHDGIVLTCNKAYIFEGENYLKAFGNVQ------------
C6Z7A8_9BACE/45-203KSKVYLLHSDV-L-KKSPLNPDPD---AQILIG...NVAFRHDSVYMYCDSACFYEKTNSLEAFDNVK------------
A6EJJ0_9SPHI/7-161KTKIILQSSQR-A-TIDA...KAN---ISYLR....NPVFRQDNATLACDSAVFYESRNVFDAFDNVH------------
B7BBT0_9PORP/66-223KTKVYLIHTNT-L-SFDK.AVKPD---AQILNG...DVCFRHDSSYMYCDSAYFFEQTNSLEAFSNVR------------
A6LEK0_PARD8/40-197KTKVFLEHANT-L-SFDK.ERNAE---AQVLNG...DVCFRHDSSYMYCDSAYFFEQTNSLEAFSNVR------------
C3JBC3_9PORP/31-188TRRIILDHADR-L-EYNA.ELTPG---VQRLVG...NVQLRHLNWVMTCDSAFLDQETDQFEAFGNVE------------
C7XBH6_9PORP/40-197KTKVFLEHANT-L-SFDK.ERNAE---AQVLNG...DVCFRHDSSYMYCDSAYFFEQTNSLEAFSNVR------------
B3C544_9BACE/43-200KTRVDLLHAEE-A-QADK.VLHPD---IQILIR...SVKLRHDSMYMYCDSALIYEKTNSVEAFGNVR------------
D2EYL4_9BACE/62-219KTRVDLLYADE-A-QADK.QLRPD---VQVLIG...SVRMKHDSMYMFCDSALIFEKINSVEAFGNVR------------
C9LKM5_9BACT/13-170NEKIVLKHADR-W-SYDQ.FRQPD---AQFLNG...NVVLLHSGMTMSCDSAILFQATNSFEAFGHVK------------
C3Q815_9BACE/45-203KSKVYLLHSDV-L-KKSPLNPDPD---AQILIG...NVAFRHDSVYMYCDSACFYEKTNSLEAFDNVK------------
D3ICV2_9BACT/28-186DQKVYLEHADE-L-KRDIYGTNPD---AQILKG...NVRLKHNGATLTCDSAYLYQESNSVRAFGRVS------------
D0THV9_9BACE/40-197KTKVFLEHANT-L-SFDK.ERNAE---AQVLNG...DVCFRHDSSYMYCDSAYFFEQTNSLEAFSNVR------------
Q7MX13_PORGI/44-201KTHVILEHADE-L-RYDR.LYNPD---VQRLLG...NVVIKHEGAVMRCDSAHLNQEENTFEAFGQVS------------
B6VRY3_9BACE/45-203KSKVYLLHSDV-L-KKSPLNPDPD---AQILIG...NVAFRHDSVYMYCDSACFYEKTNSLEAFDNVK------------
B0NWD6_BACSE/31-188KKRVDLLYADE-A-QADQ.QLRPD---VQVLIG...SVRMKHDSMYMFCDSALIYEKINSVEAFGNVR------------
B7ACA9_9BACE/15-172KKRVDLLYADE-A-QADK.QSRPD---VQVLIG...SVRMKHDSMYMFCDSALIYEKINSVEAFGNVR------------
A3XN79_LEEBM/25-184KKELDI.QSDV-S-QIDE.EKYPG---ALVMYKSTKQVYIQHEGIEMWCDLAFHYKAENFVRAIGNVR------------
D1K620_9BACE/45-203KSKVYLLHSDV-L-KKSPLNPDPD---AQILIG...NVAFRHDSVYMYCDSACFYEKTNSLEAFDNVK------------
B2RL27_PORG3/44-201KTHVILEHADE-L-RYDR.LYNPD---VQRLLG...NVVIKHEGAVMRCDSAHLNQEENTFEAFGQVS------------

PF06835

Q9HVV8_PSEAE/12-188ALIALLLIVAGYY-WNVGLELFN.....EQPTR---PGQDNTIDYYAENAHSLQYQEDGS.LDYEMTA------------
Q476E3_CUPPJ/18-199LLLMAVVAGST.F-WLVQINSQQ....EGTKAP---VVRKHEADYYIERFSATELAQDGG.TKVRFTG------------
Q7MPB3_VIBVY/8-183YLLLFFVVSWS.C-YYLYGQREA.....QSVQV---APNLELPMFSGESLNNISYNSDGI.RSHQISS------------
Q2KUD4_BORA1/8-184LIALFLLVSLV.I-STWWAADYA.QRAIPIDPP---RRITHEKDAWSRDFVMLRTDAQGK.PINRMEG------------
Q1QAN4_PSYCK/10-184TLIIAGLAGWF.F-KQQGEITPP.........V---NIETSDVDYEATDIKAVQTNEQGE.TEYELSA------------
Q65RT9_MANSM/10-187GTIALVLLAWF.Y-TLNQDKPDL.......TRL---IKAPESPEYTGHKMETTIFSPAGK.KQYQAYS------------
Q1Z1P9_PHOPR/8-183CALLIVICAWF.G-YYLLENRWK.....DDIQV---EPDAEKPLFTGSIVTNTAFNESGM.RSYQIDS------------
Q665J4_YERPS/13-184ALIALALIGWN.M-SGFNQQGAP.........V---VADDNEPSSQSQHTVTTVFNPVGQ.LNYKLVA------------
Q3R2F1_XYLFA/11-184LLLAAIVSGWS.A-WHQRKHTQA.........T---QLRDIAADYTVQDFKLVALDTQTGKKSLTLLG------------
A6VMU7_ACTSZ/14-198GVIALALLAWF.Y-SLNQEDGSL.......NHL---IKRSDSPEYIGRNMETTIFSPTGQ.KQYIAKS------------
Q6FC68_ACIAD/7-179YIAAVVIASIS.G-GYYYYSGKA......KKLD---VDSARNMTYSAEGVNLTQTDDQGH.LYVRATV------------
Q5F6F2_NEIG1/13-189LILAVALGSLS.A-WLGRISEVE......IEEV---RLNPDEPQYTMDGLDGRRFDEQGY.LKEHLSA------------
Q7W009_BORPE/13-191LLLALV......V-GTWWAADYA.QRAVQVDPP---RRLTHEMDSWARDFVMLRTDVQGH.PINRLEG------------
Q5WY70_LEGPL/13-185TLLILAGSGWY.Y-AHFNQAIIN.........K---KTLSNEVDTTISQLTVKQFNSEGV.LINLLTT------------
Q2A3E2_FRATH/15-206SIIVIIFSILY.I-SYNALDGGK......PLKN---IPQKNRVELKAFDFNYNKYDSSGN.LAMSFFA------------
Q9A926_CAUCR/44-207AATVIVQAAWR.S-LASSKLQTQ..........---...AATAPLVLDKPRFTGVLKDGR..PFLITA------------
Q83DI3_COXBU/10-185LLIVAACLSTL.L-ILRKTTSDE......RPSQ---AQLNHRPNAFMRDVNYYQYDEGGL.LHSHLVS------------
Q8Y2C5_RALSO/23-203ILLMAVVCGVT.F-LLVQVNTPQ....TEETAN---QAKRHVADYTMDGISATALDERGV.TKYRFTG------------
Q1MYN0_9GAMM/9-185ILIALTVVAYM.A-LNDRQGEEY.......HDQ---EQAKLEPDFMVENLNLQNYGENGE.LRQTVKA------------
Q7N059_PHOLL/13-184VLIILALIGWN.L-SDSDEIKSS.........S---ATDNSQPTYQSQEAITFVYDPTGK.LTYKLVA------------
Q3IG36_PSEHT/6-184IVLSVLFIGCM.V-WLWYPYFTQ..VNTVAKAD---SEVIAKPDYTAIELKQTAFDENGE.ISHKVTA------------
Q4CB63_CROWT/20-192GVILLLLLSLV.A-CQSSQPVSQ.....TLETS---GETRDETNLTLQNATLEQSNAEGE.ILWKIQV------------
Q3KI03_PSEPF/13-188GCIAAIFGAVG.Y-WNISPERFL.....DKPPV---SAAESPIDWYATNTHTIQYLEDGK.VQYEMTS------------
Q1V9H7_VIBAL/8-183YLLLIFVVAWC.G-YYLLTPKGN.....DAIQV---APDSELPMFSGSGLENITYGEDGV.RSYIIRS------------
Q1QVD4_CHRSD/15-188LLLILVVLGIG.L-AIVEQRNAT....TPGPVP---SDDAGEPDYYLEGVTMTRFDAQGI.PHQTLTS------------
Q1LRN4_RALME/18-199LLLMAIVAGST.F-WLVQINSPH....EATAQA---QVKRHVPDYYMDRFSATELAEDGN.TKIRFTG------------
Q7NSU1_CHRVO/12-188PVLLIGLTALL.T-VWLDQISRW.....DSHRR---ELDPDKPEYVAENLVATRYDKQGM.LMDKLIA------------
Q7VBX1_PROMA/3-139SIIFKLFIALG.L-VGCSSEQSK..........---...VKQPSFKFTNINLEQLDNNGN.KQFSFTT------------
Q2LSM5_SYNAS/26-198AVLCFAVLSIV.S-GVIYKVSGN...RPQKTLL---KIMDSTVDLQVMNVHYTEATDEG..VKWEIKA------------
Q494F5_BLOPB/27-200VLIIILLSFII.K-KSLIMFNAS.......LHP---LTRNDICTHQGTDVTINVYSKTGQ.LKFKLTA------------
Q8D2M9_WIGBR/15-186FYLIIIFIIYF.Q-IFFSFECIG..........---EYSSIKDNSQINNYNMRIYNINGS.IKYKIFA------------
Q2T1A3_BURTA/13-191LAAMAALAGGT.Y-WLLQATLPP....PGEALV---RPKSHTPDYFADNFSVTELDQTGS.TQYRLTA------------
Q82Y24_NITEU/13-186LTVLLLLTLWL.D-KNLQRPDSQ........QD---SGTQQEIDYIIENLDGIQINHELK.VNRFFSA------------
Q48EB8_PSE14/13-188GVLALLLAAVG.Y-WNISPESFM.....DQPVS---TVDDTVIDYYAINAHSVQYLPDGT.LQYDMTS------------
Q3J7F9_NITOC/4-178LMLIATLTAWE.L-LHEESAYIP........RS---DLNKRTTDYFMEKFTSTLMDQQGL.PLYRLAG------------
Q31H03_THICR/9-187LLFVAALVVLT.I-AFKQSVNRD....STSVQT---KPLALTHSWQIFKSTSWQVSKQDPNTKQTVIY------------
Q2P686_XANOM/13-186LFAAAVISGWS.A-WKQRARPAA.........A---AVQQSGADYILRDFELIALNKQSGKESMTLRA------------
Q1ZNQ0_PHOAS/8-183YVLLVIFCAWL.G-YNQLEQQWQ.....KDHQV---KPDDEKPMFIGNDISNTTFDLSGI.RSYQIDS------------
Q4KI84_PSEF5/13-188GTIALLFAAVG.Y-WNISPERFL.....DKPVA---QVDESAIDYYVINARSVQYLPDGK.LQYEMTS------------
A3QI76_SHELP/7-183AIIAFFGTALI.L-YWQVQSKKG.....SEELA---LDNVDRPDYIVRDLKSVQYNDEGG.INSRVSA------------
Q74BY8_GEOSL/20-186LYLVASLAIRL.V-GGNEKEAGL..........---PKLPRNIDLSLKTLHYAE.TREGV.KKWDLYA------------
Q9L7V7_HAEDC/10-185LIIVAILGGWY.M-NQHKPTDYS......LTQL---IKKEGTPDYSGRNISTMIYDVNGQ.PQYFAKA------------
Q2NWJ8_SODGM/13-184GLLVLVLIGWN.L-ADTDTAPAQ.........T---PVNAGEPTYQSEYTTTVVYNPAGG.LNYKLVA------------
Q3B209_PELLD/22-189AFILFFSAGCT.A-PKGNEPRPDAPVVKNNSPV---QESWSFRFTVTEEGIRKSLITAGHAAEYRIEG------------
Q9CP81_PASMU/10-189AGLALALLAWF.Y-SLNQGEPSL.......NTL---IKKPDSPEYVGQKMKTTVFSPTGK.KHYVAMS------------
Q8KLW4_PSEST/12-188TLIAAVLVAIG.Y-WNIRPESFM....QQPTVA---SGETPDVDFYVINSRTVQYQADGK.RNYEMTA------------
Q21FU6_SACD2/6-194LYIAFVVTLVI.G-LLFYGDSPE.QLLGSGQDK---KAAKIYPYAIAHHASTRHFANDGT.LDYEFVA------------
Q1ZEX0_9GAMM/12-183LLIAFLFWSYF.K-AEPLYKISK..........---...VHNPNYTAYNLSSTHFDTLGD.ISHKMFA------------
Q2SBI4_HAHCH/14-189AALAAILVIYL.A-AYQDEANVP.....FFEEE---QLLKDEPDAFVINAVYTTYNKEGV.LTSRLQS------------
Q3SLC6_THIDA/11-186LAILLLLAALS.F-AIERAVQVT......PAPE---HAAESDPEGIMENFDALRTDATGR.PQYRLSA------------
Q2YCX5_NITMU/11-187FVIVALFASLL.T-LLNQDGPTP.....LLAPE---SISVRAPDYVVEDFSAIRTDENDA.GYKMLLG------------
LPTC_HAEIN/15-205GVIALCALAWF.Y-SLNQETADL.......SEL---VKKPDSPDYVGYKMETTVFSPDGK.KQYLALS------------
Q72S44_LEPIC/8-181RILVFLISVVC.G-FFLIIFENC.KKVNYERVE---KERESGSSISIRNFKREAYDSSGQ.LQWELRA------------
Q6DAG2_ERWCT/13-184ALLVLILIGWN.I-ADDDTVVAP.........D---ANDPAVPVYTSEKTNTQVYSPAGK.LSYRLIS------------
Q47VI4_COLP3/8-184ALFVLLLSALI.Y-GIIEWRSAS....IEQDTL---IVDEQRPDFIAEQLESKIYSDLGQ.LSHTIEA------------
Q9KP51_VIBCH/8-183YVLLLFIASWS.L-YYLLGQEQD.....SKIQV---APNLELPMFSGENLENISYDEQGI.RNYVITS------------
LPTC_ECOLI/13-183SLAVLVMIGIN.M-AEKDDTAQV..........---VVNNNDPTYKSEHTDTLVYNPEGA.LSYRLIA------------
Q5E7W1_VIBF1/8-183MAVLLMICSWS.G-YNLYYDYVK.....GEQQT---TPDQQVPVFTGKGITNNNYDVSGI.RNYQINA------------
Q47AI2_DECAR/11-187IIMLALLAGLT.F-WLQSTIDSG.....NEKHD---GKFRHDPDAIAENFTVRRFDATGE.VRYRLTA------------
Q5R0I9_IDILO/8-184ILILLFGAGLL.L-VWRPFSDDA....DGNNAA---TTRTMQPDFTAFGLETRIFESDGL.LAHKIKS------------
Q1YU13_9GAMM/9-185VFLAFMIGGFV.L-IWDSPPEAF...LRQTSSQ---MDKKPQADSYMTAVTSRRFSQLGS.EQFSLDS------------
Q2BKN4_9GAMM/11-187ILAAFILIPVL.L-YWGFGTSPV....EQAPSR---SNLPDQVDYFIDNAKIQEWDTDGQ.LIRKVET------------
Q7VQS2_BLOFL/22-198YMVLFILIYYF.H-IHTTHSTMH......PYIS---LLDNEIYTHQGKEVITNMYNIIEKNLTLNLIA------------
A5VZ45_PSEP1/13-188GAIAALLVAIG.Y-WNVSPESFL.....DKPVA---QVDESAIDYYAINAHSVQFLPDGK.LQYEMTA------------

PF03968

Q83DI4_COXBU/10-123......TNRIVRLKAIG..---------.HPAHYS-TMPDNQK------------------ARLYAQAETILYF..PAKA
Q8EAE7_SHEON/31-142.......ENSKILVATG..---------.NPATYS-QILD.DG------------------RPASASAKEIRYE..MATR
LPTA_SHIFL/37-149......EQGKEVIDGYG..---------.KPATFY-QMQD.NG------------------KPVEGHASQMHYE..LAKD
Q57FM0_BRUAB/46-171GVGGIGSSSIDHIDIAG..---------.......-.KVYLKS------------------GTQVATGDTGRYD..AKNQ
LPTD_HAEIN/51-189QINMLGKDAEFNLDSHD..---------..GNLTN-SEYEFVG------------------RQGRGKADNITLH..NNYR
Q5P773_AROAE/35-149........GFQTGVATGSD---------KRPATFR-QKREGSN------------------EFVEGEAERIEYD..SRAE
P72709_SYNY3/57-131...................---------.......-.......------------------.....TAAQAQYF..SQER
LPTA_HAEIN/33-146.....KSGKKETVEAFG..---------.TPVTFH-QQLD.NG------------------KPVDGKANKVHYD..LGNE
Q7W010_BORPE/43-162......GNQFGVATADKG.---------.KIVTIR-QDRPETF------------------ELIEGKGLRAEYE..SSKS
Q6NDQ7_RHOPA/57-184APGPDGASSIRRLEAKG..---------.......-.HVVVTQ------------------KDQVVTGDKAVFE..TKTN
LPTD_VIBVY/55-188EVKASSSKVTNNMTSET..---------..FSLEN-TEYQFLC------------------QQGRGQAAYIAKT...GQA
Q5HVC2_CAMJR/22-133.......RKPIRYEAMQ..---------....NAR-FKIVLKG------------------KTYKGSGDKFIYN..VIKD
LPTD_VIBF1/66-199EMRTTSDKVTTNLSTED..---------..TTMVN-TAYKMSC------------------QPIRGQAGRVLKT...GQE
Q7MQR6_WOLSU/25-137.......NRPLKYEAQG..---------...NVKF-AITLADG------------------RKLKGYSNNALYD..APKN
Q8Y2C6_RALSO/38-157........GYNYAVAIAKP---------GNLAFIR-QKRDNVD------------------EYIQGWGERIEYD..GKQE
LPTD_ECOLI/53-195QVILKGPKGWANLNTKD..---------..TNVWE-GDYQMVG------------------RQGRGKADLMKQR..GENR
Q60AV1_METCA/39-150........KTEKVVAWA..---------.NPVRLK-QTPDGGK------------------EDIHGTGQRAEYF..PETG
Q7NSU0_CHRVO/32-144........GNQTLQATG..---------.RIVTFR-QKLDNNS------------------GWIEGQSSKLDYD..SAKH
Q5NQV4_ZYMMO/49-163..TGEASPQMQRLDASG..---------.......-.GVTIQT------------------PDEMAKGEIAIYD..VPKR
Q6G1C4_BARQU/38-165SHARFGSTGIKKMEALG..---------.......-.KVYIKI------------------ATQIATGDKGVFD..GESK
Q7VQS3_BLOFL/35-147......KYKSSILTAYG..---------..HPATI-HYIQTSK------------------NITSASAEVIFFD..SIDN
Y383_RHIME/50-164..VTSGNADIDRIEVSN..---------.......-.KVFLSS------------------GAQQATGESGIVN..LTNQ
Q5LWN1_SILPO/41-147......ASGIERLEATG..---------.......-.DVVLVS------------------GSDAAQAQRADYT..IGTG
Q9A2G4_CAUCR/38-152..NANACGNAQRMEAEG..---------.......-.GVYLVN------------------EQQNARGDRAVYT..FSNN
LPTD_PHOPR/70-206TIEVDSERLQSDLDTED..---------..SEMDH-AVYNLTC------------------EPGRGEARRITKTHAQGTQ
Q5WY71_LEGPL/33-148.......NQLTLAIAEGSK---------DKQAHYW-TTTAPDK------------------PPFHAYADTIKYY..PLKH
LPTD_MANSM/52-190IINLTGDDAKVHLNTKD..---------..TDVKN-ADYQFVG------------------RQGRGSAQSAEVR..EDYR
Q63XK5_BURPS/49-169........GYQYATATASG---------KKHASFR-QKREGLD------------------EYIDGDAERIDYD..GKQD
LPTD_PASMU/52-190QIQLKGEEAQVQLNTKN..---------..TDIKN-ADYQLVD------------------RQGRGKAESIALR..EDYR
Q8KYW6_9PROT/41-146.......GGIGRLSASG..---------.......-.SVLLVS------------------PSDTAQADSAVYD..FSAR
Q5R0J0_IDILO/35-147......AEQADIFIAEG..---------.TPATYS-QTLD.DG------------------NEINAEAKKITYF..QSEQ
Q9KP50_VIBCH/45-157......NGKIEEIEGYG..---------.NVATFS-QLTD.EG------------------KTLYGEAKELYYK..VRDD
Q98GS3_RHILO/46-170GAAMTGSANIDHLEVSS..---------.......-.KVYIKS------------------DDQVATGDNGTFD..MKTQ
Q7VGJ3_HELHP/21-132.......NKPQKYTATG..---------....NVR-FYAKMPN------------------KEMRGKAKKAVYN..VIKD
Q7MPB4_VIBVY/35-147......SNTIKKIEAFG..---------.QPATFS-QLMD.DG------------------KTLSGSAKQLDYS..IDND
Q5H3D1_XANOR/32-144........QTDRVVLNG..---------.KQATLK-QEMD.DG------------------AMMHGQADNIEYK..VADD
O26088_HELPY/35-147.......RKPERYEATG..---------...NTHF-NIFTEDN------------------REISGSADKLIYN..ALNG
Q8YPX3_NOSS1/50-125...................---------.......-.......------------------.....TSAQAQYF..SKER
Q5E7W2_VIBF1/30-142......KEGREVLEAYG..---------.KPTRFS-QLTD.DG------------------KTLKGKANKLRYE..LENE
O67922_AQUAE/20-125.......NKPYKLIAKG..---------.......-.NVKFRE------------------NGRKAEAEFAEYD..LRKE
LPTD_YERPS/52-194QIKLKGPKGWSNLNTKD..---------..TDIDK-GKYQMVG------------------RQGRGDADLMKLR..DQSR
LPTD_HAEDU/51-186LIQAEGHNALLDLQSKD..---------..AEVAN-TTYQLVG------------------RQGRGEAESGQFT..PQTR
Q74BY9_GEOSL/33-139......GGDVEKVEAVG..---------.......-.NVKIVQ------------------GNRLATAKEGVYY..NTEQ
Q5F6F3_NEIG1/32-143........GGESVRAEG..---------.SPVRFS-QTLDGGK------------------GTVRGQANNVTYS..SAGS
LPTD_VIBPA/57-190QVKARSDRVTNDINQDT..---------..FSLEN-TEYQFLC------------------QQGRGTAAYIART...GQS
Q6AR55_DESPS/32-143...GEKSQQVKKIICTG..---------.......-.NTEVTR------------------GEWLGTGQRMVYT..TKDK
Q5N3C4_SYNP6/48-123...................---------.......-.......------------------.....TAAQAQYF..SRER
Q6LMB8_PHOPR/30-142......QDGQETIDAYG..---------.KPATFH-QIMD.DG------------------KPIDGASLKMRYE..TAID
Q87WU2_PSESM/34-146.......GEVDVFTSVG..---------.NLAYYE-QKPAVDK------------------PIVQAYAITIQYY..AGQD
Q82Y25_NITEU/53-169........GYRYATAYG..---------.DLVSYR-QKRDGVN------------------EYVEAWSKRAEYD..DKTD

PF13100

A6KXH5_BACV8/45-203MVQGDTLFLYGDYLFYDGN---------TQIAQVR.YNVRMEN------------------KNTTLLTDSLNYD--RIYN
D1VZZ9_9BACT/49-207FVQGDTLSLTAERADYDGQ---------EQMMRAR.KNVVLKH------------------RRQTLLTDSLDYD--RLYQ
C6VSH9_DYAFD/72-229IVQGDTVTVTGDTLYYYGN---------TRLAIVSGKKTVLKD------------------TKKTLTTRKIEYD--MANG
A7AJW0_9PORP/66-223MEQGDTLFVYGDYLFYDGN---------TQVAYLR.ENVRMEN------------------GQVTLFTDSLNYE--RIPN
C2MC35_9PORP/61-218IQEGDSISITAGEMTYDGM---------TTLAELH.DNVILTK------------------NVTTLFTERLFYN--RSQK
C3RC63_9BACE/45-203MVQGDTLFLYGDYLFYDGN---------TQIAQVR.YNVRMEN------------------KNTTLLTDSLNYD--RIYN
D1PEJ9_9BACT/45-203YRQGDTLSLTCNRAEYDGQ---------MQMMRAR.KNVVLHH------------------RRQTLRTDSLDFD--RLYN
C6Y022_PEDHD/22-179INQADTINIYSDRLNYNGN---------TKMAHLT.SNVRMVD------------------NENVLTTNILDYN--MASK
Q1VX17_9FLAO/22-181MKQGDTVNMTSKYAEYNGY---------TQFAFAS.EDVVLTT------------------PSNRLTTDSLFFN--RLKQ
A7V611_BACUN/62-219MEQGDTLFIYGDYLYYDGM---------SQLAMLR.ENVRMIN------------------RNTVLTTDSLNYD--RLYD
A5FGP3_FLAJ1/21-178LVQGDTLFLNSKYAEYSGN---------LKQAFAT.GDAVMTS------------------PDATLQTDTIHFD--RNIQ
C6Z7A8_9BACE/45-203MVQGDTLFLYGDYLFYDGN---------TQIAQVR.YNVRMEN------------------KNTTLLTDSLNYD--RIYN
A6EJJ0_9SPHI/7-161INQADTINIYSKRLTYDGN---------TKNAHLT.QNVKMID------------------KESILTTEVLDYN--LGTK
B7BBT0_9PORP/66-223MEQGDTLFVYGDYLFYDGN---------TQVAYLR.ENVRMEN------------------GQVTLFTDSLNYE--RIPN
A6LEK0_PARD8/40-197MEQGDTLFVYGNYLFYDGN---------TQIAYLR.ENVRMEN------------------GQVTLFTDSLNYE--RIPD
C3JBC3_9PORP/31-188IHEGDSITILSKYLNYDGM---------ARFARLR.NTVELRN------------------STATLYTDSLDYD--RVAG
C7XBH6_9PORP/40-197MEQGDTLFVYGNYLFYDGN---------TQIAYLR.ENVRMEN------------------GQVTLFTDSLNYE--RIPD
B3C544_9BACE/43-200MEQGDTLFIYGDYLYYDGM---------SQLAMLR.ENVRMIN------------------RNTTLTTDSLNYD--RLYN
D2EYL4_9BACE/62-219MEQGDTLFIYGDYLYYDGM---------SQLAMLR.ENVRMIN------------------RNTVLTTDSLNYD--RLYD
C9LKM5_9BACT/13-170ILQGDTLSLKGEYLFYDGG---------AQLAQMR.KNVVMKH------------------RTQTLLTDSLNYD--RLYG
C3Q815_9BACE/45-203MVQGDTLFLYGDYLFYDGN---------TQIAQVR.YNVRMEN------------------KNTTLLTDSLNYD--RIYN
D3ICV2_9BACT/28-186FRQGDTLSLKGERGFYDGV---------TQILEVR.KNVVLKH------------------RNQTLYTDSLNYD--RMYK
D0THV9_9BACE/40-197MEQGDTLFVYGNYLFYDGN---------TQIAYLR.ENVRMEN------------------GQVTLFTDSLNYE--RIPD
Q7MX13_PORGI/44-201MQQGDTVSMFARYLHYDGN---------IKYARLR.HEVRLEN------------------RSATLFTDSLDYD--RVMN
B6VRY3_9BACE/45-203MVQGDTLFLYGDYLFYDGN---------TQIAQVR.YNVRMEN------------------KNTTLLTDSLNYD--RIYN
B0NWD6_BACSE/31-188MEQGDTLFIYGDYLYYDGM---------SQLAMLR.ENVRMIN------------------RNTELTTDSLNYD--RLYN
B7ACA9_9BACE/15-172MEQGDTLFIYGDYLYYDGM---------SQLAMLR.ENVRMIN------------------RNTELTTDSLNYD--RLYN
A3XN79_LEEBM/25-184MKQGDTISMRSNYAEYNGD---------TQFAWAS.GGVNLRT------------------PTATLDTDTLYFN--RIKQ
D1K620_9BACE/45-203MVQGDTLFLYGDYLFYDGN---------TQIAQVR.YNVRMEN------------------KNTTLLTDSLNYD--RIYN
B2RL27_PORG3/44-201MQQGDTVSMFARYLHYDGN---------IKYARLR.HEVRLEN------------------RSATLFTDSLDYD--RVMN

PF06835

Q9HVV8_PSEAE/12-188-------VKLEHQK.ATDI.........TFVTTPDLLLFRGNV..................QPWHIQSARAEVG--PKGK
Q476E3_CUPPJ/18-199-------DKMVHFD.DDQT.........YEVTRPAMRAYQPNR..................PPVSARADLGRMN--AEGS
Q7MPB3_VIBVY/8-183-------SHLDHYA.KSGD.........TVFENPSLVIYRDGDT.................IEWKITARRAVLD--E.EQ
Q2KUD4_BORA1/8-184-------VYGEHFP.DDDS.........YHVVSPRAIGQQANN..................PVTVAVSKTAIME--EGGK
Q1QAN4_PSYCK/10-184-------ESLTHNP.VTNK.........DEMKGITMNWEPSDK..................QRYRIEAGTAAIS--QQTG
Q65RT9_MANSM/10-187-------DTARHYD.QDGH.........TEFVNPVVFALEVETENQGK.............QSWKLTAKSATLT--K.DN
Q1Z1P9_PHOPR/8-183-------DYLEHFS.VSGD.........TDFDKPVLWVYRDGEN.................TEWRISSNTAKLD--K.DQ
Q665J4_YERPS/13-184-------EEVQNFS.AKEL.........TWFTKPVMTLFGDNAV.................ATWTVRADRAKLT--D.DK
Q3R2F1_XYLFA/11-184-------QQMQHNQ.IDST.........AEVTAPLFMIPDQAG..................QHWTLQAQTGWIN--KDGT
A6VMU7_ACTSZ/14-198-------DKVEYYS.EDGH.........TDFFNPVVFVLDDPTSDESEQSETDLK......QSWKLTAVKAKLT--K.DN
Q6FC68_ACIAD/7-179-------DRLEQNM.QNQT.........SKLENLNASTYKAGN..................VDSTFFSKYAYGY--NDNE
Q5F6F2_NEIG1/13-189-------KGAKQFP.ENSD.........IHFDSPHLVFFQEGR..................LLYEVGSDEAVYH--TENK
Q7W009_BORPE/13-191-------VYVEHFP.DDDS.........YHVTTPRAIGQQAGN..................PITIGVSKTAIME--QGGQ
Q5WY70_LEGPL/13-185-------PQVEYIP.NNNL.........HLLKNPHIIIKQDNQ..................PAWEINSLRAKSF--DGGK
Q2A3E2_FRATH/15-206-------KELQRYL.NQD..........LYMTDITEKSYDKATEK................LDWQVQAKHAQQL--ANQN
Q9A926_CAUCR/44-207-------ERAERDAKDQNI.........VRLTAPLLVRGYGEP..................NPSQATAKSGVYR--EAEN
Q83DI3_COXBU/10-185-------PLITHFP.YQNS.........FQFTRPHYLIYTDKR..................IPWNITANSGKSQ--QGIK
Q8Y2C5_RALSO/23-203-------VHMNHYE.DDLT.........YDVTFPALRIYAPDR..................PQVTARADLGKMN--GEGS
Q1MYN0_9GAMM/9-185-------KSAKHFP.ATDVQAE.....IVAFISPDITLHQADK..................KLWRLTAETGKLT--N.QR
Q7N059_PHOLL/13-184-------DDVQNYA.ESKL.........TWFTKPVLITYDSNAI.................ATWTVRANKAKLT--N.DK
Q3IG36_PSEHT/6-184-------VKTELYE.QLGF.........TLFEKPTFILYDDRQ..................KTWRINADEATLY--D.ER
Q4CB63_CROWT/20-192-------DEAKYSP.DRQT.........ANLTAVKGNIFQDGE..................IVLQVKSDYGVIQ--RDGA
Q3KI03_PSEPF/13-188-------EKAEHVK.VTDI.........TLVTKPDLNMFRGTD..................FPWHVTSERGEVN--SGGT
Q1V9H7_VIBAL/8-183-------TNLDHYA.KSGD.........TIFNNPTLMVYREGSV.................IEWKVTATRAVLD--E.DQ
Q1QVD4_CHRSD/15-188-------PRLVHTP.KDDI.........IRAASPVANIRDADG..................RQWDITGDKGRLG--AQRD
Q1LRN4_RALME/18-199-------VKMVHFE.DDQT.........YEVTTPAMRNYEPDR..................PPVTANANRGVMN--AEGS
Q7NSU1_CHRVO/12-188-------TRMWQYP.GKPD.........AYFENPDLYQYQQGA..................LQYHVTGETGRYN--NKSQ
Q7VBX1_PROMA/3-139-------KKAEIVE.ISKS.........LTAKEPVLIFYQGNK..................PYYKIQSNKASLI--NNGQ
Q2LSM5_SYNAS/26-198-------DSAQYRK.KENL.........AVFKNPCIKLIMPNG..................RVYVMTGNEGFVH--QDSK
Q494F5_BLOPB/27-200-------HRIQHFS.NQRI.........TLFTCPSIIAFDDKNI.................PTWKITANQAKLS--Y.KT
Q8D2M9_WIGBR/15-186-------QNIIISS.NQEE.........IFITNPIVIIFNENKI.................PIWSIDSMQAKIS--KKEN
Q2T1A3_BURTA/13-191-------AGLVHYE.DDET.........SDLTQPALRAFQPGK..................PTVTATAKRGTVN--GDVS
Q82Y24_NITEU/13-186-------DKLTHYP.VGDI.........TQLEHIGLVSIEPDK..................PLLRVTSGRAELA--GGDN
Q48EB8_PSE14/13-188-------DKVEHVK.ATDV.........TLLTTPDLHMYRGGE..................FPWHVQSKKGEVS--SGGD
Q3J7F9_NITOC/4-178-------THMAHYL.DNDT.........IEITAPDAVFYQQAT..................ARWKVVAERGLTN--SQGD
Q31H03_THICR/9-187-------SDEVFYQNETKQ.........SRFKNPYIIQDKET...................SAYTIKSQQGQSI--N.DQ
Q2P686_XANOM/13-186-------PEMHRNR.ADQT.........ADITTPVFLMPDNAN..................LPWTLRSKTGWVN--PDGT
Q1ZNQ0_PHOAS/8-183-------DHLEYFE.KSGQ.........TDFVKPVLWVFKDGKN.................AEWRVSSNTAILD--K.NN
Q4KI84_PSEF5/13-188-------DKVEHVK.ASEV.........TLLTKPDLQMYRGTT..................FPWHVQSERGEVN--PDGT
A3QI76_SHELP/7-183-------SHMEHYA.ERNQ.........TYFTQPIYLVYPDNGD.................AQWRLRSTKGTLD--KNSG
Q74BY8_GEOSL/20-186-------DRGEYDR.QRDV.........TLLTGVRIVFPGTDKT.................GEITLRSDKAEYF--NATK
Q9L7V7_HAEDC/10-185-------TEIKRYE.ATQH.........TEFINPFINLYDTQTRA................KQWNISAEQAEIT--H.EK
Q2NWJ8_SODGM/13-184-------DHVDHFA.DQHI.........TWFTRPVATTFDESKV.................PTWTVKADKAKLT--Q.DR
Q3B209_PELLD/22-189-------GSEQHLD.................EGVAVNFFDADGN.................TTTHISADRAIVY--E.NQ
Q9CP81_PASMU/10-189-------DSVEHFA.LSGQ.........THFQKPEVYLFELETENQLSNK...........ENWKASANKAILT--K.EN
Q8KLW4_PSEST/12-188-------EKVEHIK.ASDV.........SLLTKPDLLSYRGGE..................HPWHVRSERGEVS--AEGD
Q21FU6_SACD2/6-194-------SRLEHYQLTEDQAPEDENRVYTLIDLPVLTIFQGE...................QPWRVEAKKGKLL--GDGQ
Q1ZEX0_9GAMM/12-183-------DKATTFS.EKNN.........TVFINPRVIVYVRNKDNNQI.............STWQISSKDGLLE--D.EN
Q2SBI4_HAHCH/14-189-------QLAKHYP.DTDT.........GVLTRPNLEIFQQGE..................KSWHVESLEGELL--IKQD
Q3SLC6_THIDA/11-186-------KRLKHYT.GSRL.........TELELPRFVQIDPEA..................GEIRAAAREATIS--PTGD
Q2YCX5_NITMU/11-187-------KKMVHYP.DDDS.........AELEQPRLITIEPGK..................PSVQLQADNAKMS--AEGE
LPTC_HAEIN/15-205-------DKIEHYT.VNEQ.........TLFTAPLVYLYPTTSNEKEKEKNANQNVDFFSTQSWKLSANQARLT--K.DQ
Q72S44_LEPIC/8-181-------NESFVYV.NENK.........TTFYDIDFDQYEAGK..................FKSKLLAEKGEIN--HKTR
Q6DAG2_ERWCT/13-184-------EKAEYFN.DEQL.........SWFTTPVATLFNEQGT.................ATWSVRADRAKLT--K.DK
Q47VI4_COLP3/8-184-------ERMEHYS.DLEV.........SYFELPNYTLYPQKEG.................QPWKVSAQEATLY--K.DN
Q9KP51_VIBCH/8-183-------IHLDHYA.KSGN.........TLFKAPILKVYREGTL.................QEWEITARRGILS--K.DQ
LPTC_ECOLI/13-183-------QHVEYYS.DQAV.........SWFTQPVLTTFDKDKI.................PTWSVKADKAKLT--N.DR
Q5E7W1_VIBF1/8-183-------KALARFG.KTGE.........TNFTTPHLFVFKDGEL.................KEWEIISDLGVLN--K.KH
Q47AI2_DECAR/11-187-------PYLEHFP.DDDS.........SELKSPILISYRPDA..................PSITVKGNYAKVT--SKGE
Q5R0I9_IDILO/8-184-------EKMSHYN.QIGL.........TELKRPVYTVFSEQGE.................ELWEVSAAQGTFY--D.DQ
Q1YU13_9GAMM/9-185-------PRIEFFQ.GEST.........VKVQQPRFLARGDTP..................HPLALTANSGVLD--NASG
Q2BKN4_9GAMM/11-187-------KKLEHKP.HKEA.........NFLDAPISTQFQKNG..................NISLLTAAKGVVL--DDNS
Q7VQS2_BLOFL/22-198-------NNVQYHP.NQKT.........ISFTHPSITIFNNKNI.................AIWYITCNQAQLY--HQKK
A5VZ45_PSEP1/13-188-------DRIEHLK.TSEV.........TQVTTPDLHLYRGTE..................YPWHVQSTRAEVN--PDGT

PF03968

Q83DI4_COXBU/10-123QVLLIK.NARVT......Q-------------KQNILTGPHIWYDIKKQT------------------------------
Q8EAE7_SHEON/31-142TLTLTG.TATLD......Q-------------AGSQVTGNLIRYNIIQQK------------------------------
LPTA_SHIFL/37-149FVVLTG.NAYLQ......Q-------------VDSNIKGDKITYLVKEQK------------------------------
Q57FM0_BRUAB/46-171IMVLQGQKVVLT......D-------------GDNIVTGCKLTAHLDTGR------------------------------
LPTD_HAEIN/51-189..VMK..NATFTSC.LHGD-------------NAWAVDASEIRQYVKEEY------------------------------
Q5P773_AROAE/35-149RARLFN.QARVE......S-------------GGDEVRGHYIEYDALSEK------------------------------
P72709_SYNY3/57-131RLVLSG.NVYVL......Q-------------DGNSMRAETMTYLVDEGR------------------------------
LPTA_HAEIN/33-146FLTLTN.NAELK......Q-------------LDSKINGSVITYDVKKQQ------------------------------
Q7W010_BORPE/43-162QFDLIG.QAIVTRY.ICGK-------------PFDTIRGDRVRYNEKTGI------------------------------
Q6NDQ7_RHOPA/57-184LVTMTG.NVVLT......Q-------------ARNVVRGDRLLVDMTTGV------------------------------
LPTD_VIBVY/55-188VYELE..DGSITSC.PADD-------------NAWRLVASSIEVDQDEET------------------------------
Q5HVC2_CAMJR/22-133TYEING.HAYINE....LG-------------SNQKLFGDKIIVDRKANI------------------------------
LPTD_VIBF1/66-199IYQLE..DASFTTC.PADD-------------NSWRFKASDIELDQSDEW------------------------------
Q7MQR6_WOLSU/25-137EYHLLG.NAFMEE....IG-------------KSNTVKGEKIIINRVSGF------------------------------
Q8Y2C6_RALSO/38-157ISKLIN.RARMERL.QGAT-------------QLDEIRGAVITYDGQKEF------------------------------
LPTD_ECOLI/53-195YTILD..NGSFTSC.LPGS-------------DTWSVVGSEIIHDREEQV------------------------------
Q60AV1_METCA/39-150ILILYD.KAVVW......Q-------------GGDSTESDRIEYDSHKNF------------------------------
Q7NSU0_CHRVO/32-144FAVLTG.NARVK......R-------------NGDLVIGNVITYDTQSEV------------------------------
Q5NQV4_ZYMMO/49-163LVTLVG.HVEMV......R-------------GDSVVHGARLIIDLNTGK------------------------------
Q6G1C4_BARQU/38-165MMSLTGRNVVLT......D-------------GDNVATGCKLTADMESGK------------------------------
Q7VQS3_BLOFL/35-147IITFSG.NAHIK......Y-------------LGNSIYSDNIIYSINQKK------------------------------
Y383_RHIME/50-164TIVLKGKKVVLS......E-------------GKNVFVGCQLNVQMDTGE------------------------------
Q5LWN1_SILPO/41-147VIVMTG.DVLLT......Q-------------GKNALSSGKMTVNLTSGT------------------------------
Q9A2G4_CAUCR/38-152TAVLTG.DVILV......K-------------GNDVARGDRLTVNTKTND------------------------------
LPTD_PHOPR/70-206FYRMK..DGTYTTC.PAED-------------NSWRFSATTLEREGDSPF------------------------------
Q5WY71_LEGPL/33-148LIELIG.NARIE......Q-------------GPNSLSAAKISYDTQEQH------------------------------
LPTD_MANSM/52-190..LLN..NATFTSC.LPND-------------NSWQIEAKEMKQYIKEEY------------------------------
Q63XK5_BURPS/49-169LTTLTT.NATVRRLQGVST-------------IADTVHGSVITYDGQRDF------------------------------
LPTD_PASMU/52-190..LMT..NAVFTSC.LPQD-------------NAWSIEAKEMRQHIQEEY------------------------------
Q8KYW6_9PROT/41-146ELRMRG.NVLLN......Q-------------GAISLSADLLTIDLETGG------------------------------
Q5R0J0_IDILO/35-147RLELSG.DARIS......Q-------------GSSSSSGSLITYDLNKQT------------------------------
Q9KP50_VIBCH/45-157ELVMIN.KAMLS......Q-------------DDSEIRGSKIRYKISLQK------------------------------
Q98GS3_RHILO/46-170VLVLSGKEVVLS......Q-------------GPNVLKGCKLTVQMKTGL------------------------------
Q7VGJ3_HELHP/21-132EYQLID.SAMLEE....IG-------------KKNIIRGNMIVFNPQSQE------------------------------
Q7MPB4_VIBVY/35-147QLTMKG.QAELA......Q-------------DNNVIKGSSIVYQIALQK------------------------------
Q5H3D1_XANOR/32-144IIILTG.NYKVD......S-------------PKGTNAGQRMVYNTKTGN------------------------------
O26088_HELPY/35-147EYKLLQ.NAVVRE....VG-------------KSNVITGDEIILNKTKGY------------------------------
Q8YPX3_NOSS1/50-125RIDFSG.NVYIL.....QQ-------------GGNSIRAEKVTYLIDEGR------------------------------
Q5E7W2_VIBF1/30-142FLKMTD.SAELT......Q-------------DDSIIKGKVITYNMKTQK------------------------------
O67922_AQUAE/20-125IIHLKG.NAKIE......E-------------NGRVVEADEIIIYKREKR------------------------------
LPTD_YERPS/52-194YTILK..NGTFTSC.LPGD-------------NSWSVVGSEVIHDREEQV------------------------------
LPTD_HAEDU/51-186..RLK..NASFTAC.LLND-------------NAWSIEANEMVQHIKAGY------------------------------
Q74BY9_GEOSL/33-139KIVLSG.DPKVY......Q-------------GENMISGKVITYFVNEER------------------------------
Q5F6F3_NEIG1/32-143TVVLTG.NAKVQ......R-------------GGDVAEGAVITYNTKTEV------------------------------
LPTD_VIBPA/57-190VYELE..DGSITSC.PEGD-------------NSWRLVASGIDVDQDEET------------------------------
Q6AR55_DESPS/32-143KIVLTG.NAKAW......Q-------------NQNMVSGETITYFLDQKR------------------------------
Q5N3C4_SYNP6/48-123RIILTG.NVFVQ.....QE-------------GGNSLRGETVTYLIETGK------------------------------
Q6LMB8_PHOPR/30-142FLKMTD.EAILI......Q-------------EGSEIQGNVITYKIDEQR------------------------------
Q87WU2_PSESM/34-146RIVLID.KAKVV......N-------------DGNTSEGEKIVYDTVRQV------------------------------
Q82Y25_NITEU/53-169KIELFG.SARLK......R-------------GADEVEGDYISYDIASDF------------------------------

PF13100

A6KXH5_BACV8/45-203LGYYFD-GGTLM------D-------------EENVLTSEWGEYSPATKISVFNYDVKLVNPKF----------------
D1VZZ9_9BACT/49-207TAYFYE-GGTLI------D-------------GKDRLVADWGEYNTETRQAVFYYHVKLRSENR----------------
C6VSH9_DYAFD/72-229IAYYKQ-PGRTV------D-------------EENVLTSKEGFYNTATKEFTYYQNVKLVNKKY----------------
A7AJW0_9PORP/66-223IGYYFE-GGLIV------D-------------SLNQLSSFYGQYSPETKLAVFNDSVQVENPDF----------------
C2MC35_9PORP/61-218VAYYDN-FGTLA------D-------------SINTLTSVYGEYNTGSDEALFQNQVHLENDRF----------------
C3RC63_9BACE/45-203LGYYFD-GGTLM------D-------------EENVLTSEWGEYSPATKISVFNYDVKLVNPKF----------------
D1PEJ9_9BACT/45-203MANFFD-GGTLI------D-------------GKDKLVADWGEYHTETREAKFVYNVKLRSGKD----------------
C6Y022_PEDHD/22-179VGTYVS-GGKIV------N-------------KDVTLTSKNGYYFSNSRDAYFRYNVVVVTPES----------------
Q1VX17_9FLAO/22-181EAFYRS-GGAVK------D-------------SASTITSVIGRYFMNQEKFSFRKDVKVRNPEY----------------
A7V611_BACUN/62-219LGYYFE-GGTLT------D-------------EDNVLTSEWGEYSPATKLAVFNHDVKLVNPKF----------------
A5FGP3_FLAJ1/21-178QAYYNT-KGTIV------N-------------KENTLVSKSGRYFAAEKKFQFLTEVTITNPKY----------------
C6Z7A8_9BACE/45-203LGYYFD-GGTLM------D-------------EENVLTSEWGEYSPATKISVFNYDVKLVNPKF----------------
A6EJJ0_9SPHI/7-161IGTYVE-GGKIV------N-------------KDVTLTSKNGYYFSNSRDAYFRYNVVVVTPQT----------------
B7BBT0_9PORP/66-223IGYYFE-GGLIV------D-------------SLNQLSSFYGQYSPETKLAVFNDSVRLENTDF----------------
A6LEK0_PARD8/40-197IGYYFD-GGLIV------D-------------SLNQLSSFYGQYSPSTKLAIFNDSVRLENEQF----------------
C3JBC3_9PORP/31-188KGYYFD-TGTIV------D-------------SLNTLTSIYGEYTPSTDQAIFRDAVELVNPDF----------------
C7XBH6_9PORP/40-197IGYYFD-GGLIV------D-------------SLNQLSSFYGQYSPSTKLAIFNDSVRLENEQF----------------
B3C544_9BACE/43-200LGYYFE-GGTLT------D-------------EENVLTSEWGEYSPATKISVFNHDVKLVNPKF----------------
D2EYL4_9BACE/62-219LGYYFE-GGTLT------D-------------EDNVLTSEWGEYSPATKLAVFNHDVKLVNPKF----------------
C9LKM5_9BACT/13-170IGYFFA-GGELI------D-------------AKNRLTSDWGEYDTKTRKAKFNYSVKLKNPQF----------------
C3Q815_9BACE/45-203LGYYFD-GGTLM------D-------------EENVLTSEWGEYSPATKISVFNYDVKLVNPKF----------------
D3ICV2_9BACT/28-186NAYFFD-GGKLV------D-------------GKDQLIADWGEYNTQSRQAVFYFRVKLKSKKS----------------
D0THV9_9BACE/40-197IGYYFD-GGLIV------D-------------SLNQLSSFYGQYSPSTKLAIFNDSVRLENEQF----------------
Q7MX13_PORGI/44-201LGYYFE-GGSIV------D-------------SLNTLTSSYGEYSPTTSDAIFRDNVHLENKDY----------------
B6VRY3_9BACE/45-203LGYYFD-GGTLM------D-------------EENVLTSEWGEYSPATKISVFNYDVKLVNPKF----------------
B0NWD6_BACSE/31-188LGYYFD-GGTLT------D-------------EENVLTSEWGEYSPATKLAVFNHEVKLVNPKF----------------
B7ACA9_9BACE/15-172LGYYFD-GGTLT------D-------------EENVLTSEWGEYSPATKLAVFNHEVKLVNPKF----------------
A3XN79_LEEBM/25-184QAYYRT-GGTLR------D-------------TASVIESKIGRYYLDQDKYSFIQNVVVTNPEY----------------
D1K620_9BACE/45-203LGYYFD-GGTLM------D-------------EENVLTSEWGEYSPATKISVFNYDVKLVNPKF----------------
B2RL27_PORG3/44-201LGYYFE-GGSIV------D-------------SLNTLTSSYGEYSPTTSDAIFRDNVHLENKDY----------------

PF06835

Q9HVV8_PSEAE/12-188EVELID-DVRVARTDAKGQ..............PSILTTTRLTVFPDKNYAQTEQAVKIDAANG..VTTAVGMKAYLKDS
Q476E3_CUPPJ/18-199VIDLYG-NGFVERQQGADA..........AKDPLLTAASSYFQVLLNDDIVKTDKAVKLTRGPS..VMTANGLIFNNVTR
Q7MPB3_VIBVY/8-183VLTLSD-HVRMQNLLPGAS..............FEMLSTDKLEIDLSNRDFHADQPVLLIGPQF..ETTGEAMKGNLKTN
Q2KUD4_BORA1/8-184RVVMNG-DAHVHRNADANN.............DALDVRSQQLILIPDDDLVFTDLPAQVIKGNS..RMNGTGMRYNNKTR
Q1QAN4_PSYCK/10-184ELSLSG-GFSLISEGKTAN..........PEVEPIKVTGATLKGNTKSGQVYSNEPVKVEQGMN..RFEASSMKANLETG
Q65RT9_MANSM/10-187LLYLNG-EVVAQSLDPISR..............LQRIETEAAVVNLKNQDITSDNMVTIRGLNF..TSSGLKLTGNLKQQ
Q1Z1P9_PHOPR/8-183VLQMTG-NVRIFNLLPESI..............MKVMQTDTLRLDLITKDFDTADHVVITGTGF..QNEGTGMKGNMDRS
Q665J4_YERPS/13-184MLYLYG-HVEVDSLTADAQ..............LKKIRTDNAQVNLITQDVASDDEVTLFGIGF..TSEGMRMRGNLRDK
Q3R2F1_XYLFA/11-184LLRLRQ-DVKGDSPTDLGQ.............VPTTFRTQSLDIYPNHHLAKTTDAVTITHQGI..IQTGVGFEVNTKTQ
A6VMU7_ACTSZ/14-198MLNLTG-RVVAQSLLPESR..............LQRVESERATVNLTTQDITSDKEVTIRGLNF..VSSGLKLDGNLKQQ
Q6FC68_ACIAD/7-179KVVLSD-QVVATKLSDHGK...............MQFQTDELTTYPPKKMIETTHQVNVDSPQS..SFISQGLKADLNTG
Q5F6F2_NEIG1/13-189QVLFKN-NVVLTKTADGRR.............QAGKVETEKLHVDTESQYAQTDTPVSFQYGAS..HGQAGGMTYNHKTG
Q7W009_BORPE/13-191RIVMNG-DTHVHRQPDARN.............ETLDVRSQQLILLPDEDVVFTDLPAQVNKGNS..RMNGTGMHYNNKTR
Q5WY70_LEGPL/13-185QITFIE-QVVVHQNPGEST.............RESTLKTEEITYYPKEKKATTSLFVTFEQPGN..IIQSTGMNAYLDEK
Q2A3E2_FRATH/15-206LIHLYD-GVNAIMITKKSADNTQKTSDNDSTPDKIYIKSSEMFYNSSSKDFYNNRFTKMYDPKTGNNTTGTGVKGNSETK
Q9A926_CAUCR/44-207TLLLTD-EVKITSA..................EGFDFDAPRALIDLRTGAVSGDAGIAGSGPKG..STRASAYEVTDKGD
Q83DI3_COXBU/10-185RIYLWD-HVKVHEPPQPTE.............PETTITTSTLTLFPERSFAKTNDPVTITRPNA..VIKATGMTSNLKKG
Q8Y2C5_RALSO/23-203IIDLYD-NAKVVRAQGPDL..........RQDPLMTADSTYFQVLLNDDVVRTDKPVELHRGPS..VMNANGLVFNNVTR
Q1MYN0_9GAMM/9-185YLSLSG-RVAIKPLVDAST..............RFSLKTATLNMDLNTQIANTDSDVIIENPNT..LIESTGLTLDLKKE
Q7N059_PHOLL/13-184MLYLYG-DVQVDSLTNTSQ..............LQRITTENAIINLTTQDVSSDDQVTLIGVGL..KSVGMKMRGNLRNK
Q3IG36_PSEHT/6-184QLILEG-NVTAQNLIDGAM..............IDKITADNIQVDIMLLTMRSEQPVIITGPNL..KITGKGLEANLTTE
Q4CB63_CROWT/20-192QIFLRD-NVVAVDPRNKAV.................LKSEEVEWQPETSLLTVRKNVRGSHPQL..EASANEGKYNAREQ
Q3KI03_PSEPF/13-188EVELID-SVRVKRTDEKNR..............DTLITSTRMTVFPQQQYAQTQQPVRIDGAGG..VSTGVGMKAYLKES
Q1V9H7_VIBAL/8-183VLTLYD-KVLMQNLLPGAS..............FDTMATDKLVINLTNRDFKADQQVMLVGPQF..ETTGGAMQGNLKQH
Q1QVD4_CHRSD/15-188LLTLTG-NAQLVQPEQGWR.................LNTDVLHYQASEAHAWSDSDAVLRQHEQ..RVRGNRFDAWLDTD
Q1LRN4_RALME/18-199IIDLYG-NAFIVRQAGTDV..........SKDPRMTAASQYFQLLVNDDIVKTDKPVELTRGPS..VMNANGLIFNNVTR
Q7NSU1_CHRVO/12-188QAYFDK-KVVLIKPADSKQ.............PETRLVSSAMFVDTGKRFASSKAPSVIYQGNS..VANSIGFSYQESLG
Q7VBX1_PROMA/3-139LITLKN-KVTMQS.......................INNTNLNLL........................TDLIKWDKDNS
Q2LSM5_SYNAS/26-198DMEISG-NINLTSS..................NGDEFKTNHLSYSGIEKRCYTPAPVTMKNSRI..QVDAKGMSLSLKDE
Q494F5_BLOPB/27-200TLHLYG-YVYINNLIHNRY..............FQSIITNQAIINLITQDIISNKKVIIHGHYF..YSIGMKIHANLHTQ
Q8D2M9_WIGBR/15-186YLFLYG-KTIIKNFIYSLY..............IKKIYTNNAILNLKTHDIFSRKKTILFGSNF..NSTGIRMQGNLKYK
Q2T1A3_BURTA/13-191IVDLYD-DARILRAAGAGD.............PPMQADSQHFRVLVNDDVIETEKPVKLQRGLS.IANAAAGMKYNNVTR
Q82Y24_NITEU/13-186DIFLTR-NVAIIRGEDKDK.............DKVTMLTDFLHLIPDTDIAKTDQPVTVTRMNS..VINAIGLFMNNQTG
Q48EB8_PSE14/13-188QVELID-SVRVERTDEKQR..............TTIITTSRMTVFPQKQYAQTEQDVRIDGAGG..VTTAKGMKAYLKDS
Q3J7F9_NITOC/4-178EIDLLG-EVIIRQLGADSK............TSNMKILTQNVRVKPRIKYAETQQPVTLLNSFG..KTHSIGARVYLKDG
Q31H03_THICR/9-187SVHFNG-DVVIQMIEKQTP............SENKTLKSEQISYNTLSETLTSKVYTEITEPGL..IMSGIGFKANMASG
Q2P686_XANOM/13-186QLRLRG-DVEGDSPTGGAT.............PPTTFRTQSLDVFPQQNIAKTDAPVTMTRPGI..MQSGVGFAADLKSR
Q1ZNQ0_PHOAS/8-183VLNLHG-NVRMFNLLPDSD..............IQVIKTDNLQLNIETQDFNTQDHVMIIGPAF..QNQGDGMTGNMKRK
Q4KI84_PSEF5/13-188EVELID-SVRVSRTDEHNR..............NLLITTTRMTVFPQKQYAQTEQAVRIDGAGG..VTTAKGMKAYLKDG
A3QI76_SHELP/7-183RVTLEN-NVIIDAISPEEP..............IQTIETTYLELDLNTMIMTSDRSIRITGRDF..LITGEGLYADLNAQ
Q74BY8_GEOSL/20-186DVTLTG-NIHARST..................SGMEFTTGRASYRASRQLVVTDDRVSFRDARF..AVEGVGMEFLVPTR
Q9L7V7_HAEDC/10-185MLHLVG-NVKLKALENNAQ..............LQKIVTDKLTIDLNTQDVFTDSKVTSIGAGF..SSSGIGLKGNLKQQ
Q2NWJ8_SODGM/13-184MLYLYG-HVQVDSLTDASQ..............LKRITTDNAVVNLVTQDVSSDDEVTLYGTGF..NSTGMKMRGNLRNK
Q3B209_PELLD/22-189DIEGMG-NVVISSK..................DSTVIRTEYARRSGSDRMIRSERFVTIKRPGQ..SINGYGFESDQELK
Q9CP81_PASMU/10-189MLYLEG-NVVVESLLSPSR..............LQRVETESAVINLSTQDISSEHAVKIYGQHF..HSTGLKLTGNLQQQ
Q8KLW4_PSEST/12-188EVLLID-KVRVERTDAKGR..............PTILTTSRLTVWPDKDYAETNQAVRIDAANG..VTTATGMKAYLDDG
Q21FU6_SACD2/6-194SIELWE-DVVIRQKNESGT..............YTQLTTNKLLILPHEKVAQTEETVKINSPRG..EMTGVGMVADLAER
Q1ZEX0_9GAMM/12-183TLKLTH-DVRVENLSLDQL..............IQNIATEELTLLLDKKEISSNLFITWDGPQM..HQQGVGMWASLLSN
Q2SBI4_HAHCH/14-189TLKLRG-DVEVNGASDDGA..............PILMQTQALDYNNKSRFISTDQPVKITSNIN..QLTAVGMEADIDKK
Q3SLC6_THIDA/11-186EVDLRG-DVNVVRAAHAGQ.............SAMTLRTARLLVFPEQDQLRSPGPVDIRDDLL..TVRAGAMHYDARLR
Q2YCX5_NITMU/11-187DIYLSG-NVVIVRNAGKGR.............GETILTTSLLHLIPDQDIARTDKPVEITETNA..TIRAIGMEMNNRTG
LPTC_HAEIN/15-205ILYLEG-NVVAQNLTSDSR..............LQRIETESAVVNLKTQDITSETQVKIKGKNF..SSTGLKLVGNLRQQ
Q72S44_LEPIC/8-181LMLLEG-KILLKTD..................DHKILTAKTMEYNMDTKKLVSDSEVSVSADGT..TIRGIGLRADKDLN
Q6DAG2_ERWCT/13-184MLYLYG-HVEVNSLTKDAQ..............LQRITTNNAQVNLVTQDVSSDDEVTLYGTSF..TSSGMKMRGNLRNK
Q47VI4_COLP3/8-184RVELKN-QVHIKATEIDGL..............IKEIHCKTIALDLKTNIISSEQSVVVVGRDF..TMYGSGLIIDLNTK
Q9KP51_VIBCH/8-183VLTLYD-DVLAKNLLPDSG..............FDTLTTSEMSIQLKSRDFWADKPVELRGPQF..ETHGQAMKGNFADH
LPTC_ECOLI/13-183MLYLYG-HVEVNALVPDSQ..............LRRITTDNAQINLVTQDVTSEDLVTLYGTTF..NSSGLKMRGNLRSK
Q5E7W1_VIBF1/8-183ELYLSG-NVIVKNLLPDAA..............FETMTTDSMKIELTTKDFMTEDVVNLIGPTF..ETTGVGMKGNFTSQ
Q47AI2_DECAR/11-187TVYIWE-NVSVTRAGAADR.............LELVARMPDLTAQPDAGFAFTNSPVEITQGQS..WMTGVGAHIDNNNS
Q5R0I9_IDILO/8-184TLILEH-DVEILALEPDTH..............IEQVLTEYLIVDLKNESMSTEHPVSIHGPRL..LIRGNGMTADLKAE
Q1YU13_9GAMM/9-185RLDLQD-AVQGQITTAEGL...............AELTTDSLTYLVDSSVATTDQPFKLLSAQG..QASGTGLKIDLIND
Q2BKN4_9GAMM/11-187KTDFVG-DIEIYSNKGQPN..............ETIMRTEKLSVFHKQSIAETDQPVTIESTNS..LMQGTGMDINFNDQ
Q7VQS2_BLOFL/22-198TLNLHG-QVFINQIVKKIC..............TQSIITNQLLIDLNNQSIISNNKTIIHGHYF..YSIGSCMNINLHTQ
A5VZ45_PSEP1/13-188EVELID-KVRIARTDEKQR..............ETIITSSRMTVFPQKQYAQTEQAVRIDGAGG..TTTGKGMKAYLKEG

PF03968

Q83DI4_COXBU/10-123-----------------
Q8EAE7_SHEON/31-142-----------------
LPTA_SHIFL/37-149-----------------
Q57FM0_BRUAB/46-171-----------------
LPTD_HAEIN/51-189-----------------
Q5P773_AROAE/35-149-----------------
P72709_SYNY3/57-131-----------------
LPTA_HAEIN/33-146-----------------
Q7W010_BORPE/43-162-----------------
Q6NDQ7_RHOPA/57-184-----------------
LPTD_VIBVY/55-188-----------------
Q5HVC2_CAMJR/22-133-----------------
LPTD_VIBF1/66-199-----------------
Q7MQR6_WOLSU/25-137-----------------
Q8Y2C6_RALSO/38-157-----------------
LPTD_ECOLI/53-195-----------------
Q60AV1_METCA/39-150-----------------
Q7NSU0_CHRVO/32-144-----------------
Q5NQV4_ZYMMO/49-163-----------------
Q6G1C4_BARQU/38-165-----------------
Q7VQS3_BLOFL/35-147-----------------
Y383_RHIME/50-164-----------------
Q5LWN1_SILPO/41-147-----------------
Q9A2G4_CAUCR/38-152-----------------
LPTD_PHOPR/70-206-----------------
Q5WY71_LEGPL/33-148-----------------
LPTD_MANSM/52-190-----------------
Q63XK5_BURPS/49-169-----------------
LPTD_PASMU/52-190-----------------
Q8KYW6_9PROT/41-146-----------------
Q5R0J0_IDILO/35-147-----------------
Q9KP50_VIBCH/45-157-----------------
Q98GS3_RHILO/46-170-----------------
Q7VGJ3_HELHP/21-132-----------------
Q7MPB4_VIBVY/35-147-----------------
Q5H3D1_XANOR/32-144-----------------
O26088_HELPY/35-147-----------------
Q8YPX3_NOSS1/50-125-----------------
Q5E7W2_VIBF1/30-142-----------------
O67922_AQUAE/20-125-----------------
LPTD_YERPS/52-194-----------------
LPTD_HAEDU/51-186-----------------
Q74BY9_GEOSL/33-139-----------------
Q5F6F3_NEIG1/32-143-----------------
LPTD_VIBPA/57-190-----------------
Q6AR55_DESPS/32-143-----------------
Q5N3C4_SYNP6/48-123-----------------
Q6LMB8_PHOPR/30-142-----------------
Q87WU2_PSESM/34-146-----------------
Q82Y25_NITEU/53-169-----------------

PF13100

A6KXH5_BACV8/45-203------------TLTSD
D1VZZ9_9BACT/49-207------------LVTTD
C6VSH9_DYAFD/72-229------------TLTTD
A7AJW0_9PORP/66-223------------TLYSD
C2MC35_9PORP/61-218------------TLDTD
C3RC63_9BACE/45-203------------TLTSD
D1PEJ9_9BACT/45-203------------VVTTD
C6Y022_PEDHD/22-179------------RITSD
Q1VX17_9FLAO/22-181------------DIDSD
A7V611_BACUN/62-219------------VLTSD
A5FGP3_FLAJ1/21-178------------VIKSN
C6Z7A8_9BACE/45-203------------TLTSD
A6EJJ0_9SPHI/7-161------------VIKSD
B7BBT0_9PORP/66-223------------TLYSD
A6LEK0_PARD8/40-197------------TLYSD
C3JBC3_9PORP/31-188------------TLNTD
C7XBH6_9PORP/40-197------------TLYSD
B3C544_9BACE/43-200------------ILTSD
D2EYL4_9BACE/62-219------------VLTSD
C9LKM5_9BACT/13-170------------MLTSD
C3Q815_9BACE/45-203------------TLTSD
D3ICV2_9BACT/28-186------------DIDTD
D0THV9_9BACE/40-197------------TLYSD
Q7MX13_PORGI/44-201------------TMDTE
B6VRY3_9BACE/45-203------------TLTSD
B0NWD6_BACSE/31-188------------VLTSD
B7ACA9_9BACE/15-172------------VLTSD
A3XN79_LEEBM/25-184------------VINSD
D1K620_9BACE/45-203------------TLTSD
B2RL27_PORG3/44-201------------TMDTE

PF06835

Q9HVV8_PSEAE/12-188RMHLLSNVR...GQ.HE
Q476E3_CUPPJ/18-199EVQLLGNVR...GTIIT
Q7MPB3_VIBVY/8-183TATLYNHVQ...GR.YE
Q2KUD4_BORA1/8-184QLEVHAS........TD
Q1QAN4_PSYCK/10-184DYEF.GQVA...VS.FT
Q65RT9_MANSM/10-187AATLKEQVK...TH.YE
Q1Z1P9_PHOPR/8-183VATLLNNVK...GR.YE
Q665J4_YERPS/13-184TAELIEKVK...TS.YE
Q3R2F1_XYLFA/11-184QYKLNSKVN...TR.YE
A6VMU7_ACTSZ/14-198IATLKEQVK...TH.YE
Q6FC68_ACIAD/7-179QYEFF.NIR...GK.YA
Q5F6F2_NEIG1/13-189MLNFSSKVK...AAIYD
Q7W009_BORPE/13-191QLRVSAAADVEIAG.TE
Q5WY70_LEGPL/13-185RVELLHKAR...GS.YD
Q2A3E2_FRATH/15-206IIELSQNVR...SY.YA
Q9A926_CAUCR/44-207RVVLKGGVR...TR.LE
Q83DI3_COXBU/10-185LVHLLSHSR...GV.YE
Q8Y2C5_RALSO/23-203QVQLLGNVR...GR.IE
Q1MYN0_9GAMM/9-185TVQFISKVR...GS.HD
Q7N059_PHOLL/13-184TAELIEKVN...TY.YE
Q3IG36_PSEHT/6-184VIKLINHTR...TLYYD
Q4CB63_CROWT/20-192KLELTGKIK...AT.SE
Q3KI03_PSEPF/13-188RIHLLSNVR...GQ.YE
Q1V9H7_VIBAL/8-183TATLTDEVQ...GR.YE
Q1QVD4_CHRSD/15-188RARLTGDVQ...GH.HP
Q1LRN4_RALME/18-199EVQLLGNVR...GTIIM
Q7NSU1_CHRVO/12-188LLNLYSKTK...IV.YV
Q7VBX1_PROMA/3-139RAELSGSII...SR.IN
Q2LSM5_SYNAS/26-198QLTLLSGVR...AV.LN
Q494F5_BLOPB/27-200TAKLIDNVQ...TC.YE
Q8D2M9_WIGBR/15-186IFLLKDNIT...TL.NE
Q2T1A3_BURTA/13-191VIELYGNVR...GT.IA
Q82Y24_NITEU/13-186EILLQSRVT...AH.DD
Q48EB8_PSE14/13-188RMDLLSNVR...GQ.YE
Q3J7F9_NITOC/4-178RIELLSQVR...GN.YD
Q31H03_THICR/9-187KYRFLSDVK...TV.YQ
Q2P686_XANOM/13-186QYKLLSQVK...TR.YE
Q1ZNQ0_PHOAS/8-183VAKLLKNVK...SR.YE
Q4KI84_PSEF5/13-188RMNLLSNVR...GQ.YE
A3QI76_SHELP/7-183NIKLTSQVE...GT.YE
Q74BY8_GEOSL/20-186TLRILNDVR...AT.IA
Q9L7V7_HAEDC/10-185VATLIKDVK...TH.IE
Q2NWJ8_SODGM/13-184TAELIEKVK...TS.YE
Q3B209_PELLD/22-189HYRIFR......GS.GE
Q9CP81_PASMU/10-189IATLKEQVN...TY.YE
Q8KLW4_PSEST/12-188RMLLLSNVR...GQ.HE
Q21FU6_SACD2/6-194KITLLGKVR...GT.HD
Q1ZEX0_9GAMM/12-183EMIVKNNIK...AV.YF
Q2SBI4_HAHCH/14-189LIVLLSQVT...GV.YA
Q3SLC6_THIDA/11-186VIKLSGRVH...TR.YL
Q2YCX5_NITMU/11-187HTELLSQVK...VV.HD
LPTC_HAEIN/15-205VATLKEQVK...TY.YE
Q72S44_LEPIC/8-181KFTILKPTA......IT
Q6DAG2_ERWCT/13-184TAELIEKVK...TS.YE
Q47VI4_COLP3/8-184KMTLIQHER...TI.YK
Q9KP51_VIBCH/8-183SAELYNQVQ...GR.YE
LPTC_ECOLI/13-183NAELIEKVR...TS.YE
Q5E7W1_VIBF1/8-183EATLLENVQ...GI.YE
Q47AI2_DECAR/11-187TFVLQSQVK...GQ.YI
Q5R0I9_IDILO/8-184RMELKRHVK...TI.FQ
Q1YU13_9GAMM/9-185TVVIQSKVR...VT.HD
Q2BKN4_9GAMM/11-187ILNLHSRVK...GT.HN
Q7VQS2_BLOFL/22-198TTTLFGKIY...TQ.YE
A5VZ45_PSEP1/13-188KMDLLSNVR...GQ.YE

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window