Sequence alignment for CL0260

PF03445

Q74E96_GEOSL/70-216------------------------------------------------------------------------------RA
Q3SMK2_THIDA/311-451------------------------------------------------------------------------------RD
A5FH19_FLAJ1/315-456------------------------------------------------------------------------------NR
Q21RX0_RHOFT/287-419------------------------------------------------------------------------------QQ
Q2IEC2_ANADE/287-421------------------------------------------------------------------------------AQ
Q72EX4_DESVH/364-509------------------------------------------------------------------------------TR
B9M647_GEODF/87-225------------------------------------------------------------------------------IR
Q5KZZ8_GEOKA/30-169------------------------------------------------------------------------------RE
Q0A740_ALKEH/45-190------------------------------------------------------------------------------AA
Q0A741_ALKEH/289-440------------------------------------------------------------------------------AE
Q2SC90_HAHCH/335-475------------------------------------------------------------------------------SD
B3E878_GEOLS/160-298------------------------------------------------------------------------------TR
Q0A6Y9_ALKEH/155-300------------------------------------------------------------------------------QA
A6VT54_MARMS/299-436------------------------------------------------------------------------------KQ
Q5QUI2_IDILO/291-428------------------------------------------------------------------------------QK
Q1QZ78_CHRSD/292-424------------------------------------------------------------------------------AR
A7II29_XANP2/249-381------------------------------------------------------------------------------RQ
Q4FUP8_PSYA2/335-467------------------------------------------------------------------------------EL
Q315G6_DESAG/341-482------------------------------------------------------------------------------PR
B3EBD1_GEOLS/155-293------------------------------------------------------------------------------QE
Q0A6Z3_ALKEH/338-481------------------------------------------------------------------------------AD
A7HH07_ANADF/294-428------------------------------------------------------------------------------RK
Q89MS6_BRADU/287-419------------------------------------------------------------------------------RE
Q8NQY4_CORGL/299-437------------------------------------------------------------------------------QS
A9C1C5_DELAS/300-433------------------------------------------------------------------------------AQ
Q3AAI0_CARHZ/302-445------------------------------------------------------------------------------KD
Q0AAW3_ALKEH/298-443------------------------------------------------------------------------------RN
Q6AK79_DESPS/536-676------------------------------------------------------------------------------NR
O29291_ARCFU/289-422------------------------------------------------------------------------------KN
Q6LLZ3_PHOPR/291-423------------------------------------------------------------------------------SS
A7HF43_ANADF/290-424------------------------------------------------------------------------------GR
Q5WB02_BACSK/16-152------------------------------------------------------------------------------KR
A0KJY8_AERHH/290-422------------------------------------------------------------------------------RE
A6W3F4_MARMS/295-433------------------------------------------------------------------------------RK
O67874_AQUAE/297-438------------------------------------------------------------------------------SL
Q0A6Z6_ALKEH/50-188------------------------------------------------------------------------------GR
Q0AAE6_ALKEH/308-446------------------------------------------------------------------------------RD
A7HH08_ANADF/291-424------------------------------------------------------------------------------AR
A0QUE9_MYCS2/19-146------------------------------------------------------------------------------AE
A0L6G8_MAGMM/300-438------------------------------------------------------------------------------ER
A4SW93_POLSQ/291-424------------------------------------------------------------------------------EQ
Q0VMJ3_ALCBS/291-422------------------------------------------------------------------------------AR
A5UUU0_ROSS1/301-438------------------------------------------------------------------------------EQ
Q2RWQ7_RHORT/287-419------------------------------------------------------------------------------QA
Q5E0M6_VIBF1/300-437------------------------------------------------------------------------------KQ
Q30QK1_SULDN/290-422------------------------------------------------------------------------------HD
A1VJH4_POLNA/291-424------------------------------------------------------------------------------GQ
A0M2M4_GRAFK/316-457------------------------------------------------------------------------------NK
A1WYA2_HALHL/306-457------------------------------------------------------------------------------GE
A1TZ30_MARHV/318-457------------------------------------------------------------------------------SD
A5GB63_GEOUR/87-228------------------------------------------------------------------------------ER
A1STJ2_PSYIN/318-456------------------------------------------------------------------------------AQ
A7HBY5_ANADF/161-300------------------------------------------------------------------------------AE
Q47FJ9_DECAR/33-173------------------------------------------------------------------------------AR
Q2IP15_ANADE/291-425------------------------------------------------------------------------------TK
A7HHL2_ANADF/317-456------------------------------------------------------------------------------AR
Q47FJ8_DECAR/323-463------------------------------------------------------------------------------AD
Q1GL32_RUEST/285-422------------------------------------------------------------------------------AQ
Q8KDK9_CHLTE/323-469------------------------------------------------------------------------------EK
Q9K6I7_BACHD/316-461------------------------------------------------------------------------------EA
Q5P177_AROAE/314-454------------------------------------------------------------------------------RD
Q31GK9_THICR/297-430------------------------------------------------------------------------------HQ
A7HH09_ANADF/26-158------------------------------------------------------------------------------RS
Q7NTV8_CHRVO/285-417------------------------------------------------------------------------------GQ
Q124J8_POLSJ/165-305------------------------------------------------------------------------------KD
A7HF42_ANADF/295-425------------------------------------------------------------------------------RT
Q7MSB7_WOLSU/294-426------------------------------------------------------------------------------KE
B0UVN5_HISS2/302-436------------------------------------------------------------------------------.Q
B6IWA9_RHOCS/320-456------------------------------------------------------------------------------..
Q5SK35_THET8/277-408------------------------------------------------------------------------------.E
Q72EX3_DESVH/178-317------------------------------------------------------------------------------.T
Q7MCI2_VIBVY/302-436------------------------------------------------------------------------------.E
Q88QY0_PSEPK/323-461------------------------------------------------------------------------------.E
Q8EDA6_SHEON/299-436------------------------------------------------------------------------------KQ
Q9HZ07_PSEAE/290-420------------------------------------------------------------------------------.T

PF03710

GLNE_RHILO/579-826LKLMAT-IMGAAPRLAAIITRR....PHVFDGLLDPALLTELPDRVYLSARLSAFLEGDRAY....EEVLDRLRIFASEQ
GLNE_CORGL/627-871GQRLMR-ILGNSPYISELIIST....PDFMKQLGDA..ASGPKLLATAPTQVVKAIKATVSRHESPDRAIQAARSLRRQE
GLNE_VIBCH/33-281LNQLRY-VLGLSQFVAQTLQRD....DPLCQVLPSL..LAKPSREQYYRSELAQWLAECQDE....AVAQKRLRQFRNQE
GLNE_HAEIN/589-842LQQVIE-LCAQSQLISEQLAHY....PILLDELLNTEALRHPLPFTQYPAELHQYLLRLPPDD..EEQLIDALRQFKQAT
GLNE_PASMU/587-841LTQLIE-LCAQSRMIAEQVARH....PILLDELLDRNALLNPPPYDHYASELRQYLLRLTPDD..EEQMIDGLRQFKQAT
GLNE_ECOLI/552-806LKHLIS-LCAASPMIASQLARY....PLLLDELLDPNTLYQPTATDAYRDELRQYLLRVPEDD..EEQQLEALRQFKQAQ
GLNE_CAUCR/70-317WGSLAP-VFAASPYLAGLARRDGKRLPRIL........GGDPGETLAAILAAAEAVAAEPDF....ETARRVLRELKADL
GLNE_PSEAE/47-298LEDFRR-VAAASDFVAEQAVRD....SAMLLELAERGELENPHAPGELRSQLQARLEDCADE....DELGRRLRRFRTRQ
GLNE_ECOLI/29-277SAQAKS-VLTFSDFVQDSVIAH....PEWLTELESQ..PPQADEWQHYAAWLQEALCNVSDE....AGLMRELRLFRRRI
GLNE_PASMU/46-295IGQLRY-AIAMSDFFAETLQKQ....PHFLHQCWQQ..CPRLQDCEQYAERLTPLLAQVENE....EQLYKVLRQFRHRE
GLNE_CAUCR/589-828FELIVE-VMAFAPRLAATMAKR....PTALDALLDPTFFGPIETPAIAPWDPEDF...........EGAMDAARRLFRDQ
GLNE_VIBCH/556-810LVQLVR-LCTASPMISEQLARY....PILLDELIDPQHLYNPIPLESYQTELRDFLARIPEED..MEQQMEGLRQFKQIS
GLNE_HAEIN/46-299VYQLGY-AIAMSDFVEKVLQKY....PHLVKQWWEK..SPCFADCTAYIERLNKELANVHDE....TALYQTLRQFRNIE
GLNE_RHILO/58-307QDFLAA-VFDLSPFLRDTSRRR....PRILDALFDQPVEARLEAITAAIEQAP..LAETVSE....SSLMMELRQCKAEA
M9X424_MANHA/24-271.QPLVT-AISLSNFVHQTLQKQ....PDLLAEWLAK..FPTPDDCCNYTERLAKILARVENE....EMLGRVLRQFRHRE
GLNE_MYCTU/589-828.KRLMH-VLGTSAYVPDLLMRA....PRVIQQYEDG..PAGPKLLETEPAAVARALIASASRYPDPERAIAGARTLRRRE
Q5F608_NEIG1/520-754.AQLAQ-IMSQSSWVAAYLNKY....PILLDELISAQLLDTAFDWQALAAALSDGIEACGGDT...EAQMDTLRHFQHAQ
GLNE_PSEAE/576-830LERLLT-LCAASPMVAEQIARF....PILLDELLNEGRLFRPPQAAELAAELRERLMRIPEDD..LEQQMETLRHFKLAH

PF17405

Q5KIJ7_CRYNJ/700-921------------------------------------------------------------------------------SW
S8AXB6_PENO1/630-827------------------------------------------------------------------------------EY
D8QKX0_SCHCM/666-893------------------------------------------------------------------------------EF
M3AM01_PSEFD/673-865------------------------------------------------------------------------------DF
H2M2T9_ORYLA/620-825------------------------------------------------------------------------------.I
NOL6_DROME/640-842------------------------------------------------------------------------------EL
U4LAZ7_PYROM/630-824------------------------------------------------------------------------------AF
Q54EN2_DICDI/731-897------------------------------------------------------------------------------EL
H0YTW4_TAEGU/596-800------------------------------------------------------------------------------LL
H2B1K6_KAZAF/681-883------------------------------------------------------------------------------QI
UTP22_YEAST/703-904------------------------------------------------------------------------------KF
G3ALQ0_SPAPN/658-851------------------------------------------------------------------------------HF
G2R7X2_THITE/613-809------------------------------------------------------------------------------SL
G4T7W1_SERID/696-909------------------------------------------------------------------------------SY
K3WBL1_PYTUL/628-840------------------------------------------------------------------------------SL
J9K0G8_ACYPI/619-833------------------------------------------------------------------------------QA
W5J7Q1_ANODA/704-908------------------------------------------------------------------------------QF
B4JHB6_DROGR/615-817------------------------------------------------------------------------------EL
M2NLG7_BAUCO/565-759------------------------------------------------------------------------------GF
A0A0D1C533_USTMA/858-1074------------------------------------------------------------------------------HF
J3KKN7_COCIM/615-811------------------------------------------------------------------------------.L
B5RT80_DEBHA/668-867------------------------------------------------------------------------------GF
I2H5R1_TETBL/720-922------------------------------------------------------------------------------QF
B2AL59_PODAN/611-806------------------------------------------------------------------------------GL
S3BW46_OPHP1/638-843------------------------------------------------------------------------------SF
F4P4W3_BATDJ/687-884------------------------------------------------------------------------------GI
G4N9I5_MAGO7/611-806------------------------------------------------------------------------------GF
G7XFJ4_ASPKW/623-821------------------------------------------------------------------------------EY
T5AFI7_OPHSC/602-797------------------------------------------------------------------------------DF
H9JCB7_BOMMO/619-830------------------------------------------------------------------------------QL
A7S7H5_NEMVE/605-831------------------------------------------------------------------------------QL
G9NYU4_HYPAI/603-798------------------------------------------------------------------------------AF
NOL6_DROPS/659-861------------------------------------------------------------------------------EL
G8ZWX5_TORDC/679-881------------------------------------------------------------------------------YF
W5KKI6_ASTMX/629-835------------------------------------------------------------------------------RV
M2PAE8_CERS8/703-929------------------------------------------------------------------------------EF
UTP22_SCHPO/620-813------------------------------------------------------------------------------KF
E0VHG7_PEDHC/632-832------------------------------------------------------------------------------QL
A5DT88_LODEL/708-906------------------------------------------------------------------------------DF
M9LQU0_PSEA3/823-1039------------------------------------------------------------------------------HF
A1CJ23_ASPCL/576-774------------------------------------------------------------------------------EY
G3B4V1_CANTC/656-855------------------------------------------------------------------------------AF
M7WDQ1_RHOT1/772-987------------------------------------------------------------------------------GM
H2YJS5_CIOSA/572-776------------------------------------------------------------------------------QI
G0VFC1_NAUCC/685-887------------------------------------------------------------------------------EF
U7Q6Q9_SPOS1/648-856------------------------------------------------------------------------------SF
C5DLD6_LACTC/690-891------------------------------------------------------------------------------QF
C7YP94_NECH7/608-803------------------------------------------------------------------------------GF
J3NVZ7_GAGT3/604-799------------------------------------------------------------------------------GF
T1EE31_HELRO/505-717------------------------------------------------------------------------------QL
N1PEU7_DOTSN/672-866------------------------------------------------------------------------------GF
U5H217_USTV1/782-994------------------------------------------------------------------------------RM
Q7S1X8_NEUCR/604-803------------------------------------------------------------------------------GF
J5JXU5_BEAB2/596-791------------------------------------------------------------------------------SL
R1EK47_BOTPV/687-883------------------------------------------------------------------------------QF
B0DGR0_LACBS/686-914------------------------------------------------------------------------------SF
H9GJA7_ANOCA/630-836------------------------------------------------------------------------------LL
D5GP17_TUBMM/637-828------------------------------------------------------------------------------EY
K7IX79_NASVI/638-851------------------------------------------------------------------------------QL
Q0CBE8_ASPTN/607-805------------------------------------------------------------------------------EY
F8Q1T2_SERL3/652-880------------------------------------------------------------------------------QF
E9E4A5_METAQ/614-809------------------------------------------------------------------------------RF
J7RUP2_KAZNA/701-903------------------------------------------------------------------------------QF
H3GEK8_PHYRM/607-817------------------------------------------------------------------------------AL
A7TPZ3_VANPO/697-899------------------------------------------------------------------------------EF
A0A0J9XU34_BRUMA/572-769------------------------------------------------------------------------------KM
Q0TXJ2_PHANO/682-876------------------------------------------------------------------------------AF
M7NIM6_PNEMU/605-804------------------------------------------------------------------------------EY
A8PXA3_MALGO/684-898------------------------------------------------------------------------------AF
G8BYJ9_TETPH/624-826------------------------------------------------------------------------------LF
G0S2E0_CHATD/626-822------------------------------------------------------------------------------SL
F0ZRR2_DICPU/727-893------------------------------------------------------------------------------EL
F1Q4S6_DANRE/645-851------------------------------------------------------------------------------QL
R7YYN3_CONA1/692-891------------------------------------------------------------------------------SF
C5DTY5_ZYGRC/691-893------------------------------------------------------------------------------QL
H2SN18_TAKRU/614-820------------------------------------------------------------------------------MV
B6HEW6_PENRW/597-788------------------------------------------------------------------------------EY
Q0WVM5_ARATH/549-738------------------------------------------------------------------------------QL
G8JTZ4_ERECY/691-893------------------------------------------------------------------------------KF
B8P8H6_POSPM/981-1208------------------------------------------------------------------------------QF
G2QK39_MYCTT/606-802------------------------------------------------------------------------------GL
Q17D12_AEDAE/666-865------------------------------------------------------------------------------QF
M3CZA8_SPHMS/670-862------------------------------------------------------------------------------GF
Q6FTF1_CANGA/659-861------------------------------------------------------------------------------HL
Q75A89_ASHGO/684-886------------------------------------------------------------------------------QF
F9XME7_ZYMTI/566-760------------------------------------------------------------------------------GF
U9SUM6_RHIID/790-1007------------------------------------------------------------------------------QL
L8GAM4_PSED2/621-813------------------------------------------------------------------------------SF
Q4WWD9_ASPFU/609-807------------------------------------------------------------------------------EF
C4XY87_CLAL4/661-860------------------------------------------------------------------------------KF
K4BB35_SOLLC/549-738------------------------------------------------------------------------------QL
Q5TPK2_ANOGA/708-909------------------------------------------------------------------------------QF
C4R925_KOMPG/670-870------------------------------------------------------------------------------EF
W5FGR4_WHEAT/550-736------------------------------------------------------------------------------QL
G0NWB7_CAEBE/551-757------------------------------------------------------------------------------..
W1Q9F0_OGAPD/622-820------------------------------------------------------------------------------RF
M5EB57_MALS4/684-898------------------------------------------------------------------------------GF
N1JI70_BLUG1/626-821------------------------------------------------------------------------------GL
I1CBC4_RHIO9/650-864------------------------------------------------------------------------------QF
G3J432_CORMM/598-793------------------------------------------------------------------------------SL
K5XS17_AGABU/706-939------------------------------------------------------------------------------VF
A5DPW7_PICGU/652-850------------------------------------------------------------------------------EF
I4YA03_WALMC/598-807------------------------------------------------------------------------------EF
R9AEB2_WALI9/585-794------------------------------------------------------------------------------EF
NOL6_XENTR/638-843------------------------------------------------------------------------------VL
K0KM58_WICCF/672-873------------------------------------------------------------------------------NI
C3Z9X5_BRAFL/576-782------------------------------------------------------------------------------QL
S2JLP9_MUCC1/660-874------------------------------------------------------------------------------QL
Q6CQS3_KLULA/682-883------------------------------------------------------------------------------QF
A7AS51_BABBO/622-822------------------------------------------------------------------------------..
B6QTJ8_TALMQ/620-816------------------------------------------------------------------------------EF
B8NV94_ASPFN/617-815------------------------------------------------------------------------------EF
A0A088AV91_APIME/651-862------------------------------------------------------------------------------QV
S9XA53_SCHCR/625-818------------------------------------------------------------------------------EF
K1X311_MARBU/634-829------------------------------------------------------------------------------GF
G7E946_MIXOS/644-860------------------------------------------------------------------------------PY
V5FPA1_BYSSN/616-813------------------------------------------------------------------------------EY
T1JFU9_STRMM/607-798------------------------------------------------------------------------------QT
F2U6D3_SALR5/790-1031------------------------------------------------------------------------------FF
M1W9J6_CLAP2/611-806------------------------------------------------------------------------------GF
G8B992_CANPC/676-874------------------------------------------------------------------------------LY
N4UMZ3_COLOR/581-776------------------------------------------------------------------------------EL
C5G095_ARTOC/606-795------------------------------------------------------------------------------DI
G3VN54_SARHA/643-850------------------------------------------------------------------------------SL
S8EU65_FOMPI/687-916------------------------------------------------------------------------------DF
E3QLQ1_COLGM/590-785------------------------------------------------------------------------------EL
B2VXG7_PYRTR/651-845------------------------------------------------------------------------------AF
M3HTH7_CANMX/665-863------------------------------------------------------------------------------NF
U1HM72_ENDPU/645-849------------------------------------------------------------------------------QV
Q5B7M5_EMENI/619-815------------------------------------------------------------------------------EF
V2XZV7_MONRO/643-871------------------------------------------------------------------------------PF
G8Y8Y3_PICSO/686-885------------------------------------------------------------------------------SL
F0XND2_GROCL/621-817------------------------------------------------------------------------------GF
C5GR67_AJEDR/612-808------------------------------------------------------------------------------GL
M7UFB1_BOTF1/636-831------------------------------------------------------------------------------GF
B3SA13_TRIAD/594-809------------------------------------------------------------------------------QL
A3GGP2_PICST/664-863------------------------------------------------------------------------------RI
B6K3H2_SCHJY/618-812------------------------------------------------------------------------------GF
E5A3A1_LEPMJ/688-882------------------------------------------------------------------------------AF
I1J8W6_SOYBN/549-738------------------------------------------------------------------------------QL
J0LDN8_AURST/637-853------------------------------------------------------------------------------AY
M7SB14_EUTLA/604-800------------------------------------------------------------------------------DF
M4AYB0_XIPMA/637-843------------------------------------------------------------------------------MV
H0VL29_CAVPO/640-846------------------------------------------------------------------------------FL

PF09139

D6WLK1_TRICA/13-336YARILS.KFPQN.FTF..CFAYGSAVKKQIEK..........................................KPKDNM
F4Q0F6_DICFS/78-418IKMIME.QFPK..IKY..GFAYGSGVIAQKGYDVQDKQI........................QQQQRQQQPTTEELSPM
C5G7N5_AJEDR/130-496LRQILW.QFKAP.IRY..AFAYGSGVFPQSNRSAFPAESS......................HPAAPQAIQTGQGNSGKM
H6BQ12_EXODN/141-510LRQILW.KFRAP.IRY..AFAYGSGVFPQSSNTEGGNSKL......................HPSPPEAITKVQNGNQKM
A8NRM0_COPC7/89-410LESIVA.KFDAP.IRY..AFAYGSGVFEQDGYA....................................EKKKEGAEGPM
G1XLW6_ARTOA/133-472LRHLLW.EFKAP.IRY..AFAYGSGVFSQGTS..........................................SKDKPM
E9J9M0_SOLIN/10-328LRQLLG.EFPGN.MKF..CFAYGSGAFKQTNN...........................................DGNNM
G4N333_MAGO7/122-492LGDIVK.SFQAP.IIY..AFAYGSGVFPQSKLLGKAPSDELLR.................SVHTKPDPAIVRAQGESPKM
D8M4A9_BLAHO/3-344FEQYLS.KLPE..YDF..AITYGSGVFKQVGY.......................................SEKDHKNAM
S3BZ14_OPHP1/165-542LRQILW.QFRAP.IRY..AFAYGSGVFPQSKSDGRVPTEAEIK.................AIHPKAPQSIQRAQDGTPKM
U1HUS9_ENDPU/150-521LRQILW.KFKAP.IRY..AFAYGSGVFTQKGDPSAVSFPAST...................LHPNPPEAITKVQDGPQKM
C1E0D3_MICCC/10-340LRAVLE.DVPP..VNH..AFGYGSGVLPQP..LRDDE............................GPSASARDHAATGSV
L0P740_PNEJ8/104-428LKEILR.EFKAP.IQF..SFAYGSGVFKQKG...........................................NNKEPM
C9S6T4_VERA1/142-510LTRLLR.SYRAP.IMY..AFAYGSGIFPQAKPNRHVSDEEYR..................NVHPKPSQALKEVQASGPKS
B4NJ58_DROWI/5-342YRRTVT.RFPLGSVSY..IFAYGSGVKQQLGYKNVQQ............................PAAKPSSSKSSSSNV
E9F7E1_METRA/91-463LRIMLR.QFNAP.IVY..CFAYGSGVFPQDDISRSITEAEFR..................AVHPKPPEALVKAQKGSPKM
A5E243_LODEL/82-429LEGIVK.SFHAP.MET..AIGYGSGVLPQDGYPVDAGTATDTDTSIDTATDTSTAIDTASTSASTTAAMGTSKSDADPKQ
W1Q7W0_OGAPD/134-519LRKVVW.EFNAP.IRY..AFGYGSKVFDQGST..........................................KSSNSQ
B6K4K1_SCHJY/52-376FERIVN.SFDAP.IDV..AIAYGSGVFSQKGY.........................................DKKKKPM
H0Z110_TAEGU/13-327FR.VLA.HFLQE.LSL..AFAYCSGVAARGGP........................................GTGLGINM
M3B232_PSEFD/164-542LRQVLW.QFKAP.IRY..AFAYGSGVFGQKSSGSSTGSESLS...................PHPNPPKAVEDWQKGGAKI
E0VMJ8_PEDHC/16-330FNRILS.KFPLEDLTY..CFAYGSGVFDQLHN..........................................RSNKNM
B0WG01_CULQU/11-332FYRILS.RFPPN.FAF..CFAYGSGVKQQLGY.......................................DKAKKKQNM
K3ZJ60_SETIT/15-326LAGPLR.DILPP.VDF..CCAYGSTLLHAR............................................PDGTSM
E9CXS5_COCPS/124-488LRQILW.QFRAP.IRY..AFAYGSGVFPQSGAATGESCH........................PAAPPTIQRMQQGGGKM
A0ECV7_PARTE/9-316LKQFIQ.TLPQ..SEL..SFAYGSAVQPQFNY........................................DYTKNKPM
B9GN14_POPTR/9-326LKSFLK.VLPP..VGF..CCVYGSSLHPNN............................................NDKSTM
S8AI20_PENO1/118-482LRQILW.QFRAP.IRY..AFAYGSGVFPQSGSGAAGSTH........................PAAPAAIQKMQKGSGKM
W5N967_LEPOC/13-328YRKILS.RFPQD.MSL..AFAYGSGVFRQSGT.......................................THGQMGSNM
Q0UPI9_PHANO/59-415LRGILR.QF.PP.ITY..AFAYGSGVFPQSAATASRTTNSP.....................HPNPPEAILKWQKGGGKM
A7S007_NEMVE/10-319FRDIVS.RFPDG.ITL..AFAYGSGVFKQIGN..........................................VSTDNM
K9G9U1_PEND2/123-487LRMILW.QFKAP.IRY..AFAYGSGVFAQNGSGAPSSSLH.......................PSAPTAIQNMQKGSGKM
TAM41_DICDI/68-424INELLK.LFPP..IKY..GFAYGSGVISQKGYNRNGDG..........................STSTENPSKKEEQSPM
I1K386_SOYBN/6-319FRSFLQ.VLPP..VEF..ACVYGSSLHPSN............................................HDKTTM
M7PAY1_PNEMU/94-420LKTVLW.KFKAP.IRF..SFAYGSGIFKKKR...........................................NDKKPM
S8FW20_FOMPI/63-368LEDIVA.QFNAP.IRY..AFAYGSGVFEQDGY.........................................KQEEKPM
C5MHG3_CANTT/128-440LQGIVK.SFTAP.IDV..SIGYGSGILPQDGYE....................................QQEKQENTSKQ
Q2H207_CHAGB/144-517LKAIPW.QFRAP.IRY..AFAYGSGVFPQSKASGKTPTEEELR.................AIHPKAPLAVQRAQDGTPKM
A8Q506_MALGO/15-385ILHILQ.SMNLPMVQY..AFAYGSGVFSQAPV......................................SQKVGNTPPM
T1JUS5_TETUR/9-355LKNLIS.FLPSS.YCF..AFAYGSAVFKQSISAFDRSSSSTSK.................SKSFAASVLSNGSAKKDANM
G1KJZ6_ANOCA/15-329FRRILA.HFPPE.LSL..AFAYGSGVFQQAGA.......................................SSAETGNNM
K2RZS9_MACPH/50-418LRQILW.QFRAP.IRY..AFAYGSGVFPQSSDSGSTSLSP......................HPNPPDAIKKWQSGGQKV
M2UHY6_COCH5/80-448LRGILR.KF.PP.VTY..AFAYGSGVFPQSAATASRTTQSP.....................HPNPPDAILKWQKGGGKM
C4QXR2_KOMPG/110-482LQKVLW.KFNAP.IRF..AAGYGSGVFTQANQ........................................KVSESKPQ
G3APF1_SPAPN/81-416LEEIVK.TFNAP.IDV..SIGYGSGILPQDGYDLPKVSGTSAPAS............STSSGGSSTTTTTTTTTTSSSQQ
C7Z478_NECH7/122-494LRLMLR.QFNAP.IVY..CFAYGSGVFPQEVSKPSISDAAFR..................AVHPNPPDALVKSQKGSPKM
Q6CC57_YARLI/155-503LRQVLW.TFKAP.IRY..SFAYGSGVFSQGKE.........................................SNASKPQ
K7IVD4_NASVI/11-329FKNILQ.EFPRN.MKF..CFAYGSGVFKQKSD...........................................PASNM
J9K2F7_ACYPI/5-309LNRILT.KFPTKHLVY..CFAYGSGVFQQAGR...........................................TDRAM
TAM41_DROME/5-338YRRTVA.RFPLGSVSY..MFAYGSGVKQQEGYGKV................................GNGNNLRPPPGTV
M7TNP0_EUTLA/89-460MRQLLW.RFRAP.IRY..AFAYGSGVFPQAKGGTPTEAEIKA...................IHPKAPLAVQKAQDGSPKM
U4L0D7_PYROM/82-426LRQLLW.QFEAP.VRW..AIAYGSGVFSQGTR........................................NAGGKPPM
W1PVI6_AMBTC/11-327LAAPLN.DLPH..VDF..CCAYGSSLLPNN............................................SNKKPM
S2J8V7_MUCC1/67-383LKDVVS.QFNAP.VRY..AIAYGSGVFRQSGY.........................................DEKKKPM
E1FWI9_LOALO/14-325LKYLLD.ILPLDTVEY..ACAYGSGAVPQGSD..........................................LRLGKM
R7Z3U1_CONA1/137-506LRQILW.QFRAP.IKY..AFAYGSGVFPQSDATATSAALSP.....................HPHPPEAVLKWQKGGGKM
R9AIR3_WALI9/86-407LEKVIN.SFNAP.IRY..GFAYGSGVFQQPGY.........................................TDKDKPL
G8B9Z5_CANPC/74-380LVDLVN.TFDSK.ISA..AVGYGSGILPQNGY........................................DKPDKEKQ
Q9SN75_ARATH/9-326LSSFLS.VLPP..VDF..CCVYGSTLHPNN............................................QDKSKM
G8YHN8_PICSO/69-420VERLLQ.SFKSS.IEV..SFGYGSGVFQQSGY.........................................TGKSTPQ
B4K948_DROMO/5-334YRRVVA.RFPLGNVSY..MFAYGSGVKQQIGYE....................................KVDEKPNSKSV
S9W8F4_SCHCR/52-374LKGLLD.TFNAP.IQV..AIGYGSGVFQQAGY.........................................GSTAKPM
N1J4Q0_BLUG1/111-475LRRTLW.HFRAP.IRF..AFAYGSGVFPQSRQTYSNVRPTS....................IHPNPPPAVLKAQGGTSKM
J3PFP4_GAGT3/124-495LGDIVK.SFQAP.IIY..AFAYGSGVFPQSKLLGRTPSDELVH.................SVHPDPDPAIVRAQGEKPKM
A3LVC5_PICST/51-374LRGIID.TFNSS.IKV..SIGYGSGVLPQAGYANERSNH.........................GNNDSTTNNNIEAPVQ
Q6BKV0_DEBHA/67-411LSQLIA.NFKSP.IKF..SIGYGSGVFEQTGY.........................................KKSKKPQ
A7EQJ2_SCLS1/136-507LRQILW.QFRAP.IRY..AFAYGSGVFPQSKHTQATPSSITS...................IHSKPPPAIVEQQGGTPKM
F1L2S9_ASCSU/10-321LGALLE.CVPLDTVRF..AFAYGSGAIAQYGS..........................................QTEDKM
G3JTW8_CORMM/137-509LRVMLR.QFNAP.IVY..CFAYGSGVFPQGDLGRSISDAEFR..................AVHPKPPTALVKAQKGSPKM
V5G174_BYSSN/130-494LRQILW.QFKAP.IRY..AFAYGSGVFTQSASETPSQGH........................PAPPQAIQTVQQGKGKM
F4PEP7_BATDJ/67-400LESIVS.SFRAP.VRF..ALAYGSGVFQQKGYDAIHSSL.........................DSVNENKASSFNEKPM
Q5AGE7_CANAL/141-463LQEIVN.SFDAP.IDV..SIGYGSGILPQDGYDKD................................KSTSNNTANDSKQ
G3XQA7_ASPNA/29-371LNYIIA.KFPP..VAH..AFAYGSGVFPQSAKASTGPSVH.......................ENAPLAITQMQGGNQKM
B6QBB5_TALMQ/135-501LRQILW.KFRAP.IRY..AFAYGSGVFAQTATAGAKSDPG......................HPAPPQAIRNVQQGKGKM
F2DNW5_HORVD/11-326LAGPLR.DLLPP.VDF..CCAYGSTLTHAR............................................PDGTSM
I7M213_TETTS/17-335LDSIIQRDFPK..IDF..AFGYGSGVFRQIGY........................................DYSKDSPM
M9MEW7_PSEA3/116-467LHNILA.CFDTP.VRF..AFAYGSGVFSQKEAGPE................................HSKRPATKDGKKM
R8BP23_TOGMI/11-384LRQILW.QFRAP.IRY..AFAYGSGVFPQSKASGRTPTDEELR.................RIHPKAPLAVQRAQDGTPKM
M2M255_BAUCO/36-426LRQILW.RFRAP.IRY..AFAYGSGVFAQQSSKSMTETSMS....................PHPNPPKAVEDWQKGGAKI
T1F6T9_HELRO/4-318.QKFLK.FFPE..VRM..AFAYGSGVFKQKSH.........................................LDPSKNM
F4REF8_MELLP/113-453LSNIIQ.SFKAP.IRY..AIGYGSGVFPQKSY........................................DLKKQTPM
M5E4Z7_MALS4/64-428ILSILN.AMRLPKYNY..AFAYGSGVFSQTTK......................................AKAVGGTAPM
U5H5E0_USTV1/137-472LEEILA.DFKAP.VRF..AFAYGSGVFRQKGY.........................................AASEQPM
G3B682_CANTC/65-370LTGLVN.HFDG..TST..SIGYGSGVFEQAGY.........................................GSGSRPQ
H3FZA6_PRIPA/8-319VKELIS.DLPLGSVNF..AFAYGSGVVPQENE..........................................RMEDKM
H2S0L1_TAKRU/13-328YRRILS.EFPQD.ISL..AFAYGSGVFKQHGT.......................................NQGQMEKNM
D8PZS1_SCHCM/93-412LESIVA.QFNAP.IRY..AFAYGSGVFEQDGYR....................................TVEAPDGEKPM
D7T9Q8_VITVI/9-326LASLLK.FLPP..VEF..CCVYGSALHPNN............................................YNKSTM
G0T2B5_RHOT2/147-502LEEVMK.SFKAP.VRY..AFAYGSGVFRQKGY.........................................AKEDKPL
B7PKK9_IXOSC/7-319WSKIIS.AFPGK.FTL..AFCYGSGVFPQKGA.........................................AQPKGNM
F9WXS4_ZYMTI/148-520LRSIIW.QFRAP.IRY..AFAYGSGVFGQKSSSGVSTDLSP.....................HPHPPKAVEEWQKGGAKV
B9SQ77_RICCO/9-325LKNFLE.VLPS..VEF..CCVYGSALHPNN............................................QDKSSM
M0S210_MUSAM/10-320LAGPLE.LLPA..VDF..CCVYGSSLLPNN............................................SDKTSM
E9R3D7_ASPFU/128-493LRQILW.QFRAP.IRY..AFAYGSGVFPQSGSAAGSSQCH.......................PSAPAAIQNMQQGKGKM
I4Y9B7_WALMC/21-342LEAVFH.SFRAP.IRY..GFAYGSGVFKQTGY.........................................SDKDKPL
D3B0C8_POLPA/348-663IKKILS.QFPK..IKY..GFAYGSGVISQKGY.......................................ESNSNKQPM
A5DAD6_PICGU/58-371LEALAR.RFDGP.VEF..TFGYGSGVFDQAGY.........................................TKRAKPQ
TAM41_CAEBR/4-316YRELIS.VLPLDTVEY..AFAYGSGAIQQKDE..........................................NKAEKM
H3AQ57_LATCH/13-328FRRILS.HFPPD.ISL..AFAYGSGVFRQSGN.......................................SQGLMQNNM
G4U2Y1_SERID/94-414LEEIVG.TFHSP.IRY..AFAYGSGVFEQEGS......................................SKLEKDKKPM
H2Y1H7_CIOIN/13-342LSRLLS.RFPGD.MSL..AFSYGSGIFPQNEN.........................................SPPLSNM
Q5KAN9_CRYNJ/49-385LRPVIS.TFQAP.IDW..AAAYGSGVLPQASYK.....................................PPAPGDAGPL
E9HGG3_DAPPU/25-340FRHILS.LFPED.LVF..AFSYGSGAFQQHGQ.........................................KSTEGNV
Q7PQL6_ANOGA/11-332FFRLLS.KFPQG.FSF..CFAYGSGVKQQLGY.......................................ESVRSKRNM
F1MZC5_BOVIN/13-327FRKILS.HFPEE.LSL..AFAYGSGVYRQAGP........................................SSDQKNAM
B7GA00_PHATC/17-343.RKLLEDTLPLDNVVY..AFGYGSGVLSQE..I....................................VTKEKADDSNM
B4JF38_DROGR/5-334YRRIVT.RFPLGNVSY..MFAYGSGVKRQEGYE....................................MLDQKPDAKTV
Q16J98_AEDAE/11-332FYRILS.RFPPN.ITF..CFAYGSGVKQQLGQ.......................................DAAQKKRNM
E3K171_PUCGT/48-392LNSIIN.SFKPP.IRY..ALAYGSAVFPQNSY........................................QKQQQQPM
D5GF34_TUBMM/84-434LRSLLW.QFRAP.VRY..AFAYGSGVFSQGSKFGG.................................GSGSVAGGRKPM
G9MXT6_HYPVG/81-452LRMMLR.QFNAP.IVY..CFAYGSGVFPQEKAGRSVSEAEFR..................AVHPKPPEALVKAQKGSPKM
U9TGF8_RHIID/101-418LRKLLN.NFHAP.IRY..AIAYGSGVFPQKGY........................................NYDENKPM
L8FTT4_PSED2/132-505LRQVLW.QFRAP.IRY..AFAYGSGVFPQSKPSAPSSTPSSRT.................SIHPNAPSAIAKAQDGQPKM
TAM41_SCHPO/61-385LTKVVN.YFQAP.IDV..AVGYGSGVFRQAGY.........................................SQKENPM
R4XIF8_TAPDE/76-410LRSVLW.KFKAP.IRY..AFAYGSGVFSQKGY.........................................DGSTKPM
B8N4Y6_ASPFN/11-362LQQITQ.QFRAP.ISY..SIAYGSGVFPQTTNKTSSNPQL......................HPSPPPAISQAQKAHPKM
K5VSI5_PHACS/87-407LESIVA.QFNAP.IRY..AFAYGSGVFEQDGYT....................................ISNPKSKDGPM
T0K1A0_COLGC/136-508LTNVVR.EFRAP.VMY..AMAYGSGVFPQSKTSRSVTDEEFR..................TVHPKPTSSLMEVQKGGPKM
D7FQS1_ECTSI/13-328LGELIS.AFPE..AEF..AFAYGSGVVKQQGYA....................................ENVSNASDLPM
K5VXR0_AGABU/90-409LEDVVA.KFNAP.IRY..AFAYGSGVFEQDGR........................................EQDAETPM
F2PR85_TRIEC/162-525LRQILW.QFKAP.IRY..AFAYGSGVFPQSGTSGGSCHP.........................SPPQAIQAVQQGGGKM
F7BSM1_MONDO/13-327FRRILA.NFPDN.LSL..AFAYGSAVYRQAGP........................................NGGRKNIM
C1MRC2_MICPC/9-342LGVVLN.DLPP..VVH..AFAYGSAVFPQP............................................ASSGSV
C3ZAA9_BRAFL/5-319LSKIVS.NFPQEGLAF..AFAYGSGVFHQRGH.........................................KAMSQNM
G4V8Y8_SCHMA/10-360LKRLID.TLNTDRTNYVASFAYGSVVFPQK..........................................DRTSSNSL
V2X315_MONRO/94-415LESIVA.QFNAP.IRY..AFAYGSGVFEQDGYNK...................................PASPDDPNSPM
M5BIJ2_THACB/103-424LEEIAA.GFDAP.IRY..AFAYGSGVFNQDGY.........................................KDSDRPQ
W5JMS0_ANODA/11-332FYRILS.RFPPG.FSF..CFAYGSGVKQQLGY.......................................DTIRSKRNM
M2RN09_CERS8/89-398LESIVA.QFNAP.IRY..AFAYGSGVFDQAGQPS...................................FSSASPAERPM
E5SKP7_TRISP/223-538LERIAS.ILPRTSVSM..MFAYGSGVIAQRNS..........................................EIKRNM

PF14792

C5GK07_AJEDR/529-641--------------------------------------------------------------------------------
Q5KBS5_CRYNJ/778-890--------------------------------------------------------------------------------
DPOLB_RAT/149-262--------------------------------------------------------------------------------
DPOLB_DANRE/148-263--------------------------------------------------------------------------------
A7SJ46_NEMVE/149-263--------------------------------------------------------------------------------
C3YJ28_BRAFL/322-432--------------------------------------------------------------------------------
C7YGY5_NECH7/618-739--------------------------------------------------------------------------------
F0ZLU7_DICPU/181-297--------------------------------------------------------------------------------
A7SK52_NEMVE/213-322--------------------------------------------------------------------------------
A2QQG4_ASPNC/509-626--------------------------------------------------------------------------------
A9V5M0_MONBE/167-298--------------------------------------------------------------------------------
D7G2F8_ECTSI/183-296--------------------------------------------------------------------------------
B7QKW0_IXOSC/150-261--------------------------------------------------------------------------------
E9EVQ2_METRA/556-677--------------------------------------------------------------------------------
E3QD37_COLGM/619-740--------------------------------------------------------------------------------
B6HVS0_PENRW/522-633--------------------------------------------------------------------------------
A7EMR3_SCLS1/618-744--------------------------------------------------------------------------------
E4ZMZ8_LEPMJ/596-715--------------------------------------------------------------------------------
C5FJW6_ARTOC/469-580--------------------------------------------------------------------------------
B7QK41_IXOSC/277-387--------------------------------------------------------------------------------
B2AY49_PODAN/639-751--------------------------------------------------------------------------------
C9SJH6_VERA1/548-691--------------------------------------------------------------------------------
D8SG82_SELML/125-237--------------------------------------------------------------------------------
E3RX41_PYRTT/579-692--------------------------------------------------------------------------------
Q2HFI0_CHAGB/649-794--------------------------------------------------------------------------------
C1E884_MICCC/525-667--------------------------------------------------------------------------------
A9TCX5_PHYPA/342-457--------------------------------------------------------------------------------
B9HVB4_POPTR/315-429--------------------------------------------------------------------------------
Q0UN18_PHANO/574-687--------------------------------------------------------------------------------
A4S364_OSTLU/149-268--------------------------------------------------------------------------------
D8R616_SELML/125-233--------------------------------------------------------------------------------
A0BDW1_PARTE/419-531--------------------------------------------------------------------------------
B8JIE9_DANRE/378-488--------------------------------------------------------------------------------
F2U5R6_SALR5/160-281--------------------------------------------------------------------------------
F7CJ14_CALJA/78-188--------------------------------------------------------------------------------
Q245F6_TETTS/717-832--------------------------------------------------------------------------------
Q4QI79_LEIMA/354-499--------------------------------------------------------------------------------

PF01909

CID16_SCHPO/908-1034--------------------------------------------------------------------------------
CID1_SCHPO/69-169--------------------------------------------------------------------------------
O26508_METTH/6-97--------------------------------------------------------------------------------
O26564_METTH/21-113--------------------------------------------------------------------------------
CCA_METTH/29-141--------------------------------------------------------------------------------
O27980_ARCFU/6-90--------------------------------------------------------------------------------
CCA_ARCFU/28-133--------------------------------------------------------------------------------
O28300_ARCFU/48-135--------------------------------------------------------------------------------
O28312_ARCFU/101-191--------------------------------------------------------------------------------
O28500_ARCFU/441-531--------------------------------------------------------------------------------
O28587_ARCFU/7-100--------------------------------------------------------------------------------
O28660_ARCFU/27-113--------------------------------------------------------------------------------
O29641_ARCFU/5-90--------------------------------------------------------------------------------
O29943_ARCFU/5-101--------------------------------------------------------------------------------
O30239_ARCFU/8-91--------------------------------------------------------------------------------
PAP_CANAL/68-160--------------------------------------------------------------------------------
O44768_CAEEL/71-163--------------------------------------------------------------------------------
O66796_AQUAE/86-173--------------------------------------------------------------------------------
CID11_SCHPO/72-179--------------------------------------------------------------------------------
PAPS2_ARATH/82-179--------------------------------------------------------------------------------
O97205_LEIMA/1069-1163--------------------------------------------------------------------------------
TDT_HUMAN/311-403--------------------------------------------------------------------------------
TDT_MOUSE/312-404--------------------------------------------------------------------------------
PAPOA_BOVIN/82-175--------------------------------------------------------------------------------
PAP_YEAST/69-161--------------------------------------------------------------------------------
OAS2_HUMAN/373-475--------------------------------------------------------------------------------
Y073_HAEIN/14-110--------------------------------------------------------------------------------
TRF5_YEAST/201-326--------------------------------------------------------------------------------
PAP2_YEAST/204-318--------------------------------------------------------------------------------
GLND_RHIME/87-183--------------------------------------------------------------------------------
P72997_SYNY3/7-99--------------------------------------------------------------------------------
P73498_SYNY3/14-107--------------------------------------------------------------------------------
P73970_SYNY3/10-96--------------------------------------------------------------------------------
OAS1A_RAT/38-140--------------------------------------------------------------------------------
Q09995_CAEEL/75-168--------------------------------------------------------------------------------
PAP_SCHPO/68-161--------------------------------------------------------------------------------
Y128_METJA/11-98--------------------------------------------------------------------------------
Y141_METJA/7-99--------------------------------------------------------------------------------
Y435_METJA/7-92--------------------------------------------------------------------------------
Y604_METJA/7-100--------------------------------------------------------------------------------
Y1086_METJA/124-219--------------------------------------------------------------------------------
CCA_METJA/35-147--------------------------------------------------------------------------------
Y1217_METJA/11-98--------------------------------------------------------------------------------
Y1305_METJA/10-110--------------------------------------------------------------------------------
Y1379_METJA/11-100--------------------------------------------------------------------------------
TUT4_HUMAN/976-1065--------------------------------------------------------------------------------
Q9RTF8_DEIRA/9-95--------------------------------------------------------------------------------
Q9RWI9_DEIRA/14-98--------------------------------------------------------------------------------
Q9RXQ9_DEIRA/18-105--------------------------------------------------------------------------------
Q9U2P3_CAEEL/73-166--------------------------------------------------------------------------------
CID14_SCHPO/266-381--------------------------------------------------------------------------------
PAPA_CANAL/68-161--------------------------------------------------------------------------------
Q9VC07_DROME/53-140--------------------------------------------------------------------------------
Q9WZ83_THEMA/22-113--------------------------------------------------------------------------------
Q9X096_THEMA/7-103--------------------------------------------------------------------------------
Q9X2Z5_BACAN/31-119--------------------------------------------------------------------------------
Q9X304_BACAN/10-108--------------------------------------------------------------------------------
GLND_CORGL/12-98--------------------------------------------------------------------------------
GLND_VIBF1/55-151--------------------------------------------------------------------------------
OAS3_HUMAN/780-872--------------------------------------------------------------------------------
CCA_AERPE/39-163--------------------------------------------------------------------------------
Q9YCI7_AERPE/22-112--------------------------------------------------------------------------------
Q9YFN6_AERPE/17-110--------------------------------------------------------------------------------
Q3Y244_ENTFC/6-114--------------------------------------------------------------------------------
Q5HNP5_STAEQ/17-112--------------------------------------------------------------------------------
PAPD7_HUMAN/245-352--------------------------------------------------------------------------------
CCA_SULSO/25-127--------------------------------------------------------------------------------
CCA_THEAC/29-134--------------------------------------------------------------------------------

PF07528

O62349_CAEEL/113-354-----------------------------------------------------------------------HVGSFVTDT
Q7PYL7_ANOGA/111-351-----------------------------------------------------------------------QVGSFKKGT
ILF3_MOUSE/94-342-----------------------------------------------------------------------RVGLVAKGL
ILF2_DROME/105-345-----------------------------------------------------------------------QVGSFKKGT

PF12633

K0C9C6_CYCSP/30-225-----------------------------------------------------------------------DLKVVKQRF
Q7MYN2_PHOLL/4-200-----------------------------------------------------------------------YIETLKQRL
C9R2R0_AGGAD/4-204-----------------------------------------------------------------------DLNKARKRV
M1WST2_DESPC/651-841-----------------------------------------------------------------------.....EERM
F6AGP1_PSEF1/20-216-----------------------------------------------------------------------.LTQLRARF
F4HFE0_GALAU/3-201-----------------------------------------------------------------------NLDVAKKKV
B3PH57_CELJU/19-216-----------------------------------------------------------------------QLTLLRRRF
G4T2L3_META2/23-218-----------------------------------------------------------------------DLLAILQRF
K4KKJ3_SIMAS/20-214-----------------------------------------------------------------------.TAQIRARF
B8F5L0_HAEPS/22-213-----------------------------------------------------------------------QLSYIKHRV
B0UWZ7_HISS2/4-207-----------------------------------------------------------------------DLQQAKKQV
Q8E9H1_SHEON/9-202-----------------------------------------------------------------------......DIA
C5BLM3_TERTT/19-214-----------------------------------------------------------------------NLTKIRKRF
J7SL77_MORMO/4-201-----------------------------------------------------------------------YIETLKQRL
A3Q9P3_SHELP/3-203-----------------------------------------------------------------------EQEHFIATA
M5DMW4_9GAMM/16-206-----------------------------------------------------------------------....WRDAF
E6WHF8_PANSA/15-211-----------------------------------------------------------------------YIETLKQRL
F7YQ90_VIBA7/4-199-----------------------------------------------------------------------YTKTLIQRL
E6VWA6_DESAO/664-855-----------------------------------------------------------------------....REQRI
Q9HTS8_PSEAE/21-217-----------------------------------------------------------------------..GQLRQRF
A6VL92_ACTSZ/4-203-----------------------------------------------------------------------DLEFARKQV
Q2SQ66_HAHCH/20-215-----------------------------------------------------------------------.LKTLCQRF
A3N160_ACTP2/35-224-----------------------------------------------------------------------......SRV
E4PK78_MARAH/20-216-----------------------------------------------------------------------TLRRLRDRF
W8VBQ3_YEREN/4-200-----------------------------------------------------------------------YIETLKQRL
B4F1X4_PROMH/4-202-----------------------------------------------------------------------YIETLKQRL
Q9KVL9_VIBCH/4-199-----------------------------------------------------------------------YTQTLIHRL
Q6LLN1_PHOPR/4-203-----------------------------------------------------------------------YIQMLKNRL
D4ZCR6_SHEVD/7-207-----------------------------------------------------------------------EQNHIIETA
Q7VND7_HAEDU/2-191-----------------------------------------------------------------------......QRV
A4VGX1_PSEU5/20-216-----------------------------------------------------------------------.LATLRTRF
F9ZY47_METMM/21-216-----------------------------------------------------------------------DLHAITQRF
M4R7B7_BIBTR/21-222-----------------------------------------------------------------------RLEWAKKRI
CYAA_PASMU/4-205-----------------------------------------------------------------------DLFSAQKKV
Q88B03_PSESM/20-216-----------------------------------------------------------------------.LSQLRNRF
Q65VX6_MANSM/4-207-----------------------------------------------------------------------DLQFAKKQV
Q2NQF3_SODGM/4-200-----------------------------------------------------------------------YIETLKQRL
A1TXX4_MARHV/20-216-----------------------------------------------------------------------TLRRLRDRF
CYAA_HAEIN/4-209-----------------------------------------------------------------------NLAQAKQWV
M9X3J4_MANHA/29-225-----------------------------------------------------------------------KLNSTKARI
E1VFT5_9GAMM/19-214-----------------------------------------------------------------------QLKTLKGRF
M4X4Y6_PSEDE/20-216-----------------------------------------------------------------------.LAQLRQRF
C6BYH9_DESAD/680-878-----------------------------------------------------------------------DIEHCHACF
I5AZY9_9DELT/15-214-----------------------------------------------------------------------KLTRMKAAF
Q088L2_SHEFN/10-203-----------------------------------------------------------------------.....KDLA
X2H648_9GAMM/4-197-----------------------------------------------------------------------YINNIKKQL
A1SR20_PSYIN/12-237-----------------------------------------------------------------------EIKRLRDKA
Q87KJ0_VIBPA/4-199-----------------------------------------------------------------------YTYTIIQRL
H8GI61_METAL/21-218-----------------------------------------------------------------------DLQAIADRF
Q21EM4_SACD2/20-215-----------------------------------------------------------------------NLTLLRKRF
A4XNY1_PSEMY/20-216-----------------------------------------------------------------------.LTQLRARF
D6Z233_DESAT/8-206-----------------------------------------------------------------------......ARY
C5BBD1_EDWI9/4-201-----------------------------------------------------------------------YIETLKQRL
B7VMD8_VIBTL/4-199-----------------------------------------------------------------------YTQTLIQRL
Q88CF9_PSEPK/20-216-----------------------------------------------------------------------.LATLRARF
C4LDV3_TOLAT/4-196-----------------------------------------------------------------------QFELLVARC
M4U351_9GAMM/4-197-----------------------------------------------------------------------EIKRLRDKA
E0SKN1_DICD3/4-200-----------------------------------------------------------------------YIETLKQRL
D5C200_NITHN/12-205-----------------------------------------------------------------------..KDIRQRF
A0KFH7_AERHH/4-200-----------------------------------------------------------------------KLDTLVARY

PF10127

YCGL_BACSU/1-249--------------------------------------------------------------------------------
A8MHZ8_ALKOO/1-249--------------------------------------------------------------------------------
Q0ATC2_MARMM/14-264--------------------------------------------------------------------------------
Q5YSM9_NOCFA/7-254--------------------------------------------------------------------------------
A3QAH3_SHELP/6-255--------------------------------------------------------------------------------
Q8Y2V7_RALSO/25-271--------------------------------------------------------------------------------
Q97IY9_CLOAB/10-256--------------------------------------------------------------------------------
A6LZ95_CLOB8/1-237--------------------------------------------------------------------------------
A8F9S9_BACP2/1-249--------------------------------------------------------------------------------
Q2RSZ8_RHORT/22-270--------------------------------------------------------------------------------
Q8SCS5_BPDPK/11-264--------------------------------------------------------------------------------
A9B3Q0_HERA2/60-291--------------------------------------------------------------------------------
A7MPB9_CROS8/11-258--------------------------------------------------------------------------------
Q9S235_STRCO/1-245--------------------------------------------------------------------------------
Q65NN4_BACLD/1-249--------------------------------------------------------------------------------
Q7ULC4_RHOBA/63-303--------------------------------------------------------------------------------
A9BRG4_DELAS/16-262--------------------------------------------------------------------------------
Q7NZ84_CHRVO/14-259--------------------------------------------------------------------------------
Q24TP5_DESHY/3-250--------------------------------------------------------------------------------
Q7ULC3_RHOBA/4-250--------------------------------------------------------------------------------
Q099H0_STIAD/9-253--------------------------------------------------------------------------------
Q7MZH9_PHOLL/11-258--------------------------------------------------------------------------------
Q0BVF7_GRABC/14-264--------------------------------------------------------------------------------
A6LZ96_CLOB8/1-249--------------------------------------------------------------------------------
Q2SQI3_HAHCH/1-246--------------------------------------------------------------------------------
B4EM27_BURCJ/21-266--------------------------------------------------------------------------------
Q814A4_BACCR/1-249--------------------------------------------------------------------------------
Q853S4_BPMBZ/16-276--------------------------------------------------------------------------------
Q9HVK0_PSEAE/13-260--------------------------------------------------------------------------------

PF10620

D3FW19_BACPE/3-199-----------------------------------------------------------------------RVHDLVELK
B4EEI1_BURCJ/9-215-----------------------------------------------------------------------RRHTLVTLT
F2F9N8_SOLSS/4-194-----------------------------------------------------------------------TVHDLVFLK
R5PTN8_9BURK/4-199-----------------------------------------------------------------------RPHDLLFLT
Q20XM6_RHOPB/11-212-----------------------------------------------------------------------RPHDLLWID
G8NWE2_GRAMM/10-208-----------------------------------------------------------------------QVHDLLLLS
Q6FBG5_ACIAD/8-200-----------------------------------------------------------------------RPHDLLWGM
Q478I8_DECAR/2-209-----------------------------------------------------------------------RRHDLVYLQ
G8M515_9BURK/7-206-----------------------------------------------------------------------RPHDLVRLA
Q13P70_BURXL/22-223-----------------------------------------------------------------------RPHDLLRLQ
B0UJ86_METS4/6-208-----------------------------------------------------------------------RRHDLLDVE
E0SJB7_DICD3/5-200-----------------------------------------------------------------------RPHDLLWLT
B1Y603_LEPCP/24-240-----------------------------------------------------------------------RRHQLVRLS
B6JE84_OLICO/7-212-----------------------------------------------------------------------ERHAFVYCA
MDCG_BRADU/13-217-----------------------------------------------------------------------GRHDLVFVS
D5AVP5_RHOCB/5-220-----------------------------------------------------------------------.RHSLAHVS
Q2RUR7_RHORT/4-220-----------------------------------------------------------------------RRHTLAHID
D3HKK0_LEGLN/3-206-----------------------------------------------------------------------QRHHLIYLQ
A0R6Q2_MYCS2/5-197-----------------------------------------------------------------------RPHDLLRIA
I3U924_ADVKW/2-208-----------------------------------------------------------------------RRHDLAYLY
A4G557_HERAR/3-213-----------------------------------------------------------------------YRHNRVWLS
H5WND7_9BURK/5-214-----------------------------------------------------------------------HRHQLAHLS
W0PCX9_9BURK/2-210-----------------------------------------------------------------------RRHDLAYLY
A8AQP5_CITK8/6-200-----------------------------------------------------------------------RPHDLIWLN
D8IXS4_HERSS/5-221-----------------------------------------------------------------------PRHHLLWLT
Q4FSL5_PSYA2/2-211-----------------------------------------------------------------------HRHDLVYLQ
G0ABH8_COLFT/3-212-----------------------------------------------------------------------ARHSLVWLS
C5AE29_BURGB/13-235-----------------------------------------------------------------------VRHRVVRLA
Q21XD0_RHOFT/5-210-----------------------------------------------------------------------ARNQLVWLD
A1WLX1_VEREI/8-240-----------------------------------------------------------------------WRHRRVWLA
Q89UY6_BRADU/6-207-----------------------------------------------------------------------ARHTMVKAS
C5APL6_METEA/6-211-----------------------------------------------------------------------RRHDLLDVE
F6AEK3_PSEF1/6-203-----------------------------------------------------------------------RPHDLLWGL
MDCG_PSEAE/8-202-----------------------------------------------------------------------EPHDLLLGM
A4VRY6_PSEU5/6-198-----------------------------------------------------------------------RPHDLLWGM
D7A7S9_STAND/7-217-----------------------------------------------------------------------ARHDLLRVT
B2JLU1_PARP8/24-227-----------------------------------------------------------------------RAHDILRVR
MDCG_XANCP/3-204-----------------------------------------------------------------------GRHALVWLR
I2BDH6_SHIBC/7-201-----------------------------------------------------------------------RAHDLLWLD
A9BUU4_DELAS/12-224-----------------------------------------------------------------------HRHQLVDLG
H0Q3G4_9RHOO/2-205-----------------------------------------------------------------------RRHDLVWLD
G2IWN4_PSEUL/8-208-----------------------------------------------------------------------RPHDLLWLA
MDCG_KLEP7/6-200-----------------------------------------------------------------------RPHDLVWLN
H2IQE3_RAHAC/5-202-----------------------------------------------------------------------RAHDFVWIR
S6AL15_PSERE/6-197-----------------------------------------------------------------------RPHDLLWGM
A1VKU0_POLNA/11-212-----------------------------------------------------------------------RPHDLLWPL
MDCG_PSESM/9-203-----------------------------------------------------------------------LPHDLLWGM
H8MH16_CORCM/7-204-----------------------------------------------------------------------VRHDWVYLG
B8EMG7_METSB/15-229-----------------------------------------------------------------------RRHALLQVC
E6WJH1_PANSA/6-195-----------------------------------------------------------------------RPHDLLWLR
B1M799_METRJ/6-209-----------------------------------------------------------------------RRHDLVRAD
MDCG_AZOVD/9-206-----------------------------------------------------------------------QPHDLLWGM
W0LLU0_9GAMM/3-217-----------------------------------------------------------------------HRHDLLQFS
A5VEB4_SPHWW/8-205-----------------------------------------------------------------------RRHDLVHLR
B2UKC7_RALPJ/7-206-----------------------------------------------------------------------RAHDLLWVS
Q21AG0_RHOPB/4-220-----------------------------------------------------------------------LRHTMVEFS
A2SDW3_METPP/11-216-----------------------------------------------------------------------WRHRRVWLA
A1T0S3_PSYIN/7-202-----------------------------------------------------------------------QPHDLLWVK
B2FSQ2_STRMK/6-203-----------------------------------------------------------------------ARHTLAWLS
B8IJN7_METNO/6-210-----------------------------------------------------------------------RRHDLLDVD

PF03296

Q9EN10_AMEPV/129-284-----------------------------------------------------------------------...DNPILN
PAP1_CPRVZ/123-270-----------------------------------------------------------------------YAAHEDYVE
PAP1_DPV83/122-269-----------------------------------------------------------------------TSSMQKIAN
PAP1_MCV1/122-269-----------------------------------------------------------------------YCSMERLAE
Q6TVV2_ORFSA/120-268-----------------------------------------------------------------------.TRARALAS
PAP1_VAR67/131-279-----------------------------------------------------------------------VTSMEELAR
PAP1_FOWPN/124-271-----------------------------------------------------------------------YSSMEKIAD

PF04439

R7KZ10_9FIRM/1-274-----------------------------------------------------------------------......MYE
W6S1S8_9CLOT/1-279-----------------------------------------------------------------------MRSEKEMYE
L0EDK7_THECK/1-279-----------------------------------------------------------------------MRSERDMME
R7M6A2_9CLOT/3-279-----------------------------------------------------------------------MRTEKQIYD
F0RJQ6_DEIPM/17-291-----------------------------------------------------------------------...ETVLLR
C9A7Q4_ENTCA/1-276-----------------------------------------------------------------------MREEAELHQ
R5BA48_9CLOT/1-282-----------------------------------------------------------------------MRSERQIMD
J7SKW9_MORMO/1-275-----------------------------------------------------------------------MESIEQIIN
C0ZBY2_BREBN/3-281-----------------------------------------------------------------------LRTEQEMMN
F8KV03_PARAV/7-263-----------------------------------------------------------------------TK.......
R6MWH0_9CLOT/1-270-----------------------------------------------------------------------MRSQEEMLA
D1API7_SEBTE/1-279-----------------------------------------------------------------------MRNEKEMLD
Q81EL0_BACCR/1-279-----------------------------------------------------------------------MRTEKEMLD
E8N0I5_ANATU/1-276-----------------------------------------------------------------------MRTEQEMMD
T0U4V5_9ENTE/1-276-----------------------------------------------------------------------MRNEAEMLA
F5WV16_ERYRF/1-277-----------------------------------------------------------------------MRTETEIMT
Q7N6T3_PHOLL/8-279-----------------------------------------------------------------------.......LE
D6DFM9_CLOSC/1-277-----------------------------------------------------------------------MRSEKEVYD
C6VZK2_DYAFD/8-288-----------------------------------------------------------------------.RTASDMTE
F4C3Y1_SPHS2/10-290-----------------------------------------------------------------------.RSESEMME
Q9KFZ4_BACHD/1-282-----------------------------------------------------------------------MRTEQEMMD
D3HMA9_LEGLN/5-280-----------------------------------------------------------------------.RDEKTMLN
G4L4M5_TETHN/1-277-----------------------------------------------------------------------MRSTTEMTD
A5N4U0_CLOK5/1-276-----------------------------------------------------------------------MRSEKEMMD
F3ZWD0_MAHA5/1-282-----------------------------------------------------------------------MRSEKEMME
Q830C7_ENTFA/1-279-----------------------------------------------------------------------MRTEEEMFQ
E1R322_SPISS/4-281-----------------------------------------------------------------------.RTEKEILD
D3EE58_GEOS4/1-279-----------------------------------------------------------------------MRSEQEMMD
F5YA41_TREAZ/1-278-----------------------------------------------------------------------MRSEREMMA
K0J1M0_AMPXN/1-279-----------------------------------------------------------------------MRTEKEMYD
D9SUI2_CLOC7/1-279-----------------------------------------------------------------------MRTEQEMFD
A8MEJ4_ALKOO/1-277-----------------------------------------------------------------------MRTEQEIMN
A6TTG7_ALKMQ/1-278-----------------------------------------------------------------------MRTEKEMMD
Q5WJQ6_BACSK/1-279-----------------------------------------------------------------------MRSEQEMMT
E3EGQ4_PAEPS/1-279-----------------------------------------------------------------------MRSEPEMMN
G7M0J2_9CLOT/1-279-----------------------------------------------------------------------MRTEQEMFN
I0JN00_HALH3/1-279-----------------------------------------------------------------------MRSEEEMME
Q5ZTL0_LEGPH/5-281-----------------------------------------------------------------------.RDEQTMLT
Q5WBU9_BACSK/1-278-----------------------------------------------------------------------MRTYNEMIN
H1ZC54_MYROD/8-281-----------------------------------------------------------------------.......QN
Q65P34_BACLD/1-285-----------------------------------------------------------------------MRTEQEIID
R7EXP0_9FIRM/1-276-----------------------------------------------------------------------MRSEKEMLD
D9SN58_CLOC7/1-281-----------------------------------------------------------------------MRNTQEMMD
E3EJ73_PAEPS/1-278-----------------------------------------------------------------------MRSEQEMLH
H6NNB4_9BACL/1-279-----------------------------------------------------------------------MRSEREMMD
R6VSM5_9FIRM/1-276-----------------------------------------------------------------------MRTEDEIMK
Q3Y246_ENTFC/1-277-----------------------------------------------------------------------MRSEKEMMD
J9R2N9_RIEAN/1-283-----------------------------------------------------------------------MKVREEKLR
C6XTS4_PEDHD/4-284-----------------------------------------------------------------------.RSEQKMMK
Q24XY2_DESHY/1-282-----------------------------------------------------------------------MRSEKEMME
K8E427_CARML/1-279-----------------------------------------------------------------------MRSEEEMYH
E0RXK3_BUTPB/1-281-----------------------------------------------------------------------MKTYDEMYD
R5RFU0_9FIRM/1-279-----------------------------------------------------------------------MRSEKEVFT
AADK_BACSU/1-279-----------------------------------------------------------------------MRSEQEMMD
R5A566_9CLOT/1-278-----------------------------------------------------------------------MRTEQEMYQ

PF01743

PCNB_ECOLI/62-193--------------------------------------------------------------------------------
O66728_AQUAE/454-580--------------------------------------------------------------------------------
Q93795_CAEEL/38-162--------------------------------------------------------------------------------
CCA_BACSU/22-142--------------------------------------------------------------------------------
O83294_TREPA/24-145--------------------------------------------------------------------------------
O84710_CHLTR/23-143--------------------------------------------------------------------------------
O67911_AQUAE/37-172--------------------------------------------------------------------------------
O51649_BORBU/24-145--------------------------------------------------------------------------------
O83605_TREPA/50-165--------------------------------------------------------------------------------
PCNB_HAEIN/50-181--------------------------------------------------------------------------------
O25357_HELPY/22-146--------------------------------------------------------------------------------
P74081_SYNY3/512-663--------------------------------------------------------------------------------
CCA1_YEAST/63-205--------------------------------------------------------------------------------
I1NH95_SOYBN/99-237--------------------------------------------------------------------------------
Q88DX1_PSEPK/56-188--------------------------------------------------------------------------------
Q94K06_ARATH/110-247--------------------------------------------------------------------------------
Q9CCY1_MYCLE/41-168--------------------------------------------------------------------------------

PF06042

F7YRG9_VIBA7/44-201--------------------------------------------------------------------------------
B9JA85_AGRRK/24-187--------------------------------------------------------------------------------
Q7NQC6_CHRVO/26-191--------------------------------------------------------------------------------
A9KPI8_CLOPH/31-195--------------------------------------------------------------------------------
I1RDV7_GIBZE/30-194--------------------------------------------------------------------------------
C4L4W2_EXISA/22-184--------------------------------------------------------------------------------
E6X9J4_CELAD/24-180--------------------------------------------------------------------------------
T0TPF3_9STRE/22-184--------------------------------------------------------------------------------
E6TYF2_BACCJ/23-185--------------------------------------------------------------------------------
B2IE49_BEII9/22-182--------------------------------------------------------------------------------
R7F266_9BACI/28-194--------------------------------------------------------------------------------
Q47ZE1_COLP3/38-196--------------------------------------------------------------------------------
B7VSV6_VIBTL/5-162--------------------------------------------------------------------------------
B9DTD2_STRU0/21-182--------------------------------------------------------------------------------
G8S5F2_ACTS5/30-189--------------------------------------------------------------------------------
A8GHE5_SERP5/22-179--------------------------------------------------------------------------------
K9WRX7_9NOST/22-176--------------------------------------------------------------------------------
Q6LIY1_PHOPR/48-206--------------------------------------------------------------------------------
K9ZZZ5_DEIPD/21-185--------------------------------------------------------------------------------
K8E4K8_CARML/22-184--------------------------------------------------------------------------------
S8BA31_DACHA/30-194--------------------------------------------------------------------------------
T0TA19_9STRE/18-179--------------------------------------------------------------------------------
K9PHD3_9CYAN/22-177--------------------------------------------------------------------------------
A4Z2D9_BRASO/21-184--------------------------------------------------------------------------------
R8BBT8_TOGMI/30-194--------------------------------------------------------------------------------
Q0WCS8_YERPE/22-199--------------------------------------------------------------------------------
W0L9G9_9GAMM/22-179--------------------------------------------------------------------------------
E1V6J0_HALED/24-181--------------------------------------------------------------------------------
U4KG05_9VIBR/26-182--------------------------------------------------------------------------------
Q8EGD2_SHEON/29-193--------------------------------------------------------------------------------
Q8DVZ2_STRMU/21-183--------------------------------------------------------------------------------
E9ELM3_METRA/30-196--------------------------------------------------------------------------------
G8PQI6_PSEUV/58-222--------------------------------------------------------------------------------
A1S5C1_SHEAM/40-192--------------------------------------------------------------------------------
D4ZAN8_SHEVD/35-191--------------------------------------------------------------------------------
Q8YZI8_NOSS1/21-177--------------------------------------------------------------------------------
I3TT60_TISMK/24-184--------------------------------------------------------------------------------
M4XBK0_PSEDE/30-180--------------------------------------------------------------------------------
A0KID9_AERHH/44-203--------------------------------------------------------------------------------
B2J7L9_NOSP7/21-177--------------------------------------------------------------------------------
Q98CQ2_RHILO/58-222--------------------------------------------------------------------------------
A7HQY2_PARL1/21-184--------------------------------------------------------------------------------
G2SQN4_LACRR/23-176--------------------------------------------------------------------------------
C9A5U1_ENTCA/30-192--------------------------------------------------------------------------------
Q8E2A6_STRA5/19-180--------------------------------------------------------------------------------
D0J385_COMT2/22-181--------------------------------------------------------------------------------
C9SMQ7_VERA1/31-195--------------------------------------------------------------------------------
U5L946_9BACI/24-185--------------------------------------------------------------------------------
Q6F6M2_ACIAD/63-218--------------------------------------------------------------------------------
Q0ATF8_MARMM/35-199--------------------------------------------------------------------------------
Q12L07_SHEDO/33-198--------------------------------------------------------------------------------
B5I7I9_9ACTN/30-193--------------------------------------------------------------------------------
Q9KMH4_VIBCH/42-199--------------------------------------------------------------------------------
G3J5G4_CORMM/36-202--------------------------------------------------------------------------------
Q89V81_BRADU/22-184--------------------------------------------------------------------------------
Q5WAS6_BACSK/23-185--------------------------------------------------------------------------------
Q03U83_LACBA/22-184--------------------------------------------------------------------------------
H2IZW8_RAHAC/23-181--------------------------------------------------------------------------------
D3E7U6_GEOS4/21-179--------------------------------------------------------------------------------
F9UNI3_LACPL/22-183--------------------------------------------------------------------------------
Q9CGK8_LACLA/22-182--------------------------------------------------------------------------------
A4VSF2_STRSY/43-201--------------------------------------------------------------------------------
W8UHS0_YEREN/24-184--------------------------------------------------------------------------------
C5CXQ6_VARPS/13-176--------------------------------------------------------------------------------
H8L6T1_FRAAD/26-186--------------------------------------------------------------------------------
B9JP57_AGRRK/25-185--------------------------------------------------------------------------------
C0ZRT4_RHOE4/21-184--------------------------------------------------------------------------------
I0JHP3_HALH3/24-186--------------------------------------------------------------------------------
B4RAU1_PHEZH/22-186--------------------------------------------------------------------------------
R7F5W6_9BACI/28-194--------------------------------------------------------------------------------
A0ZEL1_NODSP/6-161--------------------------------------------------------------------------------
F0LZI9_VIBFN/22-180--------------------------------------------------------------------------------
K0I121_9BURK/29-196--------------------------------------------------------------------------------
N0ATJ8_9BACI/22-184--------------------------------------------------------------------------------
K9QIT0_9NOSO/21-177--------------------------------------------------------------------------------
A6WX10_OCHA4/47-208--------------------------------------------------------------------------------
C6D3F5_PAESJ/25-186--------------------------------------------------------------------------------
Q7MJH5_VIBVY/23-178--------------------------------------------------------------------------------
F3ZCS6_9ACTN/62-226--------------------------------------------------------------------------------
A6VYX8_MARMS/22-179--------------------------------------------------------------------------------
A4VG22_PSEU5/22-182--------------------------------------------------------------------------------
F5Z4Y3_ALTNA/31-192--------------------------------------------------------------------------------
G4R9P5_PELHB/34-198--------------------------------------------------------------------------------
X4ZH19_9BACL/21-179--------------------------------------------------------------------------------
N4VT77_COLOR/30-193--------------------------------------------------------------------------------
G8PQI7_PSEUV/50-212--------------------------------------------------------------------------------
Q084X9_SHEFN/37-198--------------------------------------------------------------------------------
R4L9D2_9ACTN/23-182--------------------------------------------------------------------------------
Q8CZ82_STRR6/25-187--------------------------------------------------------------------------------
K9W6P1_9CYAN/21-184--------------------------------------------------------------------------------
D9QML6_BRESC/23-187--------------------------------------------------------------------------------
C9A9L8_ENTCA/21-183--------------------------------------------------------------------------------
C2WZT1_BACCE/24-186--------------------------------------------------------------------------------
K9RM73_9CYAN/21-177--------------------------------------------------------------------------------
V4KBT1_9ACTN/35-199--------------------------------------------------------------------------------
C7ZKJ8_NECH7/30-194--------------------------------------------------------------------------------
E3EIW9_PAEPS/24-182--------------------------------------------------------------------------------
Q2S808_HAHCH/20-179--------------------------------------------------------------------------------
Q9A3I2_CAUCR/24-192--------------------------------------------------------------------------------
T0LHD4_COLGC/33-197--------------------------------------------------------------------------------
Q5M5D3_STRT2/19-183--------------------------------------------------------------------------------
A8AUH1_STRGC/23-185--------------------------------------------------------------------------------

PF07984

L5LWP1_MYODS/17-336-----------------------------------------------------------------------LSWDQVSRL
A1Z745_DROME/52-381-----------------------------------------------------------------------LSFEQVSKL
T1FNH1_HELRO/24-358-----------------------------------------------------------------------LNYDQINRL
T1J6X5_STRMM/39-359-----------------------------------------------------------------------LSYEQVRRL
G3Q3S6_GASAC/31-351-----------------------------------------------------------------------LNVEQVEVL
H2Z3D3_CIOSA/19-351-----------------------------------------------------------------------..YKGVARL
H9GHA4_ANOCA/13-332-----------------------------------------------------------------------LTWEQLQIL
B3RY60_TRIAD/11-330-----------------------------------------------------------------------LDYDQVSRL
E4X262_OIKDI/463-783-----------------------------------------------------------------------.KFGEIKKL
G4M0E2_SCHMA/159-490-----------------------------------------------------------------------LSYERVTRL
W5NMQ1_LEPOC/15-334-----------------------------------------------------------------------LTWEQVRLL
A7T168_NEMVE/10-329-----------------------------------------------------------------------LTYEQVHRL
T1K5N9_TETUR/11-330-----------------------------------------------------------------------LSYEQVTRL
I1FWF4_AMPQE/47-375-----------------------------------------------------------------------LTFEQVQRL
B3RUB7_TRIAD/6-351-----------------------------------------------------------------------LNYGQVGKL
K1PBY4_CRAGI/10-333-----------------------------------------------------------------------LCYEQVDRL
F7AS71_MONDO/19-338-----------------------------------------------------------------------LGWDQIKIL
H2LZV4_ORYLA/17-337-----------------------------------------------------------------------LSIEQIQAL
F7E7M3_XENTR/18-337-----------------------------------------------------------------------LSWPQVRRL
H3E7R5_PRIPA/59-392-----------------------------------------------------------------------L...QMERL
J9JYZ0_ACYPI/99-447-----------------------------------------------------------------------LSYEQVARL
E9HG11_DAPPU/7-330-----------------------------------------------------------------------LSYEQVSRV
H9JEQ9_BOMMO/53-380-----------------------------------------------------------------------LSYEQVRRL
FA46B_HUMAN/52-372-----------------------------------------------------------------------LSWPQVKRL
G3VWF6_SARHA/61-380-----------------------------------------------------------------------LSWEQVQRL
Q86NJ5_CAEEL/50-400-----------------------------------------------------------------------LAKGQMKRL
F1S1S5_PIG/9-328-----------------------------------------------------------------------LTWDQVMTL
E9IG33_SOLIN/73-399-----------------------------------------------------------------------LSFEQVRRL
W4YCY4_STRPU/13-330-----------------------------------------------------------------------LSYPQVVRL
C3YH94_BRAFL/153-472-----------------------------------------------------------------------LDYEQVRKL
H3D951_TETNG/18-337-----------------------------------------------------------------------LCWDQVRRL
E1FUA8_LOALO/18-327-----------------------------------------------------------------------LNPAQVERL

PF12281

A8I451_AZOC5/134-340--------------------------------------------------------------------------------
B9JC00_AGRRK/105-319--------------------------------------------------------------------------------
A1BBC9_PARDP/103-312--------------------------------------------------------------------------------
Q126S1_POLSJ/108-319--------------------------------------------------------------------------------
Q5P6X2_AROAE/109-317--------------------------------------------------------------------------------
Q89MC1_BRADU/114-315--------------------------------------------------------------------------------
A9CH87_AGRFC/104-319--------------------------------------------------------------------------------
Q98P17_RHILO/173-382--------------------------------------------------------------------------------
Q8KKU1_RHIEC/104-319--------------------------------------------------------------------------------
N0AYX3_9RHIZ/127-330--------------------------------------------------------------------------------
B6IPR2_RHOCS/108-321--------------------------------------------------------------------------------
V5SE53_9RHIZ/102-312--------------------------------------------------------------------------------
Q9A9N3_CAUCR/103-311--------------------------------------------------------------------------------
A8LU12_DINSH/105-313--------------------------------------------------------------------------------
D6ZZH4_STAND/103-312--------------------------------------------------------------------------------
Q3IVG2_RHOS4/104-312--------------------------------------------------------------------------------
M4S0H4_9SPHN/98-303--------------------------------------------------------------------------------
Q3IV36_RHOS4/114-326--------------------------------------------------------------------------------
B8IY04_METNO/103-315--------------------------------------------------------------------------------
D5CPE9_SIDLE/109-318--------------------------------------------------------------------------------
B3E5Q2_GEOLS/108-317--------------------------------------------------------------------------------
A9BZ70_DELAS/2-210--------------------------------------------------------------------------------
Q12C53_POLSJ/118-324--------------------------------------------------------------------------------
Q0C240_HYPNA/104-317--------------------------------------------------------------------------------
C3KPJ9_SINFN/33-247--------------------------------------------------------------------------------
B4RE82_PHEZH/98-305--------------------------------------------------------------------------------
Q0C284_HYPNA/109-317--------------------------------------------------------------------------------
A4SVJ5_POLSQ/110-320--------------------------------------------------------------------------------
A1AK69_PELPD/13-213--------------------------------------------------------------------------------
Q930T5_RHIME/105-319--------------------------------------------------------------------------------
F2IVW1_POLGS/104-311--------------------------------------------------------------------------------
A6WWH8_OCHA4/115-328--------------------------------------------------------------------------------
C3KKL2_SINFN/104-319--------------------------------------------------------------------------------
A2SPA0_METPP/110-321--------------------------------------------------------------------------------

PF03813

Q5KIJ7_CRYNJ/233-379--------------------------------------------------------------------------------
S8AXB6_PENO1/184-327--------------------------------------------------------------------------------
D8QKX0_SCHCM/187-335--------------------------------------------------------------------------------
M3AM01_PSEFD/220-362--------------------------------------------------------------------------------
H2M2T9_ORYLA/159-300--------------------------------------------------------------------------------
NOL6_DROME/177-320--------------------------------------------------------------------------------
U4LAZ7_PYROM/171-313--------------------------------------------------------------------------------
Q54EN2_DICDI/238-409--------------------------------------------------------------------------------
H0YTW4_TAEGU/134-276--------------------------------------------------------------------------------
H2B1K6_KAZAF/189-339--------------------------------------------------------------------------------
UTP22_YEAST/203-355--------------------------------------------------------------------------------
G3ALQ0_SPAPN/188-336--------------------------------------------------------------------------------
G2R7X2_THITE/138-287--------------------------------------------------------------------------------
G4T7W1_SERID/218-359--------------------------------------------------------------------------------
K3WBL1_PYTUL/157-303--------------------------------------------------------------------------------
J9K0G8_ACYPI/152-299--------------------------------------------------------------------------------
W5J7Q1_ANODA/253-396--------------------------------------------------------------------------------
B4JHB6_DROGR/155-297--------------------------------------------------------------------------------
M2NLG7_BAUCO/120-261--------------------------------------------------------------------------------
A0A0D1C533_USTMA/328-482--------------------------------------------------------------------------------
J3KKN7_COCIM/166-310--------------------------------------------------------------------------------
B5RT80_DEBHA/198-344--------------------------------------------------------------------------------
I2H5R1_TETBL/205-366--------------------------------------------------------------------------------
B2AL59_PODAN/139-285--------------------------------------------------------------------------------
S3BW46_OPHP1/142-297--------------------------------------------------------------------------------
F4P4W3_BATDJ/193-345--------------------------------------------------------------------------------
G4N9I5_MAGO7/142-294--------------------------------------------------------------------------------
G7XFJ4_ASPKW/178-320--------------------------------------------------------------------------------
T5AFI7_OPHSC/141-290--------------------------------------------------------------------------------
H9JCB7_BOMMO/161-301--------------------------------------------------------------------------------
A7S7H5_NEMVE/144-283--------------------------------------------------------------------------------
G9NYU4_HYPAI/141-292--------------------------------------------------------------------------------
NOL6_DROPS/196-339--------------------------------------------------------------------------------
G8ZWX5_TORDC/184-337--------------------------------------------------------------------------------
W5KKI6_ASTMX/169-309--------------------------------------------------------------------------------
M2PAE8_CERS8/217-361--------------------------------------------------------------------------------
UTP22_SCHPO/163-301--------------------------------------------------------------------------------
E0VHG7_PEDHC/176-317--------------------------------------------------------------------------------
A5DT88_LODEL/234-380--------------------------------------------------------------------------------
M9LQU0_PSEA3/304-455--------------------------------------------------------------------------------
A1CJ23_ASPCL/130-272--------------------------------------------------------------------------------
G3B4V1_CANTC/185-331--------------------------------------------------------------------------------
M7WDQ1_RHOT1/288-444--------------------------------------------------------------------------------
H2YJS5_CIOSA/125-260--------------------------------------------------------------------------------
G0VFC1_NAUCC/189-341--------------------------------------------------------------------------------
U7Q6Q9_SPOS1/142-304--------------------------------------------------------------------------------
C5DLD6_LACTC/208-353--------------------------------------------------------------------------------
C7YP94_NECH7/141-297--------------------------------------------------------------------------------
J3NVZ7_GAGT3/141-284--------------------------------------------------------------------------------
T1EE31_HELRO/41-182--------------------------------------------------------------------------------
N1PEU7_DOTSN/213-360--------------------------------------------------------------------------------
U5H217_USTV1/304-456--------------------------------------------------------------------------------
Q7S1X8_NEUCR/140-283--------------------------------------------------------------------------------
J5JXU5_BEAB2/141-288--------------------------------------------------------------------------------
R1EK47_BOTPV/229-373--------------------------------------------------------------------------------
B0DGR0_LACBS/207-350--------------------------------------------------------------------------------
H9GJA7_ANOCA/168-310--------------------------------------------------------------------------------
D5GP17_TUBMM/183-326--------------------------------------------------------------------------------
K7IX79_NASVI/181-318--------------------------------------------------------------------------------
Q0CBE8_ASPTN/162-304--------------------------------------------------------------------------------
F8Q1T2_SERL3/168-313--------------------------------------------------------------------------------
E9E4A5_METAQ/141-303--------------------------------------------------------------------------------
J7RUP2_KAZNA/200-355--------------------------------------------------------------------------------
H3GEK8_PHYRM/137-283--------------------------------------------------------------------------------
A7TPZ3_VANPO/200-354--------------------------------------------------------------------------------
A0A0J9XU34_BRUMA/124-262--------------------------------------------------------------------------------
Q0TXJ2_PHANO/222-368--------------------------------------------------------------------------------
M7NIM6_PNEMU/162-296--------------------------------------------------------------------------------
H2WFH4_CAEJA/116-247--------------------------------------------------------------------------------
A8PXA3_MALGO/185-331--------------------------------------------------------------------------------
G8BYJ9_TETPH/125-280--------------------------------------------------------------------------------
G0S2E0_CHATD/140-292--------------------------------------------------------------------------------
F0ZRR2_DICPU/239-413--------------------------------------------------------------------------------
F1Q4S6_DANRE/183-325--------------------------------------------------------------------------------
R7YYN3_CONA1/232-378--------------------------------------------------------------------------------
C5DTY5_ZYGRC/198-349--------------------------------------------------------------------------------
H2SN18_TAKRU/152-294--------------------------------------------------------------------------------
B6HEW6_PENRW/160-297--------------------------------------------------------------------------------
Q0WVM5_ARATH/98-233--------------------------------------------------------------------------------
G8JTZ4_ERECY/210-355--------------------------------------------------------------------------------
B8P8H6_POSPM/495-636--------------------------------------------------------------------------------
G2QK39_MYCTT/138-286--------------------------------------------------------------------------------
Q17D12_AEDAE/220-361--------------------------------------------------------------------------------
M3CZA8_SPHMS/219-358--------------------------------------------------------------------------------
Q6FTF1_CANGA/168-320--------------------------------------------------------------------------------
Q75A89_ASHGO/203-347--------------------------------------------------------------------------------
F9XME7_ZYMTI/118-257--------------------------------------------------------------------------------
U9SUM6_RHIID/312-461--------------------------------------------------------------------------------
L8GAM4_PSED2/166-311--------------------------------------------------------------------------------
Q4WWD9_ASPFU/164-305--------------------------------------------------------------------------------
C4XY87_CLAL4/190-336--------------------------------------------------------------------------------
K4BB35_SOLLC/99-234--------------------------------------------------------------------------------
Q5TPK2_ANOGA/245-394--------------------------------------------------------------------------------
C4R925_KOMPG/180-340--------------------------------------------------------------------------------
W5FGR4_WHEAT/95-231--------------------------------------------------------------------------------
G0NWB7_CAEBE/112-243--------------------------------------------------------------------------------
W1Q9F0_OGAPD/155-302--------------------------------------------------------------------------------
M5EB57_MALS4/206-350--------------------------------------------------------------------------------
N1JI70_BLUG1/174-315--------------------------------------------------------------------------------
I1CBC4_RHIO9/190-328--------------------------------------------------------------------------------
G3J432_CORMM/141-287--------------------------------------------------------------------------------
K5XS17_AGABU/206-360--------------------------------------------------------------------------------
A5DPW7_PICGU/183-328--------------------------------------------------------------------------------
I4YA03_WALMC/185-311--------------------------------------------------------------------------------
R9AEB2_WALI9/173-299--------------------------------------------------------------------------------
NOL6_XENTR/178-318--------------------------------------------------------------------------------
K0KM58_WICCF/206-354--------------------------------------------------------------------------------
C3Z9X5_BRAFL/110-246--------------------------------------------------------------------------------
S2JLP9_MUCC1/206-340--------------------------------------------------------------------------------
Q6CQS3_KLULA/201-345--------------------------------------------------------------------------------
A7AS51_BABBO/140-290--------------------------------------------------------------------------------
B6QTJ8_TALMQ/174-319--------------------------------------------------------------------------------
B8NV94_ASPFN/172-314--------------------------------------------------------------------------------
A0A088AV91_APIME/198-333--------------------------------------------------------------------------------
S9XA53_SCHCR/170-307--------------------------------------------------------------------------------
K1X311_MARBU/180-323--------------------------------------------------------------------------------
G7E946_MIXOS/201-337--------------------------------------------------------------------------------
V5FPA1_BYSSN/172-313--------------------------------------------------------------------------------
T1JFU9_STRMM/142-297--------------------------------------------------------------------------------
F2U6D3_SALR5/285-469--------------------------------------------------------------------------------
M1W9J6_CLAP2/141-300--------------------------------------------------------------------------------
G8B992_CANPC/207-353--------------------------------------------------------------------------------
N4UMZ3_COLOR/122-270--------------------------------------------------------------------------------
C5G095_ARTOC/157-298--------------------------------------------------------------------------------
G3VN54_SARHA/179-323--------------------------------------------------------------------------------
S8EU65_FOMPI/201-346--------------------------------------------------------------------------------
E3QLQ1_COLGM/130-279--------------------------------------------------------------------------------
B2VXG7_PYRTR/192-338--------------------------------------------------------------------------------
M3HTH7_CANMX/196-342--------------------------------------------------------------------------------
U1HM72_ENDPU/202-339--------------------------------------------------------------------------------
Q5B7M5_EMENI/179-319--------------------------------------------------------------------------------
V2XZV7_MONRO/158-306--------------------------------------------------------------------------------
G8Y8Y3_PICSO/216-362--------------------------------------------------------------------------------
F0XND2_GROCL/143-293--------------------------------------------------------------------------------
C5GR67_AJEDR/154-304--------------------------------------------------------------------------------
M7UFB1_BOTF1/182-324--------------------------------------------------------------------------------
B3SA13_TRIAD/129-275--------------------------------------------------------------------------------
A3GGP2_PICST/195-341--------------------------------------------------------------------------------
B6K3H2_SCHJY/165-304--------------------------------------------------------------------------------
E5A3A1_LEPMJ/228-374--------------------------------------------------------------------------------
I1J8W6_SOYBN/99-233--------------------------------------------------------------------------------
J0LDN8_AURST/177-312--------------------------------------------------------------------------------
M7SB14_EUTLA/140-289--------------------------------------------------------------------------------
M4AYB0_XIPMA/175-317--------------------------------------------------------------------------------
H0VL29_CAVPO/178-320--------------------------------------------------------------------------------

PF02410

D6WL03_TRICA/109-208--------------------------------------------------------------------------------
E1VGT7_9GAMM/19-115--------------------------------------------------------------------------------
Q72BL7_DESVH/18-114--------------------------------------------------------------------------------
E3PRI2_CLOSD/8-104--------------------------------------------------------------------------------
E3I0D8_RHOVT/51-147--------------------------------------------------------------------------------
F8KUA6_HELBC/7-101--------------------------------------------------------------------------------
C6D5V2_PAESJ/10-106--------------------------------------------------------------------------------
G4QH00_GLANF/8-104--------------------------------------------------------------------------------
K0T8E5_THAOC/404-526--------------------------------------------------------------------------------
O86327_MYCTU/12-108--------------------------------------------------------------------------------
C7NE56_LEPBD/13-105--------------------------------------------------------------------------------
K9TU63_9CYAN/35-131--------------------------------------------------------------------------------
R7F4J7_9BACT/11-109--------------------------------------------------------------------------------
B9HIN9_POPTR/50-151--------------------------------------------------------------------------------
X5DAH5_9BACT/12-110--------------------------------------------------------------------------------
H2WNK0_CAEJA/65-168--------------------------------------------------------------------------------
Q04FE5_OENOB/8-104--------------------------------------------------------------------------------
R7JA64_9PORP/9-107--------------------------------------------------------------------------------
D7CWT0_TRURR/6-101--------------------------------------------------------------------------------
H2IXB4_RAHAC/8-104--------------------------------------------------------------------------------
B1ZVV9_OPITP/13-109--------------------------------------------------------------------------------
R6TBA4_9FIRM/11-107--------------------------------------------------------------------------------
B8E1S0_DICTD/12-107--------------------------------------------------------------------------------
R5A3E4_9CLOT/8-104--------------------------------------------------------------------------------
E8NE71_MICTS/12-108--------------------------------------------------------------------------------
B9DNI5_STACT/8-104--------------------------------------------------------------------------------
A9WK69_CHLAA/4-100--------------------------------------------------------------------------------
R5HDA8_9FIRM/9-105--------------------------------------------------------------------------------
C7LYC9_ACIFD/51-146--------------------------------------------------------------------------------
K4L4Y3_9FIRM/9-105--------------------------------------------------------------------------------
Q4FP42_PELUB/9-105--------------------------------------------------------------------------------
R6ESE1_9FIRM/22-118--------------------------------------------------------------------------------
A7I1F9_CAMHC/190-283--------------------------------------------------------------------------------
K9ZZD3_DEIPD/20-115--------------------------------------------------------------------------------
G0QND0_ICHMG/58-162--------------------------------------------------------------------------------
D1CCZ4_THET1/16-112--------------------------------------------------------------------------------
C7RQU7_ACCPU/8-104--------------------------------------------------------------------------------
B9GK05_POPTR/129-223--------------------------------------------------------------------------------
Q5SHF3_THET8/12-107--------------------------------------------------------------------------------
K4KHM4_SIMAS/37-132--------------------------------------------------------------------------------
R6CD09_9FIRM/15-111--------------------------------------------------------------------------------
A0ZLR5_NODSP/38-134--------------------------------------------------------------------------------
R5Q2J4_9BACT/9-107--------------------------------------------------------------------------------
A0A068XU24_ECHMU/101-202--------------------------------------------------------------------------------
D4ZSA1_ARTPN/39-134--------------------------------------------------------------------------------
G1NDG8_MELGA/5-104--------------------------------------------------------------------------------
R6QB74_9FIRM/8-103--------------------------------------------------------------------------------
F9UNR7_LACPL/8-104--------------------------------------------------------------------------------
A1SHP8_NOCSJ/12-108--------------------------------------------------------------------------------
J9W1F9_LACBU/8-104--------------------------------------------------------------------------------
Q47JQ2_DECAR/8-104--------------------------------------------------------------------------------
B2V9I4_SULSY/8-105--------------------------------------------------------------------------------
E3GLQ0_EUBLK/11-107--------------------------------------------------------------------------------
A3N2P9_ACTP2/7-103--------------------------------------------------------------------------------
A0LSX7_ACIC1/13-109--------------------------------------------------------------------------------
E0TFT9_PARBH/42-138--------------------------------------------------------------------------------
F4GJF5_SPHCD/10-107--------------------------------------------------------------------------------
D6Z191_DESAT/20-116--------------------------------------------------------------------------------
R6RRV9_9BACE/9-107--------------------------------------------------------------------------------
G0A0U8_METMM/8-104--------------------------------------------------------------------------------
C5D4V8_GEOSW/8-104--------------------------------------------------------------------------------
E6JZX0_PARDN/12-109--------------------------------------------------------------------------------
S6AAN5_9PROT/8-104--------------------------------------------------------------------------------
R7BRJ0_9ACTN/15-110--------------------------------------------------------------------------------
B4U9M4_HYDS0/5-102--------------------------------------------------------------------------------
D4J8G6_9FIRM/9-105--------------------------------------------------------------------------------
R6EX89_9BACT/9-107--------------------------------------------------------------------------------
A4VTA2_STRSY/8-104--------------------------------------------------------------------------------
K9UU95_9CYAN/43-134--------------------------------------------------------------------------------
X2H6J8_9GAMM/8-103--------------------------------------------------------------------------------
F8F078_TRECH/16-112--------------------------------------------------------------------------------
G8JWM0_ERECY/86-219--------------------------------------------------------------------------------
Q73LW7_TREDE/15-110--------------------------------------------------------------------------------
R5BYH5_9FIRM/9-105--------------------------------------------------------------------------------
H6NIK1_9BACL/9-105--------------------------------------------------------------------------------
F0SVG5_SYNGF/9-105--------------------------------------------------------------------------------
R7R2A4_9FIRM/8-104--------------------------------------------------------------------------------
R7LB71_9BACT/9-107--------------------------------------------------------------------------------
I3WID0_BIFBI/12-110--------------------------------------------------------------------------------
G1KP02_ANOCA/11-110--------------------------------------------------------------------------------
R5RDD8_9PROT/19-114--------------------------------------------------------------------------------
F8EN32_RUNSL/16-114--------------------------------------------------------------------------------
R5SGY3_9GAMM/13-109--------------------------------------------------------------------------------
D9QBW4_CORP2/12-108--------------------------------------------------------------------------------
R5LGW6_9FIRM/6-103--------------------------------------------------------------------------------
C0R0F4_BRAHW/47-143--------------------------------------------------------------------------------
W1QI88_OGAPD/62-199--------------------------------------------------------------------------------
F9YTI3_CAPCC/14-112--------------------------------------------------------------------------------
R5YP83_9PROT/10-105--------------------------------------------------------------------------------
F9D1M0_PREDD/9-107--------------------------------------------------------------------------------
S2JP82_MUCC1/153-260--------------------------------------------------------------------------------
YM62_CAEEL/65-167--------------------------------------------------------------------------------
B5EEI2_GEOBB/16-109--------------------------------------------------------------------------------
B8I1C2_CLOCE/8-104--------------------------------------------------------------------------------
R6K4L0_9BACE/9-107--------------------------------------------------------------------------------
E6W3S5_DESIS/8-105--------------------------------------------------------------------------------
K7IQU4_NASVI/90-189--------------------------------------------------------------------------------
B7G5J9_PHATC/2-97--------------------------------------------------------------------------------
B7FPM4_PHATC/162-271--------------------------------------------------------------------------------
K9YCI5_HALP7/25-122--------------------------------------------------------------------------------
Q11XG7_CYTH3/15-113--------------------------------------------------------------------------------
A0A088A1M0_APIME/113-212--------------------------------------------------------------------------------
R5TZZ5_9FIRM/10-106--------------------------------------------------------------------------------
V4J0M6_9DELT/18-114--------------------------------------------------------------------------------
R7HB19_9FIRM/11-107--------------------------------------------------------------------------------
Q4U8K5_THEAN/211-313--------------------------------------------------------------------------------
D5X4P2_THIK1/8-104--------------------------------------------------------------------------------
F5XNG3_MICPN/12-108--------------------------------------------------------------------------------
Q6D7M0_PECAS/9-104--------------------------------------------------------------------------------
G2KW74_LACSM/8-104--------------------------------------------------------------------------------
I1XI99_METNJ/9-104--------------------------------------------------------------------------------
F4HAS9_GALAU/3-99--------------------------------------------------------------------------------
B8DJS5_DESVM/19-114--------------------------------------------------------------------------------
Q747Q6_GEOSL/15-109--------------------------------------------------------------------------------
W0RI79_9BACT/14-110--------------------------------------------------------------------------------
D6GRY3_FILAD/5-101--------------------------------------------------------------------------------
K9SPG4_9CYAN/36-131--------------------------------------------------------------------------------
A0LPG4_SYNFM/32-126--------------------------------------------------------------------------------
L0GSY4_9GAMM/8-104--------------------------------------------------------------------------------
R6GQD4_9FIRM/22-115--------------------------------------------------------------------------------
C7MPQ9_SACVD/12-108--------------------------------------------------------------------------------
S5SWN0_9CORY/13-108--------------------------------------------------------------------------------
F4PVH6_DICFS/525-623--------------------------------------------------------------------------------
W0JK56_DESAE/2-93--------------------------------------------------------------------------------
M4VFB7_9DELT/227-324--------------------------------------------------------------------------------
G8BW66_TETPH/84-227--------------------------------------------------------------------------------
B3ER25_AMOA5/16-114--------------------------------------------------------------------------------
Q3Z9G1_DEHM1/8-104--------------------------------------------------------------------------------
E6TW12_BACCJ/8-104--------------------------------------------------------------------------------
W5N0T0_LEPOC/99-198--------------------------------------------------------------------------------
D6XWC7_BACIE/8-104--------------------------------------------------------------------------------
H6RLG7_BLASD/13-108--------------------------------------------------------------------------------
ATP25_ZYGRC/85-217--------------------------------------------------------------------------------
Q3IZI6_RHOS4/3-95--------------------------------------------------------------------------------
C5CB00_MICLC/12-109--------------------------------------------------------------------------------
T1IN47_STRMM/146-245--------------------------------------------------------------------------------
W8F8R6_9BACT/15-113--------------------------------------------------------------------------------
Q1QXB2_CHRSD/8-104--------------------------------------------------------------------------------
Q7URC6_RHOBA/74-171--------------------------------------------------------------------------------
D3PKV4_MEIRD/12-108--------------------------------------------------------------------------------
Q5FRT0_GLUOX/51-147--------------------------------------------------------------------------------
H2LUV3_ORYLA/97-196--------------------------------------------------------------------------------
E3HA88_ILYPC/6-102--------------------------------------------------------------------------------
R5G8H7_9PORP/20-117--------------------------------------------------------------------------------
R5RHQ5_9FIRM/9-105--------------------------------------------------------------------------------
R5XAQ7_9FIRM/8-103--------------------------------------------------------------------------------
K7SIQ4_PROA4/13-108--------------------------------------------------------------------------------
D4H0Y6_DENA2/8-104--------------------------------------------------------------------------------
D2RNC7_ACIFV/8-104--------------------------------------------------------------------------------
R6IQY9_9CLOT/8-103--------------------------------------------------------------------------------
M3HMI8_CANMX/81-220--------------------------------------------------------------------------------
C7M7C0_CAPOD/12-111--------------------------------------------------------------------------------
R6GWL1_9FIRM/10-105--------------------------------------------------------------------------------
R6NCD6_9FIRM/5-101--------------------------------------------------------------------------------
R6A3V4_9ACTN/43-140--------------------------------------------------------------------------------
R6DIG1_9BACE/9-107--------------------------------------------------------------------------------
D3UIX0_HELM1/7-101--------------------------------------------------------------------------------
R5N925_9BACT/9-107--------------------------------------------------------------------------------
A9V8V9_MONBE/155-258--------------------------------------------------------------------------------
R7KSJ6_9BURK/8-104--------------------------------------------------------------------------------
F9ZTY5_ACICS/9-105--------------------------------------------------------------------------------
G2LE33_CHLTF/32-127--------------------------------------------------------------------------------
Q8DY34_STRA5/8-104--------------------------------------------------------------------------------
K4IPF9_PSYTT/13-111--------------------------------------------------------------------------------
W0F3W7_9BACT/26-124--------------------------------------------------------------------------------
G8AIT6_AZOBR/37-132--------------------------------------------------------------------------------
R6DUN9_9FIRM/8-103--------------------------------------------------------------------------------
R5AKW9_9CLOT/10-106--------------------------------------------------------------------------------
B5Y803_COPPD/2-97--------------------------------------------------------------------------------
A6QCD7_SULNB/8-101--------------------------------------------------------------------------------
D4K7J1_9FIRM/12-108--------------------------------------------------------------------------------
B6YRM7_AZOPC/12-110--------------------------------------------------------------------------------
R5QWA2_9FIRM/5-101--------------------------------------------------------------------------------
F2F3K1_SOLSS/7-103--------------------------------------------------------------------------------
E4NB25_KITSK/12-109--------------------------------------------------------------------------------
Q6A9H4_PROAC/12-108--------------------------------------------------------------------------------
Q21FD1_SACD2/8-104--------------------------------------------------------------------------------
W0EAU7_9FIRM/8-104--------------------------------------------------------------------------------
E1WYV6_HALMS/7-98--------------------------------------------------------------------------------
F0V8J6_NEOCL/449-551--------------------------------------------------------------------------------
E4TJ98_CALNY/7-103--------------------------------------------------------------------------------
D7WC86_9CORY/13-108--------------------------------------------------------------------------------
E4U6Z9_OCEP5/12-107--------------------------------------------------------------------------------
Q8NN58_CORGL/12-108--------------------------------------------------------------------------------
R7B4U9_9ACTN/13-109--------------------------------------------------------------------------------
E1ZH82_CHLVA/239-341--------------------------------------------------------------------------------
U3GY66_9CORY/12-108--------------------------------------------------------------------------------
R7IT94_9FIRM/11-107--------------------------------------------------------------------------------
D8S2B1_SELML/13-114--------------------------------------------------------------------------------
F6CQD9_DESK7/10-106--------------------------------------------------------------------------------
R6KF46_9FIRM/11-107--------------------------------------------------------------------------------
I0HW02_RUBGI/8-104--------------------------------------------------------------------------------
Q8YPM4_NOSS1/37-133--------------------------------------------------------------------------------
C1EE68_MICCC/526-636--------------------------------------------------------------------------------
C5KAT1_PERM5/235-334--------------------------------------------------------------------------------
H6L6C8_SAPGL/21-119--------------------------------------------------------------------------------
G4T293_META2/8-104--------------------------------------------------------------------------------
I3UBD3_ADVKW/8-104--------------------------------------------------------------------------------
H2FY28_OCESG/8-104--------------------------------------------------------------------------------
R7CUD2_9BACE/6-104--------------------------------------------------------------------------------
J9JUC8_ACYPI/125-224--------------------------------------------------------------------------------
C0ZB11_BREBN/10-106--------------------------------------------------------------------------------
K0KVP5_WICCF/177-309--------------------------------------------------------------------------------
S6EFN2_ZYGB2/82-213--------------------------------------------------------------------------------
S9W0T4_SCHCR/94-219--------------------------------------------------------------------------------
D4JS04_9FIRM/8-104--------------------------------------------------------------------------------
G8TML0_NIAKG/49-147--------------------------------------------------------------------------------
I0K9S3_9BACT/50-148--------------------------------------------------------------------------------
A0A068NYM9_9BACT/8-103--------------------------------------------------------------------------------
Q2GCL3_NEOSM/17-109--------------------------------------------------------------------------------
Q5E6V1_VIBF1/12-106--------------------------------------------------------------------------------
D0J0H1_COMT2/20-116--------------------------------------------------------------------------------
C8WIS8_EGGLE/17-112--------------------------------------------------------------------------------
Q606I9_METCA/10-106--------------------------------------------------------------------------------
B4RD60_PHEZH/47-142--------------------------------------------------------------------------------
Q2JQ53_SYNJB/16-111--------------------------------------------------------------------------------
A6Q542_NITSB/8-101--------------------------------------------------------------------------------
G0VLT2_MEGEL/20-116--------------------------------------------------------------------------------
G8Y063_PICSO/101-239--------------------------------------------------------------------------------
Q7VRA9_BLOFL/4-100--------------------------------------------------------------------------------
H1XSE2_9BACT/8-104--------------------------------------------------------------------------------
Q47MW6_THEFY/12-109--------------------------------------------------------------------------------
A1AVZ7_RUTMC/8-104--------------------------------------------------------------------------------
R5NMF0_9FIRM/8-104--------------------------------------------------------------------------------
E4RIQ7_HALHG/12-107--------------------------------------------------------------------------------
R5Z3M1_9FIRM/5-102--------------------------------------------------------------------------------
E8N386_ANATU/2-95--------------------------------------------------------------------------------
E3D0R6_9BACT/33-122--------------------------------------------------------------------------------
Q92BM7_LISMO/9-104--------------------------------------------------------------------------------
S6CGZ3_9GAMM/8-104--------------------------------------------------------------------------------
Q9A1F0_STRP1/16-112--------------------------------------------------------------------------------
A5G904_GEOUR/16-109--------------------------------------------------------------------------------
B3RRW9_TRIAD/91-190--------------------------------------------------------------------------------
F6EQY0_HOYSD/13-108--------------------------------------------------------------------------------
R6ALX9_9CLOT/27-123--------------------------------------------------------------------------------
E1G5L4_LOALO/54-150--------------------------------------------------------------------------------
Q5P2U1_AROAE/8-104--------------------------------------------------------------------------------
R5WH81_9DELT/389-485--------------------------------------------------------------------------------
R6SBY2_9FIRM/9-105--------------------------------------------------------------------------------
U6B5K9_9RHIZ/20-117--------------------------------------------------------------------------------
D1BM92_VEIPT/13-109--------------------------------------------------------------------------------
B8IEM3_METNO/6-98--------------------------------------------------------------------------------
A1SU09_PSYIN/8-104--------------------------------------------------------------------------------
K8GKE5_9CYAN/32-128--------------------------------------------------------------------------------
Q2N6F3_ERYLH/12-107--------------------------------------------------------------------------------
A3QH51_SHELP/14-110--------------------------------------------------------------------------------
C4Z098_EUBE2/9-105--------------------------------------------------------------------------------
D3EQN9_ATETH/15-112--------------------------------------------------------------------------------
E6U7Y1_ETHHY/22-118--------------------------------------------------------------------------------
G0GDI3_SPITZ/12-109--------------------------------------------------------------------------------
K9Q2R2_9CYAN/18-114--------------------------------------------------------------------------------
E0W225_PEDHC/107-206--------------------------------------------------------------------------------
I0I1R8_CALAS/2-97--------------------------------------------------------------------------------
E0RUY2_BUTPB/13-108--------------------------------------------------------------------------------
D5UTC0_TSUPD/14-108--------------------------------------------------------------------------------
D4M5X8_9FIRM/9-105--------------------------------------------------------------------------------
B1H031_UNCTG/11-107--------------------------------------------------------------------------------
A6LNB0_THEM4/5-101--------------------------------------------------------------------------------
G2SP30_LACRR/8-104--------------------------------------------------------------------------------
Q3IJ97_PSEHT/8-104--------------------------------------------------------------------------------
R5EE57_9GAMM/8-104--------------------------------------------------------------------------------
R6DH31_9CLOT/8-104--------------------------------------------------------------------------------
Q12QY1_SHEDO/9-104--------------------------------------------------------------------------------
IOJAP_ZYMMO/21-117--------------------------------------------------------------------------------
Q0VN47_ALCBS/9-105--------------------------------------------------------------------------------
Q8DJK1_THEEB/29-125--------------------------------------------------------------------------------
G0IXL6_CYCMS/8-106--------------------------------------------------------------------------------
E6WZ07_NITSE/8-101--------------------------------------------------------------------------------
W4YD31_STRPU/344-443--------------------------------------------------------------------------------
D7BBA8_MEISD/14-107--------------------------------------------------------------------------------
X2H7X0_9NEIS/15-110--------------------------------------------------------------------------------
G6D1G9_DANPL/107-206--------------------------------------------------------------------------------
Q2G298_STAA8/8-104--------------------------------------------------------------------------------
H8KN20_SOLCM/15-113--------------------------------------------------------------------------------
F6AEU5_PSEF1/13-109--------------------------------------------------------------------------------
A8Y3I6_CAEBR/59-161--------------------------------------------------------------------------------
L0KBB8_HALHC/16-107--------------------------------------------------------------------------------
F8E7X1_FLESM/8-104--------------------------------------------------------------------------------
Q3A1E2_PELCD/9-105--------------------------------------------------------------------------------
D5EEJ0_AMICL/14-107--------------------------------------------------------------------------------
K9XKK1_9CHRO/37-133--------------------------------------------------------------------------------
O51725_BORBU/11-108--------------------------------------------------------------------------------
B0SRU3_LEPBP/13-113--------------------------------------------------------------------------------
J7QF24_METSZ/35-131--------------------------------------------------------------------------------
R6BA50_9CLOT/8-104--------------------------------------------------------------------------------
D3SLN3_THEAH/7-102--------------------------------------------------------------------------------
Q2GLC3_ANAPZ/10-104--------------------------------------------------------------------------------
F2N7T7_CORGP/47-144--------------------------------------------------------------------------------
Q7VJ93_HELHP/11-105--------------------------------------------------------------------------------
A8LKJ3_DINSH/8-103--------------------------------------------------------------------------------
U5QDK7_9CYAN/13-109--------------------------------------------------------------------------------
R5CBV8_9BACE/9-107--------------------------------------------------------------------------------
U3K4T0_FICAL/9-108--------------------------------------------------------------------------------
D2VAH7_NAEGR/112-210--------------------------------------------------------------------------------
B3EK36_CHLPB/27-123--------------------------------------------------------------------------------
D8LM97_ECTSI/43-138--------------------------------------------------------------------------------
K9WGD2_9CYAN/28-124--------------------------------------------------------------------------------
F2NRK4_TRES6/11-108--------------------------------------------------------------------------------
G4Q705_ACIIR/8-105--------------------------------------------------------------------------------
C5BNN1_TERTT/7-103--------------------------------------------------------------------------------
J9Z794_LEPFM/48-141--------------------------------------------------------------------------------
R7KVA5_9FIRM/8-104--------------------------------------------------------------------------------
F2JQX0_CELLD/10-106--------------------------------------------------------------------------------
A3LQS7_PICST/33-171--------------------------------------------------------------------------------
R6GPR7_9CLOT/8-100--------------------------------------------------------------------------------
Q0ABM8_ALKEH/14-109--------------------------------------------------------------------------------
R7GK75_9CLOT/203-298--------------------------------------------------------------------------------
W0J190_9BACT/16-112--------------------------------------------------------------------------------
R7HV95_9CLOT/13-109--------------------------------------------------------------------------------
T2GFT8_DESGI/18-114--------------------------------------------------------------------------------
R6UIY6_9FIRM/6-102--------------------------------------------------------------------------------
K9RW58_SYNP3/23-119--------------------------------------------------------------------------------
R6VTB1_9FIRM/16-113--------------------------------------------------------------------------------
N0B789_9RHIZ/47-143--------------------------------------------------------------------------------
W0DX52_9GAMM/8-104--------------------------------------------------------------------------------
Q24SP4_DESHY/10-104--------------------------------------------------------------------------------
U6GU24_EIMAC/436-549--------------------------------------------------------------------------------
T0VFU6_9STRE/8-104--------------------------------------------------------------------------------
G8BC02_CANPC/81-218--------------------------------------------------------------------------------
A9KMF1_CLOPH/10-106--------------------------------------------------------------------------------
B8IY74_DESDA/31-127--------------------------------------------------------------------------------
F2I3K1_PELSM/11-107--------------------------------------------------------------------------------
R6S9M8_9FIRM/7-102--------------------------------------------------------------------------------
G8PDQ2_PEDCP/8-104--------------------------------------------------------------------------------
A0LCY9_MAGMM/19-115--------------------------------------------------------------------------------
R7XYP9_9ACTN/12-108--------------------------------------------------------------------------------
C6BY18_DESAD/18-114--------------------------------------------------------------------------------
A5WCA7_PSYWF/21-117--------------------------------------------------------------------------------
R6ZB75_9CLOT/9-105--------------------------------------------------------------------------------
X2GYY9_9BACI/7-103--------------------------------------------------------------------------------
A0A068X2K5_HYMMI/99-199--------------------------------------------------------------------------------
Q5M321_STRT2/8-104--------------------------------------------------------------------------------
K9W317_9CYAN/28-124--------------------------------------------------------------------------------
C9RAT7_AMMDK/8-104--------------------------------------------------------------------------------
Q31RX3_SYNE7/23-118--------------------------------------------------------------------------------
E2ABW0_CAMFO/117-216--------------------------------------------------------------------------------
B7ZSU4_XENTR/104-203--------------------------------------------------------------------------------
E6S731_INTC7/12-108--------------------------------------------------------------------------------
J9RNQ7_9ACTN/12-108--------------------------------------------------------------------------------
Q74ID2_LACJO/14-110--------------------------------------------------------------------------------
R5PG49_9CLOT/8-104--------------------------------------------------------------------------------
C3M9Y3_SINFN/41-137--------------------------------------------------------------------------------
K9RB59_9CYAN/38-135--------------------------------------------------------------------------------
Q4Y4A2_PLACH/249-351--------------------------------------------------------------------------------
R5SL59_9FIRM/6-102--------------------------------------------------------------------------------
A9NGN0_ACHLI/5-95--------------------------------------------------------------------------------
I3YSI4_AEQSU/13-111--------------------------------------------------------------------------------
R5VE54_9BACE/9-107--------------------------------------------------------------------------------
F7QH28_9BRAD/22-118--------------------------------------------------------------------------------
D3PE18_DEFDS/5-102--------------------------------------------------------------------------------
Q3J7T3_NITOC/8-104--------------------------------------------------------------------------------
R5K9K4_9CLOT/9-105--------------------------------------------------------------------------------
O67309_AQUAE/5-101--------------------------------------------------------------------------------
E2C2S6_HARSA/121-220--------------------------------------------------------------------------------
ATP25_LACTC/125-266--------------------------------------------------------------------------------
Q3ANY6_CHLCH/23-120--------------------------------------------------------------------------------
R7JTP2_9FIRM/9-105--------------------------------------------------------------------------------
D9R139_CLOSW/9-105--------------------------------------------------------------------------------
E3F1H1_KETVY/62-158--------------------------------------------------------------------------------
I2H8T5_TETBL/114-252--------------------------------------------------------------------------------
C4LJT9_CORK4/12-108--------------------------------------------------------------------------------
B7JXB1_CYAP8/32-128--------------------------------------------------------------------------------
B0RDF7_CLAMS/12-108--------------------------------------------------------------------------------
X5DNJ2_9CORY/13-108--------------------------------------------------------------------------------
B2IKW2_BEII9/21-117--------------------------------------------------------------------------------
Q9CJS0_PASMU/6-102--------------------------------------------------------------------------------
E2SB72_9ACTN/12-108--------------------------------------------------------------------------------
Q10VW4_TRIEI/29-126--------------------------------------------------------------------------------
A6WDM3_KINRD/18-114--------------------------------------------------------------------------------
I4A2C0_ORNRL/11-109--------------------------------------------------------------------------------
I2EQ24_EMTOG/14-112--------------------------------------------------------------------------------
S5XVR4_PARAH/2-98--------------------------------------------------------------------------------
E1SSX4_FERBD/9-104--------------------------------------------------------------------------------
D5AKK2_RHOCB/55-151--------------------------------------------------------------------------------
F0SS65_RUBBR/56-150--------------------------------------------------------------------------------
R5X7F3_9CLOT/8-104--------------------------------------------------------------------------------
E1R019_OLSUV/10-107--------------------------------------------------------------------------------
D5SVA3_PLAL2/30-124--------------------------------------------------------------------------------
R6GP78_9FIRM/10-106--------------------------------------------------------------------------------
R6XQE4_9FIRM/9-105--------------------------------------------------------------------------------
B7KCB2_CYAP7/31-128--------------------------------------------------------------------------------
B9E6Y1_MACCJ/11-107--------------------------------------------------------------------------------
R5GKV6_9FIRM/8-104--------------------------------------------------------------------------------
A0RQT7_CAMFF/6-99--------------------------------------------------------------------------------
A8F8G2_PSELT/2-95--------------------------------------------------------------------------------
Q9WXZ4_THEMA/6-102--------------------------------------------------------------------------------
R6QEW5_9FIRM/9-105--------------------------------------------------------------------------------
F8C4U4_THEGP/8-104--------------------------------------------------------------------------------
I4DAU1_DESAJ/9-106--------------------------------------------------------------------------------
F4EZF2_SELS3/10-107--------------------------------------------------------------------------------
R6EX51_9BACT/10-108--------------------------------------------------------------------------------
C7Q898_CATAD/13-108--------------------------------------------------------------------------------
Q31IE2_THICR/10-105--------------------------------------------------------------------------------
B0C3C4_ACAM1/29-124--------------------------------------------------------------------------------
R5GV36_9BACT/9-107--------------------------------------------------------------------------------
Q2RV08_RHORT/3-98--------------------------------------------------------------------------------
R5FJ79_9ACTN/20-115--------------------------------------------------------------------------------
F7V655_CLOSS/202-298--------------------------------------------------------------------------------
IOJAM_ARATH/49-148--------------------------------------------------------------------------------
E1R6B7_SPISS/8-103--------------------------------------------------------------------------------
D1AUY8_STRM9/6-98--------------------------------------------------------------------------------
W5W1D7_9PSEU/13-108--------------------------------------------------------------------------------
F2JXD4_MARM1/8-105--------------------------------------------------------------------------------
R5Q0E4_9PROT/67-162--------------------------------------------------------------------------------
A1BJS1_CHLPD/26-122--------------------------------------------------------------------------------
F9Z618_ODOSD/9-107--------------------------------------------------------------------------------
B5YGK3_THEYD/10-104--------------------------------------------------------------------------------
D6ZGB4_MOBCV/15-108--------------------------------------------------------------------------------
Q2SA29_HAHCH/8-104--------------------------------------------------------------------------------
C7R5L6_JONDD/13-108--------------------------------------------------------------------------------
R5YKL7_9FIRM/8-104--------------------------------------------------------------------------------
C1FH80_MICCC/4-102--------------------------------------------------------------------------------
ATP25_CANAL/82-221--------------------------------------------------------------------------------
R7F936_9CLOT/7-103--------------------------------------------------------------------------------
Q1H3S4_METFK/10-105--------------------------------------------------------------------------------
E4TS81_MARTH/27-125--------------------------------------------------------------------------------
C5X4I8_SORBI/118-211--------------------------------------------------------------------------------
B1XIK5_SYNP2/18-114--------------------------------------------------------------------------------
Q8RBA1_CALS4/10-105--------------------------------------------------------------------------------
Q87RQ3_VIBPA/9-104--------------------------------------------------------------------------------
E8R1R1_ISOPI/52-148--------------------------------------------------------------------------------
Q3AF31_CARHZ/10-106--------------------------------------------------------------------------------
A3I392_9BACT/8-106--------------------------------------------------------------------------------
Q7VC47_PROMA/8-105--------------------------------------------------------------------------------
R5HDA5_9FIRM/9-104--------------------------------------------------------------------------------
F2IFG0_FLUTR/25-123--------------------------------------------------------------------------------
Q8F6E4_LEPIN/16-115--------------------------------------------------------------------------------
C3YER5_BRAFL/19-118--------------------------------------------------------------------------------
E4WVJ5_OIKDI/92-192--------------------------------------------------------------------------------
R5IZX4_9FIRM/10-105--------------------------------------------------------------------------------
I6X5U0_PROPF/12-109--------------------------------------------------------------------------------
I0IB03_PHYMF/45-140--------------------------------------------------------------------------------
A1AV34_PELPD/21-115--------------------------------------------------------------------------------
B6ITL0_RHOCS/33-127--------------------------------------------------------------------------------
E8WVY3_GRATM/12-108--------------------------------------------------------------------------------
A4G2M3_HERAR/8-104--------------------------------------------------------------------------------
R5SG81_9BACE/7-105--------------------------------------------------------------------------------
V5WI46_9SPIO/20-117--------------------------------------------------------------------------------
D7GCX0_PROFC/12-108--------------------------------------------------------------------------------
D5EVB2_PRER2/6-104--------------------------------------------------------------------------------
F8ADL0_THEID/24-120--------------------------------------------------------------------------------
Q9CIX8_LACLA/8-105--------------------------------------------------------------------------------
Q4FV91_PSYA2/15-111--------------------------------------------------------------------------------
A7HJX7_FERNB/2-95--------------------------------------------------------------------------------
G8XAX0_FLACA/13-111--------------------------------------------------------------------------------
R5MJL8_9FIRM/8-103--------------------------------------------------------------------------------
Q3B6P4_CHLL7/26-122--------------------------------------------------------------------------------
A0CFH5_PARTE/123-260--------------------------------------------------------------------------------
D3SCP4_THISK/8-104--------------------------------------------------------------------------------
R6PRZ7_9FIRM/13-109--------------------------------------------------------------------------------
K9VMY5_9CYAN/30-127--------------------------------------------------------------------------------
D4KXG1_9FIRM/8-104--------------------------------------------------------------------------------
R5L7P0_9SPIR/27-124--------------------------------------------------------------------------------
ATP25_DEBHA/109-247--------------------------------------------------------------------------------
R5SKZ4_9CLOT/9-105--------------------------------------------------------------------------------
E1VB18_HALED/20-116--------------------------------------------------------------------------------
B2A6C1_NATTJ/9-106--------------------------------------------------------------------------------
I3TPX1_TISMK/24-120--------------------------------------------------------------------------------
A1WYZ2_HALHL/9-105--------------------------------------------------------------------------------
R7I4F9_9BURK/8-104--------------------------------------------------------------------------------
Q6LN95_PHOPR/8-104--------------------------------------------------------------------------------
C8WQ80_ALIAD/10-106--------------------------------------------------------------------------------
R7N5Q1_9FIRM/15-110--------------------------------------------------------------------------------
R6LSF0_9CLOT/9-105--------------------------------------------------------------------------------
I1ITD6_BRADI/41-146--------------------------------------------------------------------------------
D1AZJ0_SULD5/185-278--------------------------------------------------------------------------------
M0TAY3_MUSAM/51-152--------------------------------------------------------------------------------
D8PC97_9BACT/12-107--------------------------------------------------------------------------------
A6TQK2_ALKMQ/10-106--------------------------------------------------------------------------------
I3MWU9_ICTTR/40-139--------------------------------------------------------------------------------
A4SWG8_POLSQ/8-104--------------------------------------------------------------------------------
Q7MS87_WOLSU/155-248--------------------------------------------------------------------------------
D7CP02_SYNLT/8-104--------------------------------------------------------------------------------
R6ERE3_9FIRM/11-104--------------------------------------------------------------------------------
C6XL35_HIRBI/12-108--------------------------------------------------------------------------------
I1BWL4_RHIO9/123-222--------------------------------------------------------------------------------
G1X0K2_ARTOA/334-462--------------------------------------------------------------------------------
K9SQI6_9SYNE/18-112--------------------------------------------------------------------------------
B2KD55_ELUMP/10-104--------------------------------------------------------------------------------
I0AM81_IGNAJ/8-104--------------------------------------------------------------------------------
ATP25_VANPO/109-251--------------------------------------------------------------------------------
M1C016_SOLTU/116-211--------------------------------------------------------------------------------
R5QB53_9BURK/8-104--------------------------------------------------------------------------------
L0ES52_LIBCB/10-105--------------------------------------------------------------------------------
Q1QQT5_NITHX/14-110--------------------------------------------------------------------------------
B1VGL5_CORU7/24-120--------------------------------------------------------------------------------
R7MR88_9FIRM/8-104--------------------------------------------------------------------------------
ATP25_CANGA/122-262--------------------------------------------------------------------------------
R7NQG0_9FIRM/8-104--------------------------------------------------------------------------------
R7K4Z6_9CLOT/10-105--------------------------------------------------------------------------------
G8UKS2_TANFA/9-107--------------------------------------------------------------------------------
B8ENA7_METSB/40-135--------------------------------------------------------------------------------
F6GD04_LACS5/13-111--------------------------------------------------------------------------------
R6HRJ9_9PROT/15-110--------------------------------------------------------------------------------
D1BA22_THEAS/33-122--------------------------------------------------------------------------------
C7PFY2_CHIPD/25-123--------------------------------------------------------------------------------
Q0BRE4_GRABC/97-192--------------------------------------------------------------------------------
R5IBC6_9PORP/9-107--------------------------------------------------------------------------------
H2AMA4_KAZAF/78-205--------------------------------------------------------------------------------
A7IH11_XANP2/41-137--------------------------------------------------------------------------------
H6LK21_ACEWD/11-107--------------------------------------------------------------------------------
E4T8D0_PALPW/9-107--------------------------------------------------------------------------------
D9S2B0_THEOJ/12-106--------------------------------------------------------------------------------
R6PP02_9FIRM/8-104--------------------------------------------------------------------------------
R6UG98_9CLOT/8-104--------------------------------------------------------------------------------
V5SFF4_9RHIZ/29-125--------------------------------------------------------------------------------
D7B3J7_NOCDD/12-109--------------------------------------------------------------------------------
F6IFE3_9SPHN/10-106--------------------------------------------------------------------------------
R5EVV3_9FIRM/10-105--------------------------------------------------------------------------------
K9YL55_CYASC/31-127--------------------------------------------------------------------------------
H3GI95_PHYRM/159-258--------------------------------------------------------------------------------
F7BHS5_ORNAN/46-145--------------------------------------------------------------------------------
C1A7N4_GEMAT/16-110--------------------------------------------------------------------------------
F4NTG8_BATDJ/276-378--------------------------------------------------------------------------------
F8KZF8_PARAV/10-105--------------------------------------------------------------------------------
D0MDZ8_RHOM4/26-123--------------------------------------------------------------------------------
D9QV64_ACEAZ/9-106--------------------------------------------------------------------------------
ATP25_SCHPO/93-216--------------------------------------------------------------------------------
E6X7D5_CELAD/13-111--------------------------------------------------------------------------------
A8EWM1_ARCB4/6-99--------------------------------------------------------------------------------
W0EUD9_9PORP/8-106--------------------------------------------------------------------------------
Q9HX22_PSEAE/8-104--------------------------------------------------------------------------------
B3E3Q9_GEOLS/19-113--------------------------------------------------------------------------------
C1F5X5_ACIC5/12-108--------------------------------------------------------------------------------
F0JEE6_DESDE/18-114--------------------------------------------------------------------------------
K0B0C3_CLOA9/6-102--------------------------------------------------------------------------------
D3FXJ1_BACPE/8-104--------------------------------------------------------------------------------
F2J6T6_POLGS/21-117--------------------------------------------------------------------------------
R7ESF0_9FIRM/20-117--------------------------------------------------------------------------------
B9KGM7_ANAMF/15-109--------------------------------------------------------------------------------
R5E2B8_9FIRM/11-107--------------------------------------------------------------------------------
Q98EZ9_RHILO/18-114--------------------------------------------------------------------------------
G8PNV7_PSEUV/27-123--------------------------------------------------------------------------------
R5CEC3_9FIRM/12-108--------------------------------------------------------------------------------
N0B340_9BACI/8-104--------------------------------------------------------------------------------
E8SIE5_STAPH/9-104--------------------------------------------------------------------------------
D8LLX7_ECTSI/95-196--------------------------------------------------------------------------------
R6R4Z7_9CLOT/8-104--------------------------------------------------------------------------------
Q2YC52_NITMU/8-104--------------------------------------------------------------------------------
Q2IMF9_ANADE/3-97--------------------------------------------------------------------------------
R7G449_9PROT/8-104--------------------------------------------------------------------------------
F4LVY7_TEPAE/11-106--------------------------------------------------------------------------------
A6L1N1_BACV8/9-107--------------------------------------------------------------------------------
R5RZ49_9FIRM/10-105--------------------------------------------------------------------------------
R7C9H6_9CLOT/10-106--------------------------------------------------------------------------------
Q5WHH8_BACSK/6-102--------------------------------------------------------------------------------
Q6AJX9_DESPS/18-114--------------------------------------------------------------------------------
I4AHE2_FLELS/14-112--------------------------------------------------------------------------------
R7BM01_9FIRM/8-104--------------------------------------------------------------------------------
L0G1E7_ECHVK/8-106--------------------------------------------------------------------------------
W5KWU5_ASTMX/92-191--------------------------------------------------------------------------------
I7F098_PHAIB/14-110--------------------------------------------------------------------------------
I0JP65_HALH3/8-104--------------------------------------------------------------------------------
W1PUX9_AMBTC/52-153--------------------------------------------------------------------------------
R7AP40_9CLOT/8-104--------------------------------------------------------------------------------
D3F9N1_CONWI/13-110--------------------------------------------------------------------------------
Q46LB2_PROMT/8-105--------------------------------------------------------------------------------
R6PCX2_9CLOT/9-105--------------------------------------------------------------------------------
ATP25_KLULA/73-205--------------------------------------------------------------------------------
G8LV07_CLOCD/8-104--------------------------------------------------------------------------------
C8WAH7_ATOPD/10-107--------------------------------------------------------------------------------
R6XRX2_9FIRM/7-99--------------------------------------------------------------------------------
B8FMU2_DESAA/13-106--------------------------------------------------------------------------------
R6VXF1_9BACT/3-101--------------------------------------------------------------------------------
E1QJM4_DESB2/22-118--------------------------------------------------------------------------------
A5UYA6_ROSS1/19-115--------------------------------------------------------------------------------
E3MG32_CAERE/60-163--------------------------------------------------------------------------------
R7FMH5_9CLOT/6-100--------------------------------------------------------------------------------
H2J515_MARPK/14-110--------------------------------------------------------------------------------
E6SKC0_THEM7/9-104--------------------------------------------------------------------------------
B3PKN0_CELJU/18-114--------------------------------------------------------------------------------
A4S573_OSTLU/206-310--------------------------------------------------------------------------------
C6W7P7_DYAFD/16-114--------------------------------------------------------------------------------
R6I0A5_9FIRM/9-105--------------------------------------------------------------------------------
Q03VE9_LEUMM/13-109--------------------------------------------------------------------------------
Q310U3_DESAG/19-115--------------------------------------------------------------------------------
R6W6Y8_9BACT/9-107--------------------------------------------------------------------------------
Q30PQ1_SULDN/6-98--------------------------------------------------------------------------------
R5CLL0_9BACT/9-107--------------------------------------------------------------------------------
F0NZC4_WEEVC/12-110--------------------------------------------------------------------------------
K9S5F4_9CYAN/37-134--------------------------------------------------------------------------------
C9R6R0_AGGAD/5-101--------------------------------------------------------------------------------
R5HU75_9FIRM/12-108--------------------------------------------------------------------------------
R5Q081_9FIRM/19-115--------------------------------------------------------------------------------
R5FP90_9FIRM/5-101--------------------------------------------------------------------------------
A3DEU1_CLOTH/8-104--------------------------------------------------------------------------------
Q1G9B8_LACDA/8-104--------------------------------------------------------------------------------
A4VR05_PSEU5/8-104--------------------------------------------------------------------------------
H8MPB9_CORCM/74-172--------------------------------------------------------------------------------
Q0AKW8_MARMM/39-134--------------------------------------------------------------------------------
F0S0T6_DESTD/8-104--------------------------------------------------------------------------------
O25960_HELPY/6-100--------------------------------------------------------------------------------
M9R1R3_9RHOB/46-142--------------------------------------------------------------------------------
F5YJG7_TREPZ/15-111--------------------------------------------------------------------------------
R6DEK3_9CLOT/9-105--------------------------------------------------------------------------------
Q65H38_BACLD/8-104--------------------------------------------------------------------------------
R7FAW8_9FIRM/8-105--------------------------------------------------------------------------------
F3Z458_DESAF/57-153--------------------------------------------------------------------------------
D3PVY5_STANL/13-109--------------------------------------------------------------------------------
I2F216_9BACT/14-110--------------------------------------------------------------------------------
Q2RKZ2_MOOTA/8-104--------------------------------------------------------------------------------
S5RPA2_9PROT/9-104--------------------------------------------------------------------------------
R5PUQ2_9BACT/9-107--------------------------------------------------------------------------------
H1YG85_9SPHI/15-113--------------------------------------------------------------------------------
R6G428_9FIRM/10-105--------------------------------------------------------------------------------
D7BPC9_ARCHD/13-109--------------------------------------------------------------------------------
K9P3M8_CYAGP/9-105--------------------------------------------------------------------------------
B0JP67_MICAN/22-119--------------------------------------------------------------------------------
Q03RL2_LACBA/8-104--------------------------------------------------------------------------------
H0UKA1_9BACT/11-106--------------------------------------------------------------------------------
K4LK74_THEPS/10-105--------------------------------------------------------------------------------
D6ZEV6_SEGRD/12-108--------------------------------------------------------------------------------
K9Z2B7_CYAAP/30-126--------------------------------------------------------------------------------
D4KFF0_9FIRM/10-106--------------------------------------------------------------------------------
R6C1U9_9CLOT/11-107--------------------------------------------------------------------------------
E9FU74_DAPPU/58-157--------------------------------------------------------------------------------
C7MN28_CRYCD/14-110--------------------------------------------------------------------------------
M5E773_9GAMM/8-104--------------------------------------------------------------------------------
F6ZF75_MONDO/81-180--------------------------------------------------------------------------------
R5K116_9CLOT/8-104--------------------------------------------------------------------------------
O84774_CHLTR/10-106--------------------------------------------------------------------------------
D2PUU4_KRIFD/12-109--------------------------------------------------------------------------------
R5B5K2_9FIRM/9-105--------------------------------------------------------------------------------
D6YRN1_WADCW/10-106--------------------------------------------------------------------------------
K0J7A3_AMPXN/8-104--------------------------------------------------------------------------------
Q0P8K9_CAMJE/6-99--------------------------------------------------------------------------------
R5DCD6_9FIRM/9-105--------------------------------------------------------------------------------
R7CNP0_9FIRM/6-102--------------------------------------------------------------------------------
D1AAX1_THECD/12-109--------------------------------------------------------------------------------
B7Q172_IXOSC/85-184--------------------------------------------------------------------------------
B8C8G7_THAPS/1-100--------------------------------------------------------------------------------
A5EVS4_DICNV/8-104--------------------------------------------------------------------------------
Q7CW98_AGRFC/55-151--------------------------------------------------------------------------------
A7MK38_CROS8/88-183--------------------------------------------------------------------------------
F4CD17_SPHS2/15-113--------------------------------------------------------------------------------
J9R497_RIEAN/12-110--------------------------------------------------------------------------------
K9UMC3_9CYAN/24-120--------------------------------------------------------------------------------
Q7V1P0_PROMP/9-105--------------------------------------------------------------------------------
R5ALT6_9BACT/11-109--------------------------------------------------------------------------------
R5QK94_9FIRM/9-105--------------------------------------------------------------------------------
Q38VU1_LACSS/8-104--------------------------------------------------------------------------------
H9UK90_SPIAZ/16-113--------------------------------------------------------------------------------
G2TNI2_BACCO/8-104--------------------------------------------------------------------------------
Q6MBT6_PARUW/10-106--------------------------------------------------------------------------------
R6A7V5_9CLOT/34-124--------------------------------------------------------------------------------
L0DJT1_SINAD/58-154--------------------------------------------------------------------------------
B2FPR3_STRMK/26-122--------------------------------------------------------------------------------
A7HT63_PARL1/61-157--------------------------------------------------------------------------------
F9VG82_LACGL/8-105--------------------------------------------------------------------------------
Q2YLI9_BRUA2/7-102--------------------------------------------------------------------------------
B0VG47_CLOAI/9-104--------------------------------------------------------------------------------
C6XXK3_PEDHD/15-113--------------------------------------------------------------------------------
D9SD71_GALCS/10-105--------------------------------------------------------------------------------
B0UVQ4_HISS2/5-101--------------------------------------------------------------------------------
Q8XXC1_RALSO/8-104--------------------------------------------------------------------------------
U5N9D4_9BURK/23-119--------------------------------------------------------------------------------
B2GGE5_KOCRD/13-109--------------------------------------------------------------------------------
R5B495_9CLOT/22-117--------------------------------------------------------------------------------
B1YKR7_EXIS2/8-104--------------------------------------------------------------------------------
R6Z4U4_9FIRM/8-104--------------------------------------------------------------------------------
R7FU76_9FIRM/9-105--------------------------------------------------------------------------------
Q2RZI5_SALRD/27-124--------------------------------------------------------------------------------
G2J1W2_PSEUL/8-104--------------------------------------------------------------------------------
B7J9S2_ACIF2/10-105--------------------------------------------------------------------------------
R5WGL8_9BACT/6-104--------------------------------------------------------------------------------
G2IMP8_9SPHN/35-130--------------------------------------------------------------------------------
Q087K6_SHEFN/8-104--------------------------------------------------------------------------------
IOJAP_SYNY3/32-129--------------------------------------------------------------------------------
M4AHS6_XIPMA/111-210--------------------------------------------------------------------------------
G8ZLS5_TORDC/62-203--------------------------------------------------------------------------------
Q6F840_ACIAD/13-109--------------------------------------------------------------------------------
A4HIE4_LEIBR/27-122--------------------------------------------------------------------------------
C9RLC6_FIBSS/18-111--------------------------------------------------------------------------------
F5Y7D3_TREAZ/5-100--------------------------------------------------------------------------------
A9ITN4_BORPD/8-104--------------------------------------------------------------------------------
R7LCG4_9BACT/75-171--------------------------------------------------------------------------------
B9KZU5_THERP/16-113--------------------------------------------------------------------------------
R6BS45_9BACT/9-107--------------------------------------------------------------------------------
Q22U76_TETTS/206-310--------------------------------------------------------------------------------
Q7V7C5_PROMM/12-109--------------------------------------------------------------------------------
A6LD24_PARD8/9-107--------------------------------------------------------------------------------
V4JHI0_9GAMM/9-105--------------------------------------------------------------------------------
R9YKS2_9PROT/5-99--------------------------------------------------------------------------------
B0TBV4_HELMI/10-106--------------------------------------------------------------------------------
R7PRI7_9FIRM/6-102--------------------------------------------------------------------------------
R6TPV4_9STAP/7-99--------------------------------------------------------------------------------
R5AYU7_9BACE/9-107--------------------------------------------------------------------------------
C5CEP8_KOSOT/6-102--------------------------------------------------------------------------------
G4UJS9_NEUT9/132-292--------------------------------------------------------------------------------
G0N093_CAEBE/60-162--------------------------------------------------------------------------------
A4J7H3_DESRM/10-106--------------------------------------------------------------------------------
G8QZC8_OWEHD/15-113--------------------------------------------------------------------------------
E8UCD5_TAYEM/8-104--------------------------------------------------------------------------------
R7BSA0_9FIRM/8-104--------------------------------------------------------------------------------
R7QW75_9FIRM/9-105--------------------------------------------------------------------------------
B1WTU4_CYAA5/32-128--------------------------------------------------------------------------------
F0QZ30_BACSH/9-107--------------------------------------------------------------------------------
R5VK80_9CLOT/10-106--------------------------------------------------------------------------------
I7HEH2_9HELI/17-111--------------------------------------------------------------------------------
A1A1R8_BIFAA/12-110--------------------------------------------------------------------------------
ATP25_ASHGO/88-221--------------------------------------------------------------------------------
F4KXS4_HALH1/20-117--------------------------------------------------------------------------------
A5D414_PELTS/10-106--------------------------------------------------------------------------------
R6NC63_9CLOT/8-104--------------------------------------------------------------------------------
Q83DY7_COXBU/8-104--------------------------------------------------------------------------------
W0BD95_9GAMM/9-105--------------------------------------------------------------------------------
Q6MGS6_BDEBA/227-324--------------------------------------------------------------------------------
D3E4X0_GEOS4/10-106--------------------------------------------------------------------------------
A6VM71_ACTSZ/7-103--------------------------------------------------------------------------------
R7A8R3_9FIRM/5-102--------------------------------------------------------------------------------
F8L9P7_SIMNZ/11-106--------------------------------------------------------------------------------
I4B2F1_TURPD/18-115--------------------------------------------------------------------------------
C7N5Z8_SLAHD/15-111--------------------------------------------------------------------------------
C5C3Y0_BEUC1/13-108--------------------------------------------------------------------------------
C7LNN2_DESBD/6-102--------------------------------------------------------------------------------
R4LD67_9ACTN/13-110--------------------------------------------------------------------------------
C7MDI1_BRAFD/13-109--------------------------------------------------------------------------------
R6ZYM4_9FIRM/13-107--------------------------------------------------------------------------------
R4FM08_RHOPR/97-195--------------------------------------------------------------------------------
G0HCC1_CORVD/13-109--------------------------------------------------------------------------------
Q1IVS3_KORVE/11-108--------------------------------------------------------------------------------
W5XR92_9CORY/12-108--------------------------------------------------------------------------------
C4LCB5_TOLAT/8-104--------------------------------------------------------------------------------
I0GK03_CALEA/17-113--------------------------------------------------------------------------------
R6SD79_9CLOT/3-99--------------------------------------------------------------------------------
E7AAH6_HELFC/7-101--------------------------------------------------------------------------------
C8X2A5_DESRD/21-115--------------------------------------------------------------------------------
Q5ZVR3_LEGPH/9-105--------------------------------------------------------------------------------
F4LQI7_TREBD/10-107--------------------------------------------------------------------------------
D4J3C3_BUTFI/8-104--------------------------------------------------------------------------------
K9TF10_9CYAN/32-128--------------------------------------------------------------------------------
Q3SG63_THIDA/8-104--------------------------------------------------------------------------------
R7IGE6_9FIRM/8-104--------------------------------------------------------------------------------
Q82C74_STRAW/12-109--------------------------------------------------------------------------------
K9XVN0_STAC7/31-127--------------------------------------------------------------------------------
K4J0M5_BIFAP/12-109--------------------------------------------------------------------------------
D3DJ79_HYDTT/6-102--------------------------------------------------------------------------------
R7KD51_9FIRM/8-105--------------------------------------------------------------------------------
A1R781_ARTAT/12-108--------------------------------------------------------------------------------
R7B0J5_9BACE/11-107--------------------------------------------------------------------------------
F4A061_MAHA5/12-106--------------------------------------------------------------------------------
G4VJP1_SCHMA/94-193--------------------------------------------------------------------------------
R5QVM6_9FIRM/5-101--------------------------------------------------------------------------------
Q65RG9_MANSM/5-101--------------------------------------------------------------------------------
W5WX18_9CORY/12-108--------------------------------------------------------------------------------
Q5NFW4_FRATT/8-104--------------------------------------------------------------------------------
Q0AWK2_SYNWW/9-105--------------------------------------------------------------------------------
Q54B26_DICDI/464-559--------------------------------------------------------------------------------
B0WVG4_CULQU/121-219--------------------------------------------------------------------------------
R5NV97_9BACT/9-107--------------------------------------------------------------------------------
Q1GDM8_RUEST/15-111--------------------------------------------------------------------------------
D2QKI7_SPILD/17-114--------------------------------------------------------------------------------
B8F687_HAEPS/7-103--------------------------------------------------------------------------------
D8QQ28_SELML/79-179--------------------------------------------------------------------------------
Q9PBG4_XYLFA/35-131--------------------------------------------------------------------------------
D8UJ79_VOLCA/508-659--------------------------------------------------------------------------------
X5HL15_9RICK/7-99--------------------------------------------------------------------------------
I3ZBA9_TERRK/11-108--------------------------------------------------------------------------------
C8XF22_NAKMY/12-108--------------------------------------------------------------------------------
E4RQ84_LEAB4/12-110--------------------------------------------------------------------------------
U9U9V9_RHIID/51-151--------------------------------------------------------------------------------
R6XJJ4_9BACT/7-104--------------------------------------------------------------------------------
F4B2T6_DOKS4/13-111--------------------------------------------------------------------------------
R4KQ58_9FIRM/11-107--------------------------------------------------------------------------------
Q0SH66_RHOJR/12-108--------------------------------------------------------------------------------
R5QJ41_9FIRM/12-107--------------------------------------------------------------------------------
W8KVW8_HALHR/8-104--------------------------------------------------------------------------------
E6VZ32_DESAO/19-113--------------------------------------------------------------------------------
K6YTN0_9ALTE/9-104--------------------------------------------------------------------------------
W8UBA1_YEREN/8-104--------------------------------------------------------------------------------
R6AXF5_9BACT/9-107--------------------------------------------------------------------------------
I0IKW0_LEPFC/44-136--------------------------------------------------------------------------------
R5FVB9_9FIRM/8-104--------------------------------------------------------------------------------
D6S4W0_9LACO/8-104--------------------------------------------------------------------------------
R5U623_9FIRM/9-105--------------------------------------------------------------------------------
F8GJZ3_NITSI/8-104--------------------------------------------------------------------------------
A4XKG8_CALS8/6-98--------------------------------------------------------------------------------
R7G8T5_9FIRM/5-101--------------------------------------------------------------------------------
F4GWP5_PUSST/8-104--------------------------------------------------------------------------------
R6QDZ5_9CLOT/11-108--------------------------------------------------------------------------------
R5ELM4_9CLOT/8-104--------------------------------------------------------------------------------
G7VA32_THELD/10-105--------------------------------------------------------------------------------
E3DMY5_HALPG/12-107--------------------------------------------------------------------------------
A8MHK3_ALKOO/10-106--------------------------------------------------------------------------------
D5V5P9_ARCNC/5-98--------------------------------------------------------------------------------
R5YMX1_9FIRM/8-104--------------------------------------------------------------------------------
R7HM20_9BACT/8-106--------------------------------------------------------------------------------
G8QXT8_SPHPG/10-107--------------------------------------------------------------------------------
V5XFV4_MYCNE/12-108--------------------------------------------------------------------------------
D2NSW1_ROTMD/33-130--------------------------------------------------------------------------------
V8NPE7_OPHHA/602-701--------------------------------------------------------------------------------
C1MLU7_MICPC/83-177--------------------------------------------------------------------------------
M1P9Z1_DESSD/18-114--------------------------------------------------------------------------------
Q9A2X4_CAUCR/7-102--------------------------------------------------------------------------------
B8HKL6_CYAP4/30-126--------------------------------------------------------------------------------
R5VBQ6_9FIRM/7-103--------------------------------------------------------------------------------
ATP25_CLAL4/96-228--------------------------------------------------------------------------------
F8I0U6_WEIKK/11-107--------------------------------------------------------------------------------
C4KCZ9_THASP/8-104--------------------------------------------------------------------------------
ATP25_PICGU/88-224--------------------------------------------------------------------------------
D4LCT4_RUMC1/8-104--------------------------------------------------------------------------------
A8L0S1_FRASN/13-108--------------------------------------------------------------------------------
D4IQ57_9BACT/6-104--------------------------------------------------------------------------------
R7K5C7_9FIRM/10-106--------------------------------------------------------------------------------
B1I5R8_DESAP/10-106--------------------------------------------------------------------------------
E9J4J3_SOLIN/121-220--------------------------------------------------------------------------------
R7P8V8_9BACT/9-107--------------------------------------------------------------------------------
R7GL65_9FIRM/5-101--------------------------------------------------------------------------------
F2I5U3_AERUA/11-107--------------------------------------------------------------------------------
I3VX60_THESW/11-106--------------------------------------------------------------------------------
F0ZWV5_DICPU/383-477--------------------------------------------------------------------------------
J7R6P1_KAZNA/88-227--------------------------------------------------------------------------------
B2UMY0_AKKM8/11-108--------------------------------------------------------------------------------
R6XNW3_9FIRM/6-102--------------------------------------------------------------------------------
I5AQV5_EUBCE/9-105--------------------------------------------------------------------------------
IOJAP_TREPA/8-104--------------------------------------------------------------------------------
I3Z0Q1_BELBD/8-106--------------------------------------------------------------------------------
R7FYP6_9FIRM/22-118--------------------------------------------------------------------------------
ATP25_CANTT/82-221--------------------------------------------------------------------------------
K9T830_9CYAN/33-130--------------------------------------------------------------------------------
G4RH05_PELHB/25-121--------------------------------------------------------------------------------
F7XVP2_MIDMI/9-104--------------------------------------------------------------------------------
Q2LSS9_SYNAS/2-96--------------------------------------------------------------------------------
Q182L0_PEPD6/8-104--------------------------------------------------------------------------------
X4Z9U4_9BACL/10-106--------------------------------------------------------------------------------
I6YYA6_MELRP/8-104--------------------------------------------------------------------------------
K4BYI4_SOLLC/54-155--------------------------------------------------------------------------------
F2UAC2_SALR5/139-239--------------------------------------------------------------------------------
R5FER8_9BACT/9-107--------------------------------------------------------------------------------
J9YZQ7_9PROT/15-111--------------------------------------------------------------------------------
I4BW42_ANAMD/16-108--------------------------------------------------------------------------------
D5V9T6_MORCB/11-107--------------------------------------------------------------------------------
Q03GA3_PEDPA/8-104--------------------------------------------------------------------------------
D5EJ39_CORAD/18-113--------------------------------------------------------------------------------
G4KSV6_OSCVS/9-104--------------------------------------------------------------------------------
Q818D4_BACCR/9-104--------------------------------------------------------------------------------
R6FXQ7_9FIRM/8-104--------------------------------------------------------------------------------
U1NRB0_ASCSU/227-325--------------------------------------------------------------------------------
Q484R0_COLP3/9-104--------------------------------------------------------------------------------
M5A2E2_9ACTN/14-110--------------------------------------------------------------------------------
L7VK85_9FLAO/10-105--------------------------------------------------------------------------------
F2NNL5_MARHT/12-107--------------------------------------------------------------------------------
E1Z8J3_CHLVA/4-97--------------------------------------------------------------------------------
G0WF35_NAUDC/65-189--------------------------------------------------------------------------------
R5KVH1_9FIRM/8-104--------------------------------------------------------------------------------
A9WUT6_RENSM/16-112--------------------------------------------------------------------------------
I1YT23_PREI7/9-107--------------------------------------------------------------------------------
R7JD55_9FUSO/13-109--------------------------------------------------------------------------------
G9WG40_9LACT/8-104--------------------------------------------------------------------------------
C7NH29_KYTSD/12-108--------------------------------------------------------------------------------
R6CH16_9FIRM/8-104--------------------------------------------------------------------------------
C6X352_FLAB3/12-110--------------------------------------------------------------------------------
A4RXN6_OSTLU/16-109--------------------------------------------------------------------------------
C7RHK0_ANAPD/5-100--------------------------------------------------------------------------------
V9TWB7_9PROT/2-96--------------------------------------------------------------------------------
B9DTM8_STRU0/8-104--------------------------------------------------------------------------------
Q6AFX5_LEIXX/14-108--------------------------------------------------------------------------------
R6QUB8_9FIRM/8-104--------------------------------------------------------------------------------
B5YNF2_THAPS/450-581--------------------------------------------------------------------------------
D3AY29_POLPA/476-574--------------------------------------------------------------------------------
I4WTH1_9GAMM/17-113--------------------------------------------------------------------------------
F5WTA4_ERYRF/6-102--------------------------------------------------------------------------------
Q1MPK9_LAWIP/52-145--------------------------------------------------------------------------------
Q5LX03_RUEPO/22-118--------------------------------------------------------------------------------
A9TEA2_PHYPA/63-157--------------------------------------------------------------------------------
D3ICT2_9BACT/9-107--------------------------------------------------------------------------------
R6I9I1_9FIRM/8-103--------------------------------------------------------------------------------
C3PHZ3_CORA7/12-108--------------------------------------------------------------------------------
D3HSE6_LEGLN/9-105--------------------------------------------------------------------------------
E6UF33_RUMA7/11-107--------------------------------------------------------------------------------
R6WPM6_9CLOT/8-105--------------------------------------------------------------------------------
K3X3T5_PYTUL/107-206--------------------------------------------------------------------------------
D8K1D9_DEHLB/11-108--------------------------------------------------------------------------------
R7DMR6_9FIRM/7-103--------------------------------------------------------------------------------
E1VWM4_GLUAR/12-109--------------------------------------------------------------------------------
D5MJ59_9BACT/30-126--------------------------------------------------------------------------------
C5ZXG7_9HELI/10-104--------------------------------------------------------------------------------
B3DVR4_METI4/4-101--------------------------------------------------------------------------------
K0C587_CYCSP/7-103--------------------------------------------------------------------------------
H1ZA70_MYROD/13-111--------------------------------------------------------------------------------
C7JCS4_ACEP3/42-138--------------------------------------------------------------------------------
Q1GVM4_SPHAL/25-120--------------------------------------------------------------------------------
R5IE32_9BACT/5-103--------------------------------------------------------------------------------
G0S6Z3_CHATD/120-279--------------------------------------------------------------------------------
B4KZ09_DROMO/104-203--------------------------------------------------------------------------------
F3ZSP8_9BACE/11-109--------------------------------------------------------------------------------
B3QSE4_CHLT3/45-141--------------------------------------------------------------------------------
R5C106_9FIRM/15-109--------------------------------------------------------------------------------
R6T077_9CLOT/36-132--------------------------------------------------------------------------------
R6NVN6_9FIRM/10-106--------------------------------------------------------------------------------
H8GJL3_METAL/8-104--------------------------------------------------------------------------------
W8T6F3_EUBAC/10-106--------------------------------------------------------------------------------
Q82XC6_NITEU/9-105--------------------------------------------------------------------------------
A1S8T2_SHEAM/8-104--------------------------------------------------------------------------------
B4EV09_PROMH/8-104--------------------------------------------------------------------------------
M1E8G8_9FIRM/12-107--------------------------------------------------------------------------------
A0KN92_AERHH/9-104--------------------------------------------------------------------------------
A8ZRY5_DESOH/13-106--------------------------------------------------------------------------------
I6S4I9_ENTHA/2-94--------------------------------------------------------------------------------
F4WK15_ACREC/124-223--------------------------------------------------------------------------------
B8CXR9_HALOH/15-110--------------------------------------------------------------------------------
D0L1I9_HALNC/40-138--------------------------------------------------------------------------------
V6F0E1_9PROT/8-103--------------------------------------------------------------------------------
D4MZP3_ANAHA/9-105--------------------------------------------------------------------------------
W8RZP4_9RHOB/25-121--------------------------------------------------------------------------------
R6NDQ1_9FIRM/8-104--------------------------------------------------------------------------------
B9L8C0_NAUPA/5-98--------------------------------------------------------------------------------
F7YU42_9THEM/9-105--------------------------------------------------------------------------------
B8GV08_THISH/8-104--------------------------------------------------------------------------------
E7F2E7_DANRE/83-181--------------------------------------------------------------------------------
A9T8N1_PHYPA/162-263--------------------------------------------------------------------------------
G3AI15_SPAPN/101-235--------------------------------------------------------------------------------
X4QTP2_9ACTO/14-109--------------------------------------------------------------------------------
C8W5N8_DESAS/10-106--------------------------------------------------------------------------------
D0LK39_HALO1/35-131--------------------------------------------------------------------------------
R6DLX5_9FIRM/12-104--------------------------------------------------------------------------------
S0ET20_CHTCT/14-110--------------------------------------------------------------------------------
Q5FIX7_LACAC/8-104--------------------------------------------------------------------------------
ATP25_PHANO/99-265--------------------------------------------------------------------------------
Q038B3_LACC3/9-105--------------------------------------------------------------------------------
R6NHF7_9CLOT/9-105--------------------------------------------------------------------------------
R5YA62_9BACE/9-107--------------------------------------------------------------------------------
R6M0U4_9FIRM/9-105--------------------------------------------------------------------------------
Q9KTF0_VIBCH/10-104--------------------------------------------------------------------------------
D5XBC0_THEPJ/11-106--------------------------------------------------------------------------------
ATP25_KOMPG/78-215--------------------------------------------------------------------------------
G3B8J3_CANTC/85-222--------------------------------------------------------------------------------
I0GTD8_SELRL/8-104--------------------------------------------------------------------------------
F6DLB0_DESRL/10-106--------------------------------------------------------------------------------
R7BVC4_9BURK/20-116--------------------------------------------------------------------------------
Q2GHB7_EHRCR/18-112--------------------------------------------------------------------------------
R7J059_9BACT/9-107--------------------------------------------------------------------------------
IOJAP_HAEIN/5-101--------------------------------------------------------------------------------
Q67SC2_SYMTH/5-99--------------------------------------------------------------------------------
R5ECA2_9BURK/8-104--------------------------------------------------------------------------------
R7MJL0_9CLOT/12-108--------------------------------------------------------------------------------
H3AY78_LATCH/158-257--------------------------------------------------------------------------------
G3VZZ7_SARHA/11-110--------------------------------------------------------------------------------
Q08NZ3_STIAD/68-165--------------------------------------------------------------------------------
R6ETJ2_9FIRM/10-106--------------------------------------------------------------------------------
Q1DCX4_MYXXD/14-112--------------------------------------------------------------------------------
D1AKP5_SEBTE/6-98--------------------------------------------------------------------------------
M1WNH7_DESPC/18-113--------------------------------------------------------------------------------
F6FPQ7_ISOV2/13-108--------------------------------------------------------------------------------
F2LXZ8_HIPMA/3-95--------------------------------------------------------------------------------
Q8KG28_CHLTE/44-140--------------------------------------------------------------------------------
A2U334_9FLAO/13-111--------------------------------------------------------------------------------
L0DYT0_THIND/8-104--------------------------------------------------------------------------------
Q87VV8_PSESM/8-104--------------------------------------------------------------------------------
A5GSM6_SYNR3/8-104--------------------------------------------------------------------------------
R6A9P5_9FIRM/6-102--------------------------------------------------------------------------------
Q5QYE0_IDILO/8-104--------------------------------------------------------------------------------
E3DAG2_GARV3/12-110--------------------------------------------------------------------------------
D3R1R0_MAGIU/8-105--------------------------------------------------------------------------------
L7W7C8_NONDD/13-111--------------------------------------------------------------------------------
Q8EPV3_OCEIH/8-104--------------------------------------------------------------------------------
B8DU79_BIFA0/12-110--------------------------------------------------------------------------------
E3IV14_FRASU/13-108--------------------------------------------------------------------------------
Q5HNV5_STAEQ/8-104--------------------------------------------------------------------------------
ATP25_YEAST/105-246--------------------------------------------------------------------------------
D2R8D5_PIRSD/24-119--------------------------------------------------------------------------------
I4CCS0_DESTA/15-111--------------------------------------------------------------------------------
D5WXL5_KYRT2/10-106--------------------------------------------------------------------------------
E8REX9_DESPD/18-114--------------------------------------------------------------------------------
Q21WP9_RHOFT/19-115--------------------------------------------------------------------------------
R6TTM2_9FIRM/13-109--------------------------------------------------------------------------------
L7VM09_CLOSH/8-104--------------------------------------------------------------------------------
F0S9I9_PSESL/16-113--------------------------------------------------------------------------------
Q1AVU5_RUBXD/25-121--------------------------------------------------------------------------------

PF09970

A2BMQ9_HYPBU/4-185----------------------------------------------------------TLNDLSWLF----RKLQEH-GI
Q9YEU3_AERPE/3-181----------------------------------------------------------SRRGVASSL----RVLLDR-GF
Q0W0P2_METAR/6-201----------------------------------------------------------NFRIYREAA----SVLEAN-GI
A3DMD4_STAMF/4-178----------------------------------------------------------TLEDLAVVL----GKLSSY-GV
B8D508_DESK1/4-179----------------------------------------------------------SIDELAGIM----KTLQDE-GV
A8AAR7_IGNH4/4-184----------------------------------------------------------TLDDLIYVM----KKLQEA-GL
Q8ZWK5_PYRAE/12-191----------------------------------------------------------YKTALRKVA----KSLNEK-GV
A4YD77_METS5/3-181----------------------------------------------------------AFEKIGEIL----SQIKEK-M.
A8MBZ4_CALMQ/6-188----------------------------------------------------------YSLALLRVG----GVLGGR-GV

PF08843

P96356_MYCTU/44-279----------------------------------------------------------QFAAT..LT----DDTGAP-LL
A4QBB6_CORGB/41-280----------------------------------------------------------IVLSR...I----FANDPN-SW
A4TG06_MYCGI/45-278----------------------------------------------------------RFMAR...V----FNANEP-PW
Q3L9Z1_RHOE4/41-273----------------------------------------------------------RFLAR...V----FSSPDS-RW
Q0RZM2_RHOJR/41-272----------------------------------------------------------RFLTR...V----FDADPD-GW
A1BD69_CHLPD/21-282----------------------------------------------------------RDIKE...V----ADGLAI-HF
A1VQW1_POLNA/3-254----------------------------------------------------------ADVEA...V----AAPMGI-AI
Q8XT48_RALSO/19-276----------------------------------------------------------IIMDR...V----ARQANL-RY
B1YQB6_BURA4/27-287----------------------------------------------------------QAVGT...T----CVQLDT-AF
Q63YV1_BURPS/19-278----------------------------------------------------------RDVKH...A----CAQLGA-KF
Q82BM7_STRAW/85-332----------------------------------------------------------LVLAA..IA----DSAWVD-AL
A4X8Y5_SALTO/290-509----------------------------------------------------------HVLTT..IA----ATTWSQ-QL
A5FTN4_ACICJ/24-250----------------------------------------------------------EVVRS.IFV----KSTERE-I.
A5CLY9_CLAM3/43-277----------------------------------------------------------RFLCR...V----FADDEP-MF
B4SCH8_PELPB/39-286----------------------------------------------------------TLLNG....----LHIQGL-QL
Q5X025_LEGPL/35-302----------------------------------------------------------QSLSK....----..IENE-YF
A0A129GES9_LEGPN/35-300----------------------------------------------------------RLLVG....----..ISND-YF
Q3ICX9_PSEHT/18-286----------------------------------------------------------KLLSE....----LSFDTH-LL
Q7MZL3_PHOLL/34-307----------------------------------------------------------RLLQP....----LAFDTH-KL
B3EES9_CHLL2/39-305----------------------------------------------------------EKLAD....----IDVDGI-QL
A1W687_ACISJ/40-308----------------------------------------------------------RALFA....----LQPEGV-QL
B1HK77_BURPE/40-306----------------------------------------------------------RALST....----LAHEHV-TL
A6DS96_9BACT/37-309----------------------------------------------------------ALLEI..FS----NETLAE-YT
Q64WK6_BACFR/36-314----------------------------------------------------------KILRD..IS----MSEYAD-KT
Q7MW16_PORGI/42-316----------------------------------------------------------EILRA..LS----KSSYSQ-QI
A4VC40_BACUN/48-319----------------------------------------------------------SLMAA....----.GDKDN-RA
A4TFZ6_MYCGI/38-313----------------------------------------------------------EVLRT...I----AASHRD-EI
Q8EAV5_SHEON/44-326----------------------------------------------------------ILYVD.IAP----KLTARS-QI
E0TEK2_PARBH/39-305----------------------------------------------------------.......WG----LQQLDY-KF
A0A016HWW3_BACFG/41-334----------------------------------------------------------YALFH....----.TSVSE-YL
A3J913_9ALTE/48-337----------------------------------------------------------RLLYD...E----NLLGAH-ST
A6THM9_KLEP7/48-339----------------------------------------------------------RLLFD....----.EGFLH-PY
A9KUC3_SHEB9/48-338----------------------------------------------------------RLLYD...E----RLLGDC-SV
Q82T38_NITEU/42-327----------------------------------------------------------RALFV....----.SPLSA-DL
Q0BSX7_GRABC/42-325----------------------------------------------------------STLYG....----.SALGE-HL
Q8KW71_9RHOB/44-328----------------------------------------------------------DALFG....----.SDLGE-HL
Q7D419_AGRFC/45-352----------------------------------------------------------DFFFN...R----RKDDAI-GL
A5ETQ0_BRASB/46-335----------------------------------------------------------DALYH...R----LPADRP-RL
Q47DL1_DECAR/45-335----------------------------------------------------------DALFN...G----LATGGP-RL
A1TXM9_MARHV/49-331----------------------------------------------------------QALFS....----.MPGAH-PM
Q5WTN4_LEGPL/43-334----------------------------------------------------------DQIFS....----NEDLSP-HV
A0LER7_SYNFM/41-321----------------------------------------------------------RELFG....----LQNWGQ-HL
A3ZP42_9PLAN/42-324----------------------------------------------------------GILFE....----.SEFAS-DL
Q2SRA8_MYCCT/41-317----------------------------------------------------------DYIFN....----QSKWSM-SF
Q6MDY6_PARUW/41-327----------------------------------------------------------ERLFS....----LQKLKP-HL
B0T9L0_CAUSK/43-328----------------------------------------------------------GLLFD....----PARSTG-SM
Q212U2_RHOPB/41-335----------------------------------------------------------KRLFA...L----QGEEFA-SL
Q3A7V2_PELCD/41-315----------------------------------------------------------DKLFA....----HPPLAH-VL
A2SRV5_METLZ/41-321----------------------------------------------------------DYLFH....----DCPWKN-TL
Q70K67_9ACTN/39-270----------------------------------------------------------LFLAR..LF----RSPDAE-QW
A0A066RWX3_MYCTX/36-282----------------------------------------------------------YLLSQ...T----VQFGDN-RL
Q0AYA4_SYNWW/12-213----------------------------------------------------------PILDRLVEC----DILTDR-GF
A4AL11_9ACTN/32-263----------------------------------------------------------RFLAR..LV----ESPYAD-SF
V7MI27_MYCAV/21-255----------------------------------------------------------RIMAR...L----QAAEPG-LW
Q2IEN8_ANADE/40-269----------------------------------------------------------RYLAR...L----VRVLGD-AA
A6P1W9_9FIRM/34-254----------------------------------------------------------EFLRR..LE----KSQYAE-NL
A7B855_RUMGN/34-254----------------------------------------------------------EFLRK..LS----KSGCED-TL
B4SEI7_PELPB/39-257----------------------------------------------------------RFLYR..LS----ISSFAD-RF
A8ZZS0_DESOH/39-259----------------------------------------------------------RFLYR..LA----QSRHAN-RF
Q5KV23_GEOKA/37-258----------------------------------------------------------RLLYR..LS----ISNYRD-KF
A6LIS3_PARD8/36-258----------------------------------------------------------RLLYR..VS----VSQYKD-NF
Q64Q44_BACFR/39-261----------------------------------------------------------RLLYR..LS----ISRFYD-HF
A7LUN8_BACO1/37-259----------------------------------------------------------RLLYR..IS----QTHYRE-NF
A6DSE9_9BACT/33-256----------------------------------------------------------RFLYR..LG----LSEHKN-RI
Q0F353_9PROT/38-260----------------------------------------------------------RLLYR..LS----VSRYRD-EF
A0LJY5_SYNFM/39-260----------------------------------------------------------RLLYR..IG----RSEWRS-RF
Q5GY13_XANOR/41-262----------------------------------------------------------RVLYR..LS----VSEQQG-QF
A3Z4Q5_9SYNE/35-255----------------------------------------------------------RLLYR..IG----ISEYCD-RF
A1VW15_POLNA/35-256----------------------------------------------------------RLLYR..LS----QSAHAD-RF
A1W4H8_ACISJ/35-256----------------------------------------------------------RLLAR..VS----TSPHAD-RF
A6UKN5_SINMW/38-258----------------------------------------------------------RLLFR..LS----RSPHAG-RF
Q1M7T1_RHIL3/81-300----------------------------------------------------------RLLYR..LS----LSEHRD-RF
Q3Y113_ENTFC/32-252----------------------------------------------------------KLLER..IV----ESPYHD-DF
Q8E4P3_STRA3/32-253----------------------------------------------------------VILKK..LS----QSSYSD-HY
Q6MU66_MYCMS/32-253----------------------------------------------------------SILEK..IV----KSKNKQ-NF
Q932V7_MYCBV/32-254----------------------------------------------------------SILRR..IS----KSNERD-NF
Q6MDV8_PARUW/32-251----------------------------------------------------------RFLSR..LS----RSTYTQ-QF
Q6M9M4_PARUW/38-258----------------------------------------------------------RFLVR..LA----RSKYRD-QF
Q48616_9LACT/30-263----------------------------------------------------------RFLTR..LS----ASQYKE-KF
A5ZR43_9FIRM/34-257----------------------------------------------------------RFLER..IS----LSEYKN-QF
A6NXL8_9FIRM/29-249----------------------------------------------------------RLLVR..LA----ASAYKE-KF
Q5QWW7_IDILO/14-223----------------------------------------------------------RCLDN.FNS----HYLTEH-AI
Q4BV89_CROWT/13-234----------------------------------------------------------KILNS.FNP----TILQES-YA
A3JKF1_9ALTE/13-197----------------------------------------------------------SVLEA.MNP----ELLKDL-QC
A2SDV7_METPP/12-231----------------------------------------------------------TVLAA.LDA----DVLVAN-DC
A1VJ73_POLNA/12-232----------------------------------------------------------QVLRA.LNA----PLLREN-LC
Q2KB15_RHIEC/41-246----------------------------------------------------------AALRL.MRA----DFFLAN-KC
A0A0U1QTN6_YERP3/14-242----------------------------------------------------------GILDS.IDA----NFIEDA-EC
A4Z034_BRASO/13-212----------------------------------------------------------DGLQD.LKQ----QGLPAP-EW
A4XFS5_CALS8/11-198----------------------------------------------------------LILDC....----AKIPEE-EW
Q120Y5_POLSJ/21-211----------------------------------------------------------.TLTD.YLA----TVVDHP-TW
Q21T10_RHOFT/21-211----------------------------------------------------------KLMAH..LE----RQTSHP-LW
A1WFU2_VEREI/21-211----------------------------------------------------------GLMLH..LE----EATIEP-QW
A0A0H2Y0W6_BURCA/21-212----------------------------------------------------------TLIEE.IRK----HGTSSP-FW
Q7WXF2_CUPNH/19-210----------------------------------------------------------TLMEE.VRK----HGGIEP-FW
A0RUS7_CENSY/6-237----------------------------------------------------------NSLCYISTD----EVLKDV-QF
Q0W4I1_METAR/29-258----------------------------------------------------------LALEQ....----LRPLFP-DA
O58109_PYRHO/28-258----------------------------------------------------------YLLFQ...L----WEIFGR-KV
B3E891_GEOLS/35-303----------------------------------------------------------ALLGH....----LAESDL-NF
A3XKF9_LEEBM/37-314----------------------------------------------------------SLLEH....----LKVSGL-DF
A7M3Q0_BACO1/35-306----------------------------------------------------------SLLEM....----LVKAGC-PL
Q8G4C8_BIFLO/40-283----------------------------------------------------------RILDA..MM----REGFFS-SL
A6W084_MARMS/31-273----------------------------------------------------------DIMAV..MV----KQGVMQ-SL
Q1NX48_9DELT/33-274----------------------------------------------------------DILRL..LN----DAGLLA-GL
A3JJK0_9ALTE/33-275----------------------------------------------------------DILRE..LS----HADLLK-KL
A1WLS4_VEREI/34-292----------------------------------------------------------EIFQA..LD----DAGLLK-HL
Q7N0F8_PHOLL/35-281----------------------------------------------------------DILYC..LD----TNGLLD-QL
Q7N990_PHOLL/35-281----------------------------------------------------------DILFC..LS----KDGLLK-EI
Q1RR56_STRAM/9-205----------------------------------------------------------RLLAD.ILD----LG.SPY-PL
Q93P81_9BACT/17-212----------------------------------------------------------QFMSA....----..EVFK-TF
Q11WD0_CYTH3/17-213----------------------------------------------------------KLMQA....----..DEFK-DF
A6E7P3_9SPHI/16-212----------------------------------------------------------VLMQE....----..PIFK-HF
A7HFJ3_ANADF/43-305----------------------------------------------------------WALGQ....----..HFGD-AL
Q2JEV0_FRASC/11-201----------------------------------------------------------RIFFG....----.LPESA-GF
Q2LU48_SYNAS/35-302----------------------------------------------------------QLLDA.IRS----HPFLKD-KL
Q1LN31_CUPMC/10-279----------------------------------------------------------RLLTQ.VAP----LVFVDD-TF
Q8P655_XANCP/10-280----------------------------------------------------------RLLLD.IAP----AVFAND-IF
A4JU43_BURVG/10-285----------------------------------------------------------RLMLG.IAP----IIFDTP-LF
Q58AR5_CUPMC/10-285----------------------------------------------------------RLLID.IAP----PVFDTD-KF
A1VVH0_POLNA/10-280----------------------------------------------------------QLLLA.IAP----AIFETP-LF
A0YF78_9GAMM/10-274----------------------------------------------------------KLLLD.VLP----EVSKEA-CF
Q3ARB4_CHLCH/11-282----------------------------------------------------------DLLLQ.ILP----LVAKEK-VF
M4TXV3_9XANT/17-288----------------------------------------------------------RLLVE.ILP----VLAQEP-RF
A3W959_9RHOB/11-281----------------------------------------------------------ALLVR.VLP----YVAKEE-IF
E0TGY4_PARBH/11-280----------------------------------------------------------RLLVD.ILP----AVAAEE-DF
Q7ND98_GLOVI/12-283----------------------------------------------------------RLLVS.LLP----QVAKQE-CF
A6F2Q0_9ALTE/14-284----------------------------------------------------------TLLLQ.LVP----FVAKHQ-CF
A6X803_OCHA4/12-281----------------------------------------------------------RLLMR.LIP----IVARET-CF
A3UHI0_9RHOB/12-283----------------------------------------------------------ALLIR.TIP----FVAQEQ-CF
Q11AE5_CHESB/12-283----------------------------------------------------------QLLMQ.VLP----FVADEK-EF
Q2LU07_SYNAS/47-285----------------------------------------------------------ADLCS....----....GC-KL
A1TBN2_MYCVP/31-246----------------------------------------------------------AFLSR....----..EFGD-RI
A1U7W6_MARHV/12-228----------------------------------------------------------QIMQAICEI----IHDEGK-PL
A7NJN2_ROSCS/29-227----------------------------------------------------------CILGA..LQ----RAGAMI-PL
A5D0Y6_PELTS/89-288----------------------------------------------------------KTLKI..FS----RVNKHG-DF
Q07LJ4_RHOP5/30-260----------------------------------------------------------RALVA.IFS----DPFLRG-EL
A3WUQ2_9BRAD/30-251----------------------------------------------------------RALVN.LFE----DAFLRD-EL
Q5X0F2_LEGPL/30-282----------------------------------------------------------RAIVE.IFS----NPFLAS-EL
A0M137_GRAFK/30-253----------------------------------------------------------RALVE.IFS----DDFLRE-NL
A7LVH9_BACO1/30-253----------------------------------------------------------RALVA.IFS----DDFLAS-KL
A0A129BCM2_LEGPN/30-253----------------------------------------------------------RALVE.LFN----DPLISE-SI
Q3SW13_NITWN/30-253----------------------------------------------------------RALVE.IFS----HPVLSQ-AL
A1BFK9_CHLPD/30-252----------------------------------------------------------RALVE.IFS----NSFLAE-SL
B9M297_GEODF/30-250----------------------------------------------------------RALVE.LYS----HPLLAE-NL
O54654_HALSA/29-256----------------------------------------------------------WILWG..IF----TSDFGE-NL
Q82TQ8_NITEU/35-265----------------------------------------------------------WFLTG..LA----GHPLRD-VL
Q3B1Q4_CHLL7/29-234----------------------------------------------------------WVLAG.LAS----QEEVAD-SW
A8ZVR5_DESOH/29-286----------------------------------------------------------WMLAG.IFN----HPAIGK-SW
A6GZS9_FLAPJ/29-275----------------------------------------------------------HFIAA.IFN----EPELKE-TL
Q1Q4B8_9BACT/29-269----------------------------------------------------------HYLNG.LYN----RSLFKE-CF
A1BFT1_CHLPD/31-275----------------------------------------------------------VALYG..LW----RAGFFQ-VA
Q0YUP4_9CHLB/31-275----------------------------------------------------------VALYA..LW----RAGFFE-KA
Q74DE8_GEOSL/31-281----------------------------------------------------------VALLG..LW----RSKFFE-HA
Q1NX65_9DELT/31-281----------------------------------------------------------IALCG..LW----RGKFFE-HA
A6VTK2_MARMS/28-267----------------------------------------------------------IALAG..LY----RGGFFQ-KA
A6LDX6_PARD8/32-268----------------------------------------------------------VILAG..LY----AGGFFE-SA
A0RWG6_CENSY/28-254----------------------------------------------------------NLLSV..MV----DFPKID-KM
A0RWG1_CENSY/28-244----------------------------------------------------------SLLSI..IA----DFPGID-KI
A7LH05_9HELI/21-239----------------------------------------------------------KLMRA..IV----KNLADT-PM
Q649Z3_9ARCH/29-245----------------------------------------------------------IALRS....----IYASTN-DL
Q6L332_PICTO/28-244----------------------------------------------------------LLLYE...I----YNEFND-EL
Q3F100_BACTI/38-319----------------------------------------------------------LSLCA.LLS----SDIFVD-KT
A0A063UM99_BORBO/15-280----------------------------------------------------------LVVKA.ILS----DDKLFE-NL
Q138J1_RHOPS/18-217----------------------------------------------------------QIWRS...L----EPAGDL-NF
A4JFW1_BURVG/16-258----------------------------------------------------------KLWPD...L----APVKDL-GF
Q8KW54_9RHOB/74-323----------------------------------------------------------LFLAT.LAM----TRPYCQ-QV
A6GR58_9BURK/30-277----------------------------------------------------------IVLSA.IGS----SAPLRT-QM
Q7N7R6_PHOLL/25-274----------------------------------------------------------IVLQA.IAS----NEYLKP-KM
Q3JF57_NITOC/25-272----------------------------------------------------------TILTA.IAG----TPSLQT-AM
A1X5X8_ECOLX/40-289----------------------------------------------------------IILKS.ISI----EESLNE-MM

PF14907

D4IJI6_9BACT/30-280----------------------------------------------------------DAAQWREIY----DLSSVQ-GV
D6D2Z8_9BACE/32-294----------------------------------------------------------TDAQWWDVY----RMAVRQ-TV
E3EIB5_PAEPS/42-310----------------------------------------------------------QEMDWSRLL----RLIEHH-RV
E6SSN3_BACT6/27-274----------------------------------------------------------SANDWQTLY----RMAQAQ-AL
A6L7U2_BACV8/35-288----------------------------------------------------------SPALWQACY----RLACTQ-GV
D5EUU1_PRER2/28-271----------------------------------------------------------NADDWRWLY----QMAVRQ-SL
A1AK32_PELPD/41-295----------------------------------------------------------SPEEWRDFL----SLAAEQ-RV
D0MHT5_RHOM4/36-289----------------------------------------------------------QPLDWERLY----RLMLRH-GV
C8VWU0_DESAS/27-271----------------------------------------------------------ETLDWEKLY----QLSIWH-GI
C8W2H3_DESAS/29-273----------------------------------------------------------YKLDWEKLY----KFAAWH-GV
F0SY73_SYNGF/27-282----------------------------------------------------------HNVNQSELL----NLAMEQ-KV
B0CEE6_ACAM1/41-296----------------------------------------------------------PSMDWHTLV----RLANVH-GV
E6X194_NITSE/55-325----------------------------------------------------------PKFDIQNLL----ELSSRH-GV
A5G508_GEOUR/51-304----------------------------------------------------------ECTDWGAFT----ALVNRH-EV
B8I678_CLOCE/34-315----------------------------------------------------------GGIDWSEAI----YQMITH-RT
B8HPX3_CYAP4/33-304----------------------------------------------------------KSIDWKTLI----QTSIAQ-GV
A6QAF7_SULNB/69-323----------------------------------------------------------EHLTLHTLI----SLANQH-GI
C8W5K5_DESAS/42-296----------------------------------------------------------KPTDWQFFA----HLAVHH-RV
A0LED8_SYNFM/43-296----------------------------------------------------------GRLDWDALL----RLAEAH-KI
C8W092_DESAS/36-289----------------------------------------------------------QSVNWDLFL----HLAVYH-RL
B3U4I7_9BACT/63-313----------------------------------------------------------DGIDWELVW----KLSRTH-GV
B8HL63_CYAP4/37-290----------------------------------------------------------HPLDWPYLE----AIALRH-QV
C6CW48_PAESJ/39-291----------------------------------------------------------HGLDWPLFL----RFAVYH-ET
E3GKM5_EUBLK/27-271----------------------------------------------------------LGCDWDVVY----REARRH-SV
Q5V4C2_HALMA/33-294----------------------------------------------------------DAPDWDRVV----ALARYH-GI
B0CA05_ACAM1/43-304----------------------------------------------------------HSIDWHHFL----RLTKFH-KV
E4NR20_HALBP/45-311----------------------------------------------------------PEVEADEVL----TAAHHL-GV
D0MJ16_RHOM4/27-280----------------------------------------------------------GLADPAEVA----RLAVQQ-GV
D5C0P8_NITHN/38-283----------------------------------------------------------SSLNWDKLL----YYAQVH-AL
E4T3H3_PALPW/32-289----------------------------------------------------------EVKDWDYLT----KTIIDR-GI
B8HYI9_CYAP4/46-308----------------------------------------------------------PGLDWTYVL----NQANDH-GL
Q2S9G8_HAHCH/40-294----------------------------------------------------------ESSDWECFL----QQLRWH-RV
E0RZJ9_BUTPB/57-297----------------------------------------------------------DGIDIGELI----NYAAKG-HI
F2NH29_DESAR/30-285----------------------------------------------------------GKIAWPDFL----RWVDRH-RV
E6UIV6_RUMA7/27-267----------------------------------------------------------KDIDIERLY----QLAKYH-TV
B3DZF9_METI4/33-292----------------------------------------------------------GSFHWELFY----NLCFVH-GL
F2JWV8_MARM1/27-283----------------------------------------------------------NEEEVSLLA----RTCAQH-RI
D9SE91_GALCS/39-298----------------------------------------------------------PLIHADALI----WLAIRH-RI
D1CIV7_THET1/37-287----------------------------------------------------------QPFDWPRLL----AIAHSQ-DV
D2QFF6_SPILD/34-281----------------------------------------------------------QPINWHRVY----TLAVRH-RL
D4LAD3_RUMC1/30-273----------------------------------------------------------EQMQLRPML----SLAQQH-TL
Q7N4C9_PHOLL/37-311----------------------------------------------------------TEFPWDRFL----SVVNRQ-KI
E6UK59_RUMA7/32-272----------------------------------------------------------DKINLSQLY----EVAQTH-SL
E8X100_GRATM/35-290----------------------------------------------------------NDIDWRAFL----AAAHSH-RL
D1YWY8_METPS/61-314----------------------------------------------------------SISQWYELF----SALKPH-GI
A9AY74_HERA2/29-280----------------------------------------------------------SPNDWKVLA----HLADYH-EV
E8UZW2_TERSS/40-293----------------------------------------------------------SSIDWSRLL----RIAHRN-RV
Q5ZRD2_LEGPH/18-272----------------------------------------------------------TSFSAPEIL----KTAQRM-RL
Q2W7B9_MAGSA/35-286----------------------------------------------------------AIGDWSQVV----AGATSH-HV
Q47DA0_DECAR/28-284----------------------------------------------------------TLTDWDDTL----RLARQA-RL
A5VF23_SPHWW/48-301----------------------------------------------------------DRFDWDELI----GMAARG-RL
C7RTZ8_ACCPU/29-287----------------------------------------------------------PPADWELLL----RVARRV-RL
A9NH68_ACHLI/22-261----------------------------------------------------------DSQDELELT----KIIFEN-GL
E4NA58_KITSK/44-325----------------------------------------------------------PDLDWGAFT----DAAARH-KL
Q220U3_RHOFT/22-279----------------------------------------------------------SGQQWDLLI----RQARRT-KL
C8VW96_DESAS/31-295----------------------------------------------------------SHSKPECLT----NRLNEL-QV
Q1IJX8_KORVE/41-297----------------------------------------------------------EQVGDEVAW----QVAKQH-EL
Q0ACH9_ALKEH/23-281----------------------------------------------------------RLGDWDALL----RVARVA-SL
Q2G399_NOVAD/40-294----------------------------------------------------------DEEGWSDLA----ALAEDK-RA
Q82U71_NITEU/28-285----------------------------------------------------------DNRQWELLL----RLARRA-QL
E8X2I6_GRATM/22-260----------------------------------------------------------SDVEWEQAF----ELAEAE-QV
Q2N714_ERYLH/28-286----------------------------------------------------------TEADWQRID----IIAAQH-RL
A1K446_AZOSB/28-282----------------------------------------------------------TPPQWTALL----AAARAA-NL
Q3SG05_THIDA/23-278----------------------------------------------------------SMADWDTLV----RQARAA-GL
A0L573_MAGMM/21-281----------------------------------------------------------PPAEQEPLL----RMLRVE-GL
A1SY03_PSYIN/35-284----------------------------------------------------------KKVNFDRLQ----TLIIQH-RT
A5VCA1_SPHWW/21-272----------------------------------------------------------APDGWTSLL----AIARAE-RL
Q1GTD6_SPHAL/21-273----------------------------------------------------------APRDWDRVI----TVARAE-AM
C6W7P4_DYAFD/31-292----------------------------------------------------------APFDPQKYL----ALAKWH-QI
A2U3F5_9FLAO/33-287----------------------------------------------------------NAVNWDDIV----KLSTAH-YV
Q2RPP9_RHORT/33-290----------------------------------------------------------DGATWDRLI----PLARHA-GV
Q98C81_RHILO/47-300----------------------------------------------------------PNLSAAAVA----DIARLN-KV
D3SEY4_THISK/21-280----------------------------------------------------------TAAEWAPLL----AAARES-AL
D4Z532_SPHJU/20-266----------------------------------------------------------DAGGWNALV----AMARAE-RL
Q5P7H0_AROAE/23-275----------------------------------------------------------DTARWEHVL----RLARMT-GL
D9R9Y8_CLOSW/28-270----------------------------------------------------------RQPDWEKMY----RLADYH-NV
C8X6N8_NAKMY/33-276----------------------------------------------------------SATEIDEFV----DAARLH-RI
E8WZ57_GRATM/42-294----------------------------------------------------------SEREWKSNL----KWLDTS-GL
A1WX94_HALHL/26-285----------------------------------------------------------PESLWTGIL----AVGREN-LL
C4ZNM3_THASP/23-275----------------------------------------------------------PEARWDRVL----RLARMT-GL
B9JQN6_AGRRK/37-306----------------------------------------------------------SAEEFAQLF----AAIRIH-RV
Q15WK0_PSEA6/24-278----------------------------------------------------------THTEWEFLI----RIAREA-SV
E3FNY0_STIAD/23-272----------------------------------------------------------RGAPWEDFV----DWAIAQ-GL
A7HIS8_ANADF/20-254----------------------------------------------------------PDADPALLA----DVLEAH-GL
Q1DDG5_MYXXD/51-300----------------------------------------------------------RGAPWEEYV----DWAIMQ-GL
C2X1P1_BACCE/40-289----------------------------------------------------------SDIDWELFL----EQAVHH-RV
D4KWT4_9FIRM/552-802----------------------------------------------------------.ETEWESIL----SIADRH-RV
D4MW73_ANAHA/28-281----------------------------------------------------------.TQDWEKIY----DISQKQ-QL
I1YWC5_PREI7/27-278----------------------------------------------------------.KKDFSALQ----NIANMQ-TV
R5UJA3_9BACT/33-278----------------------------------------------------------..RQWDDIF----RMAADQ-GV
Q8KKS5_RHIEC/2-289----------------------------------------------------------........V----WRAEHN-RT
Q8XN73_CLOPE/29-276----------------------------------------------------------...KWNEIM----CEANAH-EI
R5QD91_9FIRM/30-263----------------------------------------------------------.KEEIERVI----KCARVH-GV
R5QEH8_9FIRM/29-271----------------------------------------------------------.ETDWGKFY----RICKFH-KI
R5XE76_9CLOT/30-276----------------------------------------------------------...DLVYIY----KMSEIH-HV
R6KK05_9BACE/28-278----------------------------------------------------------.SADWEEIY----QLARTQ-AL
R6QP25_9CLOT/29-271----------------------------------------------------------.GVDWEKLY----RICKFH-KI
R7JPI5_9BACT/51-294----------------------------------------------------------SEEDWTRLF----TLAAQH-GV

PF10706

A6TJ11_KLEP7/73-246------------------------------------------------------MDTTQVTLIHKIL----AAADER-NL
Q8YL66_NOSS1/1-174------------------------------------------------------MNDLHIELIHQLF----AASDKI-NL

PF04991

Q753A8_ASHGO/506-745-------------------------------------------------------------------------TNSS-NL
A5DCG8_PICGU/263-461-------------------------------------------------------------------------AREA-GI
A6LC14_PARD8/39-262-------------------------------------------------------------------------CRKH-DI
Q87Q28_VIBPA/24-242-------------------------------------------------------------------------CERH-DL
Q03SH4_LACBA/23-245-------------------------------------------------------------------------CHQL-GL
A7TLM6_VANPO/513-754-------------------------------------------------------------------------TKAN-GI
A6M2A9_CLOB8/33-257-------------------------------------------------------------------------CDKH-NI
YJ31_YEAST/469-720-------------------------------------------------------------------------VKAN-GL
Q03GP1_PEDPA/22-243-------------------------------------------------------------------------CDKH-DI
A6LBV7_PARD8/43-251-------------------------------------------------------------------------AKEN-NI
A5UNE2_METS3/36-262-------------------------------------------------------------------------CEEN-DI
A5UND9_METS3/81-296-------------------------------------------------------------------------CKKH-DI
Q6FSB7_CANGA/473-717-------------------------------------------------------------------------TKAN-GL
Q832Q2_ENTFA/24-252-------------------------------------------------------------------------CRSN-NL
A5UNH1_METS3/30-252-------------------------------------------------------------------------CEEN-NI
MNN4_YEAST/490-746-------------------------------------------------------------------------TKAN-GI
A7TID6_VANPO/522-767-------------------------------------------------------------------------TKAN-GI
A6LD13_PARD8/44-278-------------------------------------------------------------------------CEKE-GL
Q6FRE8_CANGA/512-760-------------------------------------------------------------------------AIAN-GL
A6LI11_PARD8/44-274-------------------------------------------------------------------------CSKY-GL
Q2NIC1_METST/35-244-------------------------------------------------------------------------CQKY-EL
A6L4H8_BACV8/26-253-------------------------------------------------------------------------CKRH-DL
Q9CIZ2_LACLA/24-251-------------------------------------------------------------------------CREN-GI
Q832P6_ENTFA/27-250-------------------------------------------------------------------------CEEH-NL
Q6CV94_KLULA/470-711-------------------------------------------------------------------------VKAN-GL
B0URY8_HISS2/24-243-------------------------------------------------------------------------CAKN-DI
D6CZV8_9BACE/24-240-------------------------------------------------------------------------CKEH-NL
G0VHC4_NAUCC/584-836-------------------------------------------------------------------------TRAN-GL
LICD_HAEIN/24-243-------------------------------------------------------------------------CERY-KI
Q1G8I9_LACDA/45-275-------------------------------------------------------------------------CQKY-DI
Q6CV92_KLULA/338-579-------------------------------------------------------------------------..SN-DL
Q8CWR1_STRR6/24-245-------------------------------------------------------------------------CKKH-DI
Q8DPD7_STRR6/25-246-------------------------------------------------------------------------CKEH-DL
Q8DPI0_STRR6/24-243-------------------------------------------------------------------------CKKH-NI
Q8DYQ6_STRA5/24-249-------------------------------------------------------------------------ARDN-KI
Q8R630_FUSNN/25-234-------------------------------------------------------------------------CNEN-KI
R5K6F7_9CLOT/25-248-------------------------------------------------------------------------CEKH-GL
R5U2Q7_9BACE/28-256-------------------------------------------------------------------------CRKH-DI
R6N240_9CLOT/23-251-------------------------------------------------------------------------CDEE-QI
R6N4Y5_9CLOT/26-257-------------------------------------------------------------------------CEKH-SL
R6X1W1_9PORP/32-241-------------------------------------------------------------------------CRKH-GI
R7EDL2_9BACE/24-240-------------------------------------------------------------------------CKEH-GL
R7EEU8_9BACE/31-244-------------------------------------------------------------------------CTKY-DI
R7EJM5_9BACE/32-245-------------------------------------------------------------------------CRKH-KL

PF04229

Q7UQR9_RHOBA/21-182----------------------------------------------------------------PIR----LMHHDA.RW
F4FG59_VERMA/4-164----------------------------------------------------------------AVE----IVDYQP.AW
H6L1E0_SAPGL/5-166----------------------------------------------------------------TIE----VCPYRE.DW
E4N0U3_KITSK/9-181----------------------------------------------------------------.VL----VLPYDP.DW
D1BEG0_SANKS/7-190----------------------------------------------------------------PAR----LARYDD.TW
F0R0L2_BACSH/21-180----------------------------------------------------------------KII----LHEYDP.QW
R6RXV9_9CLOT/9-171----------------------------------------------------------------TVK----LIPHQE.EW
C7M6I7_CAPOD/21-178----------------------------------------------------------------PIN----LTQHNP.LW
K9PW19_9CYAN/3-165----------------------------------------------------------------KVE----VVAHNL.SW
F8I524_SULAT/19-179----------------------------------------------------------------RVH----VEPYNP.LW
D9S0W3_THEOJ/3-164----------------------------------------------------------------KVV----VTDYNP.MW
R6D2S7_9CLOT/3-163----------------------------------------------------------------.VI----VTAYNP.NW
C1A083_RHOE4/211-392----------------------------------------------------------------.PE----LAPADP.SW
E1VYF6_GLUAR/165-333----------------------------------------------------------------.IE----IAEPSP.HW
W5TQQ6_9NOCA/29-187----------------------------------------------------------------PVE----IVAYDP.NW
B2TLP2_CLOBB/5-165----------------------------------------------------------------HVI----VEDYNP.KW
B9JDR1_AGRRK/3-162----------------------------------------------------------------PIR----LVDYDP.AW
I0H1C1_ACTM4/212-377----------------------------------------------------------------NLR----IVPFDP.EW
F9UMA6_LACPL/43-192----------------------------------------------------------------PIQ----LTAYQS.DW
Y3154_VIBCH/37-187----------------------------------------------------------------...----ADEYQA.SC
Q81YH7_BACAN/4-173----------------------------------------------------------------RIT----IEEYNI.KW
E6S9I6_INTC7/214-387----------------------------------------------------------------..A----VVAPRS.DW
W5TJ52_9NOCA/212-391----------------------------------------------------------------AIE----VTDHDP.AW
K9XBR5_9CHRO/3-167----------------------------------------------------------------EII----IVEYDP.HW
E3GIN1_EUBLK/3-163----------------------------------------------------------------PII----LKKHNP.NY
K0KAS1_SACES/227-393----------------------------------------------------------------PLN----VLPYDP.TW
D4J128_BUTFI/5-166----------------------------------------------------------------HVV----VLPYNE.KW
A4FKT9_SACEN/207-379----------------------------------------------------------------SPV----LVEPDP.EW
B6QAD6_TALMQ/29-191----------------------------------------------------------------PIT----IIEYDI.IW
D1AHI7_SEBTE/18-178----------------------------------------------------------------PII----LKDYNP.EY
R4KDL8_CLOPA/5-164----------------------------------------------------------------HVV----VEDYNP.NW
A5G319_ACICJ/3-168----------------------------------------------------------------HVE----MAEYDP.AW
H6N9P1_9BACL/2-161----------------------------------------------------------------KVR----LSEYSE.NW
Q2K5X8_RHIEC/4-163----------------------------------------------------------------PVE----LVSYDR.EW
Q8DTG8_STRMU/18-179----------------------------------------------------------------PIF----LVEHKE.EW
C4KZG2_EXISA/3-162----------------------------------------------------------------KVE----VVKYNP.EW
E4NR36_HALBP/5-165----------------------------------------------------------------PIT----IAEYNP.EW
I7EVS4_PHAIB/4-164----------------------------------------------------------------...----VVAPDP.TW
K0NHL1_DESTT/8-169----------------------------------------------------------------TVR----VVDHNS.GW
K0JPZ1_SACES/83-263----------------------------------------------------------------PPV----LHDHDP.DL
H6NPI6_9BACL/17-180----------------------------------------------------------------PVT----LAPPDP.QW
Q88IL4_PSEPK/6-162----------------------------------------------------------------..K----ITPYDP.TW
Q65HR6_BACLD/152-312----------------------------------------------------------------KVK----VVSYKE.EW
D8MSB8_ERWBE/3-163----------------------------------------------------------------IVV----VAPYDQ.QW
R5WT49_9BACT/2-163----------------------------------------------------------------NIR----VVPYNP.EW
R5MRQ0_9BACE/17-180----------------------------------------------------------------PIL----LTEHQE.NW
L0IAX8_HALRX/8-169----------------------------------------------------------------TVE----LVTHRE.CW
Q55AI9_DICDI/5-191----------------------------------------------------------------SVT----VVEHDP.RW
B0C1Z8_ACAM1/3-165----------------------------------------------------------------TVE----VVSHNP.AW
A7MK97_CROS8/6-166----------------------------------------------------------------QIV----LEPYNP.AW
C8W1B5_DESAS/176-344----------------------------------------------------------------PIV----LREYNP.AY
Q83EE3_COXBU/18-178----------------------------------------------------------------IIE----VVPYDP.DW
D3FQ45_BACPE/3-163----------------------------------------------------------------KVQ----VVPYQK.DW
B8NAT5_ASPFN/26-188----------------------------------------------------------------LIE----IVEPDP.TW
D2PRV9_KRIFD/5-169----------------------------------------------------------------RIT----ITEYDV.HW
C5C5E0_BEUC1/9-171----------------------------------------------------------------PVR----VVPARA.GW
M2MR17_BAUCO/24-208----------------------------------------------------------------ELT----IVEPDS.QW
K1W9P8_TRIAC/2-167----------------------------------------------------------------PIQ----VVEYDP.AW
I0H425_ACTM4/12-172----------------------------------------------------------------VIR----IADHDP.AW
Q81PM3_BACAN/8-166----------------------------------------------------------------KVF----LVPWTE.EW
V5FMN7_BYSSN/27-191----------------------------------------------------------------RLE----VVEYDP.TW
A5I088_CLOBH/18-180----------------------------------------------------------------PII----LEEHNP.LW
R6CHS7_9CLOT/8-171----------------------------------------------------------------RVT----LYPHQT.EW
K9QG42_9NOSO/2-163----------------------------------------------------------------KVE----VVPHNP.NW
F0RLV6_DEIPM/12-172----------------------------------------------------------------TIE----VVPYDP.AW
YZZE_STRCO/25-180----------------------------------------------------------------EIG----LSDYDA.RW
R4TB77_AMYOR/212-382----------------------------------------------------------------.PK----IAPYDE.TW
Q480R9_COLP3/9-169----------------------------------------------------------------VIE----VVDYDP.NW
R7K5K1_9FIRM/2-163----------------------------------------------------------------KVE----VVDYRP.EW
K9XRX3_STAC7/4-167----------------------------------------------------------------KVE----VLPHNP.KW
D2R1G3_PIRSD/2-160----------------------------------------------------------------NIE----VASYDP.RW
C7N2S7_SLAHD/18-179----------------------------------------------------------------PIS----LVEHND.AW
W5W422_9PSEU/211-378----------------------------------------------------------------APE----LVPYDP.SW
R4PVG6_9BACT/9-168----------------------------------------------------------------TVK----LVNYSR.DW
Y4798_PSEAE/21-183----------------------------------------------------------------RIE----VLPADP.AW
R5AL68_9BACT/11-171----------------------------------------------------------------PIV----LAAYNP.DW
Q5ZY58_LEGPH/204-370----------------------------------------------------------------HID----IVAYNT.EW
U5RPT9_9CLOT/8-169----------------------------------------------------------------KVR----LLPHCE.EW
C8WR35_ALIAD/281-442----------------------------------------------------------------PVS----LTEVST.RH
YQKA_BACSU/153-313----------------------------------------------------------------KVE----IILYNE.KW
B8FH40_DESAA/17-183----------------------------------------------------------------KID----MAPYNP.AR
D6ZD81_SEGRD/214-391----------------------------------------------------------------..V----LAEPDP.TW
S6AG51_PSERE/6-162----------------------------------------------------------------..T----ISHYDH.NW
G8RQ26_MYCRN/217-398----------------------------------------------------------------EPV----LVPSDP.SW
G0G9J0_AMYMS/26-185----------------------------------------------------------------TVT----LADYDP.EW
H5WXT5_9PSEU/241-411----------------------------------------------------------------.PV----LVEPDP.SW
A0QU49_MYCS2/32-190----------------------------------------------------------------PVA----IVAPDP.RW
K9RII6_9CYAN/3-167----------------------------------------------------------------EIE----IVKHNP.NW
R7YMF0_CONA1/4-163----------------------------------------------------------------PVI----VEDYNP.AW
Q7MJH4_VIBVY/9-159----------------------------------------------------------------..H----AEEYQA.SC
K0JYW2_SACES/116-273----------------------------------------------------------------TVE----LVPYDD.GV
C6CZF7_PAESJ/4-164----------------------------------------------------------------QWR----IAVHNP.QW
I4EWN3_9ACTN/45-201----------------------------------------------------------------QIS----VVDYDA.RW
R6USG1_9FIRM/169-332----------------------------------------------------------------PIV----IRPYNE.QY
G3JC83_CORMM/22-188----------------------------------------------------------------TIT----IVDADP.SW
R6K9E4_9BACE/11-174----------------------------------------------------------------PII----LTEYQK.DW
Q5HQZ0_STAEQ/13-170----------------------------------------------------------------...----...SVK.QF
A3QDM7_SHELP/4-183----------------------------------------------------------------SIV----VIDHQM.SW
Q8TK81_METAC/20-182----------------------------------------------------------------IVR----VVPYDP.EW
I7BP47_NATSJ/8-170----------------------------------------------------------------PIE----LVPARYDAW
A6WAJ0_KINRD/50-209----------------------------------------------------------------PAV----VVDYDP.HW
A0JWM9_ARTS2/214-385----------------------------------------------------------------..V----LAPADP.TW
C7YUZ2_NECH7/30-193----------------------------------------------------------------PLA----IVEPDP.SW
F8L3S4_SIMNZ/8-166----------------------------------------------------------------TID----LLPYDP.SW
M2YLJ2_DOTSN/41-212----------------------------------------------------------------..A----ILPPDP.QW
Q1D1T3_MYXXD/32-190----------------------------------------------------------------KVA----VAPYDA.GW
R8BXH6_TOGMI/31-193----------------------------------------------------------------PIE----IVESDP.AW
V6K242_STRNV/29-199----------------------------------------------------------------QVT----LGEYDP.HW
D6GQ99_FILAD/18-178----------------------------------------------------------------PIF----LVEHNP.LW
I0JMF1_HALH3/3-163----------------------------------------------------------------RVQ----VNLYDE.TW
D2SB44_GEOOG/32-188----------------------------------------------------------------TVV----VQDPDP.EW
W8EQN2_9BACT/18-186----------------------------------------------------------------PVE----LVAHDA.GW
C6WGV0_ACTMD/28-186----------------------------------------------------------------AVV----IAPYDP.AW
D3EI21_GEOS4/6-165----------------------------------------------------------------AIH----LEPYDK.QW
M3AHS4_PSEFD/34-203----------------------------------------------------------------KVS----IVEYNP.LW
V9X9E8_9NOCA/211-393----------------------------------------------------------------.PV----LVPARE.EW
R5A7J0_9CLOT/21-180----------------------------------------------------------------TIQ----LQDYNP.AW
I2EU23_EMTOG/3-172----------------------------------------------------------------...----IQEYRE.SW
E6UAG3_RUMA7/4-166----------------------------------------------------------------PVV----VEQYNE.EW
R5VAK1_9FIRM/4-165----------------------------------------------------------------HIV----VREYDP.NY
I2F809_9BACT/5-167----------------------------------------------------------------PVI----VAEYDS.SW
A0A0D2YDZ7_FUSO4/30-193----------------------------------------------------------------PIA----IVEPDP.KW
W5W1G6_9PSEU/88-244----------------------------------------------------------------TIH----IAEPDP.DW
C4ZJM8_THASP/15-182----------------------------------------------------------------RVE----IVPYDP.AW
Y1888_BACHD/32-191----------------------------------------------------------------SIT----LLEYDP.RW
D5UGE0_CELFN/2-161----------------------------------------------------------------RVF----VVPYDE.CW
K0ETX6_9NOCA/211-393----------------------------------------------------------------ELR----LVPANP.EW
Q0ANT8_MARMM/3-164----------------------------------------------------------------.VD----VVDYDP.GW
B9M8V0_GEODF/15-182----------------------------------------------------------------EVA----IVPYDP.RW
E9FC77_METRA/32-195----------------------------------------------------------------.LE----IVEPDP.TW
Q5UW62_HALMA/8-169----------------------------------------------------------------TVE----LVPHQE.EW
D7AV49_NOCDD/30-189----------------------------------------------------------------RVR----LSEYDP.KW
W5WGD4_9PSEU/84-261----------------------------------------------------------------.PE----LAEWDP.SW
V5XFQ0_MYCNE/214-379----------------------------------------------------------------DAA----VVPYDA.SW
G2XBV0_VERDV/31-198----------------------------------------------------------------PLI----VEPYNA.AW
I1S3S8_GIBZE/30-193----------------------------------------------------------------TIA----IDEPDP.SW
C6WB47_ACTMD/210-381----------------------------------------------------------------PPK----VVDPDP.TW
Q0SI30_RHOJR/210-391----------------------------------------------------------------.PE----LAPPNS.QW
A3CX26_METMJ/18-179----------------------------------------------------------------HVR----VVDYDP.VW
D5BAN2_ZUNPS/18-185----------------------------------------------------------------PIH----LEDHNP.AW
D1BE93_SANKS/25-181----------------------------------------------------------------HVD----LHDYDE.RW
J7L577_NOCAA/28-187----------------------------------------------------------------RIA----IVPHDP.KW
I0JT44_HALH3/47-207----------------------------------------------------------------TVS----LRSYHP.EW
W0BB67_9GAMM/10-170----------------------------------------------------------------LIE----VVPYDF.NW
Q4KFG9_PSEF5/6-162----------------------------------------------------------------..K----ISLYDD.HW
R5EZV1_9CLOT/22-183----------------------------------------------------------------PVF----LTEHRP.VW
Q189F3_PEPD6/18-179----------------------------------------------------------------PIF----LTTHKE.CW
R5J8J7_9CLOT/11-172----------------------------------------------------------------.LI----IMDYTE.DY
E8N7N1_MICTS/6-189----------------------------------------------------------------PAA----IAEHRP.EW
COAE_MYCPA/210-395----------------------------------------------------------------PVR----LVPPDP.EW
Q82TF0_NITEU/35-196----------------------------------------------------------------RIQ----LAEYDL.RW
Q81CT5_BACCR/4-164----------------------------------------------------------------QIV----IKPYQK.EW
I0KB45_9BACT/5-175----------------------------------------------------------------PIH----IADYSP.AW
D2Q1S7_KRIFD/4-173----------------------------------------------------------------SIT----IVRPDP.TW
D3PXU1_STANL/211-382----------------------------------------------------------------TIT----MADYSP.QW
B2VVX8_PYRTR/3-161----------------------------------------------------------------.VV----VEQYNT.EW
Q837C3_ENTFA/3-163----------------------------------------------------------------.VI----VTEYQP.AW
E8SKB4_STAPH/10-169----------------------------------------------------------------...----TENQQP.FY
G8SCS9_ACTS5/212-375----------------------------------------------------------------ELH----IVPPDP.GW
H6R024_NOCCG/201-383----------------------------------------------------------------ELR----LVAPDP.DW
D3HRN8_LEGLN/9-169----------------------------------------------------------------LIE----VHPYDA.NW
F0JD71_DESDE/16-183----------------------------------------------------------------RIR----LVPPDP.AW
H6LKW2_ACEWD/9-173----------------------------------------------------------------PII----LKEHNP.KY
COAE_MYCLE/210-398----------------------------------------------------------------PAG----LVTSDP.IW
R9TA40_9EURY/18-177----------------------------------------------------------------PIR----LTEHNA.EW
R5NDU7_9BACT/18-177----------------------------------------------------------------PIY----LTEHQP.YW
E3FUL3_STIAD/60-221----------------------------------------------------------------.LE----VRAYDP.SW
C7QZ85_JONDD/13-170----------------------------------------------------------------PVE----LKEADP.LW
U5LFL0_9BACI/7-168----------------------------------------------------------------KVD----VQPYSR.SW
B1YEV6_EXIS2/3-163----------------------------------------------------------------QVI----VTPYQS.SW
G9N0Q7_HYPVG/30-192----------------------------------------------------------------KIE----IVEPDA.SW
D0LRK4_HALO1/63-218----------------------------------------------------------------...----.KDYDP.AW
K9UHL6_9CYAN/4-165----------------------------------------------------------------KVE----VVPHDR.NW
Q0U0A7_PHANO/2-162----------------------------------------------------------------PIT----VLSYDP.AW
K9X9I3_9CHRO/3-165----------------------------------------------------------------KVE----VVPHNP.QW
H1ZDJ0_MYROD/6-189----------------------------------------------------------------...----.EPYNP.KW
C6CSH6_PAESJ/2-161----------------------------------------------------------------EVR----LSDYKE.EW
I0KC39_9BACT/4-171----------------------------------------------------------------PVE----IVPFDP.RW
A5I0C7_CLOBH/9-169----------------------------------------------------------------IIE----VVPHNP.RW
D1CF17_THET1/8-168----------------------------------------------------------------PVI----VVPYDP.EW
U5VXI8_9ACTN/209-373----------------------------------------------------------------ALH----VVPSDP.TW
R7XXE7_9ACTN/3-160----------------------------------------------------------------.VE----VVAWSA.DW
C7N047_SACVD/214-386----------------------------------------------------------------PPK----LVPADP.TW
R4KA00_CLOPA/5-167----------------------------------------------------------------KVI----VVPYDS.KW
F2F973_SOLSS/9-173----------------------------------------------------------------EVV----LVPYEA.GW
B1MAV8_MYCA9/211-383----------------------------------------------------------------.PE----LMPADP.TW
R7NHU4_9MOLU/7-167----------------------------------------------------------------IVE----LVDYDS.NW
G0G0L6_AMYMS/196-366----------------------------------------------------------------.PK----IAEYDL.GW
S5RIM5_9STRE/14-176----------------------------------------------------------------EVL----LLSYQE.SW
A8FEV1_BACP2/150-310----------------------------------------------------------------KVE----VIEYQT.SW
Q2KDV8_RHIEC/3-162----------------------------------------------------------------AIK----VVDYDP.SW
R5T2X8_9FIRM/18-179----------------------------------------------------------------PIF----LVPHKK.EW
G4L3G4_TETHN/32-191----------------------------------------------------------------PIK----LVDYNP.NW
K9U9A9_9CYAN/3-168----------------------------------------------------------------NIV----IVEYDR.QW
Y2534_DEIRA/32-184----------------------------------------------------------------..D----LISPDPGRW
A8FA86_BACP2/8-167----------------------------------------------------------------EVF----LVPWSA.EW
R8BCT1_TOGMI/34-197----------------------------------------------------------------TIE----IVEPDP.SW
R5X925_9FIRM/14-176----------------------------------------------------------------AVA----VEAHKA.EW
GRPB_BACPE/8-173----------------------------------------------------------------EVI----LVTHSE.NW
R6RNY7_9FIRM/13-174----------------------------------------------------------------.VT----LMPYQE.EW
E3EIR7_PAEPS/4-166----------------------------------------------------------------QVV----ISEYNP.QW
A5I050_CLOBH/2-163----------------------------------------------------------------KVQ----VVEYNS.EW
H1VDI7_COLHI/31-193----------------------------------------------------------------.LS----IEPPDP.AW
N4UZ58_COLOR/309-472----------------------------------------------------------------PLA----IEPPNP.DW
C8XAW5_NAKMY/211-382----------------------------------------------------------------.PR----LVAPRA.SW
C8WAQ0_ATOPD/20-179----------------------------------------------------------------PIF----LVEHND.KW
K0K1A8_SACES/37-195----------------------------------------------------------------NVV----ITPYDP.EW
D9SV06_CLOC7/4-168----------------------------------------------------------------EML----VVPYND.EW
D7BEE1_MEISD/4-169----------------------------------------------------------------PIE----LLEYDP.SW
Q74CV0_GEOSL/2-165----------------------------------------------------------------RIA----IEEYSS.AW
U5L973_9BACI/9-172----------------------------------------------------------------EVR----LADHSP.GW
R7K4C0_9FIRM/184-345----------------------------------------------------------------PIE----LMPHDD.GF
A1R6F2_ARTAT/218-384----------------------------------------------------------------...----...SKG.EW
Q2G068_STAA8/12-170----------------------------------------------------------------...----..DLTN.CF
Q0RJB4_FRAAA/11-173----------------------------------------------------------------PVD----LVAHDP.GW
A1CSD9_ASPCL/61-222----------------------------------------------------------------LIE----IVDYNP.LW
F8B2Q7_FRADG/43-199----------------------------------------------------------------VIR----IVDYDP.AW
D4M8N7_9BACT/11-171----------------------------------------------------------------PIF----LVRHHE.EW
R6IAQ5_9FIRM/8-176----------------------------------------------------------------DVR----LFEHNK.EW
F0T2H2_SYNGF/9-169----------------------------------------------------------------.VA----LYDHEI.SW
D3EFC9_GEOS4/5-164----------------------------------------------------------------.LI----VVEYNP.NW
B6QP89_TALMQ/30-189----------------------------------------------------------------KIS----IVEPNP.AW
R6CC32_9CLOT/13-180----------------------------------------------------------------EVQ----IFPYDP.QW
M2RUD6_COCSN/3-161----------------------------------------------------------------.VT----VDQYRE.EW
J5JV21_BEAB2/22-188----------------------------------------------------------------TID----IVDPDP.SW
Q4WKR7_ASPFU/23-185----------------------------------------------------------------PIE----IVDYDP.SW
M3BXF1_SPHMS/30-197----------------------------------------------------------------KVA----IVVPNP.LW
F4LJZ3_TREBD/18-177----------------------------------------------------------------PIF----LTAHQD.CW
L0KBF6_HALHC/18-182----------------------------------------------------------------PII----LREHNP.EY
F0ZS88_DICPU/4-173----------------------------------------------------------------..E----IEPHNI.NW
B0RAH0_CLAMS/4-161----------------------------------------------------------------MIR----LEEHRS.GW
E1RF13_METP4/16-180----------------------------------------------------------------PII----LSDYNP.AW
W6RXI5_9CLOT/18-181----------------------------------------------------------------PII----LKEHNP.EY
E8ND31_MICTS/47-196----------------------------------------------------------------RA.----.......GW
A1AP29_PELPD/17-185----------------------------------------------------------------RIE----VVPYDA.CW
G8PS80_PSEUV/5-164----------------------------------------------------------------KVK----VVDAQA.RW
C5C2T3_BEUC1/32-194----------------------------------------------------------------PIT----VVDYDE.SW
G9NLT9_HYPAI/30-192----------------------------------------------------------------KLE----IADPNP.LW
J5JAK5_BEAB2/35-197----------------------------------------------------------------PLA----IEEPKP.EW
A6WBN4_KINRD/58-214----------------------------------------------------------------ELE----LHDHDE.RW
C8VG40_EMENI/27-192----------------------------------------------------------------RIE----IVEPDP.AW
F4L6A7_HALH1/6-175----------------------------------------------------------------KIT----ISPYNP.EW
E3J2T3_FRASU/21-178----------------------------------------------------------------RIV----IAAYRP.EW
COAE_MYCTU/210-395----------------------------------------------------------------PAR----LVPADP.SW
C0QYF8_BRAHW/3-170----------------------------------------------------------------IIE----IVDYDP.NW
Q6CG34_YARLI/3-172----------------------------------------------------------------.IV----ICPPSP.SW
C2X2A2_BACCE/3-163----------------------------------------------------------------RIV----VVPYEN.HW
I2B7X5_SHIBC/41-199----------------------------------------------------------------NIN----VDRYDP.EW
R6QU09_9FIRM/17-181----------------------------------------------------------------PIV----LCGHKE.EW
A1SCK2_NOCSJ/16-200----------------------------------------------------------------PAA----LQAHDP.AW
G8LV75_CLOCD/29-188----------------------------------------------------------------PIT----LVEYDP.NW
C1ABX5_GEMAT/4-164----------------------------------------------------------------TVR----VVAYDA.SW
F8L5H4_SIMNZ/6-169----------------------------------------------------------------KIE----VVPYDP.SW
A1TAF0_MYCVP/210-390----------------------------------------------------------------EAR----LVPSDP.SW
E5ADM9_LEPMJ/589-747----------------------------------------------------------------.VV----VEQYDP.KW
W0E5J7_9FIRM/3-163----------------------------------------------------------------VVV----VNDYNY.QW
D6D4R0_9BACE/19-178----------------------------------------------------------------PIT----LTAHQD.YW
G7MD75_9CLOT/6-165----------------------------------------------------------------.VV----VEDYNP.EW
D3E8X8_GEOS4/3-165----------------------------------------------------------------EVI----VTPYNP.DW
E1QDH8_DESB2/16-184----------------------------------------------------------------PVE----IVDPDP.RW
L0J6E6_9MYCO/3-164----------------------------------------------------------------.VT----VVEYDT.HW
R6R8F5_9FIRM/2-160----------------------------------------------------------------...----VLPYDP.AW
L0DYV6_THIND/8-167----------------------------------------------------------------GVT----LVGYDA.SW
F8D8W2_HALXS/8-171----------------------------------------------------------------TVE----LEPYND.EW
E3FRK9_STIAD/45-209----------------------------------------------------------------NID----VREYDP.RW
R6CUV5_9CLOT/17-184----------------------------------------------------------------EVR----IVPYDP.QW
R5RQF7_9FIRM/7-166----------------------------------------------------------------KVE----VVPYNE.DW
Q5ZWJ7_LEGPH/174-340----------------------------------------------------------------SVE----LVPYDS.QW
L0IZF9_9MYCO/209-374----------------------------------------------------------------KLE----LTPYDP.TW
B2HQZ8_MYCMM/210-396----------------------------------------------------------------PAR----VVPADP.SW
G9N260_HYPVG/30-192----------------------------------------------------------------PIE----IVEPDP.SW
A4FFQ9_SACEN/32-191----------------------------------------------------------------PVT----LVDYDP.RW
J7L574_NOCAA/29-191----------------------------------------------------------------PIH----VVDHDP.EW
R7A6W2_9FIRM/28-187----------------------------------------------------------------TIY----LSEYDP.NW
R4SP20_AMYOR/28-187----------------------------------------------------------------TVT----LAEYDP.EW
E9SZZ4_RHOHA/222-405----------------------------------------------------------------PPV----VRPADP.DW
K9VQD2_9CYAN/4-164----------------------------------------------------------------KVE----VVPHDP.NW
R5LK04_9MOLU/7-167----------------------------------------------------------------TVK----LEEYNP.KW
Q0CCF9_ASPTN/28-183----------------------------------------------------------------PLE----IVEYNP.EW
D3FCW0_CONWI/18-181----------------------------------------------------------------.VR----ILPPDR.SW
Q81PZ3_BACAN/4-164----------------------------------------------------------------QIV----IKPYEK.EW
A6WEQ7_KINRD/4-189----------------------------------------------------------------PAV----LHPYDP.AW
I5AW69_EUBCE/66-227----------------------------------------------------------------PIF----LVAHDD.RW
B9JCE0_AGRRK/17-178----------------------------------------------------------------CVT----LAVPNA.RW
A6T980_KLEP7/3-163----------------------------------------------------------------ILT----VVDYDE.MW
G3JP53_CORMM/36-199----------------------------------------------------------------PLA----ITEAQP.SW
T0JR78_COLGC/30-193----------------------------------------------------------------PLA----IEPPNP.AW
Q12KI9_SHEDO/3-162----------------------------------------------------------------.VD----VVPYRL.GW
S3E6I7_GLAL2/3-173----------------------------------------------------------------QIT----ILPHNP.LW
R6IMI3_9CLOT/8-178----------------------------------------------------------------AVA----LYPHEK.AW
M1MIC4_9CLOT/5-169----------------------------------------------------------------NVV----VLPYDF.NW
D5ELY3_CORAD/2-162----------------------------------------------------------------KIE----VVPYSD.EW
F4FGK1_VERMA/211-377----------------------------------------------------------------RVT----LTEPDP.TW
B9E8H7_MACCJ/3-152----------------------------------------------------------------QVM----IVPYDS.IW
G8NQJ1_GRAMM/17-177----------------------------------------------------------------TVI----VVEYDP.SW

PF07733

Q7NC15_MYCGA/866-1293----------------------------------------------------------------DKL....IELVWN-KA
DPO3_MYCGE/833-1253----------------------------------------------------------------QKL....IDKTWK-QA
Q8EUK5_MYCPE/836-1261----------------------------------------------------------------DKL....KQLIYQ-KS
DPO3_UREPA/820-1245----------------------------------------------------------------QKT....IDYVYH-TA
DPO3_MYCPU/814-1239----------------------------------------------------------------IKL....KKLVYE-NA
DPO3_THEMA/755-1179----------------------------------------------------------------EIV....RNLTMK-RA
DPO3_LACPL/824-1248----------------------------------------------------------------AEI....EKLTMD-RA
Q831W8_ENTFA/829-1259----------------------------------------------------------------QEI....TDLSYN-RA
DPO3_BACSU/824-1248----------------------------------------------------------------EEI....REMSYQ-RA
DPO3_STRMU/838-1270----------------------------------------------------------------EKV....AEMTYE-KA
DPO3_LACLA/1015-1445----------------------------------------------------------------ERI....VRLTYE-KA
Q97DN0_CLOAB/831-1259----------------------------------------------------------------QTI....KDIAYE-KA
DPO3_CALS4/788-1212----------------------------------------------------------------EEL....RRITLE-KA
DPO3_CLOPE/835-1259----------------------------------------------------------------EEI....RNMTMN-KV
YORL_BACSU/351-824----------------------------------------------------------------RYL....LKLIED-GF
Q855Z2_9CAUD/296-787----------------------------------------------------------------KPL....RFVCDK-GL
Q9S291_STRCO/316-759----------------------------------------------------------------PHLVGAGRRTAQR-AL
Q97JQ0_CLOAB/303-740----------------------------------------------------------------KKL....NKLPKN-EL
A0A089QXJ1_MYCTU/349-763----------------------------------------------------------------SWL....RSLVMA-GA
DNAE2_CORGL/326-732----------------------------------------------------------------SWL....AHLVST-RI
DNE22_RHIME/271-694----------------------------------------------------------------QSL....QHYTWE-GV
DNE21_AGRFC/274-698----------------------------------------------------------------QAL....EKMVWE-AV
DNAE2_CAUCR/276-710----------------------------------------------------------------QHL....TDLTWK-GA
A0A0F6IRC6_BRUSS/279-717----------------------------------------------------------------QHL....YDLVWE-GA
DNAE2_BRADU/286-718----------------------------------------------------------------GHL....EDLTWA-GV
DNE21_RHIME/278-706----------------------------------------------------------------ESL....RRLVAE-GA
DNAE2_RHILO/282-713----------------------------------------------------------------AEL....ERLARE-GA
DNAE2_VIBPA/269-695----------------------------------------------------------------SYL....RMLVEQ-GK
DNAE2_XANCP/316-739----------------------------------------------------------------SYL....RQLTEA-GM
DNAE2_PSEPK/277-701----------------------------------------------------------------SWL....RELCEQ-GM
DNAE2_RHOBA/384-808----------------------------------------------------------------EHL....KRLTWE-GA
DNAE2_RALSO/300-737----------------------------------------------------------------GYL....LAEVMA-GA
DNAE2_BORPA/290-714----------------------------------------------------------------SYL....RQQTYL-GA
DPO3A_MYCPN/248-673----------------------------------------------------------------QML....SEQCQL-AL
DPO3A_MYCGE/248-673----------------------------------------------------------------AVL....ESLCQT-NL
Q98PK3_MYCPU/229-653----------------------------------------------------------------DFL....VKILKE-SW
DPO3A_THEMA/164-518----------------------------------------------------------------ELL....IKK...-..
Q7NBN6_MYCGA/233-673----------------------------------------------------------------QYL....VELCQT-RF
DPO3A_UREPA/227-651----------------------------------------------------------------EIL....KQLCIS-GL
Q8EWK5_MYCPE/241-666----------------------------------------------------------------ALL....HKFCMD-GL
Q7UUS6_RHOBA/322-756----------------------------------------------------------------DYL....RKLCEQ-GL
Q9ACS8_STRCO/337-788----------------------------------------------------------------SWL....RKEVLT-GL
Q8G7V8_BIFLO/321-762----------------------------------------------------------------SLF....LKKVEE-GL
Q83G24_TROWT/311-752----------------------------------------------------------------SWF....ASEVKR-GI
Q82AB6_STRAW/315-756----------------------------------------------------------------TWF....QEEVRR-GM
Q8W6C3_9CAUD/372-814----------------------------------------------------------------QVL....REEIEQ-FI
Q8NNQ8_CORGL/324-769----------------------------------------------------------------TWL....HHEVMA-GL
DPO3A_MYCTU/319-762----------------------------------------------------------------SWL....RHEVDA-GL
DPO3A_LACLA/246-680----------------------------------------------------------------EHL....REEATL-GL
Q8DQ86_STRR6/249-668----------------------------------------------------------------EEL....RERAEL-GL
A0A0E1EST6_STRPY/242-661----------------------------------------------------------------QEL....QELTEA-GL
Q8E002_STRA5/240-659----------------------------------------------------------------EEL....RTLTQN-NL
Q8KE50_CHLTE/299-761----------------------------------------------------------------EYL....RHLTWE-GA
DPO3A_CHLTR/336-773----------------------------------------------------------------AFL....EELCEQ-GL
Q8F9D7_LEPIN/264-695----------------------------------------------------------------SYL....EKLIWE-GI
DPO3A_BORBU/301-723----------------------------------------------------------------EYL....EHLTLE-GL
DPO3A_TREPA/300-724----------------------------------------------------------------HYI....RHLVHR-GL
Q7P5E9_FUSNV/291-716----------------------------------------------------------------EYL....KTICHT-NI
Q8KTR8_TREPR/302-737----------------------------------------------------------------SAL....ACTLGS-GL
DPO3A_CAMJE/321-753----------------------------------------------------------------MVF....EELCKK-GL
DPO3A_HELPY/320-761----------------------------------------------------------------SYF....AYKARE-GL
Q7M7Z6_WOLSU/313-756----------------------------------------------------------------DYF....AYKCRE-GL
Q7VGQ0_HELHP/336-776----------------------------------------------------------------VYF....AFKCRQ-GL
Q8R912_CALS4/297-719----------------------------------------------------------------EYL....RNLCYE-GL
Q97LN8_CLOAB/302-724----------------------------------------------------------------EYL....KKLCYE-GL
Q8XNH3_CLOPE/297-742----------------------------------------------------------------EYL....RKTCFD-GL
DPO3A_STAAM/247-667----------------------------------------------------------------KYL....WRVLVT-QL
Q92BE1_LISIN/282-704----------------------------------------------------------------DVL....RETAYA-GL
C7CYL0_ENTFL/281-704----------------------------------------------------------------SYL....RSLCLE-KL
DPO3A_BACHD/279-703----------------------------------------------------------------DYL....RKLCEQ-GA
Q81KY5_BACAN/282-705----------------------------------------------------------------MYL....RRVCEE-GL
DPO3A_BACSU/281-704----------------------------------------------------------------DYL....TDICME-GL
DPO3A_AQUAE/311-763----------------------------------------------------------------EYL....RELAYK-GL
Q8PAW8_XANCP/303-750----------------------------------------------------------------SWI....RSQSRD-GL
Q7NZL1_CHRVO/292-727----------------------------------------------------------------DFL....VHEAKR-GL
DPO3A_NEIMA/294-728----------------------------------------------------------------DYL....VKLSNE-GL
Q7VWC8_BORPE/295-736----------------------------------------------------------------DYL....VQLSEE-GL
Q82TC2_NITEU/294-744----------------------------------------------------------------QHL....RELAQT-GL
Q8XXB1_RALSO/298-737----------------------------------------------------------------DYL....VHLAKD-GL
Q7VRD1_BLOFL/290-735----------------------------------------------------------------NFL....VTQARL-GL
Q8D2H5_WIGBR/290-735----------------------------------------------------------------KYI....INKSYL-GL
DPO3A_BUCBP/294-739----------------------------------------------------------------DFL....VMKAKK-GM
DPO3A_BUCAI/291-736----------------------------------------------------------------KYL....IKEAYK-GI
DPO3A_PSEFL/290-737----------------------------------------------------------------EYF....RKVSFD-GL
Q83C00_COXBU/287-724----------------------------------------------------------------DYF....RAQAKQ-GL
DPO3A_RICPR/286-734----------------------------------------------------------------YLI....RKYATE-GL
DPO3A_CAUCR/298-728----------------------------------------------------------------EEL....EHQARE-GL
Q92QM9_RHIME/324-756----------------------------------------------------------------AEL....RRQAEE-GL
Q89KN8_BRADU/302-734----------------------------------------------------------------AEL....KRQAEE-GL

PF04607

Q8F1P4_LEPIN/241-352-----------------------------------------------------------------------GRAKHFYSI
Q7NBS7_MYCGA/247-359-----------------------------------------------------------------------SRIKSVYST
Q83GJ6_TROWT/256-367-----------------------------------------------------------------------GRPKEIYSI
YWAC_BACSU/57-179-----------------------------------------------------------------------SRVKSFESI
Q8DU97_STRMU/42-162-----------------------------------------------------------------------GRVKPIESI
Q7NGY9_GLOVI/272-383-----------------------------------------------------------------------GRPKHLWGI
Q7VM28_HAEDU/245-356-----------------------------------------------------------------------GRPKHIYSI
Q9X388_BACAN/65-209-----------------------------------------------------------------------SRVKDAGHL
Q8EBQ4_SHEON/250-361-----------------------------------------------------------------------GRPKHIYSI
Q7MAV7_PORGI/253-368-----------------------------------------------------------------------GRTKSINSI
Q8LSZ7_CHLRE/410-527-----------------------------------------------------------------------GRPKNLYGI
Q7NRS8_CHRVO/260-371-----------------------------------------------------------------------GRPKHIYSI
Q8XKG7_CLOPE/50-185-----------------------------------------------------------------------TRVKSASSL
Q8A9W5_BACTN/249-366-----------------------------------------------------------------------GRTKSIHSI
Q8XJZ8_CLOPE/66-208-----------------------------------------------------------------------SRIKNPDRL
Q8DLB2_THEEB/256-367-----------------------------------------------------------------------GRPKHLYSI
Q9KBP0_BACHD/57-179-----------------------------------------------------------------------SRVKSPESI
Q88BE4_PSESM/235-346-----------------------------------------------------------------------GRQKHLYGI
Q7U332_HAEDU/235-346-----------------------------------------------------------------------GREKHLYAL
Q9K903_BACHD/43-163-----------------------------------------------------------------------GRVKPISSI
Q89K51_BRADU/270-381-----------------------------------------------------------------------GRRKKPFSI
Q830U9_ENTFA/54-174-----------------------------------------------------------------------GRVKPVDSI
SPOT_SYNY3/267-378-----------------------------------------------------------------------GRPKHLYGI
Q8FPL1_COREF/265-376-----------------------------------------------------------------------GRPKHYWSI
Q97DY0_CLOAB/61-183-----------------------------------------------------------------------DRVKDPKSI
Q9CIJ5_LACLA/36-155-----------------------------------------------------------------------GRVKRRESI
Q8EJU8_SHEON/235-346-----------------------------------------------------------------------GREKNLYSI
Q8DUK1_STRMU/46-172-----------------------------------------------------------------------ARIKTNESM
Q9RTX1_DEIRA/64-194-----------------------------------------------------------------------ARLKKPASL
Q8DZK6_STRA5/44-164-----------------------------------------------------------------------GRVKSVESI
O25466_HELPY/265-376-----------------------------------------------------------------------TRVKRPYSI
Q820X2_COXBU/235-346-----------------------------------------------------------------------GREKHLYSI
YJBM_BACSU/45-164-----------------------------------------------------------------------GRVKPVASI
Q9CH66_LACLA/57-179-----------------------------------------------------------------------HRLKSPESI
Q8P5T8_XANCP/255-366-----------------------------------------------------------------------SRIKTPWSI
Q7U362_BORPE/282-393-----------------------------------------------------------------------GREKTLYGV
Q83BW2_COXBU/241-352-----------------------------------------------------------------------GRAKHIYSI
Q9A812_CAUCR/255-366-----------------------------------------------------------------------GREKSPYSI
Q8XJ23_CLOPE/233-344-----------------------------------------------------------------------GRPKHFYSI
Q885Y7_PSESM/259-370-----------------------------------------------------------------------GRAKHIYSI
Q9WZI8_THEMA/289-400-----------------------------------------------------------------------GRYKHYYSI
Q8RAL8_CALS4/234-345-----------------------------------------------------------------------GRPKHFYSI
Q7U324_HELHP/252-362-----------------------------------------------------------------------SRVKRYYSI
Q97LC0_CLOAB/45-165-----------------------------------------------------------------------GRVKEISSI
SPOT_AQUAE/237-348-----------------------------------------------------------------------YRSKHYYSI
Q7MAV5_PORGI/262-377-----------------------------------------------------------------------ARVKSVYSI
SPOT_BORBU/252-364-----------------------------------------------------------------------VRSKHFYSI
Q818C3_BACCR/50-172-----------------------------------------------------------------------TRLKQPESI
Q8KC80_CHLTE/244-357-----------------------------------------------------------------------GRAKHLYSI
RELA_HAEIN/253-364-----------------------------------------------------------------------GRPKHIYSI
Q8XXG1_RALSO/249-360-----------------------------------------------------------------------GREKTLYSI
Q7TTS4_SYNPX/282-392-----------------------------------------------------------------------GRPKHLFGI
Q92D54_LISMO/43-163-----------------------------------------------------------------------GRVKPVASI
Q8FNX4_COREF/61-188-----------------------------------------------------------------------TRLKEWSSL
Q81GK0_BACCR/48-168-----------------------------------------------------------------------GRVKSVASI
Q9PQK8_UREPA/246-355-----------------------------------------------------------------------WRLKGIYST
Q7D045_AGRFC/236-347-----------------------------------------------------------------------GRQKKPYSV
Q889A5_PSESM/52-191-----------------------------------------------------------------------SRIKDPGHL
Q7MBD5_CHRVO/250-361-----------------------------------------------------------------------GREKNLYSI
Q7MUI3_PORGI/30-160-----------------------------------------------------------------------HRTKSVMSI
Q8CXQ4_MYCPE/252-362-----------------------------------------------------------------------ERIKGIYST
Q8A0M3_BACTN/251-368-----------------------------------------------------------------------ARVKSIYSI
CRSH_ARATH/309-434-----------------------------------------------------------------------GRYKSRYSM
Q898M4_CLOTE/66-201-----------------------------------------------------------------------SRVKSPKSL
Q8DYZ3_STRA5/45-171-----------------------------------------------------------------------GRIKTSDSM
Q8NR76_CORGL/66-188-----------------------------------------------------------------------SRLKTPESI
Q8G4H5_BIFLO/112-234-----------------------------------------------------------------------RRLKSVSSI
RELA_MYCLE/290-401-----------------------------------------------------------------------GRPKHYWSI
Q8Y8U1_LISMO/51-173-----------------------------------------------------------------------SRVKSLESI
Q8RF04_FUSNN/66-209-----------------------------------------------------------------------RRVKKPTHL
Q8XZ30_RALSO/254-365-----------------------------------------------------------------------GRPKHIYSI
Q8P6N1_XANCP/244-355-----------------------------------------------------------------------GRPKHIYSI
Q8ERT0_OCEIH/42-162-----------------------------------------------------------------------ARVKPIPSI
Q7VTF3_BORPE/258-369-----------------------------------------------------------------------GRPKHIYSI
Q7MAH7_WOLSU/253-363-----------------------------------------------------------------------SRIKRHYSI
B0TF84_HELMI/237-347-----------------------------------------------------------------------GRPKHFYSI
B5I035_9ACTN/197-306-----------------------------------------------------------------------GRPKHYYSV
D3FSJ4_BACPE/58-179-----------------------------------------------------------------------SRLKSPESI
I1QPB8_ORYGL/428-537-----------------------------------------------------------------------GRHKSLYSI
M1A0E5_SOLTU/182-305-----------------------------------------------------------------------GRYKSRYST
M1B3M7_SOLTU/437-545-----------------------------------------------------------------------GRHKSLYSI
SPOT_ECOLI/235-345-----------------------------------------------------------------------GREKHLYSI
Q1D7G8_MYXXD/252-362-----------------------------------------------------------------------GRFKHVYSI
Q2FXU1_STAA8/240-350-----------------------------------------------------------------------GRPKHIYSI
Q2G204_STAA8/43-162-----------------------------------------------------------------------GRVKPIASI
Q2G2L7_STAA8/77-198-----------------------------------------------------------------------RRVKEMRSL
RSH_BRUA2/235-344-----------------------------------------------------------------------SRQKKPWSV
CRSH1_ORYSJ/316-438-----------------------------------------------------------------------GRYKSRFST
Q8DPU2_STRR6/44-163-----------------------------------------------------------------------GRVKPIESI
Q8DXB2_STRA5/240-348-----------------------------------------------------------------------GRPKHIYSI
Q8R5V7_FUSNN/234-344-----------------------------------------------------------------------GRFKHFYSI
Q9A0A1_STRP1/53-178-----------------------------------------------------------------------SRIKSEASM
R4UJ80_9MOLU/240-350-----------------------------------------------------------------------GRSKSIYSI

PF03445

Q74E96_GEOSL/70-216IHDELN-------------------------------VLEME---------------------------------RFLAI
Q3SMK2_THIDA/311-451IQQLSR-------------------------------NMLAQ---------------------------------G....
A5FH19_FLAJ1/315-456IMQLLQ-------------------------------GYLDQ---------------------------------N....
Q21RX0_RHOFT/287-419VDESVG-------------------------------LLVRG---------------------------------G....
Q2IEC2_ANADE/287-421VSDMVG-------------------------------GLLAA---------------------------------R....
Q72EX4_DESVH/364-509VDALAF-------------------------------DLLCE---------------------------------G....
B9M647_GEODF/87-225FTLLTK-------------------------------EYFTR---------------------------------R....
Q5KZZ8_GEOKA/30-169LRRCLA-------------------------------P....---------------------------------.....
Q0A740_ALKEH/45-190QQRLVA-------------------------------QLRAR---------------------------------G....
Q0A741_ALKEH/289-440LPSVAR-------------------------------QAREA---------------------------------N....
Q2SC90_HAHCH/335-475VARLAE-------------------------------TMIAH---------------------------------G....
B3E878_GEOLS/160-298IIELLQ-------------------------------FVVKA---------------------------------G....
Q0A6Y9_ALKEH/155-300QSDLAG-------------------------------DLLAD---------------------------------R....
A6VT54_MARMS/299-436WPTLIM-------------------------------NLIVT---------------------------------D....
Q5QUI2_IDILO/291-428LPEYLQ-------------------------------TFASR---------------------------------V....
Q1QZ78_CHRSD/292-424LPQLIQ-------------------------------TLMAQ---------------------------------G....
A7II29_XANP2/249-381IDSLVG-------------------------------VLDAD---------------------------------G....
Q4FUP8_PSYA2/335-467IGRYIR-------------------------------AQYQN---------------------------------G....
Q315G6_DESAG/341-482VAHVVR-------------------------------AVVEE---------------------------------G....
B3EBD1_GEOLS/155-293VQKLVV-------------------------------HLFGT---------------------------------G....
Q0A6Z3_ALKEH/338-481IHRLVG-------------------------------QMIDQ---------------------------------G....
A7HH07_ANADF/294-428VAEMTA-------------------------------VLLAG---------------------------------G....
Q89MS6_BRADU/287-419IETQTR-------------------------------VLRRQ---------------------------------G....
Q8NQY4_CORGL/299-437AAEVAS-------------------------------RFIDR---------------------------------G....
A9C1C5_DELAS/300-433ITRLVA-------------------------------ALHRG---------------------------------G....
Q3AAI0_CARHZ/302-445AEGVLT-------------------------------ALVSE---------------------------------K....
Q0AAW3_ALKEH/298-443TGKVVR-------------------------------DAFES---------------------------------H....
Q6AK79_DESPS/536-676MPNLIR-------------------------------TMIDA---------------------------------G....
O29291_ARCFU/289-422LTKSIS-------------------------------SLVMR---------------------------------G....
Q6LLZ3_PHOPR/291-423QQRLVA-------------------------------TLFNN---------------------------------G....
A7HF43_ANADF/290-424LAEMAS-------------------------------SLLAS---------------------------------G....
Q5WB02_BACSK/16-152LRKQVL-------------------------------NMSKP---------------------------------F....
A0KJY8_AERHH/290-422QQQLTR-------------------------------SLFGQ---------------------------------G....
A6W3F4_MARMS/295-433MTHTFT-------------------------------QLVLA---------------------------------D....
O67874_AQUAE/297-438VDDMAV-------------------------------NLFNE---------------------------------G....
Q0A6Z6_ALKEH/50-188FPEGQA-------------------------------ALQRS---------------------------------G....
Q0AAE6_ALKEH/308-446ARDTFV-------------------------------GMERE---------------------------------G....
A7HH08_ANADF/291-424VAEMAA-------------------------------ALVAG---------------------------------G....
A0QUE9_MYCS2/19-146LPAAAR-------------------------------ELV..---------------------------------G....
A0L6G8_MAGMM/300-438IPNILV-------------------------------NHIES---------------------------------G....
A4SW93_POLSQ/291-424ITNLIS-------------------------------LLHRN---------------------------------G....
Q0VMJ3_ALCBS/291-422LPDLVN-------------------------------ALMAQ---------------------------------G....
A5UUU0_ROSS1/301-438VTATVG-------------------------------GLLDA---------------------------------G....
Q2RWQ7_RHORT/287-419LDPLIQ-------------------------------GMGGS---------------------------------G....
Q5E0M6_VIBF1/300-437RSAVFQ-------------------------------GMMES---------------------------------N....
Q30QK1_SULDN/290-422FKSLII-------------------------------TLRAK---------------------------------G....
A1VJH4_POLNA/291-424ITRLIS-------------------------------LLQRS---------------------------------G....
A0M2M4_GRAFK/316-457IMILLN-------------------------------GYLKS---------------------------------N....
A1WYA2_HALHL/306-457VGYVAR-------------------------------EAWNN---------------------------------N....
A1TZ30_MARHV/318-457VSRLVD-------------------------------AMLAH---------------------------------G....
A5GB63_GEOUR/87-228FNRTAT-------------------------------DHFAR---------------------------------R....
A1STJ2_PSYIN/318-456LKNCFV-------------------------------RMVNE---------------------------------D....
A7HBY5_ANADF/161-300IRRLAI-------------------------------DLLAQ---------------------------------G....
Q47FJ9_DECAR/33-173LHVFQQ-------------------------------RAISG---------------------------------G....
Q2IP15_ANADE/291-425VSEMVS-------------------------------ALFAG---------------------------------G....
A7HHL2_ANADF/317-456LPRLVR-------------------------------ALMLE---------------------------------G....
Q47FJ8_DECAR/323-463VRQLSF-------------------------------NMLAQ---------------------------------G....
Q1GL32_RUEST/285-422IPQLLV-------------------------------QLVEA---------------------------------G....
Q8KDK9_CHLTE/323-469AEKLLK-------------------------------MYIAQ---------------------------------D....
Q9K6I7_BACHD/316-461IHDILS-------------------------------TLLRD---------------------------------G....
Q5P177_AROAE/314-454IRQLAL-------------------------------NLIAQ---------------------------------G....
Q31GK9_THICR/297-430IDALVI-------------------------------NLNNR---------------------------------G....
A7HH09_ANADF/26-158VARIVS-------------------------------ALLRR---------------------------------G....
Q7NTV8_CHRVO/285-417IDRLVR-------------------------------ILSGH---------------------------------G....
Q124J8_POLSJ/165-305IQRIAL-------------------------------ALLTQ---------------------------------G....
A7HF42_ANADF/295-425VTEMCA-------------------------------TVLGA---------------------------------G....
Q7MSB7_WOLSU/294-426TLTLIK-------------------------------TLQAQ---------------------------------G....
B0UVN5_HISS2/302-436QRDLFR-------------------------------ALLER---------------------------------G....
B6IWA9_RHOCS/320-456LPHLVH-------------------------------DLVQT---------------------------------G....
Q5SK35_THET8/277-408VARLVA-------------------------------GLFQA---------------------------------G....
Q72EX3_DESVH/178-317LHRLIR-------------------------------RYTSE---------------------------------G....
Q7MCI2_VIBVY/302-436RQTIFQ-------------------------------ALVES---------------------------------G....
Q88QY0_PSEPK/323-461ISQLVE-------------------------------RMLAH---------------------------------G....
Q8EDA6_SHEON/299-436IPVLLQ-------------------------------NLISA---------------------------------D....
Q9HZ07_PSEAE/290-420LDTLIA-------------------------------TLAGN---------------------------------G....

PF03710

GLNE_RHILO/579-826KFLIGV-------------------------------RLLAG---------------------------------S----
GLNE_CORGL/627-871LARIAS-------------------------------ADLLN---------------------------------M----
GLNE_VIBCH/33-281MVYIAW-------------------------------RDFCA---------------------------------S----
GLNE_HAEIN/589-842LLKVAA-------------------------------ADILG---------------------------------A----
GLNE_PASMU/587-841LLRIAA-------------------------------ADILG---------------------------------A----
GLNE_ECOLI/552-806LLRIAA-------------------------------ADIAG---------------------------------T----
GLNE_CAUCR/70-317HLLTAI-------------------------------SDLGG---------------------------------V----
GLNE_PSEAE/47-298QLRIIW-------------------------------RDLTR---------------------------------R----
GLNE_ECOLI/29-277MVRIAW-------------------------------AQTLA---------------------------------L----
GLNE_PASMU/46-295MAKLSF-------------------------------CQSLN---------------------------------L----
GLNE_CAUCR/589-828SFRIGV-------------------------------RVMSG---------------------------------T----
GLNE_VIBCH/556-810ILRIAA-------------------------------ADIAG---------------------------------V----
GLNE_HAEIN/46-299MAKLSF-------------------------------CQSLN---------------------------------L----
GLNE_RHILO/58-307HFLIAL-------------------------------ADLAG---------------------------------E----
M9X424_MANHA/24-271LARLSF-------------------------------IQSNK---------------------------------L----
GLNE_MYCTU/589-828LARIGS-------------------------------ADLLG---------------------------------L----
Q5F608_NEIG1/520-754VFRLAV-------------------------------QDLAG---------------------------------L----
GLNE_PSEAE/576-830GLRVAA-------------------------------SEIAG---------------------------------T----

PF17405

Q5KIJ7_CRYNJ/700-921.LSLIQIP........---------------.SSAR.DAITI---------------------------------K----
S8AXB6_PENO1/630-827.DDMLY..........---------------....D.EGDEV---------------------------------I----
D8QKX0_SCHCM/666-893.DAVLRL.........---------------..PAEVAQAYA---------------------------------A----
M3AM01_PSEFD/673-865.NKLVR..........---------------....G.GS...---------------------------------.----
H2M2T9_ORYLA/620-825.DDVVK..........---------------......TGSEV---------------------------------P----
NOL6_DROME/640-842.DQVYQLSPWF...KV---------------NKLKTKLPLGQ---------------------------------D----
U4LAZ7_PYROM/630-824.DTLVS..........---------------....G.EQ...---------------------------------.----
Q54EN2_DICDI/731-897.DQLIV..........---------------...........---------------------------------S----
H0YTW4_TAEGU/596-800.ESVIR..........---------------......TGKEA---------------------------------G----
H2B1K6_KAZAF/681-883.QDLLPLP........---------------..NLP.ASSNT---------------------------------S----
UTP22_YEAST/703-904.HNFLPLP........---------------..NLP.SSAKT---------------------------------S----
G3ALQ0_SPAPN/658-851.NNKLPV.........---------------..PL.....SG---------------------------------T----
G2R7X2_THITE/613-809.PDLLS..........---------------....L.KP...---------------------------------.----
G4T7W1_SERID/696-909VERILPH.........---------------..PASPMVRYS---------------------------------S----
K3WBL1_PYTUL/628-840.YSALNVEEVPA..IS---------------TKKSS.GLSAS---------------------------------F----
J9K0G8_ACYPI/619-833.ESVLEN.........---------------..PFLVPIGFD---------------------------------Y----
W5J7Q1_ANODA/704-908.EAALQP.........---------------..WPPKEIEVL---------------------------------H----
B4JHB6_DROGR/615-817.DIVHSLTPSF...KV---------------AKLQTKLQLKQ---------------------------------D----
M2NLG7_BAUCO/565-759.NRLLR..........---------------....G.SL...---------------------------------.----
A0A0D1C533_USTMA/858-1074.ESLLDID........---------------..TSLARAAHL---------------------------------V----
J3KKN7_COCIM/615-811.DSEKF..........---------------....P.AIRDV---------------------------------M----
B5RT80_DEBHA/668-867.NNRLPTP........---------------..LLP.SASNQ---------------------------------S----
I2H5R1_TETBL/720-922.QDLLPLP........---------------..NLP.ASSKT---------------------------------S----
B2AL59_PODAN/611-806.AVLLS..........---------------....I.KP...---------------------------------.----
S3BW46_OPHP1/638-843.AAMVP..........---------------....I.TP...---------------------------------.----
F4P4W3_BATDJ/687-884.ESITN..........---------------...........---------------------------------.----
G4N9I5_MAGO7/611-806.TSLIH..........---------------....A.KP...---------------------------------.----
G7XFJ4_ASPKW/623-821.DDKLR..........---------------....E.GGDDV---------------------------------F----
T5AFI7_OPHSC/602-797.SSTIQ..........---------------....L.SH...---------------------------------.----
H9JCB7_BOMMO/619-830.DSVLV..........---------------...RKQYAGES---------------------------------S----
A7S7H5_NEMVE/605-831.DCLLQRNNGTSTTPS---------------ESQQAPTSSSI---------------------------------Q----
G9NYU4_HYPAI/603-798.SSIIN..........---------------....L.SH...---------------------------------.----
NOL6_DROPS/659-861.DLVYQLSPWF...KV---------------SKVKTKLELQQ---------------------------------D----
G8ZWX5_TORDC/679-881.QDLLPLP........---------------..NLP.GCSKT---------------------------------S----
W5KKI6_ASTMX/629-835.HEVIK..........---------------......LRKEI---------------------------------K----
M2PAE8_CERS8/703-929.DSLLRL.........---------------..PPSIASVYQ---------------------------------A----
UTP22_SCHPO/620-813.RVYVH..........---------------......SKISP---------------------------------N----
E0VHG7_PEDHC/632-832.ESYTS..........---------------...........---------------------------------.----
A5DT88_LODEL/708-906.EQRLPVP........---------------..LLP.TASNQ---------------------------------V----
M9LQU0_PSEA3/823-1039.DSLLEVD........---------------..STLARTAHV---------------------------------V----
A1CJ23_ASPCL/576-774.EALLS..........---------------....S.CGDGI---------------------------------I----
G3B4V1_CANTC/656-855.NKKLPIP........---------------..LLP.SGSNQ---------------------------------P----
M7WDQ1_RHOT1/772-987.DHLVVEPL.......---------------AVRRQ.IYLED---------------------------------S----
H2YJS5_CIOSA/572-776.EEIIS..........---------------......LPWKQ---------------------------------L----
G0VFC1_NAUCC/685-887.QDLLPLP........---------------..NLP.ASSTT---------------------------------S----
U7Q6Q9_SPOS1/648-856.SALVP..........---------------....I.TP...---------------------------------.----
C5DLD6_LACTC/690-891.QELIPLP........---------------..NLP.ASTSI---------------------------------S----
C7YP94_NECH7/608-803.SSVIA..........---------------....L.SH...---------------------------------.----
J3NVZ7_GAGT3/604-799.TSLIH..........---------------....A.KA...---------------------------------.----
T1EE31_HELRO/505-717.DHVLKPV........---------------.EGKASSDSSI---------------------------------Y----
N1PEU7_DOTSN/672-866.SKLVR..........---------------....G.SS...---------------------------------.----
U5H217_USTV1/782-994.DHLMVESE.......---------------ALRRA.LYLED---------------------------------A----
Q7S1X8_NEUCR/604-803.TELIP..........---------------....I.KP...---------------------------------.----
J5JXU5_BEAB2/596-791.ATVID..........---------------....I.SN...---------------------------------.----
R1EK47_BOTPV/687-883.SRLLS..........---------------....G.SG...---------------------------------Q----
B0DGR0_LACBS/686-914.DSVLRL.........---------------..PESISSKYL---------------------------------A----
H9GJA7_ANOCA/630-836.ESVIK..........---------------......MGREP---------------------------------A----
D5GP17_TUBMM/637-828.TTAVG..........---------------....G.GR...---------------------------------.----
K7IX79_NASVI/638-851.EEFLKM.........---------------...KKVKVWGF---------------------------------R----
Q0CBE8_ASPTN/607-805.DDQLR..........---------------....T.CGHGV---------------------------------V----
F8Q1T2_SERL3/652-880.DSSLHF.........---------------..PDSVLDLHE---------------------------------S----
E9E4A5_METAQ/614-809.SPLIG..........---------------....L.SH...---------------------------------.----
J7RUP2_KAZNA/701-903.QNLLPLP........---------------..NLP.ANSKT---------------------------------S----
H3GEK8_PHYRM/607-817.YSALDVEEPA....G---------------LKKAK.ATNAS---------------------------------F----
A7TPZ3_VANPO/697-899.QNLLPLP........---------------..NLP.SSSKT---------------------------------S----
A0A0J9XU34_BRUMA/572-769.EEILP..........---------------...........---------------------------------.----
Q0TXJ2_PHANO/682-876.AQLVT..........---------------....A.GRIQG---------------------------------Q----
M7NIM6_PNEMU/605-804.DKYIN..........---------------.........FP---------------------------------K----
A8PXA3_MALGO/684-898.VGWLDVPT.......---------------SLAQR.VYSKD---------------------------------P----
G8BYJ9_TETPH/624-826.HELLPLP........---------------..NLP.ASSNT---------------------------------S----
G0S2E0_CHATD/626-822.PALLS..........---------------....I.KP...---------------------------------.----
F0ZRR2_DICPU/727-893.DSLII..........---------------...........---------------------------------G----
F1Q4S6_DANRE/645-851.DDVIK..........---------------......VNKEL---------------------------------C----
R7YYN3_CONA1/692-891.DHMLP..........---------------....G.GSHGV---------------------------------Q----
C5DTY5_ZYGRC/691-893.QSFLPLP........---------------..NLP.ASSKT---------------------------------S----
H2SN18_TAKRU/614-820.DDVII..........---------------......LDPEV---------------------------------P----
B6HEW6_PENRW/597-788.DELLK..........---------------....K.HGDDI---------------------------------L----
Q0WVM5_ARATH/549-738DFSLNY..........---------------..........G---------------------------------G----
G8JTZ4_ERECY/691-893.HNLLPLP........---------------..NLP.GSSKT---------------------------------S----
B8P8H6_POSPM/981-1208.DSVLRL.........---------------..PESVSAIYQ---------------------------------T----
G2QK39_MYCTT/606-802.PALLS..........---------------....L.KP...---------------------------------.----
Q17D12_AEDAE/666-865.EVSVK..........---------------.....PDGAEL---------------------------------H----
M3CZA8_SPHMS/670-862.GKLIR..........---------------....G.GT...---------------------------------.----
Q6FTF1_CANGA/659-861.HKQLPLP........---------------..NLP.SSSAT---------------------------------S----
Q75A89_ASHGO/684-886.HSRLPQP........---------------..NLP.GSLKL---------------------------------S----
F9XME7_ZYMTI/566-760.SKQLR..........---------------....G.GT...---------------------------------.----
U9SUM6_RHIID/790-1007.NKFVMPS........---------------.SNVP.RNIWN---------------------------------P----
L8GAM4_PSED2/621-813.DALLP..........---------------....D.SV...---------------------------------.----
Q4WWD9_ASPFU/609-807.EERLN..........---------------....S.YGSGI---------------------------------I----
C4XY87_CLAL4/661-860.NARLPTP........---------------..SNA.LASNS---------------------------------G----
K4BB35_SOLLC/549-738DFCLLH..........---------------..........R---------------------------------D----
Q5TPK2_ANOGA/708-909.EAAVT..........---------------....PFPVQEL---------------------------------H----
C4R925_KOMPG/670-870.QSYVPLP........---------------..SLP.ASTKQ---------------------------------S----
W5FGR4_WHEAT/550-736DFCLLV..........---------------..........G---------------------------------G----
G0NWB7_CAEBE/551-757......TT........---------------..NST.SAEAD---------------------------------Q----
W1Q9F0_OGAPD/622-820.WKMLP..........---------------...VP.LTSNL---------------------------------M----
M5EB57_MALS4/684-898.AGLVDMTP.......---------------SLSSR.AYLKD---------------------------------P----
N1JI70_BLUG1/626-821.EKLLP..........---------------....K.SV...---------------------------------.----
I1CBC4_RHIO9/650-864.YDYLNFAK.......---------------GLPQH.LFNPE---------------------------------L----
G3J432_CORMM/598-793.ASTIA..........---------------....L.SP...---------------------------------.----
K5XS17_AGABU/706-939.DSMLRL.........---------------..PEEVSKVYL---------------------------------N----
A5DPW7_PICGU/652-850.NALLPTP........---------------..LLP.AANNQ---------------------------------A----
I4YA03_WALMC/598-807.DGLLE..........---------------......VEAVD---------------------------------G----
R9AEB2_WALI9/585-794.DGLLD..........---------------......AGAVD---------------------------------G----
NOL6_XENTR/638-843.DCVLT..........---------------......RGKE.---------------------------------A----
K0KM58_WICCF/672-873.NKLLPLP........---------------..NLP.SSTKQ---------------------------------S----
C3Z9X5_BRAFL/576-782.LDPNQ..........---------------......NSTSH---------------------------------P----
S2JLP9_MUCC1/660-874.YGYLNLSK.......---------------HVPEN.LFSPE---------------------------------L----
Q6CQS3_KLULA/682-883.QQLLPLP........---------------..NLP.ASSKT---------------------------------S----
A7AS51_BABBO/622-822.LSIVDING.......---------------DTKKR.KFDGN---------------------------------S----
B6QTJ8_TALMQ/620-816.DETLQ..........---------------....Q.LA.GS---------------------------------E----
B8NV94_ASPFN/617-815.DEKLR..........---------------....N.SGNGI---------------------------------F----
A0A088AV91_APIME/651-862.EELIKL.........---------------..QKVKITHFV---------------------------------Y----
S9XA53_SCHCR/625-818.QLFTH..........---------------......AKLSP---------------------------------N----
K1X311_MARBU/634-829.NKILP..........---------------....G.PG...---------------------------------.----
G7E946_MIXOS/644-860.DALLMQPD.......---------------CVFEA...SAS---------------------------------D----
V5FPA1_BYSSN/616-813.DRILD..........---------------....N.WGGSL---------------------------------T----
T1JFU9_STRMM/607-798.ESFVA..........---------------.........RG---------------------------------N----
F2U6D3_SALR5/790-1031.EPVLAGAGVPA..PG---------------ALAAA.SSAPT---------------------------------T----
M1W9J6_CLAP2/611-806.SSLLG..........---------------....L.SH...---------------------------------.----
G8B992_CANPC/676-874.EKRLPLS........---------------..LLS.TTSNQ---------------------------------V----
N4UMZ3_COLOR/581-776.PSSLN..........---------------....I.SP...---------------------------------.----
C5G095_ARTOC/606-795.SQAVP..........---------------.......GISN---------------------------------A----
G3VN54_SARHA/643-850.DPLIR..........---------------......VPKET---------------------------------H----
S8EU65_FOMPI/687-916.DAVTRL.........---------------..PEDIGRVLR---------------------------------V----
E3QLQ1_COLGM/590-785.PSSLD..........---------------....I.SP...---------------------------------.----
B2VXG7_PYRTR/651-845.GHLIT..........---------------....A.GRMQG---------------------------------Q----
M3HTH7_CANMX/665-863.DKKLPVA........---------------..LLP.SASNQ---------------------------------V----
U1HM72_ENDPU/645-849.EHVVL..........---------------....A.PN..R---------------------------------L----
Q5B7M5_EMENI/619-815.DGQLL..........---------------....K.NGDGV---------------------------------I----
V2XZV7_MONRO/643-871.DELLRL.........---------------..PEHISRYYT---------------------------------G----
G8Y8Y3_PICSO/686-885.LSNLPIP........---------------..LLP.SAHSQ---------------------------------S----
F0XND2_GROCL/621-817.AAMVP..........---------------....L.VA...---------------------------------.----
C5GR67_AJEDR/612-808.DAEYF..........---------------....N..GVGA---------------------------------L----
M7UFB1_BOTF1/636-831.EKLLP..........---------------....S.YG...---------------------------------.----
B3SA13_TRIAD/594-809.DHTLAITY.......---------------.EDEKSKLPFC---------------------------------N----
A3GGP2_PICST/664-863.ANKLPTP........---------------..LLP.SASNQ---------------------------------V----
B6K3H2_SCHJY/618-812SDVLGR..........---------------......TALVN---------------------------------S----
E5A3A1_LEPMJ/688-882.SHLVS..........---------------....A.GRIQG---------------------------------A----
I1J8W6_SOYBN/549-738DFSLLH..........---------------..........G---------------------------------S----
J0LDN8_AURST/637-853.ENVLR..........---------------...........---------------------------------.----
M7SB14_EUTLA/604-800.SKIIS..........---------------....S.AP...---------------------------------.----
M4AYB0_XIPMA/637-843.DDVIT..........---------------......TGNEV---------------------------------P----
H0VL29_CAVPO/640-846.DALIQ..........---------------......RPKEP---------------------------------S----

PF09139

D6WLK1_TRICA/13-336IDLIYCVDNPSAWHEA...............NMKENFSHYSG.LKYF..G....HNFVA......QFQEN.FGA.K----
F4Q0F6_DICFS/78-418IDMVFAVDNANDWHKE...............NLERNWSHYSF.LAYG..G....PKLIS......FVQR..TSA.K----
C5G7N5_AJEDR/130-496IDFIFGVSYSQHWHAL...............NLNQHRDHYSG.LGSL..G....SYIVS......QIQER.WGA.G----
H6BQ12_EXODN/141-510IDFIFGVSYTQHWHSL...............NLQEHRDHYSA.VGSL..G....SYAVS......KIQDS.FGA.G----
A8NRM0_COPC7/89-410LDFMFAVTHPAHFHSI...............NMHQFPSHYPL.HARM.FG....SSYVS......RVQD..IGP.G----
G1XLW6_ARTOA/133-472VDLIFGVTYTQHWHSL...............NLTEHRDHYSF.LGKM..G....SGVVA......KVQDG.FGA.G----
E9J9M0_SOLIN/10-328LDLIFVVRNANKWHAE...............NLTRNPKHYAKPLRFL..G....PKVIT......NVQER.SGA.K----
G4N333_MAGO7/122-492IDFIFGVSHTQHWHSL...............NMRQNRHHYSA.VASL..G....SGFVS......RVQDR.YGA.G----
D8M4A9_BLAHO/3-344LDVIIGVRDPIEWHRV...............NMQLNPEHYSF.FRHL..G....SSTIA......KLEN..FGLGH----
S3BZ14_OPHP1/165-542IDFIFGVTFTQHWHSL...............NLHQHRDHYSA.LGSL..G....SGAVS......YVQDN.WGA.G----
U1HUS9_ENDPU/150-521IDFIFGVSYSQHWHSL...............NLQEHRDHYSA.VGSL..G....SYAVS......KLQDS.FGA.G----
C1E0D3_MICCC/10-340VDFVFAVDDPRAWHRR...............NMAMNPSHYAP.HLRA.LG....GGTVA......ALADR.VGA.G----
L0P740_PNEJ8/104-428IDFIFGVSQAQQWHSL...............NLFHNNNHYSF.LKYF..G....SYFIS......YLQEK.IKA.N----
C9S6T4_VERA1/142-510IDLIFGVTHTQHWHSL...............NMRQHPEHYSS.LAKF..G....SGLVS......TTQER.WGA.G----
B4NJ58_DROWI/5-342IDLVFCVRDALGFHAE...............NMHRHPSHYSA.LRHL..G....PRFAA......QYQER.MGA.G----
E9F7E1_METRA/91-463IDFIFGVSHTQHWHSI...............NIRQHRDHYSG.IASL..G....SGLVS......RVQN..WGA.G----
A5E243_LODEL/82-429MDFIFVVKNSASFHKE...............NLLQNANHYSS.KS.........LMWIN......YIQ....GK.G----
W1Q7W0_OGAPD/134-519VDMIYAVSYPDHWHSL...............NIAQNPDHYSS.LRHL..G....SSIVS......QIGE..LGA.G----
B6K4K1_SCHJY/52-376LDFIFGVKDPYQWHSV...............NVKQNPKHYSF.LKYF..G....SRSIS......YLQES.VGT.G----
H0Z110_TAEGU/13-327LDFVFAVDDVVTWHMM...............NLLKNRSHYSF.LKFF..G....PKKIS......TIQR..YGA.G----
M3B232_PSEFD/164-542IDFIFGVSHTQHWHSL...............NLMQHPKHYSA.LRYIPNS....SAVVS......WMQDK.WGA.G----
E0VMJ8_PEDHC/16-330IDFIFAVKNSEKWHSS...............NLQLNPSHYSA.LSFL..G....SKFIA......KVQTS.IPS.R----
B0WG01_CULQU/11-332IDLIYTVDNAHRWHVS...............NLERNPDHYSG.LGRF..G....GNFIA......KYQET.LGA.K----
K3ZJ60_SETIT/15-326VDYILGVADPLHWHSE...............NLKRNPAHYSR.WMGC.LG....ASAIT......GLADR.IGV.G----
E9CXS5_COCPS/124-488IDFIFGVSYSQHWHSL...............NLNQHRDHYSA.IGSL..G....SYVVS......QVQDK.WGA.G----
A0ECV7_PARTE/9-316IDLIIAVDNVEEWHMQ...............NIQINSTHYSG.LSYY.LG....SRFIQ......RMNVEIF...P----
B9GN14_POPTR/9-326VDYIIGVSDPKQWHSK...............NMELNEDHYAS.WMVPLGG....AKLIT......QVADK.IGV.G----
S8AI20_PENO1/118-482IDFIFGVSYSQHWHDL...............NLNQHRDHYSG.LGSM..G....SYVVS......QVQDK.FGA.G----
W5N967_LEPOC/13-328LDFVFAVDDPVSWHTM...............NLMKNHKHYSF.LRYL..G....PRHVS......NVQSQ.HGA.R----
Q0UPI9_PHANO/59-415IDFVLTPRFSEHFHSL...............NLRSHRDHYSF.LGSL..G....SGVIN......RVQK..LGA.G----
A7S007_NEMVE/10-319IDFVFVVDNPYDWHSK...............NLSRFPHHYSF.MANL..G....VNAIV......SLQDE.IGA.G----
K9G9U1_PEND2/123-487IDFIFGVSYSQHWHAI...............NLNQNRDHYSA.LGSL..G....SYTVS......QVQDR.FGA.G----
TAM41_DICDI/68-424IDLIFAVENSTKWHSL...............NLVNNQSHYSF.LGLM..G....AHIVA......KVQY..MNA.K----
I1K386_SOYBN/6-319TDYILGVSDPKQWHSE...............NLKLNKHHYAS.WMVHLGG....ESLIT......GVADR.IGV.G----
M7PAY1_PNEMU/94-420IDFIFGVSHAQHWHSL...............NLLYNRDHYSF.LKHF..G....SYFIS......YLQEN.IGA.N----
S8FW20_FOMPI/63-368LDFMFAVTHADHWHSI...............NMNQFPGHYPL.HAR......................E..ISP.G----
C5MHG3_CANTT/128-440LDFIFVVENTTQFHKE...............NVHQNPKHYSS.KS.........LSIIK......QIQ....GKDG----
Q2H207_CHAGB/144-517IDFIFGVSHTQHWHSL...............NMKQHRDHYSR.LASL..G....SGAVS......YVQDK.MGA.G----
A8Q506_MALGO/15-385IDMVIAVKDPIHWHAA...............NMLRNKSHYPW.WTRW.CG....LWAIK......AAQR..MGA.G----
T1JUS5_TETUR/9-355VDLVVVVDDSLEFHRN...............NLRNNAQHYSL.LRHL..G....PKGVA......HIQDN.FGA.R----
G1KJZ6_ANOCA/15-329LDFVFAVDNSVTWHTT...............NLSKNRNHYSF.LKYF..G....PKLIA......NIQN..YGA.G----
K2RZS9_MACPH/50-418IDFIFGVTYSQHWHSL...............NLAQHRDHYSF.LGSF..G....SWAVS......QVQDR.FGA.G----
M2UHY6_COCH5/80-448IDFILTPRFSQHFHSL...............NLREHRDHYSF.LGSL..G....SAVVS......HVQEK.YGA.G----
C4QXR2_KOMPG/110-482MDMIYAVSYPDHWHAL...............NLHQFPEHYSF.LRIG..G....SGLIG......KVQD..LGA.G----
G3APF1_SPAPN/81-416LDFIHIVPDSHEFHRV...............NLQQNRSHYSF.KS.........LSIIN......FIQ....GT.G----
C7Z478_NECH7/122-494IDFIFGVTHTQHWHSI...............NMKQHRDHYSG.IASL..G....SGFVS......RVQN..WGA.G----
Q6CC57_YARLI/155-503VDLIFGVKYPNHWHSL...............NLKQNPHHYSG.LKYL..G....SDAIA......AIQE..TAA.G----
K7IVD4_NASVI/11-329LDLIFVVRNPYQWHAE...............NMNKNPEHYAQPLRFL..G....HKAVA......KAQET.WGA.K----
J9K2F7_ACYPI/5-309VDLIFVVNNTHDFHQE...............NLTINPDHYSS.IRYL..G....ASVLS......SVQTS.FGA.N----
TAM41_DROME/5-338VDLVFCVRDARGFHAE...............NLHRHPDHYSA.LRHL..G....PNFVA......KYQER.LGA.G----
M7TNP0_EUTLA/89-460IDFIFGVQHTQHFHSL...............NLRQHRDHYSG.LGSL..G....SAAVS......WVQDK.WGA.G----
U4L0D7_PYROM/82-426IDLIFGVTYTQHWHSI...............NLKQHRDHYSF.LGSF..G....SRAVA......TTQEK.LGA.G----
W1PVI6_AMBTC/11-327VDYILGVSDPMQWHSQ...............NLEKNRHHYGS.FLAY.LG....SRTIT......QVADE.IGV.G----
S2J8V7_MUCC1/67-383VDFIFGVSHPGHWHDL...............NMQQNPHHYSG.IRAL..G....SGAVT......LLQEK.VGA.G----
E1FWI9_LOALO/14-325VDFIIATSDSNQFHKQ...............NLKMNPMHYSS.LRFL..G....YQKIA......QLQRN.YAA.R----
R7Z3U1_CONA1/137-506IDFIFGVTYTQHWHSL...............NLTQHRDHYSF.LGSL..G....SGLVS......AVQDR.FGA.G----
R9AIR3_WALI9/86-407VDFIVATTHPYHWHSI...............NIQQNPTHYPF.LAKI.LG....SKAIN......YVQRA.FGA.R----
G8B9Z5_CANPC/74-380LDFIFLVNDTAKFHHE...............NVKQNPSHYST.KS.........LTVIN......FLQ....GS.G----
Q9SN75_ARATH/9-326VDYILGVSDPIKWHSA...............NLKMNSDHYAS.WMVHLGG....ARLIT......NVADK.VGV.G----
G8YHN8_PICSO/69-420IDLIHLVRNAQSFHEG...............NLHQYPEHYSG.IKYF.GG....SHAIE......KVQR..LGA.G----
B4K948_DROMO/5-334IDLVFCVRDTQGFHAE...............NIHRHSSHYSA.LCHL..G....ANLVA......QYQEI.LGA.R----
S9W8F4_SCHCR/52-374VDFIFQVDNPVRWHEL...............NIQQNPSHYSF.LKYL..G....PKIIA......NVQDN.YGA.N----
N1J4Q0_BLUG1/111-475IDFIFGVSHTQHWHSL...............NLAQHRDHYSA.LGSL..G....SGAVS......AVQEK.WGA.G----
J3PFP4_GAGT3/124-495IDFIFGVSHTQHWHSL...............NIRQNRHHYSG.LASL..G....SGLVS......RVQDR.YGA.G----
A3LVC5_PICST/51-374IDFINIVEDNQTFHKQ...............NLVKNRSHYSI.KS.........AGLIK......FLQ....GKNG----
Q6BKV0_DEBHA/67-411IDMIHMVDKPADFHEQ...............NLEQFSGHYSG.IRMF..G....PAIIS......KIQE..YGA.G----
A7EQJ2_SCLS1/136-507IDFIFGVSYSQHWHSL...............NLNQHRDHYSA.LGSL..G....SGAVT......AVQEK.WGA.G----
F1L2S9_ASCSU/10-321VDFIIASSNSHTFHEE...............NLDRNPSHYSM.IRRL..G....ARSIT......NMQRN.FAA.R----
G3JTW8_CORMM/137-509IDFIFGVSHTQHWHSL...............NIKQHRKHYSG.VASL..G....SGAVS......YVQD..WGA.G----
V5G174_BYSSN/130-494IDFIFGVSYSQHWHSL...............NLHQHRDHYSA.LGSM..G....SYMVS......KVQDN.WGA.G----
F4PEP7_BATDJ/67-400VDFIFGVVHSEHWHSL...............NIKQNPHHYSS.IAGL..G....SGSIA......KIQDS.FGA.G----
Q5AGE7_CANAL/141-463LDFMFLVKDCGKFHQE...............NLKQNRDHYSI.KS.........LRLIK......KVQ....GTNG----
G3XQA7_ASPNA/29-371IDFILGVPCAEEWHGL...............NLQQNPHHYGA.LGKL..G....KRAIA......RVQE..LGA.G----
B6QBB5_TALMQ/135-501IDFIFGVSHTQHWHSL...............NLQEHRDHYSA.LGAL..G....SGAVS......AVQDK.WGA.G----
F2DNW5_HORVD/11-326VDYILGVADPLHWHSE...............NMARNPTHYSS.WMAR.RG....PEAVT......WLADR.VGV.G----
I7M213_TETTS/17-335IDLIFGVQDADEWHRM...............NLIKNPSHYSG.LGYY.LG....SSYLH......FLQQYIT...P----
M9MEW7_PSEA3/116-467VDFIMAVTHPQHWHSL...............NMAQHPKHYSM.FSRL.LG....GLGIG......LIQP..VGA.K----
R8BP23_TOGMI/11-384IDFIFGVTFTQHWHSL...............NLNQHRDHYSW.LGSL..G....SGAVS......HVQDR.WGA.G----
M2M255_BAUCO/36-426IDFIFGVSHTQHWHSL...............NLMEHPDHYSF.LRHLPYS....SAAIS......HIQDD.FGA.G----
T1F6T9_HELRO/4-318LDLILVTDNPHKWHKM...............NLKMNRKHYSF.LKLL..G....PKIIS......DVQDK.FGA.K----
F4REF8_MELLP/113-453LDFVFAVSHPSHWHSI...............NLQQNPKHYSL.PLRW.LG....SAPIS......WLQEKGPGA.G----
M5E4Z7_MALS4/64-428IDMVIAVEEPAHWHVM...............NMHANPHHYPW.WARL.FG....GWAVR......ATQN..IGA.K----
U5H5E0_USTV1/137-472LDFVFAVSHPSHWHAI...............NMAQNPHHYSL.PMRL.LG....SDAVA......WMQEKGLGA.N----
G3B682_CANTC/65-370IDLVHVVDSTSAFHRQ...............NLNKYPHHYSA.LKYL..G....VRAID......WVQS..WGP.G----
H3FZA6_PRIPA/8-319VDLVLCTKDPQAFHAD...............NLQQNPSHYSF.LRML..G....PATIT......KLQQS..TA.K----
H2S0L1_TAKRU/13-328LDFVIAVDDPVTWHTM...............NLLQNRKHYSI.LKLL..G....PTTVS......SIQHD.YGA.S----
D8PZS1_SCHCM/93-412LDFLFAVTHADHFHSI...............NMNQFPSHYPL.SARV.LG....SDYVS......RVQN..ISP.G----
D7T9Q8_VITVI/9-326VDYILGVSDPMQWHSQ...............NLKMNRDHYAS.SMVYLGG....AKLIT......QVADE.IGV.G----
G0T2B5_RHOT2/147-502LDFIFAVSHPSHWHAI...............NMQQHPEHYSL.PMRL.MG....SNAVA......WMQEKGLGA.E----
B7PKK9_IXOSC/7-319LDVIFAVDDPLAWHRE...............NLKRNWRHYSF.LRYG..G....PHLVN......KVQKD.FGA.Y----
F9WXS4_ZYMTI/148-520IDFIFGVSHTQHWHSL...............NLAQNPHHYSG.LRFMPNS....SALVS......WMQDG.WGA.G----
B9SQ77_RICCO/9-325VDFILGVSDPRQWHSE...............NLKLNRDHYAS.WMVHLGG....AKLIT......EVADE.IGV.G----
M0S210_MUSAM/10-320VDYILGVADPIQWHSEASASFLDDLLSESAMNLT....................YMIIN......WVAYG.IGV.G----
E9R3D7_ASPFU/128-493IDFIFGVSYTQHWHAL...............NLSQHRDHYSA.LGST..G....SYMVS......QVQDR.FGA.G----
I4Y9B7_WALMC/21-342VDFIIAVTHPHHWHSI...............NIQQNPSHYPL.GAKL.FG....NKAIT......FLQRK.FGA.Q----
D3B0C8_POLPA/348-663IDLVFAVENSEQWHKE...............NIKQNFDHYSF.LAYF..G....ESTVT......TVQK..MAA.K----
A5DAD6_PICGU/58-371IDMIHVVDDACNFHTT...............NLRQFGNHYSG.LKYL.GG....APTIS......AVQQ..WGG.G----
TAM41_CAEBR/4-316VDFVVVTKDAQEFHKA...............NIAKNPQHYSL.LRLL..G....PKMLE......KIQCN.FAA.R----
H3AQ57_LATCH/13-328LDFVFVVDDPVTWHTM...............NIMKNRKHYSF.LKFF..G....PKQIS......NIQSN.YGA.G----
G4U2Y1_SERID/94-414LDFIFAVSHPEHWHSI...............NLAQNPSHYAL.HARL.LG....SDFVG......RVQN..WGPAA----
H2Y1H7_CIOIN/13-342LDLIFVVRDPRSWHSE...............NMRMNKLHYWYPMRYL..G....PNYAF......KLMEN.YGA.G----
Q5KAN9_CRYNJ/49-385TDLLISTPDAEAFHKI...............NLEQNPRHYPV.YARW.MG....GKGVG......WVQEK.WGA.G----
E9HGG3_DAPPU/25-340VDLILVVDDAETFHRL...............NLERNSKHYSS.MKYL..G....PHLLA......SFQEK.WGA.R----
Q7PQL6_ANOGA/11-332IDLIYVVDNAHRWHTA...............NLDQNFEHYSS.MRLL..G....GGLIA......KYQES.FGA.R----
F1MZC5_BOVIN/13-327LDFVFTVDDPVAWHSK...............NLKRNWNHYSF.LKVL..G....PRIIT......AVQNN.YGA.G----
B7GA00_PHATC/17-343IDVIMVVDDAFSFHQT...............NILLNPAHYAL.PFWT.RFRKSMPEVWATWWQRHSVNNQLLRNPR----
B4JF38_DROGR/5-334IDLIFCVRDTLGFHAE...............NIHRHEAHYSS.LRYL..G....ANFVA......KYQER.FGA.R----
Q16J98_AEDAE/11-332IDLIYTVDNAHRWHAS...............NLERNPDHYSG.LKYL..G....SNFIA......KYQES.FGA.K----
E3K171_PUCGT/48-392LDFIFAVTHPSHWHSI...............NLHHHPHHYSL.PARL.LG....SPAIS......WLQERGPGA.G----
D5GF34_TUBMM/84-434IDLIFGVTYTQHWHSL...............NLAQHRDHYSF.LGGM..G....SAVIS......HIQDD.FGS.G----
G9MXT6_HYPVG/81-452IDFIFGVTHTEHWHSI...............NMKQHRDHYSG.VASL..G....SGFVS......RVQG..WGA.G----
U9TGF8_RHIID/101-418IDFIFAVGHTQHWHSL...............NINQNRKHYSY.LGTL..G....SGAVT......MLQEN.LGA.G----
L8FTT4_PSED2/132-505IDFIFGVSYTEHWHSL...............NLNQHRDHYSG.LGSL..G....SGAVS......SVQDK.FGA.G----
TAM41_SCHPO/61-385IDFIFQVEDPVKWHKI...............NLQQNPSHYSF.VKNF..G....PGFVS......TLQES.FGT.G----
R4XIF8_TAPDE/76-410VDYIFGVSYAQHFHSL...............NLHHHPDHYSF.LRRL..G....SGVVG......HVQTG.YGA.G----
B8N4Y6_ASPFN/11-362IDFIFGISHAHTWHTI...............NLQQHPHHYPP.LLRS.LG....PRAIS......KCQEN.FGA.G----
K5VSI5_PHACS/87-407LDFMFAVTHASHWHDL...............NMHQFPGHYPL.YARA.LG....SEFVS......RVQE..INP.G----
T0K1A0_COLGC/136-508IDFIFGVTHTQHWHSL...............NMRQHRDHYSG.LASF..G....SGLVS......TFQDR.WGA.G----
D7FQS1_ECTSI/13-328LDLVLAVEDSEAWHKA...............NLKRNRDHYSG.LARL.FG....AGGVA......WLQEG.FGA.K----
K5VXR0_AGABU/90-409LDFMFAVTHPAHFHYI...............NMQQYPAHYPM.HARM.LG....SSYVE......RVED..IGP.G----
F2PR85_TRIEC/162-525IDFIFGVSHSQHWHSL...............NLNQHRNHYSS.LGSM..G....SYVVS......QVQER.MGA.G----
F7BSM1_MONDO/13-327LDFVFSVDDPVTWHSK...............NLQKNRNHYSC.LRLF..G....PNVIA......KVQNN.FGA.G----
C1MRC2_MICPC/9-342VDYVLAVDAPDEWHAA...............NMAANPSHYAA.HLRL.LG....ARSPG......WIADR.VGV.G----
C3ZAA9_BRAFL/5-319VDFIFAVDNAEAWHKE...............NMRRNRKHYSF.LSSL..X....PEGIA......RVQEN.WGA.R----
G4V8Y8_SCHMA/10-360IDLVIIVRNPVEWHLK...............NISENPNHYNF.VVRN.YAQKYQSSSLE......AFHSRIPGP.K----
V2X315_MONRO/94-415LDFMFAVTHPDHFHSI...............NMHQHASHYPL.HSRI.FG....SDYVS......RVQA..IGP.G----
M5BIJ2_THACB/103-424LDFLFAVTHADHFHSI...............NMQQNPKHYAL.VPRL.LG....SDFVA......RTQS..LAP.G----
W5JMS0_ANODA/11-332IDLIYTVDNPTRWHTA...............NLDLNFDHYSG.MRLL..G....GNVIA......RFQEN.LGA.R----
M2RN09_CERS8/89-398LDFMFAVTHADHWHSI...............NMQQHPGHYPL.HARI..........................P.G----
E5SKP7_TRISP/223-538IDFVVVVDKPLEWHKE...............NLKLNSSHYSM.LRYI..G....AERLT......KLQTD.YAA.R----

PF14792

C5GK07_AJEDR/529-641----------------------------------RIPRAEV---------------------------------------
Q5KBS5_CRYNJ/778-890----------------------------------RIPREEC---------------------------------------
DPOLB_RAT/149-262----------------------------------RIPREEM---------------------------------------
DPOLB_DANRE/148-263----------------------------------RIPRSEM---------------------------------------
A7SJ46_NEMVE/149-263----------------------------------RIPREEM---------------------------------------
C3YJ28_BRAFL/322-432----------------------------------RMPREEA---------------------------------------
C7YGY5_NECH7/618-739----------------------------------RIPRREV---------------------------------------
F0ZLU7_DICPU/181-297----------------------------------RVPRKEI---------------------------------------
A7SK52_NEMVE/213-322----------------------------------RMPREEA---------------------------------------
A2QQG4_ASPNC/509-626----------------------------------RIPRSEV---------------------------------------
A9V5M0_MONBE/167-298----------------------------------RIPRAEV---------------------------------------
D7G2F8_ECTSI/183-296----------------------------------RMPRSEA---------------------------------------
B7QKW0_IXOSC/150-261----------------------------------RIPREEV---------------------------------------
E9EVQ2_METRA/556-677----------------------------------RIPRREV---------------------------------------
E3QD37_COLGM/619-740----------------------------------RIPRSEV---------------------------------------
B6HVS0_PENRW/522-633----------------------------------RIPRKEV---------------------------------------
A7EMR3_SCLS1/618-744----------------------------------RIPRAEI---------------------------------------
E4ZMZ8_LEPMJ/596-715----------------------------------RIPRAEV---------------------------------------
C5FJW6_ARTOC/469-580----------------------------------RIPREEV---------------------------------------
B7QK41_IXOSC/277-387----------------------------------KMPREEA---------------------------------------
B2AY49_PODAN/639-751----------------------------------RIPRSEV---------------------------------------
C9SJH6_VERA1/548-691----------------------------------RIPRREV---------------------------------------
D8SG82_SELML/125-237----------------------------------RIPRDEV---------------------------------------
E3RX41_PYRTT/579-692----------------------------------RIPRAEV---------------------------------------
Q2HFI0_CHAGB/649-794----------------------------------RIPRAEV---------------------------------------
C1E884_MICCC/525-667----------------------------------RIPRDEV---------------------------------------
A9TCX5_PHYPA/342-457----------------------------------KIPRHEI---------------------------------------
B9HVB4_POPTR/315-429----------------------------------RIPRHEV---------------------------------------
Q0UN18_PHANO/574-687----------------------------------RIPRSEV---------------------------------------
A4S364_OSTLU/149-268----------------------------------RIPREEV---------------------------------------
D8R616_SELML/125-233----------------------------------RIPRDEV---------------------------------------
A0BDW1_PARTE/419-531----------------------------------RIPRDEA---------------------------------------
B8JIE9_DANRE/378-488----------------------------------RMPRSEA---------------------------------------
F2U5R6_SALR5/160-281----------------------------------RIPRDEV---------------------------------------
F7CJ14_CALJA/78-188----------------------------------RMPREEA---------------------------------------
Q245F6_TETTS/717-832----------------------------------RMPREEA---------------------------------------
Q4QI79_LEIMA/354-499----------------------------------RIPHEEG---------------------------------------

PF01909

CID16_SCHPO/908-1034----------------------------------------I---------------------------------------
CID1_SCHPO/69-169----------------------------------------L---------------------------------------
O26508_METTH/6-97----------------------------------------L---------------------------------------
O26564_METTH/21-113----------------------------------------M---------------------------------------
CCA_METTH/29-141----------------------------------------L---------------------------------------
O27980_ARCFU/6-90----------------------------------------I---------------------------------------
CCA_ARCFU/28-133----------------------------------------E---------------------------------------
O28300_ARCFU/48-135----------------------------------------R---------------------------------------
O28312_ARCFU/101-191----------------------------------------V---------------------------------------
O28500_ARCFU/441-531----------------------------------------I---------------------------------------
O28587_ARCFU/7-100----------------------------------------L---------------------------------------
O28660_ARCFU/27-113----------------------------------------I---------------------------------------
O29641_ARCFU/5-90----------------------------------------K---------------------------------------
O29943_ARCFU/5-101----------------------------------------L---------------------------------------
O30239_ARCFU/8-91----------------------------------------L---------------------------------------
PAP_CANAL/68-160----------------------------------------S---------------------------------------
O44768_CAEEL/71-163----------------------------------------C---------------------------------------
O66796_AQUAE/86-173----------------------------------------R---------------------------------------
CID11_SCHPO/72-179----------------------------------------V---------------------------------------
PAPS2_ARATH/82-179----------------------------------------L---------------------------------------
O97205_LEIMA/1069-1163----------------------------------------L---------------------------------------
TDT_HUMAN/311-403----------------------------------------V---------------------------------------
TDT_MOUSE/312-404----------------------------------------S---------------------------------------
PAPOA_BOVIN/82-175----------------------------------------S---------------------------------------
PAP_YEAST/69-161----------------------------------------K---------------------------------------
OAS2_HUMAN/373-475----------------------------------------I---------------------------------------
Y073_HAEIN/14-110----------------------------------------L---------------------------------------
TRF5_YEAST/201-326----------------------------------------I---------------------------------------
PAP2_YEAST/204-318----------------------------------------I---------------------------------------
GLND_RHIME/87-183----------------------------------------L---------------------------------------
P72997_SYNY3/7-99----------------------------------------P---------------------------------------
P73498_SYNY3/14-107----------------------------------------D---------------------------------------
P73970_SYNY3/10-96----------------------------------------L---------------------------------------
OAS1A_RAT/38-140----------------------------------------L---------------------------------------
Q09995_CAEEL/75-168----------------------------------------I---------------------------------------
PAP_SCHPO/68-161----------------------------------------A---------------------------------------
Y128_METJA/11-98----------------------------------------L---------------------------------------
Y141_METJA/7-99----------------------------------------I---------------------------------------
Y435_METJA/7-92----------------------------------------K---------------------------------------
Y604_METJA/7-100----------------------------------------I---------------------------------------
Y1086_METJA/124-219----------------------------------------C---------------------------------------
CCA_METJA/35-147----------------------------------------I---------------------------------------
Y1217_METJA/11-98----------------------------------------L---------------------------------------
Y1305_METJA/10-110----------------------------------------L---------------------------------------
Y1379_METJA/11-100----------------------------------------L---------------------------------------
TUT4_HUMAN/976-1065----------------------------------------L---------------------------------------
Q9RTF8_DEIRA/9-95----------------------------------------H---------------------------------------
Q9RWI9_DEIRA/14-98----------------------------------------I---------------------------------------
Q9RXQ9_DEIRA/18-105----------------------------------------L---------------------------------------
Q9U2P3_CAEEL/73-166----------------------------------------A---------------------------------------
CID14_SCHPO/266-381----------------------------------------V---------------------------------------
PAPA_CANAL/68-161----------------------------------------K---------------------------------------
Q9VC07_DROME/53-140----------------------------------------V---------------------------------------
Q9WZ83_THEMA/22-113----------------------------------------L---------------------------------------
Q9X096_THEMA/7-103----------------------------------------L---------------------------------------
Q9X2Z5_BACAN/31-119----------------------------------------V---------------------------------------
Q9X304_BACAN/10-108----------------------------------------M---------------------------------------
GLND_CORGL/12-98----------------------------------------E---------------------------------------
GLND_VIBF1/55-151----------------------------------------L---------------------------------------
OAS3_HUMAN/780-872----------------------------------------I---------------------------------------
CCA_AERPE/39-163----------------------------------------V---------------------------------------
Q9YCI7_AERPE/22-112----------------------------------------A---------------------------------------
Q9YFN6_AERPE/17-110----------------------------------------R---------------------------------------
Q3Y244_ENTFC/6-114----------------------------------------I---------------------------------------
Q5HNP5_STAEQ/17-112----------------------------------------.---------------------------------------
PAPD7_HUMAN/245-352----------------------------------------V---------------------------------------
CCA_SULSO/25-127----------------------------------------.---------------------------------------
CCA_THEAC/29-134----------------------------------------I---------------------------------------

PF07528

O62349_CAEEL/113-354TTH------------------SSDKSDVVVQLSTLPSYETV---------------------------------------
Q7PYL7_ANOGA/111-351MMA------------------GSNVADIVIILKSLPTRDCA---------------------------------------
ILF3_MOUSE/94-342LLK------------------GDLDLELVLLCKEKPTTALL---------------------------------------
ILF2_DROME/105-345ILT------------------GNNVADVVVILKTLPTKEAV---------------------------------------

PF12633

K0C9C6_CYCSP/30-225LNL------------------HKLKMQRAIDAVTPRQKIFL---------------------------------------
Q7MYN2_PHOLL/4-200DAI------------------NQLRLERASTAMSAEFKQVY---------------------------------------
C9R2R0_AGGAD/4-204DYL------------------DKLRIQRALSDTPESFQQVF---------------------------------------
M1WST2_DESPC/651-841LTL------------------NRARLARALAGLEREKQVYL---------------------------------------
F6AGP1_PSEF1/20-216MRI------------------NHGRQQRAMQALSPRQQRVL---------------------------------------
F4HFE0_GALAU/3-201EQL------------------DKLRLERALAGAPNEFQYVL---------------------------------------
B3PH57_CELJU/19-216LSL------------------NEQRVARTLTNLSERQQQFM---------------------------------------
G4T2L3_META2/23-218KNL------------------HLLQQKRIQSFLQPRQRVFL---------------------------------------
K4KKJ3_SIMAS/20-214HAL------------------NQSRLALAQMSLSERQCDAL---------------------------------------
B8F5L0_HAEPS/22-213DML------------------DQFRIHNTLRNHSEAFQSVF---------------------------------------
B0UWZ7_HISS2/4-207EFV------------------DQLRLERALSSTSVEFQRVL---------------------------------------
Q8E9H1_SHEON/9-202ERL------------------NQVRIARALALLSPLQKHLF---------------------------------------
C5BLM3_TERTT/19-214LAI------------------NQDRLTRMRDALTVRQQLVL---------------------------------------
J7SL77_MORMO/4-201DAI------------------NQLRSERATIGMSRAFKDVY---------------------------------------
A3Q9P3_SHELP/3-203ERL------------------NKVRLARALAMLTPLQRHLM---------------------------------------
M5DMW4_9GAMM/16-206LAL------------------NQERLDATRSQMTKRQQAVI---------------------------------------
E6WHF8_PANSA/15-211DAI------------------NQLRVDRALAAMGPAFQHVY---------------------------------------
F7YQ90_VIBA7/4-199DNL------------------NQQRTERALALMDLQSQRVF---------------------------------------
E6VWA6_DESAO/664-855QGF------------------NRKRLVRAMGRLDRDKQAYL---------------------------------------
Q9HTS8_PSEAE/21-217LAV------------------NAGRLQRARQALSSRQERVL---------------------------------------
A6VL92_ACTSZ/4-203ADL------------------EKFRLFRALSGTTDEFRYVF---------------------------------------
Q2SQ66_HAHCH/20-215ITL------------------VEHRLQRTRLALTPRQQVVL---------------------------------------
A3N160_ACTP2/35-224DAL------------------DHFRTQRALAANSPQFQHVF---------------------------------------
E4PK78_MARAH/20-216LLV------------------NQQRWNRAHSALSYRQQMVL---------------------------------------
W8VBQ3_YEREN/4-200DAI------------------NQLRVDRALAAMGPAFQRVY---------------------------------------
B4F1X4_PROMH/4-202DAI------------------NQLRLERAFASMSDVFKQVY---------------------------------------
Q9KVL9_VIBCH/4-199DKL------------------NRQRIERALALMDLQSQRVF---------------------------------------
Q6LLN1_PHOPR/4-203DGH------------------NQLRIERARAAMNVQSEQVF---------------------------------------
D4ZCR6_SHEVD/7-207DRL------------------NRVRQARALALLSPLKRDLL---------------------------------------
Q7VND7_HAEDU/2-191DAL------------------NDFRIERALAANNPQFQHVF---------------------------------------
A4VGX1_PSEU5/20-216LAV------------------NAARLERALAAMSTRQQQVL---------------------------------------
F9ZY47_METMM/21-216KHF------------------NQSRLQRMREFLQPRQYEFL---------------------------------------
M4R7B7_BIBTR/21-222DAL------------------ENHRIYNILKNSDESFKQVF---------------------------------------
CYAA_PASMU/4-205EYL------------------DKLRIERALSGSSGEFQHVF---------------------------------------
Q88B03_PSESM/20-216LSL------------------NDGRYARALEGMSTRQQSVL---------------------------------------
Q65VX6_MANSM/4-207DDL------------------HRLRVERVLQGSTADFQHVF---------------------------------------
Q2NQF3_SODGM/4-200DAI------------------NQLRVDRALAAMGPDFQHVY---------------------------------------
A1TXX4_MARHV/20-216LLV------------------NQQRWQRACSALTYRQQMVL---------------------------------------
CYAA_HAEIN/4-209SAL------------------DQRRFERALQGSGDAFQHVL---------------------------------------
M9X3J4_MANHA/29-225DQL------------------NAYRIERAINANNHHFMHVF---------------------------------------
E1VFT5_9GAMM/19-214LAV------------------NAERLRRTLEGLSPKRQQFL---------------------------------------
M4X4Y6_PSEDE/20-216LKV------------------NAGRLRRASEALSSRQQLVL---------------------------------------
C6BYH9_DESAD/680-878AEN------------------NSRRLDWAQSKLDSKSRKLL---------------------------------------
I5AZY9_9DELT/15-214SNY------------------NVVRMREALRYLSGPKLELF---------------------------------------
Q088L2_SHEFN/10-203EKL------------------NGIRLARVLNVLPESQLHLF---------------------------------------
X2H648_9GAMM/4-197KDL------------------ALLKHERALNAMSEEFQHVF---------------------------------------
A1SR20_PSYIN/12-237DEL------------------TRLRIQSAELLMNADTLTVF---------------------------------------
Q87KJ0_VIBPA/4-199DNL------------------NQQRIDRALALMDSQSQQVF---------------------------------------
H8GI61_METAL/21-218RKF------------------HHFKRESIRHVLTPSQRQFL---------------------------------------
Q21EM4_SACD2/20-215LSI------------------NTDRLERMRSALNSHQQLCL---------------------------------------
A4XNY1_PSEMY/20-216LKI------------------NQGRLQRTMLGLSSRQQLVL---------------------------------------
D6Z233_DESAT/8-206HLY------------------NEERIAKSVLLNPHKSNIIF---------------------------------------
C5BBD1_EDWI9/4-201DAI------------------NQLRVERALSAMGPAFQQVY---------------------------------------
B7VMD8_VIBTL/4-199DNL------------------NQQRIDRALALMNVQGQRVF---------------------------------------
Q88CF9_PSEPK/20-216LHL------------------NQGRLQRAKEGLSTRQQQVL---------------------------------------
C4LDV3_TOLAT/4-196DAI------------------NQIKMERALEAMNEAGRRML---------------------------------------
M4U351_9GAMM/4-197DQF------------------NRLRIQSAQVLMTENEYNVF---------------------------------------
E0SKN1_DICD3/4-200DAI------------------NQLRVDRALEAMKPAFQQVY---------------------------------------
D5C200_NITHN/12-205FAL------------------NRHRLGRVRESLRPRQRVFL---------------------------------------
A0KFH7_AERHH/4-200DEL------------------NRLKTQRALGLMSRYGQQVF---------------------------------------

PF10127

YCGL_BACSU/1-249-----------------------------------MKQRII---------------------------------------
A8MHZ8_ALKOO/1-249-----------------------------------MKSVIM---------------------------------------
Q0ATC2_MARMM/14-264-----------------------------------MHDTIL---------------------------------------
Q5YSM9_NOCFA/7-254-----------------------------------MSVHGS---------------------------------------
A3QAH3_SHELP/6-255-----------------------------------IKKEIL---------------------------------------
Q8Y2V7_RALSO/25-271-----------------------------------IRARVL---------------------------------------
Q97IY9_CLOAB/10-256-----------------------------------IEELVN---------------------------------------
A6LZ95_CLOB8/1-237-----------------------------------MNKVTK---------------------------------------
A8F9S9_BACP2/1-249-----------------------------------MRERIK---------------------------------------
Q2RSZ8_RHORT/22-270-----------------------------------LGPAAA---------------------------------------
Q8SCS5_BPDPK/11-264-----------------------------------MRVTIN---------------------------------------
A9B3Q0_HERA2/60-291-----------------------------------LRKQFN---------------------------------------
A7MPB9_CROS8/11-258-----------------------------------MRERVR---------------------------------------
Q9S235_STRCO/1-245-----------------------------------MIDALD---------------------------------------
Q65NN4_BACLD/1-249-----------------------------------MKQRIE---------------------------------------
Q7ULC4_RHOBA/63-303-----------------------------------IHHDQL---------------------------------------
A9BRG4_DELAS/16-262-----------------------------------MRATVL---------------------------------------
Q7NZ84_CHRVO/14-259-----------------------------------VRRRVM---------------------------------------
Q24TP5_DESHY/3-250-----------------------------------VKERII---------------------------------------
Q7ULC3_RHOBA/4-250-----------------------------------ARIIDY---------------------------------------
Q099H0_STIAD/9-253-----------------------------------HQTRVS---------------------------------------
Q7MZH9_PHOLL/11-258-----------------------------------MKQHIC---------------------------------------
Q0BVF7_GRABC/14-264-----------------------------------IRSVIQ---------------------------------------
A6LZ96_CLOB8/1-249-----------------------------------MDKVIQ---------------------------------------
Q2SQI3_HAHCH/1-246-----------------------------------MEKRIQ---------------------------------------
B4EM27_BURCJ/21-266-----------------------------------.RARVM---------------------------------------
Q814A4_BACCR/1-249-----------------------------------MREKIE---------------------------------------
Q853S4_BPMBZ/16-276-----------------------------------.HEPVQ---------------------------------------
Q9HVK0_PSEAE/13-260-----------------------------------MRERVL---------------------------------------

PF10620

D3FW19_BACPE/3-199DVE..........---............GFLSKETFPDWVYS--------------------------------------
B4EEI1_BURCJ/9-215AAG.WGAAFARDP---ALAGDP............LVRAWAE.--------------------------------------
F2F9N8_SOLSS/4-194SMD..........---............QIDYFGQYPDWMNE--------------------------------------
R5PTN8_9BURK/4-199GKA..........---............SLRDSL..APLIDG--------------------------------------
Q20XM6_RHOPB/11-212EPR..........---............TLISDSSTPAWVFA--------------------------------------
G8NWE2_GRAMM/10-208SGR..........---............VHPACMAEPPWVQT--------------------------------------
Q6FBG5_ACIAD/8-200TCE..........---............MLPEDA..PHWVKD--------------------------------------
Q478I8_DECAR/2-209RDA....LFSTPC---AETGDPYWQA........A.GDWIA.--------------------------------------
G8M515_9BURK/7-206PGA..........---..............PPFADAPGWVAA--------------------------------------
Q13P70_BURXL/22-223.............---............RLQTFDAEPAWVRE--------------------------------------
B0UJ86_METS4/6-208PQA.WAGVLAGRP---DIEGVP............HVAEWAQ.--------------------------------------
E0SJB7_DICD3/5-200SRE..........---............ALEGID..APWVDS--------------------------------------
B1Y603_LEPCP/24-240PAG.WQTVLAQTH---AESARPC............LAHWAA.--------------------------------------
B6JE84_OLICO/7-212PER..........---...LSDGAIRTAHSQDIAVIESWIR.--------------------------------------
MDCG_BRADU/13-217PAG.WRAMLDARD---DLAADS............LLARWPK.--------------------------------------
D5AVP5_RHOCB/5-220PAS..RPGILAAV---LDALPEQMRD..PGTRKLVRDAMSK.--------------------------------------
Q2RUR7_RHORT/4-220PIA..RARLLPAL---IEALPAAMRG..PDIEARIEHVLIS.--------------------------------------
D3HKK0_LEGLN/3-206PGT..........---..EFFLVSCHEENRLIKEHVSAWFA.--------------------------------------
A0R6Q2_MYCS2/5-197DVA..........---............RLSGDA..PSWVAA--------------------------------------
I3U924_ADVKW/2-208SNA.EYQLLSP..---..VQSPTAQA........ALQRWLH.--------------------------------------
A4G557_HERAR/3-213ANG.W.....QAA---CARLPAAHAK........ELMRWAE.--------------------------------------
H5WND7_9BURK/5-214AAG.WQAILAMPW---DDEASAC............LAHWAA.--------------------------------------
W0PCX9_9BURK/2-210PTA.DYRLLST..---..SPDAAAHH........ALQRWLH.--------------------------------------
A8AQP5_CITK8/6-200ARS..........---............ALEGVT..ESWVDD--------------------------------------
D8IXS4_HERSS/5-221EAA.WTRLQTQSQ---DSREQAV............LARWRQ.--------------------------------------
Q4FSL5_PSYA2/2-211PEEAFTMLNASLP---LAVIQAVD.............NMIM.--------------------------------------
G0ABH8_COLFT/3-212ADG.WQRAA.QTA---AAGNRAA............LERWQS.--------------------------------------
C5AE29_BURGB/13-235PAA.W.AALAEPL---VERLALPA.ADA...A..VIRAWAA.--------------------------------------
Q21XD0_RHOFT/5-210AQA.WAQMQAHPW---DDEAQH............ILAHWRS.--------------------------------------
A1WLX1_VEREI/8-240PAL..........---...RAQDMRAGTGAGAVQAFIARAQ.--------------------------------------
Q89UY6_BRADU/6-207AAG.WAAVMSRHP---ELASEP............IIDGWAR.--------------------------------------
C5APL6_METEA/6-211PGA.WAAAVIARA---DLAEVP............HVAAWVN.--------------------------------------
F6AEK3_PSEF1/6-203LPT..........---............QLPQEA..PAWARA--------------------------------------
MDCG_PSEAE/8-202APA..........---............HLPENA..PAWVCA--------------------------------------
A4VRY6_PSEU5/6-198RPE..........---............QLPADA..PAWAVA--------------------------------------
D7A7S9_STAND/7-217PEG.WRATLTVT.---......EGLERLSDEPRRLVEGWCE.--------------------------------------
B2JLU1_PARP8/24-227.............---............KLEPFDAEPAWVRD--------------------------------------
MDCG_XANCP/3-204ADA..........---.......PSQALTPGAQPRLQAWFA.--------------------------------------
I2BDH6_SHIBC/7-201SNT..........---............PPQGIT..DPWVAE--------------------------------------
A9BUU4_DELAS/12-224PQA.WADLLERPR---DAQAREI............LTHWRD.--------------------------------------
H0Q3G4_9RHOO/2-205PAF..........---.....PLADFGVTEDHRAELGDWIA.--------------------------------------
G2IWN4_PSEUL/8-208DPA..........---............ALCTDTPLPDWAGA--------------------------------------
MDCG_KLEP7/6-200HAS..........---............ALEDIA..EPWVAQ--------------------------------------
H2IQE3_RAHAC/5-202DRS..........---............ALESDDVLPEWVNT--------------------------------------
S6AL15_PSERE/6-197TPD..........---............QLPGEA..PDWARQ--------------------------------------
A1VKU0_POLNA/11-212AAS..........---............SLVFSGPPPPWATP--------------------------------------
MDCG_PSESM/9-203PLS..........---............ALPDDA..PQWAVD--------------------------------------
H8MH16_CORCM/7-204DH..WAEALRSPL---IPDVLV............HVTAWRA.--------------------------------------
B8EMG7_METSB/15-229PEG...FAIALAG---FAQAESPAGAPVKIPP..IVTEWAA.--------------------------------------
E6WJH1_PANSA/6-195HDR..........---............ALVGIT..EAWVAE--------------------------------------
B1M799_METRJ/6-209PAA.WAAWRVGRP---DLSAVP............HLEHWAA.--------------------------------------
MDCG_AZOVD/9-206STD..........---............RLDAAA..PTWAAE--------------------------------------
W0LLU0_9GAMM/3-217PQA..AQQIFLLW---QAAQPHDWLSSLPDWQ....RSFNA.--------------------------------------
A5VEB4_SPHWW/8-205SGA..........---.......RIEGVAAAPEVLLADWVA.--------------------------------------
B2UKC7_RALPJ/7-206ETP..........---............VATDDAPLPDWAIT--------------------------------------
Q21AG0_RHOPB/4-220VEE..RLRSAETV---CGGLLAPFRQ..PALQEQVRRAFAA.--------------------------------------
A2SDW3_METPP/11-216PDL..........---...GPADLAGLGDPTDAQAVVDWAQ.--------------------------------------
A1T0S3_PSYIN/7-202DIV..........---............IHQEN...PNWYAN--------------------------------------
B2FSQ2_STRMK/6-203ADADWRADVTA..---...............HEPRLAAWFA.--------------------------------------
B8IJN7_METNO/6-210PGA.WAAMLAQRP---DLDGVP............HVADWAR.--------------------------------------

PF03296

Q9EN10_AMEPV/129-284EILKQYVYKQKLK---NVTVNND......KKKIIDPDDEKLA--------------------------------------
PAP1_CPRVZ/123-270AMLRSY.......---RVTDGAG..PPKGRNKVSD.....LV--------------------------------------
PAP1_DPV83/122-269DALNSM.......---NIATISD..KVMGRHNVSS.....LV--------------------------------------
PAP1_MCV1/122-269EVLWSY.......---NVAFRSG..KVMGRHCVSN.....LV--------------------------------------
Q6TVV2_ORFSA/120-268RALDSY.......---AVLPPPEEAAPMARHKHSD.....LV--------------------------------------
PAP1_VAR67/131-279DMLNSM.......---NVAVIDK.AKVMGRHNVSS.....LV--------------------------------------
PAP1_FOWPN/124-271DILDSY.......---NVVEPSK..EVKGRHKVSD.....LV--------------------------------------

PF04439

R7KZ10_9FIRM/1-274LIIGTARADERIR---AVYMNGS.......RTDKNAPKVIF---------------------------------------
W6S1S8_9CLOT/1-279LILSIANNDKRIH---AVYMNGS.......RVNKNIKSDIF---------------------------------------
L0EDK7_THECK/1-279LIVGFAKADERVR---AVILNGS.......RANPDAPRDCF---------------------------------------
R7M6A2_9CLOT/3-279TILNFAKADDRIR---VVTLEGS.......RTNINIIPDDF---------------------------------------
F0RJQ6_DEIPM/17-291RVRAFAEADPRVR---AAVLSGS.......RVNAAIRPDPF---------------------------------------
C9A7Q4_ENTCA/1-276LILSVGQRV.GAR---AIGLSGS.......RTDPQAPKDFL---------------------------------------
R5BA48_9CLOT/1-282TILSVVKSSDNIR---AAYMNGS.......RTNPNVEKDEL---------------------------------------
J7SKW9_MORMO/1-275NIISFALLDPRID---AVIITGS.......VARQNQA.DRF---------------------------------------
C0ZBY2_BREBN/3-281MLIDFARKDDRIR---LVTLEGS.......RTNKNIPADPF---------------------------------------
F8KV03_PARAV/7-263.IVEWAKQEQTVK---AVILQGS.......HATNQA..DRY---------------------------------------
R6MWH0_9CLOT/1-270IILKKAKQEEHIR---AALLQGS.......RVSKEAKPDCF---------------------------------------
D1API7_SEBTE/1-279LILRTAVNDPEIR---AVYMNGS.......RTNPNVKKDIF---------------------------------------
Q81EL0_BACCR/1-279LIINTAIEDERIR---AVIMNGS.......RVNPNVKRDCF---------------------------------------
E8N0I5_ANATU/1-276LILTFARNDERVR---AVILNGS.......RANPNAPRDFF---------------------------------------
T0U4V5_9ENTE/1-276VILRVGQKI.GVQ---AIAISGS.......RREPNAISDRF---------------------------------------
F5WV16_ERYRF/1-277LILEQAKLSQHIR---IVAMNGS.......RVNKEIEKDSM---------------------------------------
Q7N6T3_PHOLL/8-279KILTFAHNDPRID---TVIQTGS.......RARNARV.DKF---------------------------------------
D6DFM9_CLOSC/1-277IVLNFAKTDKRIR---MVTLEGS.......RTNTNIPPDDF---------------------------------------
C6VZK2_DYAFD/8-288LILEVARKDHRIL---AVLQDGS.......RSNPNVTPDIF---------------------------------------
F4C3Y1_SPHS2/10-290LILRVAAKDTKIL---GVLQDGS.......RSNPNVSKDIF---------------------------------------
Q9KFZ4_BACHD/1-282VILTIAKKEERIR---AVYMNGS.......RTNSNVPKDLF---------------------------------------
D3HMA9_LEGLN/5-280LIVQAAKNDKRIR---AVIMNGS.......RASPSAKKDIF---------------------------------------
G4L4M5_TETHN/1-277LILETAQKLPEVK---AVAMSGS.......RANKSIPKDNF---------------------------------------
A5N4U0_CLOK5/1-276LIIAVANNDVRIR---AAYLEGS.......RANPNVPKDIF---------------------------------------
F3ZWD0_MAHA5/1-282LILGVAESDEHVR---AVYMNGS.......RANPNITKDAY---------------------------------------
Q830C7_ENTFA/1-279LIMDVAKQEEHIR---AVGMVGS.......RTNVKAPKDSF---------------------------------------
E1R322_SPISS/4-281LIYNFVEADNRIR---VVIMNGS.......RVNPNIQKDIF---------------------------------------
D3EE58_GEOS4/1-279LVLGYAARDERVR---AVTLEGS.......RTNPNVPKDIF---------------------------------------
F5YA41_TREAZ/1-278LILGVAQKDERIR---AVWMNGS.......RTNTNAPKDDF---------------------------------------
K0J1M0_AMPXN/1-279LVLNFAKNDQRVR---AVGLNGS.......RTNPNAPRDIF---------------------------------------
D9SUI2_CLOC7/1-279LILNTAKEDERIR---AVYINGS.......RTNPNAIKDIF---------------------------------------
A8MEJ4_ALKOO/1-277LMLDIAKQDERIR---IMILEGS.......RTNVNIPKDEF---------------------------------------
A6TTG7_ALKMQ/1-278RILNTAKEDERIR---AVVMNGS.......RVGNPSSKDCF---------------------------------------
Q5WJQ6_BACSK/1-279LFLDFAKNDERIR---LVTLEGS.......RTNKAITPDKF---------------------------------------
E3EGQ4_PAEPS/1-279MLVKFAMNDKRIR---LVTMEGS.......RTNFNVPPDSF---------------------------------------
G7M0J2_9CLOT/1-279LILSAAENDERIR---AVVMNGS.......RTNRNAIKDIF---------------------------------------
I0JN00_HALH3/1-279LILSVAETEPHIR---GVIMNGS.......RVNPNVTPDLF---------------------------------------
Q5ZTL0_LEGPH/5-281LIIKIANDDERIK---IVIMNGS.......RASPSAKKDIF---------------------------------------
Q5WBU9_BACSK/1-278LLLGVAKSDERIR---AVCMNGS.......RTNRNARKDPF---------------------------------------
H1ZC54_MYROD/8-281QVLDLASNDTRIR---AVLLNGS.......RANPNVMPDVY---------------------------------------
Q65P34_BACLD/1-285LVLKVAREDSRVR---AVGMNGSRTNPNVPRTNPNVPKDPF---------------------------------------
R7EXP0_9FIRM/1-276LIIRTAREDERII---AAYLEGS.......RVDPNAQKDIF---------------------------------------
D9SN58_CLOC7/1-281LILNIAKEDARIR---AVYLSGS.......RVDPDATQDKY---------------------------------------
E3EJ73_PAEPS/1-278TILQFAQEDERVR---AVIMNGS.......RANPHAPRDIF---------------------------------------
H6NNB4_9BACL/1-279TILSFANEEEGIR---AVIMNGS.......RVNPKARRDPF---------------------------------------
R6VSM5_9FIRM/1-276LLINTAAQDDRIR---AAYLEGS.......RVNPDVPRDMF---------------------------------------
Q3Y246_ENTFC/1-277LVLSLAEQDERIR---IVTLEGS.......RANINIPKDEF---------------------------------------
J9R2N9_RIEAN/1-283TIIEWSEKNEDVR---VLLLTSS.......LVNPLALVDEF---------------------------------------
C6XTS4_PEDHD/4-284LILDVATDHPEVR---AVLLNGS.......RANPNVATDIF---------------------------------------
Q24XY2_DESHY/1-282IILSTAKKDERIR---AVYMNGS.......RTNPNVPKDIY---------------------------------------
K8E427_CARML/1-279LILQKAQLDERIR---GVLLNGS.......RANKHVKPDRL---------------------------------------
E0RXK3_BUTPB/1-281LIIKTATEDDRIR---AATMEGS.......AVTPGAVRDGF---------------------------------------
R5RFU0_9FIRM/1-279LFDNIAKTDDRIR---VMTLEGS.......RVNPNVKPDQW---------------------------------------
AADK_BACSU/1-279IFLDFALNDERIR---LVTLEGS.......RTNRNIPPDNF---------------------------------------
R5A566_9CLOT/1-278LILEYAWKDPKIR---GVILNGS.......RANPTAKLDRF---------------------------------------

PF01743

PCNB_ECOLI/62-193--------------------------------------------------------------------------------
O66728_AQUAE/454-580--------------------------------------------------------------------------------
Q93795_CAEEL/38-162--------------------------------------------------------------------------------
CCA_BACSU/22-142--------------------------------------------------------------------------------
O83294_TREPA/24-145--------------------------------------------------------------------------------
O84710_CHLTR/23-143--------------------------------------------------------------------------------
O67911_AQUAE/37-172--------------------------------------------------------------------------------
O51649_BORBU/24-145--------------------------------------------------------------------------------
O83605_TREPA/50-165--------------------------------------------------------------------------------
PCNB_HAEIN/50-181--------------------------------------------------------------------------------
O25357_HELPY/22-146--------------------------------------------------------------------------------
P74081_SYNY3/512-663--------------------------------------------------------------------------------
CCA1_YEAST/63-205--------------------------------------------------------------------------------
I1NH95_SOYBN/99-237--------------------------------------------------------------------------------
Q88DX1_PSEPK/56-188--------------------------------------------------------------------------------
Q94K06_ARATH/110-247--------------------------------------------------------------------------------
Q9CCY1_MYCLE/41-168--------------------------------------------------------------------------------

PF06042

F7YRG9_VIBA7/44-201--------------------------------------------------------------------------------
B9JA85_AGRRK/24-187--------------------------------------------------------------------------------
Q7NQC6_CHRVO/26-191--------------------------------------------------------------------------------
A9KPI8_CLOPH/31-195--------------------------------------------------------------------------------
I1RDV7_GIBZE/30-194--------------------------------------------------------------------------------
C4L4W2_EXISA/22-184--------------------------------------------------------------------------------
E6X9J4_CELAD/24-180--------------------------------------------------------------------------------
T0TPF3_9STRE/22-184--------------------------------------------------------------------------------
E6TYF2_BACCJ/23-185--------------------------------------------------------------------------------
B2IE49_BEII9/22-182--------------------------------------------------------------------------------
R7F266_9BACI/28-194--------------------------------------------------------------------------------
Q47ZE1_COLP3/38-196--------------------------------------------------------------------------------
B7VSV6_VIBTL/5-162--------------------------------------------------------------------------------
B9DTD2_STRU0/21-182--------------------------------------------------------------------------------
G8S5F2_ACTS5/30-189--------------------------------------------------------------------------------
A8GHE5_SERP5/22-179--------------------------------------------------------------------------------
K9WRX7_9NOST/22-176--------------------------------------------------------------------------------
Q6LIY1_PHOPR/48-206--------------------------------------------------------------------------------
K9ZZZ5_DEIPD/21-185--------------------------------------------------------------------------------
K8E4K8_CARML/22-184--------------------------------------------------------------------------------
S8BA31_DACHA/30-194--------------------------------------------------------------------------------
T0TA19_9STRE/18-179--------------------------------------------------------------------------------
K9PHD3_9CYAN/22-177--------------------------------------------------------------------------------
A4Z2D9_BRASO/21-184--------------------------------------------------------------------------------
R8BBT8_TOGMI/30-194--------------------------------------------------------------------------------
Q0WCS8_YERPE/22-199--------------------------------------------------------------------------------
W0L9G9_9GAMM/22-179--------------------------------------------------------------------------------
E1V6J0_HALED/24-181--------------------------------------------------------------------------------
U4KG05_9VIBR/26-182--------------------------------------------------------------------------------
Q8EGD2_SHEON/29-193--------------------------------------------------------------------------------
Q8DVZ2_STRMU/21-183--------------------------------------------------------------------------------
E9ELM3_METRA/30-196--------------------------------------------------------------------------------
G8PQI6_PSEUV/58-222--------------------------------------------------------------------------------
A1S5C1_SHEAM/40-192--------------------------------------------------------------------------------
D4ZAN8_SHEVD/35-191--------------------------------------------------------------------------------
Q8YZI8_NOSS1/21-177--------------------------------------------------------------------------------
I3TT60_TISMK/24-184--------------------------------------------------------------------------------
M4XBK0_PSEDE/30-180--------------------------------------------------------------------------------
A0KID9_AERHH/44-203--------------------------------------------------------------------------------
B2J7L9_NOSP7/21-177--------------------------------------------------------------------------------
Q98CQ2_RHILO/58-222--------------------------------------------------------------------------------
A7HQY2_PARL1/21-184--------------------------------------------------------------------------------
G2SQN4_LACRR/23-176--------------------------------------------------------------------------------
C9A5U1_ENTCA/30-192--------------------------------------------------------------------------------
Q8E2A6_STRA5/19-180--------------------------------------------------------------------------------
D0J385_COMT2/22-181--------------------------------------------------------------------------------
C9SMQ7_VERA1/31-195--------------------------------------------------------------------------------
U5L946_9BACI/24-185--------------------------------------------------------------------------------
Q6F6M2_ACIAD/63-218--------------------------------------------------------------------------------
Q0ATF8_MARMM/35-199--------------------------------------------------------------------------------
Q12L07_SHEDO/33-198--------------------------------------------------------------------------------
B5I7I9_9ACTN/30-193--------------------------------------------------------------------------------
Q9KMH4_VIBCH/42-199--------------------------------------------------------------------------------
G3J5G4_CORMM/36-202--------------------------------------------------------------------------------
Q89V81_BRADU/22-184--------------------------------------------------------------------------------
Q5WAS6_BACSK/23-185--------------------------------------------------------------------------------
Q03U83_LACBA/22-184--------------------------------------------------------------------------------
H2IZW8_RAHAC/23-181--------------------------------------------------------------------------------
D3E7U6_GEOS4/21-179--------------------------------------------------------------------------------
F9UNI3_LACPL/22-183--------------------------------------------------------------------------------
Q9CGK8_LACLA/22-182--------------------------------------------------------------------------------
A4VSF2_STRSY/43-201--------------------------------------------------------------------------------
W8UHS0_YEREN/24-184--------------------------------------------------------------------------------
C5CXQ6_VARPS/13-176--------------------------------------------------------------------------------
H8L6T1_FRAAD/26-186--------------------------------------------------------------------------------
B9JP57_AGRRK/25-185--------------------------------------------------------------------------------
C0ZRT4_RHOE4/21-184--------------------------------------------------------------------------------
I0JHP3_HALH3/24-186--------------------------------------------------------------------------------
B4RAU1_PHEZH/22-186--------------------------------------------------------------------------------
R7F5W6_9BACI/28-194--------------------------------------------------------------------------------
A0ZEL1_NODSP/6-161--------------------------------------------------------------------------------
F0LZI9_VIBFN/22-180--------------------------------------------------------------------------------
K0I121_9BURK/29-196--------------------------------------------------------------------------------
N0ATJ8_9BACI/22-184--------------------------------------------------------------------------------
K9QIT0_9NOSO/21-177--------------------------------------------------------------------------------
A6WX10_OCHA4/47-208--------------------------------------------------------------------------------
C6D3F5_PAESJ/25-186--------------------------------------------------------------------------------
Q7MJH5_VIBVY/23-178--------------------------------------------------------------------------------
F3ZCS6_9ACTN/62-226--------------------------------------------------------------------------------
A6VYX8_MARMS/22-179--------------------------------------------------------------------------------
A4VG22_PSEU5/22-182--------------------------------------------------------------------------------
F5Z4Y3_ALTNA/31-192--------------------------------------------------------------------------------
G4R9P5_PELHB/34-198--------------------------------------------------------------------------------
X4ZH19_9BACL/21-179--------------------------------------------------------------------------------
N4VT77_COLOR/30-193--------------------------------------------------------------------------------
G8PQI7_PSEUV/50-212--------------------------------------------------------------------------------
Q084X9_SHEFN/37-198--------------------------------------------------------------------------------
R4L9D2_9ACTN/23-182--------------------------------------------------------------------------------
Q8CZ82_STRR6/25-187--------------------------------------------------------------------------------
K9W6P1_9CYAN/21-184--------------------------------------------------------------------------------
D9QML6_BRESC/23-187--------------------------------------------------------------------------------
C9A9L8_ENTCA/21-183--------------------------------------------------------------------------------
C2WZT1_BACCE/24-186--------------------------------------------------------------------------------
K9RM73_9CYAN/21-177--------------------------------------------------------------------------------
V4KBT1_9ACTN/35-199--------------------------------------------------------------------------------
C7ZKJ8_NECH7/30-194--------------------------------------------------------------------------------
E3EIW9_PAEPS/24-182--------------------------------------------------------------------------------
Q2S808_HAHCH/20-179--------------------------------------------------------------------------------
Q9A3I2_CAUCR/24-192--------------------------------------------------------------------------------
T0LHD4_COLGC/33-197--------------------------------------------------------------------------------
Q5M5D3_STRT2/19-183--------------------------------------------------------------------------------
A8AUH1_STRGC/23-185--------------------------------------------------------------------------------

PF07984

L5LWP1_MYODS/17-336HEVLNEVVPVHGR.G.NFPTLELTLKDIVQTVRSRLEEA...--------------------------------------
A1Z745_DROME/52-381HDVMDEKVAIHGR.G.NFPTLEVKLKDLVNLVRRKLEAEVNA--------------------------------------
T1FNH1_HELRO/24-358DQIIGSTFDVHGHSGLGYPNLSIKAKELIVAVRDKLVES...--------------------------------------
T1J6X5_STRMM/39-359DTVMEEVVPIHGR.G.NFPTLEIKLKDLVHVVRSKLESD...--------------------------------------
G3Q3S6_GASAC/31-351HQVLSEAVPIHGR.G.NFPTLELRPRDIIIAVRARLQQQ...--------------------------------------
H2Z3D3_CIOSA/19-351TELMEADVPIHGV.G.NFPDLQISPSELIQMVCDRLECS...--------------------------------------
H9GHA4_ANOCA/13-332DQVLTEVIPIHGR.G.NFPTLEVKPKDIIRVVKEQLIKK...--------------------------------------
B3RY60_TRIAD/11-330DEILTQVISIDGV.G.NFPSLEVRPYQFVNLILKKLAIH...--------------------------------------
E4X262_OIKDI/463-783QKILDKSHEIHGK.G.NFPTITVEPTKLIKDIHARLGEA...--------------------------------------
G4M0E2_SCHMA/159-490HYVLSKTIPIHSRYP.GFPTIMVKLHDLLRAVRGNLKSA...--------------------------------------
W5NMQ1_LEPOC/15-334DEVMTEAVPVHGR.G.NFPTLEVRLKDIVQMVRSRLEEK...--------------------------------------
A7T168_NEMVE/10-329DNVLNQVVQVHGR.G.NFPTLDVHLRELINVVSSGLKDE...--------------------------------------
T1K5N9_TETUR/11-330DTVMDEVVPIHGR.G.NFPTLEMKLKDLVSVVRGKLEEE...--------------------------------------
I1FWF4_AMPQE/47-375SQIVSDPIAINAKEG.NFPTLAISPAQLIKAVKKRLDSK...--------------------------------------
B3RUB7_TRIAD/6-351VELLETCVEIHGY.G.NLPTLQIPLKELLRKVRNNLRKD...--------------------------------------
K1PBY4_CRAGI/10-333NKVMEDVIPIHGR.G.NFPTLDVKLKDLVQVVRDKLKAE...--------------------------------------
F7AS71_MONDO/19-338DQVLSEDVPIHGR.G.NFPTLEVKTKDIILVIQEELQKK...--------------------------------------
H2LZV4_ORYLA/17-337DRILTEVIPIHGR.G.NFPTLQVRVKDIIRVVKDRLVER...--------------------------------------
F7E7M3_XENTR/18-337DAILCESVPIHGR.G.NFPTLSCRPRDLVQVVRSRLEQK...--------------------------------------
H3E7R5_PRIPA/59-392QQLLNENIEIDGA.G.NFPEIILPLRHFVVALKRQLVSA...--------------------------------------
J9JYZ0_ACYPI/99-447NDVMDETVSIHGR.G.NFPTLEVRLRDLVAMVRDRLRAQAAP--------------------------------------
E9HG11_DAPPU/7-330HDVMNETVSIHGR.G.NFPTLELRLRDLVTLVRAKLEAD...--------------------------------------
H9JEQ9_BOMMO/53-380NDVMDEVVAIHGR.G.NFPTLHVRLRELVAGVRARLELAQAA--------------------------------------
FA46B_HUMAN/52-372DALLSEPIPIHGR.G.NFPTLSVQPRQIVQVVRSTLEEQ...--------------------------------------
G3VWF6_SARHA/61-380DDILSETIPIHGR.G.NFPTLEMQPRQIVKVVRSRLEEK...--------------------------------------
Q86NJ5_CAEEL/50-400RAVLEERVEIHGR.G.NFPTISTKLINLIRCLRQHMGSV...--------------------------------------
F1S1S5_PIG/9-328DQVLNEVIPIHGR.G.NFPTLEVKPKDIIHVVKDQLIEQ...--------------------------------------
E9IG33_SOLIN/73-399NDVMNEVVSIHGR.G.NFPTLEVRLRDLVTVVRSKLETDPSN--------------------------------------
W4YCY4_STRPU/13-330DEVLTTPVAVHGR.G.NFPTLDVTLLDLVENVREKLVGS...--------------------------------------
C3YH94_BRAFL/153-472DQVLNDVVPIHGR.G.NFPTLEICLKSLVQVVRKRLEEE...--------------------------------------
H3D951_TETNG/18-337DSILAESVPIHGR.G.NFPTLSVQPRQIVQVVRARLEER...--------------------------------------
E1FUA8_LOALO/18-327RSVLNEQVEIHGR.G.NFPTISVRLHDLIVCVRDSLRAA...--------------------------------------

PF12281

A8I451_AZOC5/134-340--------------------------------------------------------------------------------
B9JC00_AGRRK/105-319--------------------------------------------------------------------------------
A1BBC9_PARDP/103-312--------------------------------------------------------------------------------
Q126S1_POLSJ/108-319--------------------------------------------------------------------------------
Q5P6X2_AROAE/109-317--------------------------------------------------------------------------------
Q89MC1_BRADU/114-315--------------------------------------------------------------------------------
A9CH87_AGRFC/104-319--------------------------------------------------------------------------------
Q98P17_RHILO/173-382--------------------------------------------------------------------------------
Q8KKU1_RHIEC/104-319--------------------------------------------------------------------------------
N0AYX3_9RHIZ/127-330--------------------------------------------------------------------------------
B6IPR2_RHOCS/108-321--------------------------------------------------------------------------------
V5SE53_9RHIZ/102-312--------------------------------------------------------------------------------
Q9A9N3_CAUCR/103-311--------------------------------------------------------------------------------
A8LU12_DINSH/105-313--------------------------------------------------------------------------------
D6ZZH4_STAND/103-312--------------------------------------------------------------------------------
Q3IVG2_RHOS4/104-312--------------------------------------------------------------------------------
M4S0H4_9SPHN/98-303--------------------------------------------------------------------------------
Q3IV36_RHOS4/114-326--------------------------------------------------------------------------------
B8IY04_METNO/103-315--------------------------------------------------------------------------------
D5CPE9_SIDLE/109-318--------------------------------------------------------------------------------
B3E5Q2_GEOLS/108-317--------------------------------------------------------------------------------
A9BZ70_DELAS/2-210--------------------------------------------------------------------------------
Q12C53_POLSJ/118-324--------------------------------------------------------------------------------
Q0C240_HYPNA/104-317--------------------------------------------------------------------------------
C3KPJ9_SINFN/33-247--------------------------------------------------------------------------------
B4RE82_PHEZH/98-305--------------------------------------------------------------------------------
Q0C284_HYPNA/109-317--------------------------------------------------------------------------------
A4SVJ5_POLSQ/110-320--------------------------------------------------------------------------------
A1AK69_PELPD/13-213--------------------------------------------------------------------------------
Q930T5_RHIME/105-319--------------------------------------------------------------------------------
F2IVW1_POLGS/104-311--------------------------------------------------------------------------------
A6WWH8_OCHA4/115-328--------------------------------------------------------------------------------
C3KKL2_SINFN/104-319--------------------------------------------------------------------------------
A2SPA0_METPP/110-321--------------------------------------------------------------------------------

PF03813

Q5KIJ7_CRYNJ/233-379--------------------------------------------------------------------------------
S8AXB6_PENO1/184-327--------------------------------------------------------------------------------
D8QKX0_SCHCM/187-335--------------------------------------------------------------------------------
M3AM01_PSEFD/220-362--------------------------------------------------------------------------------
H2M2T9_ORYLA/159-300--------------------------------------------------------------------------------
NOL6_DROME/177-320--------------------------------------------------------------------------------
U4LAZ7_PYROM/171-313--------------------------------------------------------------------------------
Q54EN2_DICDI/238-409--------------------------------------------------------------------------------
H0YTW4_TAEGU/134-276--------------------------------------------------------------------------------
H2B1K6_KAZAF/189-339--------------------------------------------------------------------------------
UTP22_YEAST/203-355--------------------------------------------------------------------------------
G3ALQ0_SPAPN/188-336--------------------------------------------------------------------------------
G2R7X2_THITE/138-287--------------------------------------------------------------------------------
G4T7W1_SERID/218-359--------------------------------------------------------------------------------
K3WBL1_PYTUL/157-303--------------------------------------------------------------------------------
J9K0G8_ACYPI/152-299--------------------------------------------------------------------------------
W5J7Q1_ANODA/253-396--------------------------------------------------------------------------------
B4JHB6_DROGR/155-297--------------------------------------------------------------------------------
M2NLG7_BAUCO/120-261--------------------------------------------------------------------------------
A0A0D1C533_USTMA/328-482--------------------------------------------------------------------------------
J3KKN7_COCIM/166-310--------------------------------------------------------------------------------
B5RT80_DEBHA/198-344--------------------------------------------------------------------------------
I2H5R1_TETBL/205-366--------------------------------------------------------------------------------
B2AL59_PODAN/139-285--------------------------------------------------------------------------------
S3BW46_OPHP1/142-297--------------------------------------------------------------------------------
F4P4W3_BATDJ/193-345--------------------------------------------------------------------------------
G4N9I5_MAGO7/142-294--------------------------------------------------------------------------------
G7XFJ4_ASPKW/178-320--------------------------------------------------------------------------------
T5AFI7_OPHSC/141-290--------------------------------------------------------------------------------
H9JCB7_BOMMO/161-301--------------------------------------------------------------------------------
A7S7H5_NEMVE/144-283--------------------------------------------------------------------------------
G9NYU4_HYPAI/141-292--------------------------------------------------------------------------------
NOL6_DROPS/196-339--------------------------------------------------------------------------------
G8ZWX5_TORDC/184-337--------------------------------------------------------------------------------
W5KKI6_ASTMX/169-309--------------------------------------------------------------------------------
M2PAE8_CERS8/217-361--------------------------------------------------------------------------------
UTP22_SCHPO/163-301--------------------------------------------------------------------------------
E0VHG7_PEDHC/176-317--------------------------------------------------------------------------------
A5DT88_LODEL/234-380--------------------------------------------------------------------------------
M9LQU0_PSEA3/304-455--------------------------------------------------------------------------------
A1CJ23_ASPCL/130-272--------------------------------------------------------------------------------
G3B4V1_CANTC/185-331--------------------------------------------------------------------------------
M7WDQ1_RHOT1/288-444--------------------------------------------------------------------------------
H2YJS5_CIOSA/125-260--------------------------------------------------------------------------------
G0VFC1_NAUCC/189-341--------------------------------------------------------------------------------
U7Q6Q9_SPOS1/142-304--------------------------------------------------------------------------------
C5DLD6_LACTC/208-353--------------------------------------------------------------------------------
C7YP94_NECH7/141-297--------------------------------------------------------------------------------
J3NVZ7_GAGT3/141-284--------------------------------------------------------------------------------
T1EE31_HELRO/41-182--------------------------------------------------------------------------------
N1PEU7_DOTSN/213-360--------------------------------------------------------------------------------
U5H217_USTV1/304-456--------------------------------------------------------------------------------
Q7S1X8_NEUCR/140-283--------------------------------------------------------------------------------
J5JXU5_BEAB2/141-288--------------------------------------------------------------------------------
R1EK47_BOTPV/229-373--------------------------------------------------------------------------------
B0DGR0_LACBS/207-350--------------------------------------------------------------------------------
H9GJA7_ANOCA/168-310--------------------------------------------------------------------------------
D5GP17_TUBMM/183-326--------------------------------------------------------------------------------
K7IX79_NASVI/181-318--------------------------------------------------------------------------------
Q0CBE8_ASPTN/162-304--------------------------------------------------------------------------------
F8Q1T2_SERL3/168-313--------------------------------------------------------------------------------
E9E4A5_METAQ/141-303--------------------------------------------------------------------------------
J7RUP2_KAZNA/200-355--------------------------------------------------------------------------------
H3GEK8_PHYRM/137-283--------------------------------------------------------------------------------
A7TPZ3_VANPO/200-354--------------------------------------------------------------------------------
A0A0J9XU34_BRUMA/124-262--------------------------------------------------------------------------------
Q0TXJ2_PHANO/222-368--------------------------------------------------------------------------------
M7NIM6_PNEMU/162-296--------------------------------------------------------------------------------
H2WFH4_CAEJA/116-247--------------------------------------------------------------------------------
A8PXA3_MALGO/185-331--------------------------------------------------------------------------------
G8BYJ9_TETPH/125-280--------------------------------------------------------------------------------
G0S2E0_CHATD/140-292--------------------------------------------------------------------------------
F0ZRR2_DICPU/239-413--------------------------------------------------------------------------------
F1Q4S6_DANRE/183-325--------------------------------------------------------------------------------
R7YYN3_CONA1/232-378--------------------------------------------------------------------------------
C5DTY5_ZYGRC/198-349--------------------------------------------------------------------------------
H2SN18_TAKRU/152-294--------------------------------------------------------------------------------
B6HEW6_PENRW/160-297--------------------------------------------------------------------------------
Q0WVM5_ARATH/98-233--------------------------------------------------------------------------------
G8JTZ4_ERECY/210-355--------------------------------------------------------------------------------
B8P8H6_POSPM/495-636--------------------------------------------------------------------------------
G2QK39_MYCTT/138-286--------------------------------------------------------------------------------
Q17D12_AEDAE/220-361--------------------------------------------------------------------------------
M3CZA8_SPHMS/219-358--------------------------------------------------------------------------------
Q6FTF1_CANGA/168-320--------------------------------------------------------------------------------
Q75A89_ASHGO/203-347--------------------------------------------------------------------------------
F9XME7_ZYMTI/118-257--------------------------------------------------------------------------------
U9SUM6_RHIID/312-461--------------------------------------------------------------------------------
L8GAM4_PSED2/166-311--------------------------------------------------------------------------------
Q4WWD9_ASPFU/164-305--------------------------------------------------------------------------------
C4XY87_CLAL4/190-336--------------------------------------------------------------------------------
K4BB35_SOLLC/99-234--------------------------------------------------------------------------------
Q5TPK2_ANOGA/245-394--------------------------------------------------------------------------------
C4R925_KOMPG/180-340--------------------------------------------------------------------------------
W5FGR4_WHEAT/95-231--------------------------------------------------------------------------------
G0NWB7_CAEBE/112-243--------------------------------------------------------------------------------
W1Q9F0_OGAPD/155-302--------------------------------------------------------------------------------
M5EB57_MALS4/206-350--------------------------------------------------------------------------------
N1JI70_BLUG1/174-315--------------------------------------------------------------------------------
I1CBC4_RHIO9/190-328--------------------------------------------------------------------------------
G3J432_CORMM/141-287--------------------------------------------------------------------------------
K5XS17_AGABU/206-360--------------------------------------------------------------------------------
A5DPW7_PICGU/183-328--------------------------------------------------------------------------------
I4YA03_WALMC/185-311--------------------------------------------------------------------------------
R9AEB2_WALI9/173-299--------------------------------------------------------------------------------
NOL6_XENTR/178-318--------------------------------------------------------------------------------
K0KM58_WICCF/206-354--------------------------------------------------------------------------------
C3Z9X5_BRAFL/110-246--------------------------------------------------------------------------------
S2JLP9_MUCC1/206-340--------------------------------------------------------------------------------
Q6CQS3_KLULA/201-345--------------------------------------------------------------------------------
A7AS51_BABBO/140-290--------------------------------------------------------------------------------
B6QTJ8_TALMQ/174-319--------------------------------------------------------------------------------
B8NV94_ASPFN/172-314--------------------------------------------------------------------------------
A0A088AV91_APIME/198-333--------------------------------------------------------------------------------
S9XA53_SCHCR/170-307--------------------------------------------------------------------------------
K1X311_MARBU/180-323--------------------------------------------------------------------------------
G7E946_MIXOS/201-337--------------------------------------------------------------------------------
V5FPA1_BYSSN/172-313--------------------------------------------------------------------------------
T1JFU9_STRMM/142-297--------------------------------------------------------------------------------
F2U6D3_SALR5/285-469--------------------------------------------------------------------------------
M1W9J6_CLAP2/141-300--------------------------------------------------------------------------------
G8B992_CANPC/207-353--------------------------------------------------------------------------------
N4UMZ3_COLOR/122-270--------------------------------------------------------------------------------
C5G095_ARTOC/157-298--------------------------------------------------------------------------------
G3VN54_SARHA/179-323--------------------------------------------------------------------------------
S8EU65_FOMPI/201-346--------------------------------------------------------------------------------
E3QLQ1_COLGM/130-279--------------------------------------------------------------------------------
B2VXG7_PYRTR/192-338--------------------------------------------------------------------------------
M3HTH7_CANMX/196-342--------------------------------------------------------------------------------
U1HM72_ENDPU/202-339--------------------------------------------------------------------------------
Q5B7M5_EMENI/179-319--------------------------------------------------------------------------------
V2XZV7_MONRO/158-306--------------------------------------------------------------------------------
G8Y8Y3_PICSO/216-362--------------------------------------------------------------------------------
F0XND2_GROCL/143-293--------------------------------------------------------------------------------
C5GR67_AJEDR/154-304--------------------------------------------------------------------------------
M7UFB1_BOTF1/182-324--------------------------------------------------------------------------------
B3SA13_TRIAD/129-275--------------------------------------------------------------------------------
A3GGP2_PICST/195-341--------------------------------------------------------------------------------
B6K3H2_SCHJY/165-304--------------------------------------------------------------------------------
E5A3A1_LEPMJ/228-374--------------------------------------------------------------------------------
I1J8W6_SOYBN/99-233--------------------------------------------------------------------------------
J0LDN8_AURST/177-312--------------------------------------------------------------------------------
M7SB14_EUTLA/140-289--------------------------------------------------------------------------------
M4AYB0_XIPMA/175-317--------------------------------------------------------------------------------
H0VL29_CAVPO/178-320--------------------------------------------------------------------------------

PF02410

D6WL03_TRICA/109-208--------------------------------------------------------------------------------
E1VGT7_9GAMM/19-115--------------------------------------------------------------------------------
Q72BL7_DESVH/18-114--------------------------------------------------------------------------------
E3PRI2_CLOSD/8-104--------------------------------------------------------------------------------
E3I0D8_RHOVT/51-147--------------------------------------------------------------------------------
F8KUA6_HELBC/7-101--------------------------------------------------------------------------------
C6D5V2_PAESJ/10-106--------------------------------------------------------------------------------
G4QH00_GLANF/8-104--------------------------------------------------------------------------------
K0T8E5_THAOC/404-526--------------------------------------------------------------------------------
O86327_MYCTU/12-108--------------------------------------------------------------------------------
C7NE56_LEPBD/13-105--------------------------------------------------------------------------------
K9TU63_9CYAN/35-131--------------------------------------------------------------------------------
R7F4J7_9BACT/11-109--------------------------------------------------------------------------------
B9HIN9_POPTR/50-151--------------------------------------------------------------------------------
X5DAH5_9BACT/12-110--------------------------------------------------------------------------------
H2WNK0_CAEJA/65-168--------------------------------------------------------------------------------
Q04FE5_OENOB/8-104--------------------------------------------------------------------------------
R7JA64_9PORP/9-107--------------------------------------------------------------------------------
D7CWT0_TRURR/6-101--------------------------------------------------------------------------------
H2IXB4_RAHAC/8-104--------------------------------------------------------------------------------
B1ZVV9_OPITP/13-109--------------------------------------------------------------------------------
R6TBA4_9FIRM/11-107--------------------------------------------------------------------------------
B8E1S0_DICTD/12-107--------------------------------------------------------------------------------
R5A3E4_9CLOT/8-104--------------------------------------------------------------------------------
E8NE71_MICTS/12-108--------------------------------------------------------------------------------
B9DNI5_STACT/8-104--------------------------------------------------------------------------------
A9WK69_CHLAA/4-100--------------------------------------------------------------------------------
R5HDA8_9FIRM/9-105--------------------------------------------------------------------------------
C7LYC9_ACIFD/51-146--------------------------------------------------------------------------------
K4L4Y3_9FIRM/9-105--------------------------------------------------------------------------------
Q4FP42_PELUB/9-105--------------------------------------------------------------------------------
R6ESE1_9FIRM/22-118--------------------------------------------------------------------------------
A7I1F9_CAMHC/190-283--------------------------------------------------------------------------------
K9ZZD3_DEIPD/20-115--------------------------------------------------------------------------------
G0QND0_ICHMG/58-162--------------------------------------------------------------------------------
D1CCZ4_THET1/16-112--------------------------------------------------------------------------------
C7RQU7_ACCPU/8-104--------------------------------------------------------------------------------
B9GK05_POPTR/129-223--------------------------------------------------------------------------------
Q5SHF3_THET8/12-107--------------------------------------------------------------------------------
K4KHM4_SIMAS/37-132--------------------------------------------------------------------------------
R6CD09_9FIRM/15-111--------------------------------------------------------------------------------
A0ZLR5_NODSP/38-134--------------------------------------------------------------------------------
R5Q2J4_9BACT/9-107--------------------------------------------------------------------------------
A0A068XU24_ECHMU/101-202--------------------------------------------------------------------------------
D4ZSA1_ARTPN/39-134--------------------------------------------------------------------------------
G1NDG8_MELGA/5-104--------------------------------------------------------------------------------
R6QB74_9FIRM/8-103--------------------------------------------------------------------------------
F9UNR7_LACPL/8-104--------------------------------------------------------------------------------
A1SHP8_NOCSJ/12-108--------------------------------------------------------------------------------
J9W1F9_LACBU/8-104--------------------------------------------------------------------------------
Q47JQ2_DECAR/8-104--------------------------------------------------------------------------------
B2V9I4_SULSY/8-105--------------------------------------------------------------------------------
E3GLQ0_EUBLK/11-107--------------------------------------------------------------------------------
A3N2P9_ACTP2/7-103--------------------------------------------------------------------------------
A0LSX7_ACIC1/13-109--------------------------------------------------------------------------------
E0TFT9_PARBH/42-138--------------------------------------------------------------------------------
F4GJF5_SPHCD/10-107--------------------------------------------------------------------------------
D6Z191_DESAT/20-116--------------------------------------------------------------------------------
R6RRV9_9BACE/9-107--------------------------------------------------------------------------------
G0A0U8_METMM/8-104--------------------------------------------------------------------------------
C5D4V8_GEOSW/8-104--------------------------------------------------------------------------------
E6JZX0_PARDN/12-109--------------------------------------------------------------------------------
S6AAN5_9PROT/8-104--------------------------------------------------------------------------------
R7BRJ0_9ACTN/15-110--------------------------------------------------------------------------------
B4U9M4_HYDS0/5-102--------------------------------------------------------------------------------
D4J8G6_9FIRM/9-105--------------------------------------------------------------------------------
R6EX89_9BACT/9-107--------------------------------------------------------------------------------
A4VTA2_STRSY/8-104--------------------------------------------------------------------------------
K9UU95_9CYAN/43-134--------------------------------------------------------------------------------
X2H6J8_9GAMM/8-103--------------------------------------------------------------------------------
F8F078_TRECH/16-112--------------------------------------------------------------------------------
G8JWM0_ERECY/86-219--------------------------------------------------------------------------------
Q73LW7_TREDE/15-110--------------------------------------------------------------------------------
R5BYH5_9FIRM/9-105--------------------------------------------------------------------------------
H6NIK1_9BACL/9-105--------------------------------------------------------------------------------
F0SVG5_SYNGF/9-105--------------------------------------------------------------------------------
R7R2A4_9FIRM/8-104--------------------------------------------------------------------------------
R7LB71_9BACT/9-107--------------------------------------------------------------------------------
I3WID0_BIFBI/12-110--------------------------------------------------------------------------------
G1KP02_ANOCA/11-110--------------------------------------------------------------------------------
R5RDD8_9PROT/19-114--------------------------------------------------------------------------------
F8EN32_RUNSL/16-114--------------------------------------------------------------------------------
R5SGY3_9GAMM/13-109--------------------------------------------------------------------------------
D9QBW4_CORP2/12-108--------------------------------------------------------------------------------
R5LGW6_9FIRM/6-103--------------------------------------------------------------------------------
C0R0F4_BRAHW/47-143--------------------------------------------------------------------------------
W1QI88_OGAPD/62-199--------------------------------------------------------------------------------
F9YTI3_CAPCC/14-112--------------------------------------------------------------------------------
R5YP83_9PROT/10-105--------------------------------------------------------------------------------
F9D1M0_PREDD/9-107--------------------------------------------------------------------------------
S2JP82_MUCC1/153-260--------------------------------------------------------------------------------
YM62_CAEEL/65-167--------------------------------------------------------------------------------
B5EEI2_GEOBB/16-109--------------------------------------------------------------------------------
B8I1C2_CLOCE/8-104--------------------------------------------------------------------------------
R6K4L0_9BACE/9-107--------------------------------------------------------------------------------
E6W3S5_DESIS/8-105--------------------------------------------------------------------------------
K7IQU4_NASVI/90-189--------------------------------------------------------------------------------
B7G5J9_PHATC/2-97--------------------------------------------------------------------------------
B7FPM4_PHATC/162-271--------------------------------------------------------------------------------
K9YCI5_HALP7/25-122--------------------------------------------------------------------------------
Q11XG7_CYTH3/15-113--------------------------------------------------------------------------------
A0A088A1M0_APIME/113-212--------------------------------------------------------------------------------
R5TZZ5_9FIRM/10-106--------------------------------------------------------------------------------
V4J0M6_9DELT/18-114--------------------------------------------------------------------------------
R7HB19_9FIRM/11-107--------------------------------------------------------------------------------
Q4U8K5_THEAN/211-313--------------------------------------------------------------------------------
D5X4P2_THIK1/8-104--------------------------------------------------------------------------------
F5XNG3_MICPN/12-108--------------------------------------------------------------------------------
Q6D7M0_PECAS/9-104--------------------------------------------------------------------------------
G2KW74_LACSM/8-104--------------------------------------------------------------------------------
I1XI99_METNJ/9-104--------------------------------------------------------------------------------
F4HAS9_GALAU/3-99--------------------------------------------------------------------------------
B8DJS5_DESVM/19-114--------------------------------------------------------------------------------
Q747Q6_GEOSL/15-109--------------------------------------------------------------------------------
W0RI79_9BACT/14-110--------------------------------------------------------------------------------
D6GRY3_FILAD/5-101--------------------------------------------------------------------------------
K9SPG4_9CYAN/36-131--------------------------------------------------------------------------------
A0LPG4_SYNFM/32-126--------------------------------------------------------------------------------
L0GSY4_9GAMM/8-104--------------------------------------------------------------------------------
R6GQD4_9FIRM/22-115--------------------------------------------------------------------------------
C7MPQ9_SACVD/12-108--------------------------------------------------------------------------------
S5SWN0_9CORY/13-108--------------------------------------------------------------------------------
F4PVH6_DICFS/525-623--------------------------------------------------------------------------------
W0JK56_DESAE/2-93--------------------------------------------------------------------------------
M4VFB7_9DELT/227-324--------------------------------------------------------------------------------
G8BW66_TETPH/84-227--------------------------------------------------------------------------------
B3ER25_AMOA5/16-114--------------------------------------------------------------------------------
Q3Z9G1_DEHM1/8-104--------------------------------------------------------------------------------
E6TW12_BACCJ/8-104--------------------------------------------------------------------------------
W5N0T0_LEPOC/99-198--------------------------------------------------------------------------------
D6XWC7_BACIE/8-104--------------------------------------------------------------------------------
H6RLG7_BLASD/13-108--------------------------------------------------------------------------------
ATP25_ZYGRC/85-217--------------------------------------------------------------------------------
Q3IZI6_RHOS4/3-95--------------------------------------------------------------------------------
C5CB00_MICLC/12-109--------------------------------------------------------------------------------
T1IN47_STRMM/146-245--------------------------------------------------------------------------------
W8F8R6_9BACT/15-113--------------------------------------------------------------------------------
Q1QXB2_CHRSD/8-104--------------------------------------------------------------------------------
Q7URC6_RHOBA/74-171--------------------------------------------------------------------------------
D3PKV4_MEIRD/12-108--------------------------------------------------------------------------------
Q5FRT0_GLUOX/51-147--------------------------------------------------------------------------------
H2LUV3_ORYLA/97-196--------------------------------------------------------------------------------
E3HA88_ILYPC/6-102--------------------------------------------------------------------------------
R5G8H7_9PORP/20-117--------------------------------------------------------------------------------
R5RHQ5_9FIRM/9-105--------------------------------------------------------------------------------
R5XAQ7_9FIRM/8-103--------------------------------------------------------------------------------
K7SIQ4_PROA4/13-108--------------------------------------------------------------------------------
D4H0Y6_DENA2/8-104--------------------------------------------------------------------------------
D2RNC7_ACIFV/8-104--------------------------------------------------------------------------------
R6IQY9_9CLOT/8-103--------------------------------------------------------------------------------
M3HMI8_CANMX/81-220--------------------------------------------------------------------------------
C7M7C0_CAPOD/12-111--------------------------------------------------------------------------------
R6GWL1_9FIRM/10-105--------------------------------------------------------------------------------
R6NCD6_9FIRM/5-101--------------------------------------------------------------------------------
R6A3V4_9ACTN/43-140--------------------------------------------------------------------------------
R6DIG1_9BACE/9-107--------------------------------------------------------------------------------
D3UIX0_HELM1/7-101--------------------------------------------------------------------------------
R5N925_9BACT/9-107--------------------------------------------------------------------------------
A9V8V9_MONBE/155-258--------------------------------------------------------------------------------
R7KSJ6_9BURK/8-104--------------------------------------------------------------------------------
F9ZTY5_ACICS/9-105--------------------------------------------------------------------------------
G2LE33_CHLTF/32-127--------------------------------------------------------------------------------
Q8DY34_STRA5/8-104--------------------------------------------------------------------------------
K4IPF9_PSYTT/13-111--------------------------------------------------------------------------------
W0F3W7_9BACT/26-124--------------------------------------------------------------------------------
G8AIT6_AZOBR/37-132--------------------------------------------------------------------------------
R6DUN9_9FIRM/8-103--------------------------------------------------------------------------------
R5AKW9_9CLOT/10-106--------------------------------------------------------------------------------
B5Y803_COPPD/2-97--------------------------------------------------------------------------------
A6QCD7_SULNB/8-101--------------------------------------------------------------------------------
D4K7J1_9FIRM/12-108--------------------------------------------------------------------------------
B6YRM7_AZOPC/12-110--------------------------------------------------------------------------------
R5QWA2_9FIRM/5-101--------------------------------------------------------------------------------
F2F3K1_SOLSS/7-103--------------------------------------------------------------------------------
E4NB25_KITSK/12-109--------------------------------------------------------------------------------
Q6A9H4_PROAC/12-108--------------------------------------------------------------------------------
Q21FD1_SACD2/8-104--------------------------------------------------------------------------------
W0EAU7_9FIRM/8-104--------------------------------------------------------------------------------
E1WYV6_HALMS/7-98--------------------------------------------------------------------------------
F0V8J6_NEOCL/449-551--------------------------------------------------------------------------------
E4TJ98_CALNY/7-103--------------------------------------------------------------------------------
D7WC86_9CORY/13-108--------------------------------------------------------------------------------
E4U6Z9_OCEP5/12-107--------------------------------------------------------------------------------
Q8NN58_CORGL/12-108--------------------------------------------------------------------------------
R7B4U9_9ACTN/13-109--------------------------------------------------------------------------------
E1ZH82_CHLVA/239-341--------------------------------------------------------------------------------
U3GY66_9CORY/12-108--------------------------------------------------------------------------------
R7IT94_9FIRM/11-107--------------------------------------------------------------------------------
D8S2B1_SELML/13-114--------------------------------------------------------------------------------
F6CQD9_DESK7/10-106--------------------------------------------------------------------------------
R6KF46_9FIRM/11-107--------------------------------------------------------------------------------
I0HW02_RUBGI/8-104--------------------------------------------------------------------------------
Q8YPM4_NOSS1/37-133--------------------------------------------------------------------------------
C1EE68_MICCC/526-636--------------------------------------------------------------------------------
C5KAT1_PERM5/235-334--------------------------------------------------------------------------------
H6L6C8_SAPGL/21-119--------------------------------------------------------------------------------
G4T293_META2/8-104--------------------------------------------------------------------------------
I3UBD3_ADVKW/8-104--------------------------------------------------------------------------------
H2FY28_OCESG/8-104--------------------------------------------------------------------------------
R7CUD2_9BACE/6-104--------------------------------------------------------------------------------
J9JUC8_ACYPI/125-224--------------------------------------------------------------------------------
C0ZB11_BREBN/10-106--------------------------------------------------------------------------------
K0KVP5_WICCF/177-309--------------------------------------------------------------------------------
S6EFN2_ZYGB2/82-213--------------------------------------------------------------------------------
S9W0T4_SCHCR/94-219--------------------------------------------------------------------------------
D4JS04_9FIRM/8-104--------------------------------------------------------------------------------
G8TML0_NIAKG/49-147--------------------------------------------------------------------------------
I0K9S3_9BACT/50-148--------------------------------------------------------------------------------
A0A068NYM9_9BACT/8-103--------------------------------------------------------------------------------
Q2GCL3_NEOSM/17-109--------------------------------------------------------------------------------
Q5E6V1_VIBF1/12-106--------------------------------------------------------------------------------
D0J0H1_COMT2/20-116--------------------------------------------------------------------------------
C8WIS8_EGGLE/17-112--------------------------------------------------------------------------------
Q606I9_METCA/10-106--------------------------------------------------------------------------------
B4RD60_PHEZH/47-142--------------------------------------------------------------------------------
Q2JQ53_SYNJB/16-111--------------------------------------------------------------------------------
A6Q542_NITSB/8-101--------------------------------------------------------------------------------
G0VLT2_MEGEL/20-116--------------------------------------------------------------------------------
G8Y063_PICSO/101-239--------------------------------------------------------------------------------
Q7VRA9_BLOFL/4-100--------------------------------------------------------------------------------
H1XSE2_9BACT/8-104--------------------------------------------------------------------------------
Q47MW6_THEFY/12-109--------------------------------------------------------------------------------
A1AVZ7_RUTMC/8-104--------------------------------------------------------------------------------
R5NMF0_9FIRM/8-104--------------------------------------------------------------------------------
E4RIQ7_HALHG/12-107--------------------------------------------------------------------------------
R5Z3M1_9FIRM/5-102--------------------------------------------------------------------------------
E8N386_ANATU/2-95--------------------------------------------------------------------------------
E3D0R6_9BACT/33-122--------------------------------------------------------------------------------
Q92BM7_LISMO/9-104--------------------------------------------------------------------------------
S6CGZ3_9GAMM/8-104--------------------------------------------------------------------------------
Q9A1F0_STRP1/16-112--------------------------------------------------------------------------------
A5G904_GEOUR/16-109--------------------------------------------------------------------------------
B3RRW9_TRIAD/91-190--------------------------------------------------------------------------------
F6EQY0_HOYSD/13-108--------------------------------------------------------------------------------
R6ALX9_9CLOT/27-123--------------------------------------------------------------------------------
E1G5L4_LOALO/54-150--------------------------------------------------------------------------------
Q5P2U1_AROAE/8-104--------------------------------------------------------------------------------
R5WH81_9DELT/389-485--------------------------------------------------------------------------------
R6SBY2_9FIRM/9-105--------------------------------------------------------------------------------
U6B5K9_9RHIZ/20-117--------------------------------------------------------------------------------
D1BM92_VEIPT/13-109--------------------------------------------------------------------------------
B8IEM3_METNO/6-98--------------------------------------------------------------------------------
A1SU09_PSYIN/8-104--------------------------------------------------------------------------------
K8GKE5_9CYAN/32-128--------------------------------------------------------------------------------
Q2N6F3_ERYLH/12-107--------------------------------------------------------------------------------
A3QH51_SHELP/14-110--------------------------------------------------------------------------------
C4Z098_EUBE2/9-105--------------------------------------------------------------------------------
D3EQN9_ATETH/15-112--------------------------------------------------------------------------------
E6U7Y1_ETHHY/22-118--------------------------------------------------------------------------------
G0GDI3_SPITZ/12-109--------------------------------------------------------------------------------
K9Q2R2_9CYAN/18-114--------------------------------------------------------------------------------
E0W225_PEDHC/107-206--------------------------------------------------------------------------------
I0I1R8_CALAS/2-97--------------------------------------------------------------------------------
E0RUY2_BUTPB/13-108--------------------------------------------------------------------------------
D5UTC0_TSUPD/14-108--------------------------------------------------------------------------------
D4M5X8_9FIRM/9-105--------------------------------------------------------------------------------
B1H031_UNCTG/11-107--------------------------------------------------------------------------------
A6LNB0_THEM4/5-101--------------------------------------------------------------------------------
G2SP30_LACRR/8-104--------------------------------------------------------------------------------
Q3IJ97_PSEHT/8-104--------------------------------------------------------------------------------
R5EE57_9GAMM/8-104--------------------------------------------------------------------------------
R6DH31_9CLOT/8-104--------------------------------------------------------------------------------
Q12QY1_SHEDO/9-104--------------------------------------------------------------------------------
IOJAP_ZYMMO/21-117--------------------------------------------------------------------------------
Q0VN47_ALCBS/9-105--------------------------------------------------------------------------------
Q8DJK1_THEEB/29-125--------------------------------------------------------------------------------
G0IXL6_CYCMS/8-106--------------------------------------------------------------------------------
E6WZ07_NITSE/8-101--------------------------------------------------------------------------------
W4YD31_STRPU/344-443--------------------------------------------------------------------------------
D7BBA8_MEISD/14-107--------------------------------------------------------------------------------
X2H7X0_9NEIS/15-110--------------------------------------------------------------------------------
G6D1G9_DANPL/107-206--------------------------------------------------------------------------------
Q2G298_STAA8/8-104--------------------------------------------------------------------------------
H8KN20_SOLCM/15-113--------------------------------------------------------------------------------
F6AEU5_PSEF1/13-109--------------------------------------------------------------------------------
A8Y3I6_CAEBR/59-161--------------------------------------------------------------------------------
L0KBB8_HALHC/16-107--------------------------------------------------------------------------------
F8E7X1_FLESM/8-104--------------------------------------------------------------------------------
Q3A1E2_PELCD/9-105--------------------------------------------------------------------------------
D5EEJ0_AMICL/14-107--------------------------------------------------------------------------------
K9XKK1_9CHRO/37-133--------------------------------------------------------------------------------
O51725_BORBU/11-108--------------------------------------------------------------------------------
B0SRU3_LEPBP/13-113--------------------------------------------------------------------------------
J7QF24_METSZ/35-131--------------------------------------------------------------------------------
R6BA50_9CLOT/8-104--------------------------------------------------------------------------------
D3SLN3_THEAH/7-102--------------------------------------------------------------------------------
Q2GLC3_ANAPZ/10-104--------------------------------------------------------------------------------
F2N7T7_CORGP/47-144--------------------------------------------------------------------------------
Q7VJ93_HELHP/11-105--------------------------------------------------------------------------------
A8LKJ3_DINSH/8-103--------------------------------------------------------------------------------
U5QDK7_9CYAN/13-109--------------------------------------------------------------------------------
R5CBV8_9BACE/9-107--------------------------------------------------------------------------------
U3K4T0_FICAL/9-108--------------------------------------------------------------------------------
D2VAH7_NAEGR/112-210--------------------------------------------------------------------------------
B3EK36_CHLPB/27-123--------------------------------------------------------------------------------
D8LM97_ECTSI/43-138--------------------------------------------------------------------------------
K9WGD2_9CYAN/28-124--------------------------------------------------------------------------------
F2NRK4_TRES6/11-108--------------------------------------------------------------------------------
G4Q705_ACIIR/8-105--------------------------------------------------------------------------------
C5BNN1_TERTT/7-103--------------------------------------------------------------------------------
J9Z794_LEPFM/48-141--------------------------------------------------------------------------------
R7KVA5_9FIRM/8-104--------------------------------------------------------------------------------
F2JQX0_CELLD/10-106--------------------------------------------------------------------------------
A3LQS7_PICST/33-171--------------------------------------------------------------------------------
R6GPR7_9CLOT/8-100--------------------------------------------------------------------------------
Q0ABM8_ALKEH/14-109--------------------------------------------------------------------------------
R7GK75_9CLOT/203-298--------------------------------------------------------------------------------
W0J190_9BACT/16-112--------------------------------------------------------------------------------
R7HV95_9CLOT/13-109--------------------------------------------------------------------------------
T2GFT8_DESGI/18-114--------------------------------------------------------------------------------
R6UIY6_9FIRM/6-102--------------------------------------------------------------------------------
K9RW58_SYNP3/23-119--------------------------------------------------------------------------------
R6VTB1_9FIRM/16-113--------------------------------------------------------------------------------
N0B789_9RHIZ/47-143--------------------------------------------------------------------------------
W0DX52_9GAMM/8-104--------------------------------------------------------------------------------
Q24SP4_DESHY/10-104--------------------------------------------------------------------------------
U6GU24_EIMAC/436-549--------------------------------------------------------------------------------
T0VFU6_9STRE/8-104--------------------------------------------------------------------------------
G8BC02_CANPC/81-218--------------------------------------------------------------------------------
A9KMF1_CLOPH/10-106--------------------------------------------------------------------------------
B8IY74_DESDA/31-127--------------------------------------------------------------------------------
F2I3K1_PELSM/11-107--------------------------------------------------------------------------------
R6S9M8_9FIRM/7-102--------------------------------------------------------------------------------
G8PDQ2_PEDCP/8-104--------------------------------------------------------------------------------
A0LCY9_MAGMM/19-115--------------------------------------------------------------------------------
R7XYP9_9ACTN/12-108--------------------------------------------------------------------------------
C6BY18_DESAD/18-114--------------------------------------------------------------------------------
A5WCA7_PSYWF/21-117--------------------------------------------------------------------------------
R6ZB75_9CLOT/9-105--------------------------------------------------------------------------------
X2GYY9_9BACI/7-103--------------------------------------------------------------------------------
A0A068X2K5_HYMMI/99-199--------------------------------------------------------------------------------
Q5M321_STRT2/8-104--------------------------------------------------------------------------------
K9W317_9CYAN/28-124--------------------------------------------------------------------------------
C9RAT7_AMMDK/8-104--------------------------------------------------------------------------------
Q31RX3_SYNE7/23-118--------------------------------------------------------------------------------
E2ABW0_CAMFO/117-216--------------------------------------------------------------------------------
B7ZSU4_XENTR/104-203--------------------------------------------------------------------------------
E6S731_INTC7/12-108--------------------------------------------------------------------------------
J9RNQ7_9ACTN/12-108--------------------------------------------------------------------------------
Q74ID2_LACJO/14-110--------------------------------------------------------------------------------
R5PG49_9CLOT/8-104--------------------------------------------------------------------------------
C3M9Y3_SINFN/41-137--------------------------------------------------------------------------------
K9RB59_9CYAN/38-135--------------------------------------------------------------------------------
Q4Y4A2_PLACH/249-351--------------------------------------------------------------------------------
R5SL59_9FIRM/6-102--------------------------------------------------------------------------------
A9NGN0_ACHLI/5-95--------------------------------------------------------------------------------
I3YSI4_AEQSU/13-111--------------------------------------------------------------------------------
R5VE54_9BACE/9-107--------------------------------------------------------------------------------
F7QH28_9BRAD/22-118--------------------------------------------------------------------------------
D3PE18_DEFDS/5-102--------------------------------------------------------------------------------
Q3J7T3_NITOC/8-104--------------------------------------------------------------------------------
R5K9K4_9CLOT/9-105--------------------------------------------------------------------------------
O67309_AQUAE/5-101--------------------------------------------------------------------------------
E2C2S6_HARSA/121-220--------------------------------------------------------------------------------
ATP25_LACTC/125-266--------------------------------------------------------------------------------
Q3ANY6_CHLCH/23-120--------------------------------------------------------------------------------
R7JTP2_9FIRM/9-105--------------------------------------------------------------------------------
D9R139_CLOSW/9-105--------------------------------------------------------------------------------
E3F1H1_KETVY/62-158--------------------------------------------------------------------------------
I2H8T5_TETBL/114-252--------------------------------------------------------------------------------
C4LJT9_CORK4/12-108--------------------------------------------------------------------------------
B7JXB1_CYAP8/32-128--------------------------------------------------------------------------------
B0RDF7_CLAMS/12-108--------------------------------------------------------------------------------
X5DNJ2_9CORY/13-108--------------------------------------------------------------------------------
B2IKW2_BEII9/21-117--------------------------------------------------------------------------------
Q9CJS0_PASMU/6-102--------------------------------------------------------------------------------
E2SB72_9ACTN/12-108--------------------------------------------------------------------------------
Q10VW4_TRIEI/29-126--------------------------------------------------------------------------------
A6WDM3_KINRD/18-114--------------------------------------------------------------------------------
I4A2C0_ORNRL/11-109--------------------------------------------------------------------------------
I2EQ24_EMTOG/14-112--------------------------------------------------------------------------------
S5XVR4_PARAH/2-98--------------------------------------------------------------------------------
E1SSX4_FERBD/9-104--------------------------------------------------------------------------------
D5AKK2_RHOCB/55-151--------------------------------------------------------------------------------
F0SS65_RUBBR/56-150--------------------------------------------------------------------------------
R5X7F3_9CLOT/8-104--------------------------------------------------------------------------------
E1R019_OLSUV/10-107--------------------------------------------------------------------------------
D5SVA3_PLAL2/30-124--------------------------------------------------------------------------------
R6GP78_9FIRM/10-106--------------------------------------------------------------------------------
R6XQE4_9FIRM/9-105--------------------------------------------------------------------------------
B7KCB2_CYAP7/31-128--------------------------------------------------------------------------------
B9E6Y1_MACCJ/11-107--------------------------------------------------------------------------------
R5GKV6_9FIRM/8-104--------------------------------------------------------------------------------
A0RQT7_CAMFF/6-99--------------------------------------------------------------------------------
A8F8G2_PSELT/2-95--------------------------------------------------------------------------------
Q9WXZ4_THEMA/6-102--------------------------------------------------------------------------------
R6QEW5_9FIRM/9-105--------------------------------------------------------------------------------
F8C4U4_THEGP/8-104--------------------------------------------------------------------------------
I4DAU1_DESAJ/9-106--------------------------------------------------------------------------------