Sequence alignment for CL0260

PF14792

Q5KBS5_CRYNJ/778-890----------RIPREECKQIYE---LIK.LE-------------------------------------------------
DPOLB_RAT/149-262----------RIPREEMLQMQD---IVL.NE-------------------------------------------------
DPOLB_DANRE/148-263----------RIPRSEMQKMEA---LIL.KE-------------------------------------------------
A7SJ46_NEMVE/149-263----------RIPREEMIKLRD---IVL.VH-------------------------------------------------
C3YJ28_BRAFL/322-432----------RMPREEAAEIER---TVR.EM-------------------------------------------------
C7YGY5_NECH7/618-739----------RIPRREVEALGT---VVR.KG-------------------------------------------------
F0ZLU7_DICPU/181-297----------RVPRKEIEVFEK---LVS.NS-------------------------------------------------
A7SK52_NEMVE/213-322----------RMPREEAGKIGE---VVK.AA-------------------------------------------------
A2QQG4_ASPNC/509-626----------RIPRSEVEAHGE---IVR.KA-------------------------------------------------
A9V5M0_MONBE/167-298----------RIPRAEVEALRQ---AVF.AE-------------------------------------------------
D7G2F8_ECTSI/183-296----------RMPRSEAAEIEA---VVT.KV-------------------------------------------------
B7QKW0_IXOSC/150-261----------RIPREEVAQLEA---RIL.AE-------------------------------------------------
E9EVQ2_METRA/556-677----------RIPRREVEALGA---FVR.RA-------------------------------------------------
D2A436_TRICA/901-1007----------KIPRNEIKQIEN---LIR.GH-------------------------------------------------
E3QD37_COLGM/619-740----------RIPRSEVKLLGA---VVR.SE-------------------------------------------------
B6HVS0_PENRW/522-633----------RIPRKEVEAHGA---IVR.KA-------------------------------------------------
A7EMR3_SCLS1/618-744----------RIPRAEIEELGT---HIT.KT-------------------------------------------------
E4ZMZ8_LEPMJ/596-715----------RIPRAEVEAHAN---HVR.SA-------------------------------------------------
C5FJW6_ARTOC/469-580----------RIPREEVEAHGA---IVR.ET-------------------------------------------------
B7QK41_IXOSC/277-387----------KMPREEAGEIAD---TVA.KA-------------------------------------------------
B2AY49_PODAN/639-751----------RIPRSEVTQLAA---FVQ.RE-------------------------------------------------
C9SJH6_VERA1/548-691----------RIPRREVEALAA---VVR.SA-------------------------------------------------
D8SG82_SELML/125-237----------RIPRDEVVDTEK---FVR.GV-------------------------------------------------
E3RX41_PYRTT/579-692----------RIPRAEVEAHGA---VVI.AA-------------------------------------------------
Q2HFI0_CHAGB/649-794----------RIPRAEVGKLFA---YVQ.RE-------------------------------------------------
C1E884_MICSR/525-667----------RIPRDEVEALAG---HVE.DA-------------------------------------------------
A9TCX5_PHYPA/342-457----------KIPRHEIKEMEA---IVQ.KS-------------------------------------------------
C5Z7H1_SORBI/359-473----------RIPRHEVSEMEE---LLK.DV-------------------------------------------------
B9HVB4_POPTR/315-429----------RIPRHEVQEMEL---LLQ.KT-------------------------------------------------
Q0UN18_PHANO/574-687----------RIPRSEVEAHGA---AVK.AA-------------------------------------------------
A4S364_OSTLU/149-268----------RIPREEVSHIAT---AVR.EA-------------------------------------------------
D8R616_SELML/125-233----------RIPRDEVADTEK---FVR.GV-------------------------------------------------
A0BDW1_PARTE/419-531----------RIPRDEATIIYD---IVK.RE-------------------------------------------------
B8JIE9_DANRE/378-488----------RMPRSEANAIEK---TVK.DA-------------------------------------------------
C5GK07_AJEDR/525-637----------RIPRAEVEAHGA---IVK.KL-------------------------------------------------
F2U5R6_SALR5/160-281----------RIPRDEVDRLRK---QAF.AI-------------------------------------------------
F7CJ14_CALJA/78-188----------RMPREEATEIEQ---TVQ.KA-------------------------------------------------
Q245F6_TETTS/717-832----------RMPREEATLIVN---EVI.KG-------------------------------------------------
Q4QI79_LEIMA/354-499----------RIPHEEGRLHEA---FMKLRM-------------------------------------------------

PF01909

CID16_SCHPO/908-1034----------------IKKLLK---SLRKLE-------------------------------------------------
CID1_SCHPO/69-169----------------LDTLRL---CLKRIS-------------------------------------------------
O26508_METTH/6-97----------------LEKLAE---FFEEKD-------------------------------------------------
O26564_METTH/21-113----------------MEMLRR---YFKDKA-------------------------------------------------
CCA_METTH/29-141----------------LVECLN---GLAEEQ-------------------------------------------------
O27980_ARCFU/6-90----------------INEIIG---EVK...-------------------------------------------------
CCA_ARCFU/28-133----------------EEELRR---RLDEL.-------------------------------------------------
O28300_ARCFU/48-135----------------RERAKE---VMESLL-------------------------------------------------
O28312_ARCFU/101-191----------------VRKIVE---FFSEIP-------------------------------------------------
O28500_ARCFU/441-531----------------IPAVVD---ELRRRY-------------------------------------------------
O28587_ARCFU/7-100----------------LRKLRE---SRKELK-------------------------------------------------
O28660_ARCFU/27-113----------------IKKLAK---KMLE..-------------------------------------------------
O29641_ARCFU/5-90----------------KEITKK---DVQ...-------------------------------------------------
O29943_ARCFU/5-101----------------LLELSR---ELKEKF-------------------------------------------------
O30239_ARCFU/8-91----------------LEQIRK---DLREFS-------------------------------------------------
PAP_CANAL/68-160----------------SKNMSD---SMAQDA-------------------------------------------------
O44768_CAEEL/71-163----------------CYQLKN---IISKNN-------------------------------------------------
O66796_AQUAE/86-173----------------RKYIED---FFKRRN-------------------------------------------------
CID11_SCHPO/72-179----------------VDKLRT---ILSTEI-------------------------------------------------
PAPS2_ARATH/82-179----------------LTRQRG---YTDQMV-------------------------------------------------
O97205_LEIMA/1069-1163----------------LCWIIE---AVLRKH-------------------------------------------------
TDT_HUMAN/311-403----------------VSVLVK---EAVWAF-------------------------------------------------
TDT_MOUSE/312-404----------------SMLVKE---AVVTFL-------------------------------------------------
PAPOA_BOVIN/82-175----------------SKNLPQ---SVIENV-------------------------------------------------
PAP_YEAST/69-161----------------KKNMSD---GMARDA-------------------------------------------------
OAS2_HUMAN/373-475----------------IRTFLK---ENCFRQ-------------------------------------------------
Y073_HAEIN/14-110----------------LAIVKT---ILQQLV-------------------------------------------------
TRF5_YEAST/201-326----------------IDKLRR---AVKELW-------------------------------------------------
PAP2_YEAST/204-318----------------ISTIRE---AVKQLW-------------------------------------------------
GLND_RHIME/87-183----------------LNQVFD---AAKAPE-------------------------------------------------
P72997_SYNY3/7-99----------------PMEQIR---QFCHKW-------------------------------------------------
P73498_SYNY3/14-107----------------DPGKIT---AFCQQW-------------------------------------------------
P73970_SYNY3/10-96----------------LSQSKP---DLQSRF-------------------------------------------------
OAS1A_RAT/38-140----------------LCDFLK---ERCFRD-------------------------------------------------
Q09995_CAEEL/75-168----------------ISRIPK---DQMFNA-------------------------------------------------
PAP_SCHPO/68-161----------------AKHMNE---KMANEA-------------------------------------------------
Y128_METJA/11-98----------------LRKHKK---ILKEKY-------------------------------------------------
Y141_METJA/7-99----------------IKEFKK---DISTIL-------------------------------------------------
Y435_METJA/7-92----------------KRKIIP---ILLKHG-------------------------------------------------
Y604_METJA/7-100----------------IKEFVN---ALKSKY-------------------------------------------------
Y1086_METJA/124-219----------------CRKLAL---ILEDYG-------------------------------------------------
CCA_METJA/35-147----------------IDKIWE---IVRENS-------------------------------------------------
Y1217_METJA/11-98----------------LRKHKK---ILKEKY-------------------------------------------------
Y1305_METJA/10-110----------------LDEFLQ---KCKQKF-------------------------------------------------
Y1379_METJA/11-100----------------LRKHKK---ILKDKY-------------------------------------------------
TUT4_HUMAN/976-1065----------------LIGLEK---FIQKEY-------------------------------------------------
Q9RTF8_DEIRA/9-95----------------HRQAID---ALARRH-------------------------------------------------
Q9RWI9_DEIRA/14-98----------------IAAHAD---ELRQLG-------------------------------------------------
Q9RXQ9_DEIRA/18-105----------------LREGAG---EWRTLG-------------------------------------------------
Q9U2P3_CAEEL/73-166----------------AMKIPN---GEGVNA-------------------------------------------------
CID14_SCHPO/266-381----------------VSRINQ---AVLQKW-------------------------------------------------
PAPA_CANAL/68-161----------------KKNISE---GMARDV-------------------------------------------------
Q9VC07_DROME/53-140----------------VRRIED---VVLSIW-------------------------------------------------
Q9WZ83_THEMA/22-113----------------LGIIRN---SLPQLL-------------------------------------------------
Q9X096_THEMA/7-103----------------LSEFKK---RVSEKF-------------------------------------------------
Q9X2Z5_BACAN/31-119----------------VQKIRE---TVSS..-------------------------------------------------
Q9X304_BACAN/10-108----------------MMLYSS---RLNEMF-------------------------------------------------
GLND_CORGL/12-98----------------EKEVLA---LLGSLV-------------------------------------------------
GLND_VIBF1/55-151----------------LSRLWQ---FFKFDD-------------------------------------------------
OAS3_HUMAN/780-872----------------ICSFLK---ENCFRN-------------------------------------------------
CCA_AERPE/39-163----------------VARALE---ECEDLR-------------------------------------------------
Q9YCI7_AERPE/22-112----------------ASKLLE---RLG...-------------------------------------------------
Q9YFN6_AERPE/17-110----------------RRKALE---IVRALS-------------------------------------------------
Q3Y244_ENTFC/6-114----------------IKSVAE---KLSSLS-------------------------------------------------
Q5HNP5_STAEQ/17-112----------------....LK---IVKDLF-------------------------------------------------
PAPD7_HUMAN/245-352----------------VKRIET---VVKDLW-------------------------------------------------
CCA_SULSO/25-127----------------.....E---IIRERL-------------------------------------------------
CCA_THEAC/29-134----------------IRKINS---ICRSRG-------------------------------------------------

PF07528

O62349_CAEEL/113-354---------------HVGSFVT---DTTTHS-------------------------------------------------
Q7PYL7_ANOGA/111-351---------------QVGSFKK---GTMMAG-------------------------------------------------
ILF3_MOUSE/94-342---------------RVGLVAK---GLLLKG-------------------------------------------------
ILF2_DROME/105-345---------------QVGSFKK---GTILTG-------------------------------------------------

PF12633

K0C9C6_CYCSP/30-225DLKVVKQRFLNLHKLKMQRAID---AVTPRQ-------------------------------------------------
Q7MYN2_PHOLL/4-200YIETLKQRLDAINQLRLERAST---AMSAEF-------------------------------------------------
C9R2R0_AGGAD/4-204DLNKARKRVDYLDKLRIQRALS---DTPESF-------------------------------------------------
M1WST2_DESPC/651-841.....EERMLTLNRARLARALA---GLEREK-------------------------------------------------
F6AGP1_PSEF1/20-216.LTQLRARFMRINHGRQQRAMQ---ALSPRQ-------------------------------------------------
F4HFE0_GALAU/3-201NLDVAKKKVEQLDKLRLERALA---GAPNEF-------------------------------------------------
B3PH57_CELJU/19-216QLTLLRRRFLSLNEQRVARTLT---NLSERQ-------------------------------------------------
G4T2L3_META2/23-218DLLAILQRFKNLHLLQQKRIQS---FLQPRQ-------------------------------------------------
K4KKJ3_SIMAS/20-214.TAQIRARFHALNQSRLALAQM---SLSERQ-------------------------------------------------
B8F5L0_HAEPS/22-213QLSYIKHRVDMLDQFRIHNTLR---NHSEAF-------------------------------------------------
B0UWZ7_HISS2/4-207DLQQAKKQVEFVDQLRLERALS---STSVEF-------------------------------------------------
Q8E9H1_SHEON/9-202......DIAERLNQVRIARALA---LLSPLQ-------------------------------------------------
C5BLM3_TERTT/19-214NLTKIRKRFLAINQDRLTRMRD---ALTVRQ-------------------------------------------------
J7SL77_MORMO/4-201YIETLKQRLDAINQLRSERATI---GMSRAF-------------------------------------------------
I0DV26_PROSM/4-199YIETLKQRLDAINQLRLDRATA---SMDETF-------------------------------------------------
A3Q9P3_SHELP/3-203EQEHFIATAERLNKVRLARALA---MLTPLQ-------------------------------------------------
M5DMW4_9GAMM/16-206....WRDAFLALNQERLDATRS---QMTKRQ-------------------------------------------------
E6WHF8_PANSA/15-211YIETLKQRLDAINQLRVDRALA---AMGPAF-------------------------------------------------
F7YQ90_VIBA7/4-199YTKTLIQRLDNLNQQRTERALA---LMDLQS-------------------------------------------------
E6VWA6_DESAO/664-855....REQRIQGFNRKRLVRAMG---RLDRDK-------------------------------------------------
Q9HTS8_PSEAE/21-217..GQLRQRFLAVNAGRLQRARQ---ALSSRQ-------------------------------------------------
A6VL92_ACTSZ/4-203DLEFARKQVADLEKFRLFRALS---GTTDEF-------------------------------------------------
Q2SQ66_HAHCH/20-215.LKTLCQRFITLVEHRLQRTRL---ALTPRQ-------------------------------------------------
A3N160_ACTP2/35-224......SRVDALDHFRTQRALA---ANSPQF-------------------------------------------------
E4PK78_MARAH/20-216TLRRLRDRFLLVNQQRWNRAHS---ALSYRQ-------------------------------------------------
W8VBQ3_YEREN/4-200YIETLKQRLDAINQLRVDRALA---AMGPAF-------------------------------------------------
B4F1X4_PROMH/4-202YIETLKQRLDAINQLRLERAFA---SMSDVF-------------------------------------------------
Q9KVL9_VIBCH/4-199YTQTLIHRLDKLNRQRIERALA---LMDLQS-------------------------------------------------
Q6LLN1_PHOPR/4-203YIQMLKNRLDGHNQLRIERARA---AMNVQS-------------------------------------------------
D4ZCR6_SHEVD/7-207EQNHIIETADRLNRVRQARALA---LLSPLK-------------------------------------------------
Q7VND7_HAEDU/2-191......QRVDALNDFRIERALA---ANNPQF-------------------------------------------------
A4VGX1_PSEU5/20-216.LATLRTRFLAVNAARLERALA---AMSTRQ-------------------------------------------------
F9ZY47_METMM/21-216DLHAITQRFKHFNQSRLQRMRE---FLQPRQ-------------------------------------------------
M4R7B7_BIBTR/21-222RLEWAKKRIDALENHRIYNILK---NSDESF-------------------------------------------------
CYAA_PASMU/4-205DLFSAQKKVEYLDKLRIERALS---GSSGEF-------------------------------------------------
Q88B03_PSESM/20-216.LSQLRNRFLSLNDGRYARALE---GMSTRQ-------------------------------------------------
Q65VX6_MANSM/4-207DLQFAKKQVDDLHRLRVERVLQ---GSTADF-------------------------------------------------
Q2NQF3_SODGM/4-200YIETLKQRLDAINQLRVDRALA---AMGPDF-------------------------------------------------
A1TXX4_MARHV/20-216TLRRLRDRFLLVNQQRWQRACS---ALTYRQ-------------------------------------------------
CYAA_HAEIN/4-209NLAQAKQWVSALDQRRFERALQ---GSGDAF-------------------------------------------------
M9X3J4_MANHA/29-225KLNSTKARIDQLNAYRIERAIN---ANNHHF-------------------------------------------------
E1VFT5_9GAMM/19-214QLKTLKGRFLAVNAERLRRTLE---GLSPKR-------------------------------------------------
M4X4Y6_PSEDE/20-216.LAQLRQRFLKVNAGRLRRASE---ALSSRQ-------------------------------------------------
C6BYH9_DESAD/680-878DIEHCHACFAENNSRRLDWAQS---KLDSKS-------------------------------------------------
I5AZY9_9DELT/15-214KLTRMKAAFSNYNVVRMREALR---YLSGPK-------------------------------------------------
Q088L2_SHEFN/10-203.....KDLAEKLNGIRLARVLN---VLPESQ-------------------------------------------------
X2H648_9GAMM/4-197YINNIKKQLKDLALLKHERALN---AMSEEF-------------------------------------------------
A1SR20_PSYIN/12-237EIKRLRDKADELTRLRIQSAEL---LMNADT-------------------------------------------------
Q87KJ0_VIBPA/4-199YTYTIIQRLDNLNQQRIDRALA---LMDSQS-------------------------------------------------
H8GI61_METAL/21-218DLQAIADRFRKFHHFKRESIRH---VLTPSQ-------------------------------------------------
Q21EM4_SACD2/20-215NLTLLRKRFLSINTDRLERMRS---ALNSHQ-------------------------------------------------
A4XNY1_PSEMY/20-216.LTQLRARFLKINQGRLQRTML---GLSSRQ-------------------------------------------------
D6Z233_DESAT/8-206......ARYHLYNEERIAKSVL---LNPHKS-------------------------------------------------
C5BBD1_EDWI9/4-201YIETLKQRLDAINQLRVERALS---AMGPAF-------------------------------------------------
B7VMD8_VIBTL/4-199YTQTLIQRLDNLNQQRIDRALA---LMNVQG-------------------------------------------------
Q88CF9_PSEPK/20-216.LATLRARFLHLNQGRLQRAKE---GLSTRQ-------------------------------------------------
C4LDV3_TOLAT/4-196QFELLVARCDAINQIKMERALE---AMNEAG-------------------------------------------------
M4U351_9GAMM/4-197EIKRLRDKADQFNRLRIQSAQV---LMTENE-------------------------------------------------
E0SKN1_DICD3/4-200YIETLKQRLDAINQLRVDRALE---AMKPAF-------------------------------------------------
D5C200_NITHN/12-205..KDIRQRFFALNRHRLGRVRE---SLRPRQ-------------------------------------------------
A0KFH7_AERHH/4-200KLDTLVARYDELNRLKTQRALG---LMSRYG-------------------------------------------------

PF10620

D3FW19_BACPE/3-199----------------RVHDLV---ELKDVE.-------.........------...-------------------....
B4EEI1_BURCJ/9-215----------------RRHTLV---TLTAAG.-------WGAAFARDP------ALA-------------------GDP.
F2F9N8_SOLSS/4-194----------------TVHDLV---FLKSMD.-------.........------...-------------------....
R5PTN8_9BURK/4-199----------------RPHDLL---FLTGKA.-------.........------...-------------------....
Q20XM6_RHOPB/11-212----------------RPHDLL---WIDEPR.-------.........------...-------------------....
G8NWE2_GRAMM/10-208----------------QVHDLL---LLSSGR.-------.........------...-------------------....
Q6FBG5_ACIAD/8-200----------------RPHDLL---WGMTCE.-------.........------...-------------------....
Q478I8_DECAR/2-209----------------RRHDLV---YLQRDA.-------...LFSTPC------AET-------------------GDPY
G8M515_9BURK/7-206----------------RPHDLV---RLAPGA.-------.........------...-------------------....
Q13P70_BURXL/22-223----------------RPHDLL---RLQ....-------.........------...-------------------....
B0UJ86_METS4/6-208----------------RRHDLL---DVEPQA.-------WAGVLAGRP------DIE-------------------GVP.
E0SJB7_DICD3/5-200----------------RPHDLL---WLTSRE.-------.........------...-------------------....
B1Y603_LEPCP/24-240----------------RRHQLV---RLSPAG.-------WQTVLAQTH------AES-------------------ARPC
B6JE84_OLICO/7-212----------------ERHAFV---YCAPER.-------.........------...-------------------LSDG
I0DQT6_PROSM/4-200----------------NPHDFV---WISSLD.-------.........------...-------------------....
MDCG_BRADU/13-217----------------GRHDLV---FVSPAG.-------WRAMLDARD------DLA-------------------ADS.
D5AVP5_RHOCB/5-220----------------.RHSLA---HVSPAS.-------.RPGILAAV------LDA-------------------LPEQ
Q2RUR7_RHORT/4-220----------------RRHTLA---HIDPIA.-------.RARLLPAL------IEA-------------------LPAA
D3HKK0_LEGLN/3-206----------------QRHHLI---YLQPGT.-------.........------..E-------------------FFLV
A0R6Q2_MYCS2/5-197----------------RPHDLL---RIADVA.-------.........------...-------------------....
I3U924_ADVKW/2-208----------------RRHDLA---YLYSNA.-------EYQLLSP..------..V-------------------QSPT
A4G557_HERAR/3-213----------------YRHNRV---WLSANG.-------W.....QAA------CAR-------------------LPAA
H5WND7_9BURK/5-214----------------HRHQLA---HLSAAG.-------WQAILAMPW------DDE-------------------ASAC
W0PCX9_9BURK/2-210----------------RRHDLA---YLYPTA.-------DYRLLST..------..S-------------------PDAA
A8AQP5_CITK8/6-200----------------RPHDLI---WLNARS.-------.........------...-------------------....
D8IXS4_HERSS/5-221----------------PRHHLL---WLTEAA.-------WTRLQTQSQ------DSR-------------------EQAV
Q4FSL5_PSYA2/2-211----------------HRHDLV---YLQPEEA-------FTMLNASLP------LAV-------------------IQAV
G0ABH8_COLFT/3-212----------------ARHSLV---WLSADG.-------WQRAA.QTA------AAG-------------------NRAA
C5AE29_BURGB/13-235----------------VRHRVV---RLAPAA.-------W.AALAEPL------VER-------------------LALP
C5CZJ3_VARPS/8-216----------------HRHQLA---WLTRSG.-------WAAVLGRPW------DVQ-------------------ARDC
Q21XD0_RHOFT/5-210----------------ARNQLV---WLDAQA.-------WAQMQAHPW------DDE-------------------AQH.
A1WLX1_VEREI/8-240----------------WRHRRV---WLAPAL.-------.........------...-------------------RAQD
Q89UY6_BRADU/6-207----------------ARHTMV---KASAAG.-------WAAVMSRHP------ELA-------------------SEP.
C5APL6_METEA/6-211----------------RRHDLL---DVEPGA.-------WAAAVIARA------DLA-------------------EVP.
F6AEK3_PSEF1/6-203----------------RPHDLL---WGLLPT.-------.........------...-------------------....
MDCG_PSEAE/8-202----------------EPHDLL---LGMAPA.-------.........------...-------------------....
A4VRY6_PSEU5/6-198----------------RPHDLL---WGMRPE.-------.........------...-------------------....
D7A7S9_STAND/7-217----------------ARHDLL---RVTPEG.-------WRATLTVT.------...-------------------...E
B2JLU1_BURP8/24-227----------------RAHDIL---RVR....-------.........------...-------------------....
MDCG_XANCP/3-204----------------GRHALV---WLRADA.-------.........------...-------------------....
I2BDH6_SHIBC/7-201----------------RAHDLL---WLDSNT.-------.........------...-------------------....
A9BUU4_DELAS/12-224----------------HRHQLV---DLGPQA.-------WADLLERPR------DAQ-------------------AREI
H0Q3G4_9RHOO/2-205----------------RRHDLV---WLDPAF.-------.........------...-------------------..PL
G2IWN4_PSEUL/8-208----------------RPHDLL---WLADPA.-------.........------...-------------------....
MDCG_KLEP7/6-200----------------RPHDLV---WLNHAS.-------.........------...-------------------....
H2IQE3_RAHAC/5-202----------------RAHDFV---WIRDRS.-------.........------...-------------------....
S6AL15_PSERE/6-197----------------RPHDLL---WGMTPD.-------.........------...-------------------....
A1VKU0_POLNA/11-212----------------RPHDLL---WPLAAS.-------.........------...-------------------....
MDCG_PSESM/9-203----------------LPHDLL---WGMPLS.-------.........------...-------------------....
H8MH16_CORCM/7-204----------------VRHDWV---YLGDH..-------WAEALRSPL------IPD-------------------VLV.
B8EMG7_METSB/15-229----------------RRHALL---QVCPEG.-------..FAIALAG------FAQ-------------------AESP
E6WJH1_PANSA/6-195----------------RPHDLL---WLRHDR.-------.........------...-------------------....
B1M799_METRJ/6-209----------------RRHDLV---RADPAA.-------WAAWRVGRP------DLS-------------------AVP.
MDCG_AZOVD/9-206----------------QPHDLL---WGMSTD.-------.........------...-------------------....
W0LLU0_9ENTR/3-217----------------HRHDLL---QFSPQA.-------.AQQIFLLW------QAA-------------------QPHD
A5VEB4_SPHWW/8-205----------------RRHDLV---HLRSGA.-------.........------...-------------------....
B2UKC7_RALPJ/7-206----------------RAHDLL---WVSETP.-------.........------...-------------------....
Q21AG0_RHOPB/4-220----------------LRHTMV---EFSVEE.-------.RLRSAETV------CGG-------------------LLAP
A2SDW3_METPP/11-216----------------WRHRRV---WLAPDL.-------.........------...-------------------GPAD
A1T0S3_PSYIN/7-202----------------QPHDLL---WVKDIV.-------.........------...-------------------....
B2FSQ2_STRMK/6-203----------------ARHTLA---WLSADAD-------WRADVTA..------...-------------------....
B8IJN7_METNO/6-210----------------RRHDLL---DVDPGA.-------WAAMLAQRP------DLD-------------------GVP.

PF10127

YCGL_BACSU/1-249----------------MKQRII---DELKRIE-------QSY....GV------...-------------------....
A8MHZ8_ALKOO/1-249----------------MKSVIM---EKLEEIE-------RDN....QI------...-------------------....
Q0ATC2_MARMM/14-264----------------MHDTIL---NQLRQIE-------TRE....NV------...-------------------....
Q5YSM9_NOCFA/7-254----------------MSVHGS---AEFQRIA-------NQ.......------...-------------------....
A3QAH3_SHELP/6-255----------------IKKEIL---RRIRNAE-------KEH....NV------...-------------------....
Q8Y2V7_RALSO/25-271----------------IRARVL---SELADIE-------RRH....DV------...-------------------....
Q97IY9_CLOAB/10-256----------------IEELVN---MKLDEIE-------KKE....NV------...-------------------....
A6LZ95_CLOB8/1-237----------------MNKVTK---EILNKEE-------YKFIHSNEN------L..-------------------....
A8F9S9_BACP2/1-249----------------MRERIK---EELKIIE-------ETY....DV------...-------------------....
Q2RSZ8_RHORT/22-270----------------LGPAAA---RAVAAFA-------EAE....GV------...-------------------....
Q8SCS5_BPDPK/11-264----------------MRVTIN---VELDRIE-------KKY....GV------...-------------------....
A9B3Q0_HERA2/60-291----------------LRKQFN---DPLLGLE-------QPQLAENRQ------...-------------------....
A7MPB9_CROS8/11-258----------------MRERVR---QVLNEVE-------TKY....GV------...-------------------....
Q9S235_STRCO/1-245----------------MIDALD---IDLAPVV-------AEQ....PF------...-------------------....
Q65NN4_BACLD/1-249----------------MKQRIE---EELKNIE-------ATY....GV------...-------------------....
Q7ULC4_RHOBA/63-303----------------IHHDQL---VRLSEFK-------NQFIRNTTA------PLM-------------------DSGL
A9BRG4_DELAS/16-262----------------MRATVL---ANLVEVE-------RRH....EV------...-------------------....
Q7NZ84_CHRVO/14-259----------------VRRRVM---EELAALE-------RRH....HV------...-------------------....
Q24TP5_DESHY/3-250----------------VKERII---GELAQIE-------IEK....QV------...-------------------....
Q7ULC3_RHOBA/4-250----------------ARIIDY---DKMLPHI-------RAA....PH------...-------------------....
Q099H0_STIAD/9-253----------------HQTRVS---GRILDEE-------ASR.....R------...-------------------....
Q7MZH9_PHOLL/11-258----------------MKQHIC---QKLAQLE-------TEL....QI------...-------------------....
Q0BVF7_GRABC/14-264----------------IRSVIQ---ERLDRIV-------AEN....HV------...-------------------....
A6LZ96_CLOB8/1-249----------------MDKVIQ---AQLRDIE-------EKN....NV------...-------------------....
Q2SQI3_HAHCH/1-246----------------MEKRIQ---ETLERIE-------WEH....DV------...-------------------....
B4EM27_BURCJ/21-266----------------.RARVM---AELAEVE-------RRH....DV------...-------------------....
Q814A4_BACCR/1-249----------------MREKIE---LELERIE-------KEN....DV------...-------------------....
Q853S4_BPMBZ/16-276----------------.HEPVQ---GAFETSH-------SSS....HH------QQI-------------------...A
Q9HVK0_PSEAE/13-260----------------MRERVL---DELERIE-------REH....DV------...-------------------....

PF04439

R7KZ10_9FIRM/1-274......MYELIIGTARADERIR---AVYMNGS.......RTDKNAPKV------IFQ-------------------DYDI
W6S1S8_9CLOT/1-279MRSEKEMYELILSIANNDKRIH---AVYMNGS.......RVNKNIKSD------IFQ-------------------DYDI
L0EDK7_THECK/1-279MRSERDMMELIVGFAKADERVR---AVILNGS.......RANPDAPRD------CFQ-------------------DYDI
R7M6A2_9CLOT/3-279MRTEKQIYDTILNFAKADDRIR---VVTLEGS.......RTNINIIPD------DFQ-------------------DYDI
F0RJQ6_DEIPM/17-291...ETVLLRRVRAFAEADPRVR---AAVLSGS.......RVNAAIRPD------PFQ-------------------DVDL
C9A7Q4_ENTCA/1-276MREEAELHQLILSVGQRV.GAR---AIGLSGS.......RTDPQAPKD------FLQ-------------------DFDV
R5BA48_9CLOT/1-282MRSERQIMDTILSVVKSSDNIR---AAYMNGS.......RTNPNVEKD------ELR-------------------DYDI
A8AXL5_STRGC/1-268MKTETEMFDVILQTAKAL.QVY---AVAMSGS.......RSNPNATKD------EFQ-------------------DYDV
J7SKW9_MORMO/1-275MESIEQIINNIISFALLDPRID---AVIITGS.......VARQNQA.D------RFS-------------------DINA
C0ZBY2_BREBN/3-281LRTEQEMMNMLIDFARKDDRIR---LVTLEGS.......RTNKNIPAD------PFQ-------------------DYDV
F8KV03_PARAV/7-263TK........IVEWAKQEQTVK---AVILQGS.......HATNQA..D------RYS-------------------DYDL
R6MWH0_9CLOT/1-270MRSQEEMLAIILKKAKQEEHIR---AALLQGS.......RVSKEAKPD------CFQ-------------------DYDV
D1API7_SEBTE/1-279MRNEKEMLDLILRTAVNDPEIR---AVYMNGS.......RTNPNVKKD------IFQ-------------------DYDI
Q81EL0_BACCR/1-279MRTEKEMLDLIINTAIEDERIR---AVIMNGS.......RVNPNVKRD------CFQ-------------------DYDI
E8N0I5_ANATU/1-276MRTEQEMMDLILTFARNDERVR---AVILNGS.......RANPNAPRD------FFQ-------------------DFDI
T0U4V5_9ENTE/1-276MRNEAEMLAVILRVGQKI.GVQ---AIAISGS.......RREPNAISD------RFQ-------------------DYDI
F5WV16_ERYRF/1-277MRTETEIMTLILEQAKLSQHIR---IVAMNGS.......RVNKEIEKD------SMQ-------------------DYDI
Q7N6T3_PHOLL/8-279.......LEKILTFAHNDPRID---TVIQTGS.......RARNARV.D------KFS-------------------DLDI
D6DFM9_CLOSC/1-277MRSEKEVYDIVLNFAKTDKRIR---MVTLEGS.......RTNTNIPPD------DFQ-------------------DFDI
C6VZK2_DYAFD/8-288.RTASDMTELILEVARKDHRIL---AVLQDGS.......RSNPNVTPD------IFQ-------------------DFDI
F4C3Y1_SPHS2/10-290.RSESEMMELILRVAAKDTKIL---GVLQDGS.......RSNPNVSKD------IFQ-------------------DYDI
Q9KFZ4_BACHD/1-282MRTEQEMMDVILTIAKKEERIR---AVYMNGS.......RTNSNVPKD------LFQ-------------------DYDI
D3HMA9_LEGLN/5-280.RDEKTMLNLIVQAAKNDKRIR---AVIMNGS.......RASPSAKKD------IFQ-------------------DYDI
G4L4M5_TETHN/1-277MRSTTEMTDLILETAQKLPEVK---AVAMSGS.......RANKSIPKD------NFQ-------------------DFDI
A5N4U0_CLOK5/1-276MRSEKEMMDLIIAVANNDVRIR---AAYLEGS.......RANPNVPKD------IFQ-------------------DYDI
F3ZWD0_MAHA5/1-282MRSEKEMMELILGVAESDEHVR---AVYMNGS.......RANPNITKD------AYQ-------------------DYDI
Q830C7_ENTFA/1-279MRTEEEMFQLIMDVAKQEEHIR---AVGMVGS.......RTNVKAPKD------SFQ-------------------DFDI
E1R322_SPISS/4-281.RTEKEILDLIYNFVEADNRIR---VVIMNGS.......RVNPNIQKD------IFQ-------------------DYDI
D3EE58_GEOS4/1-279MRSEQEMMDLVLGYAARDERVR---AVTLEGS.......RTNPNVPKD------IFQ-------------------DYDI
F5YA41_TREAZ/1-278MRSEREMMALILGVAQKDERIR---AVWMNGS.......RTNTNAPKD------DFQ-------------------DYDI
K0J1M0_AMPXN/1-279MRTEKEMYDLVLNFAKNDQRVR---AVGLNGS.......RTNPNAPRD------IFQ-------------------DYDV
D9SUI2_CLOC7/1-279MRTEQEMFDLILNTAKEDERIR---AVYINGS.......RTNPNAIKD------IFQ-------------------DYDV
A8MEJ4_ALKOO/1-277MRTEQEIMNLMLDIAKQDERIR---IMILEGS.......RTNVNIPKD------EFQ-------------------DYDM
A6TTG7_ALKMQ/1-278MRTEKEMMDRILNTAKEDERIR---AVVMNGS.......RVGNPSSKD------CFQ-------------------DYDI
Q5WJQ6_BACSK/1-279MRSEQEMMTLFLDFAKNDERIR---LVTLEGS.......RTNKAITPD------KFQ-------------------DYDI
E3EGQ4_PAEPS/1-279MRSEPEMMNMLVKFAMNDKRIR---LVTMEGS.......RTNFNVPPD------SFQ-------------------DYDI
G7M0J2_9CLOT/1-279MRTEQEMFNLILSAAENDERIR---AVVMNGS.......RTNRNAIKD------IFQ-------------------DYDI
I0JN00_HALH3/1-279MRSEEEMMELILSVAETEPHIR---GVIMNGS.......RVNPNVTPD------LFQ-------------------DYDI
Q5ZTL0_LEGPH/5-281.RDEQTMLTLIIKIANDDERIK---IVIMNGS.......RASPSAKKD------IFQ-------------------DYDI
Q5WBU9_BACSK/1-278MRTYNEMINLLLGVAKSDERIR---AVCMNGS.......RTNRNARKD------PFQ-------------------DYDI
H1ZC54_MYROD/8-281.......QNQVLDLASNDTRIR---AVLLNGS.......RANPNVMPD------VYQ-------------------DFDL
Q65P34_BACLD/1-285MRTEQEIIDLVLKVAREDSRVR---AVGMNGSRTNPNVPRTNPNVPKD------PFR-------------------DYDI
R7EXP0_9FIRM/1-276MRSEKEMLDLIIRTAREDERII---AAYLEGS.......RVDPNAQKD------IFR-------------------DYDV
D9SN58_CLOC7/1-281MRNTQEMMDLILNIAKEDARIR---AVYLSGS.......RVDPDATQD------KYS-------------------DFDI
E3EJ73_PAEPS/1-278MRSEQEMLHTILQFAQEDERVR---AVIMNGS.......RANPHAPRD------IFQ-------------------DYDI
H6NNB4_9BACL/1-279MRSEREMMDTILSFANEEEGIR---AVIMNGS.......RVNPKARRD------PFQ-------------------DYDI
R6VSM5_9FIRM/1-276MRTEDEIMKLLINTAAQDDRIR---AAYLEGS.......RVNPDVPRD------MFQ-------------------DYDV
Q3Y246_ENTFC/1-277MRSEKEMMDLVLSLAEQDERIR---IVTLEGS.......RANINIPKD------EFQ-------------------DYDI
J9R2N9_RIEAN/1-283MKVREEKLRTIIEWSEKNEDVR---VLLLTSS.......LVNPLALVD------EFS-------------------DLDI
C6XTS4_PEDHD/4-284.RSEQKMMKLILDVATDHPEVR---AVLLNGS.......RANPNVATD------IFQ-------------------DYDI
Q24XY2_DESHY/1-282MRSEKEMMEIILSTAKKDERIR---AVYMNGS.......RTNPNVPKD------IYQ-------------------DYDI
K8E427_CARML/1-279MRSEEEMYHLILQKAQLDERIR---GVLLNGS.......RANKHVKPD------RLQ-------------------DFDI
E0RXK3_BUTPB/1-281MKTYDEMYDLIIKTATEDDRIR---AATMEGS.......AVTPGAVRD------GFS-------------------DFDI
R5RFU0_9FIRM/1-279MRSEKEVFTLFDNIAKTDDRIR---VMTLEGS.......RVNPNVKPD------QWQ-------------------DYDI
AADK_BACSU/1-279MRSEQEMMDIFLDFALNDERIR---LVTLEGS.......RTNRNIPPD------NFQ-------------------DYDI
I0DXB6_PROSM/4-277...PASLINKIISVSLLDPRID---AVILTGS.......RGREQQI.D------HYS-------------------DIDI
R5A566_9CLOT/1-278MRTEQEMYQLILEYAWKDPKIR---GVILNGS.......RANPTAKLD------RFR-------------------DFDI

PF03296

Q9EN10_AMEPV/129-284-------------...DNPILN---EILKQY-------------------------------------------------
PAP1_CPRVZ/123-270-------------YAAHEDYVE---AMLRSY-------------------------------------------------
PAP1_DPV83/122-269-------------TSSMQKIAN---DALNSM-------------------------------------------------
PAP1_MCV1/122-269-------------YCSMERLAE---EVLWSY-------------------------------------------------
Q6TVV2_ORFSA/120-268-------------.TRARALAS---RALDSY-------------------------------------------------
PAP1_VAR67/131-279-------------VTSMEELAR---DMLNSM-------------------------------------------------
PAP1_FOWPN/124-271-------------YSSMEKIAD---DILDSY-------------------------------------------------

PF01743

PCNB_ECOLI/62-193----------------AWLVGG---GVRDLL-------------------------------------------------
O66728_AQUAE/454-580----------------AYIVGG---VVRDIL-------------------------------------------------
Q93795_CAEEL/38-162----------------LRIAGG---AVRDLL-------------------------------------------------
CCA_BACSU/22-142----------------AYFVGG---AVRDSY-------------------------------------------------
O83294_TREPA/24-145----------------IYVVGG---AVRDFL-------------------------------------------------
O84710_CHLTR/23-143----------------AYFVGG---SVRDML-------------------------------------------------
O67911_AQUAE/37-172----------------CFIVGG---WVRDRI-------------------------------------------------
O51649_BORBU/24-145----------------FYLVGG---ALRDLL-------------------------------------------------
O83605_TREPA/50-165----------------TYIVGG---AVRDLV-------------------------------------------------
PCNB_HAEIN/50-181----------------AYIVGG---CIRDLL-------------------------------------------------
O25357_HELPY/22-146----------------LYLVGG---CVRDYL-------------------------------------------------
P74081_SYNY3/512-663----------------LYLVGG---AVRDLW-------------------------------------------------
CCA1_YEAST/63-205----------------LRITGG---WVRDKL-------------------------------------------------
I1NH95_SOYBN/99-237----------------LRVAGG---WVRDKL-------------------------------------------------
Q88DX1_PSEPK/56-188----------------AYLVGG---CVRDLM-------------------------------------------------
Q94K06_ARATH/110-247----------------LRVAGG---WVRDKL-------------------------------------------------
Q9CCY1_MYCLE/41-168----------------LYLVGG---SVRDAL-------------------------------------------------

PF06042

F7YRG9_VIBA7/44-201---------------------Y---HVSQLG-------------------------------------------------
B9JA85_AGRRK/24-187---------------------R---NWEKIA-------------------------------------------------
Q7NQC6_CHRVO/26-191---------------------R---AARALG-------------------------------------------------
A9KPI8_CLOPH/31-195---------------------K---RAKQLN-------------------------------------------------
A0A016Q9B1_GIBZA/30-194---------------------S---RAAEMK-------------------------------------------------
C4L4W2_EXISA/22-184---------------------H---AVASLD-------------------------------------------------
E6X9J4_CELAD/24-180---------------------D---IVRDLS-------------------------------------------------
T0TPF3_9STRE/22-184---------------------T---IIRDLD-------------------------------------------------
E6TYF2_BACCJ/23-185---------------------E---TVETLK-------------------------------------------------
B2IE49_BEII9/22-182---------------------R---TVRSLD-------------------------------------------------
R7F266_9BACI/28-194---------------------D---YIDTLQ-------------------------------------------------
Q47ZE1_COLP3/38-196---------------------.---....NH-------------------------------------------------
B7VSV6_VIBTL/5-162---------------------N---CVAQLD-------------------------------------------------
B9DTD2_STRU0/21-182---------------------G---IVQELS-------------------------------------------------
G8S5F2_ACTS5/30-189---------------------H---AAATLA-------------------------------------------------
A8GHE5_SERP5/22-179---------------------R---TARRLG-------------------------------------------------
K9WRX7_9NOST/22-176---------------------.---EIAQLN-------------------------------------------------
Q6LIY1_PHOPR/48-206---------------------R---AVKSLN-------------------------------------------------
K9ZZZ5_DEIPD/21-185---------------------A---RLPALQ-------------------------------------------------
K8E4K8_CARML/22-184---------------------K---IVKSLN-------------------------------------------------
S8BA31_DACHA/30-194---------------------T---RAAALN-------------------------------------------------
T0TA19_9STRE/18-179---------------------K---IIAALK-------------------------------------------------
K9PHD3_9CYAN/22-177---------------------.---AISLVN-------------------------------------------------
A4Z2D9_BRASO/21-184---------------------H---VIRRID-------------------------------------------------
R8BBT8_TOGMI/30-194---------------------N---RAASMN-------------------------------------------------
Q0WCS8_YERPE/22-199---------------------Y---TARELG-------------------------------------------------
W0L9G9_9ENTR/22-179---------------------S---TARRLG-------------------------------------------------
E1V6J0_HALED/24-181---------------------E---LAECLG-------------------------------------------------
U4KG05_9VIBR/26-182---------------------E---AVARLN-------------------------------------------------
Q8EGD2_SHEON/29-193---------------------Q---CAQVHD-------------------------------------------------
Q8DVZ2_STRMU/21-183---------------------T---IIRDLK-------------------------------------------------
E9ELM3_METRA/30-196---------------------S---RAPSLH-------------------------------------------------
G8PQI6_PSEUV/58-222---------------------K---ILRDAG-------------------------------------------------
A1S5C1_SHEAM/40-192---------------------.---.MARFG-------------------------------------------------
D4ZAN8_SHEVD/35-191---------------------.---FAVKLD-------------------------------------------------
Q8YZI8_NOSS1/21-177---------------------E---TISQVN-------------------------------------------------
I3TT60_TISMK/24-184---------------------.---EVAACG-------------------------------------------------
M4XBK0_PSEDE/30-180---------------------.---......-------------------------------------------------
A0KID9_AERHH/44-203---------------------R---AARELA-------------------------------------------------
B2J7L9_NOSP7/21-177---------------------P---AIAQLN-------------------------------------------------
Q98CQ2_RHILO/58-222---------------------A---RARTLG-------------------------------------------------
A7HQY2_PARL1/21-184---------------------Q---HLPELK-------------------------------------------------
G2SQN4_LACRR/23-176---------------------.---ILDRYH-------------------------------------------------
C9A5U1_ENTCA/30-192---------------------.---DVSALG-------------------------------------------------
Q8E2A6_STRA5/19-180---------------------A---IIKSLP-------------------------------------------------
D0J385_COMT2/22-181---------------------E---RWDDLN-------------------------------------------------
C9SMQ7_VERA1/31-195---------------------N---RAARLG-------------------------------------------------
U5L946_9BACI/24-185---------------------K---AAEAAG-------------------------------------------------
Q6F6M2_ACIAD/63-218---------------------.---......-------------------------------------------------
Q0ATF8_MARMM/35-199---------------------E---RAHGLD-------------------------------------------------
Q12L07_SHEDO/33-198---------------------N---IAKHNH-------------------------------------------------
B5I7I9_9ACTN/30-193---------------------.---RTATLD-------------------------------------------------
Q9KMH4_VIBCH/42-199---------------------E---CVYQLE-------------------------------------------------
G3J5G4_CORMM/36-202---------------------E---RVATMG-------------------------------------------------
Q89V81_BRADU/22-184---------------------.---ELARLA-------------------------------------------------
Q5WAS6_BACSK/23-185---------------------K---TTSSLD-------------------------------------------------
Q03U83_LACBA/22-184---------------------R---LIQACH-------------------------------------------------
H2IZW8_RAHAC/23-181---------------------T---QASTQN-------------------------------------------------
D3E7U6_GEOS4/21-179---------------------G---IVRDLA-------------------------------------------------
F9UNI3_LACPL/22-183---------------------Q---LIQDCH-------------------------------------------------
Q9CGK8_LACLA/22-182---------------------D---EVSVLN-------------------------------------------------
A4VSF2_STRSY/43-201---------------------D---IMDRLN-------------------------------------------------
W8UHS0_YEREN/24-184---------------------.---.ARELG-------------------------------------------------
C5CXQ6_VARPS/13-176---------------------R---AVRSLG-------------------------------------------------
H8L6T1_FRAAD/26-186---------------------Q---AVRSLQ-------------------------------------------------
B9JP57_AGRRK/25-185---------------------.---..DKLA-------------------------------------------------
I1RDV7_GIBZE/30-194---------------------S---RAAEMK-------------------------------------------------
C0ZRT4_RHOE4/21-184---------------------.---RAPKLG-------------------------------------------------
I0JHP3_HALH3/24-186---------------------.---.ATDHY-------------------------------------------------
B4RAU1_PHEZH/22-186---------------------R---TARDLD-------------------------------------------------
R7F5W6_9BACI/28-194---------------------D---YIYELK-------------------------------------------------
A0ZEL1_NODSP/6-161---------------------P---AIAQLN-------------------------------------------------
F0LZI9_VIBFN/22-180---------------------R---AVQSLN-------------------------------------------------
K0I121_9BURK/29-196---------------------E---RLPFLG-------------------------------------------------
N0ATJ8_9BACI/22-184---------------------D---TAKSLN-------------------------------------------------
K9QIT0_9NOSO/21-177---------------------P---AIAQTN-------------------------------------------------
A6WX10_OCHA4/47-208---------------------.---......-------------------------------------------------
C6D3F5_PAESJ/25-186---------------------H---TAGSMN-------------------------------------------------
Q7MJH5_VIBVY/23-178---------------------G---HVAELS-------------------------------------------------
F3ZCS6_9ACTN/62-226---------------------.---RAAGLG-------------------------------------------------
A6VYX8_MARMS/22-179---------------------E---LASTLG-------------------------------------------------
A4VG22_PSEU5/22-182---------------------A---HVRALA-------------------------------------------------
F5Z4Y3_ALTSS/31-192---------------------N---ALKSLK-------------------------------------------------
G4R9P5_PELHB/34-198---------------------E---ILRAAG-------------------------------------------------
X4ZH19_9BACL/21-179---------------------E---LVRQLE-------------------------------------------------
N4VT77_COLOR/30-193---------------------A---RARALD-------------------------------------------------
G8PQI7_PSEUV/50-212---------------------.---GIRSLR-------------------------------------------------
Q084X9_SHEFN/37-198---------------------.---VMQQQG-------------------------------------------------
R4L9D2_9ACTN/23-182---------------------R---AAAELG-------------------------------------------------
Q8CZ82_STRR6/25-187---------------------T---IIRDLG-------------------------------------------------
K9W6P1_9CYAN/21-184---------------------P---AIAQLN-------------------------------------------------
D9QML6_BRESC/23-187---------------------T---VVRAQD-------------------------------------------------
C9A9L8_ENTCA/21-183---------------------T---IIEALQ-------------------------------------------------
C2WZT1_BACCE/24-186---------------------H---IAKSLE-------------------------------------------------
K9RM73_9CYAN/21-177---------------------P---AISKLN-------------------------------------------------
V4KBT1_9ACTN/35-199---------------------D---RAATLA-------------------------------------------------
C7ZKJ8_NECH7/30-194---------------------E---RAASMK-------------------------------------------------
E3EIW9_PAEPS/24-182---------------------R---YVRELK-------------------------------------------------
Q2S808_HAHCH/20-179---------------------A---AARSLG-------------------------------------------------
Q9A3I2_CAUCR/24-192---------------------K---TVRELD-------------------------------------------------
T0LHD4_COLGC/33-197---------------------T---RAATLN-------------------------------------------------
Q5M5D3_STRT2/19-183---------------------K---IIHSFQ-------------------------------------------------
A8AUH1_STRGC/23-185---------------------K---IIRELN-------------------------------------------------

PF07984

L5LWP1_MYODS/17-336LSWDQVSRLHEVLNEVVPVHGR.G.NFPTLELTLKDIVQTVRSRLEEA......GIQ...................VQDV
A1Z745_DROME/52-381LSFEQVSKLHDVMDEKVAIHGR.G.NFPTLEVKLKDLVNLVRRKLEAEVNAGGAGVL...................VKDI
T1FNH1_HELRO/24-358LNYDQINRLDQIIGSTFDVHGHSGLGYPNLSIKAKELIVAVRDKLVES......GFH...................LKDI
T1J6X5_STRMM/39-359LSYEQVRRLDTVMEEVVPIHGR.G.NFPTLEIKLKDLVHVVRSKLESD......SVS...................VKDI
G3Q3S6_GASAC/31-351LNVEQVEVLHQVLSEAVPIHGR.G.NFPTLELRPRDIIIAVRARLQQQ......GIA...................VRDI
H2Z3D3_CIOSA/19-351..YKGVARLTELMEADVPIHGV.G.NFPDLQISPSELIQMVCDRLECS......GVK...................VKSV
H9GHA4_ANOCA/13-332LTWEQLQILDQVLTEVIPIHGR.G.NFPTLEVKPKDIIRVVKEQLIKK......QIV...................IRDI
B3RY60_TRIAD/11-330LDYDQVSRLDEILTQVISIDGV.G.NFPSLEVRPYQFVNLILKKLAIH......GIH...................LYDV
E4X262_OIKDI/463-783.KFGEIKKLQKILDKSHEIHGK.G.NFPTITVEPTKLIKDIHARLGEA......GIS...................VAHV
G4M0E2_SCHMA/159-490LSYERVTRLHYVLSKTIPIHSRYP.GFPTIMVKLHDLLRAVRGNLKSA......GIP...................IRNI
W5NMQ1_LEPOC/15-334LTWEQVRLLDEVMTEAVPVHGR.G.NFPTLEVRLKDIVQMVRSRLEEK......GIR...................VRDV
A7T168_NEMVE/10-329LTYEQVHRLDNVLNQVVQVHGR.G.NFPTLDVHLRELINVVSSGLKDE......NLR...................IRDI
T1K5N9_TETUR/11-330LSYEQVTRLDTVMDEVVPIHGR.G.NFPTLEMKLKDLVSVVRGKLEEE......NVT...................LRDI
I1FWF4_AMPQE/47-375LTFEQVQRLSQIVSDPIAINAKEG.NFPTLAISPAQLIKAVKKRLDSK......DID...................VTDV
B3RUB7_TRIAD/6-351LNYGQVGKLVELLETCVEIHGY.G.NLPTLQIPLKELLRKVRNNLRKD......NVN...................VRNI
K1PBY4_CRAGI/10-333LCYEQVDRLNKVMEDVIPIHGR.G.NFPTLDVKLKDLVQVVRDKLKAE......GVC...................VRDI
F7AS71_MONDO/19-338LGWDQIKILDQVLSEDVPIHGR.G.NFPTLEVKTKDIILVIQEELQKK......EIV...................IKDI
H2LZV4_ORYLA/17-337LSIEQIQALDRILTEVIPIHGR.G.NFPTLQVRVKDIIRVVKDRLVER......DIM...................VKDI
F7E7M3_XENTR/18-337LSWPQVRRLDAILCESVPIHGR.G.NFPTLSCRPRDLVQVVRSRLEQK......GIL...................VHNV
H3E7R5_PRIPA/59-392L...QMERLQQLLNENIEIDGA.G.NFPEIILPLRHFVVALKRQLVSA......GLS...................PLSI
J9JYZ0_ACYPI/99-447LSYEQVARLNDVMDETVSIHGR.G.NFPTLEVRLRDLVAMVRDRLRAQAAPEDDDVAFPAERSTPPSPDADDTCFQVRSI
E9HG11_DAPPU/7-330LSYEQVSRVHDVMNETVSIHGR.G.NFPTLELRLRDLVTLVRAKLEAD......GVA...................VKDM
H9JEQ9_BOMMO/53-380LSYEQVRRLNDVMDEVVAIHGR.G.NFPTLHVRLRELVAGVRARLELAQAAGGAGVS...................VRDV
FA46B_HUMAN/52-372LSWPQVKRLDALLSEPIPIHGR.G.NFPTLSVQPRQIVQVVRSTLEEQ......GLH...................VHSV
G3VWF6_SARHA/61-380LSWEQVQRLDDILSETIPIHGR.G.NFPTLEMQPRQIVKVVRSRLEEK......RIG...................VRDV
Q86NJ5_CAEEL/50-400LAKGQMKRLRAVLEERVEIHGR.G.NFPTISTKLINLIRCLRQHMGSV......QVE...................ARDV
F1S1S5_PIG/9-328LTWDQVMTLDQVLNEVIPIHGR.G.NFPTLEVKPKDIIHVVKDQLIEQ......GII...................VKDT
E9IG33_SOLIN/73-399LSFEQVRRLNDVMNEVVSIHGR.G.NFPTLEVRLRDLVTVVRSKLETDPSNGGAGMR...................VRDI
W4YCY4_STRPU/13-330LSYPQVVRLDEVLTTPVAVHGR.G.NFPTLDVTLLDLVENVREKLVGS......NID...................VRCI
C3YH94_BRAFL/153-472LDYEQVRKLDQVLNDVVPIHGR.G.NFPTLEICLKSLVQVVRKRLEEE......GIP...................LRDV
H3D951_TETNG/18-337LCWDQVRRLDSILAESVPIHGR.G.NFPTLSVQPRQIVQVVRARLEER......GVA...................VRDV
E1FUA8_LOALO/18-327LNPAQVERLRSVLNEQVEIHGR.G.NFPTISVRLHDLIVCVRDSLRAA......GIG...................PKNV

PF12281

A8I451_AZOC5/134-340--------------..AAKIIR---ALDEAG-------------------------------------------------
B9JC00_AGRRK/105-319--------------LTTARILR---ALNKAN-------------------------------------------------
A1BBC9_PARDP/103-312--------------RGSGQVIS---AMARAG-------------------------------------------------
Q126S1_POLSJ/108-319--------------.KHVRAVR---RLSDYG-------------------------------------------------
Q5P6X2_AROAE/109-317--------------TIVGEVLL---ALAASN-------------------------------------------------
Q89MC1_BRADU/114-315--------------EEVGAAAR---AIGMSG-------------------------------------------------
A9CH87_AGRFC/104-319--------------RFAGEVTK---ALADAG-------------------------------------------------
Q98P17_RHILO/173-382--------------AATGSILH---AFASAG-------------------------------------------------
Q8KKU1_RHIEC/104-319--------------AMSGDIVE---ALADGG-------------------------------------------------
N0AYX3_9RHIZ/127-330--------------.KLGKILE---VIANEG-------------------------------------------------
B6IPR2_RHOCS/108-321--------------..SSDIIE---ALWKAG-------------------------------------------------
V5SE53_9RHIZ/102-312--------------HLSGSIVE---AMWKAG-------------------------------------------------
Q9A9N3_CAUCR/103-311--------------NRTGRVLQ---VLAQAG-------------------------------------------------
A8LU12_DINSH/105-313--------------RATGSILS---AMAAAG-------------------------------------------------
D6ZZH4_STAND/103-312--------------AATGSLLN---ALQKAG-------------------------------------------------
Q3IVG2_RHOS4/104-312--------------RETGSLLL---AFARAG-------------------------------------------------
W6S626_9RHIZ/127-341--------------.FAGDVTK---ALADAG-------------------------------------------------
M4S0H4_9SPHN/98-303--------------RRLGAALD---AIAYAG-------------------------------------------------
Q3IV36_RHOS4/114-326--------------.LTARVIR---KFEDLG-------------------------------------------------
B8IY04_METNO/103-315--------------SMTGRVLE---ALANAG-------------------------------------------------
D5CPE9_SIDLE/109-318--------------NVVVGLLE---EIRRTG-------------------------------------------------
B3E5Q2_GEOLS/108-317--------------HPVARVIR---ELADSA-------------------------------------------------
A9BZ70_DELAS/2-210--------------NDLHAFAK---LVKALS-------------------------------------------------
Q12C53_POLSJ/118-324--------------...IEVLN---AMMRYG-------------------------------------------------
Q0C240_HYPNA/104-317--------------PLTGAVIE---AFAEAG-------------------------------------------------
C3KPJ9_RHISN/33-247--------------RFTGDVVA---AMGAAG-------------------------------------------------
B4RE82_PHEZH/98-305--------------RTTGAVLD---ALAQAG-------------------------------------------------
Q0C284_HYPNA/109-317--------------MQNGKTLR---ALAQAG-------------------------------------------------
A4SVJ5_POLSQ/110-320--------------.KHFRVVN---RLDQYG-------------------------------------------------
A1AK69_PELPD/13-213--------------QDVTDLLR---ELSGIG-------------------------------------------------
Q930T5_RHIME/105-319--------------RMSGDVIE---ALASGG-------------------------------------------------
F2IVW1_POLGS/104-311--------------.ATGSLLS---AMAAAG-------------------------------------------------
A6WWH8_OCHA4/115-328--------------HLTARIIR---AVDNAG-------------------------------------------------
C3KKL2_RHISN/104-319--------------RFAGDVTK---ALADAG-------------------------------------------------
A2SPA0_METPP/110-321--------------NEVADVCS---ELDAAQ-------------------------------------------------

PF02410

E1VGT7_9GAMM/19-115----------------NAAL.T---ALDDMK-------------------------------------------------
Q72BL7_DESVH/18-114----------------KAII.G---WLEEKK-------------------------------------------------
E3PRI2_CLOSD/8-104----------------KLVY.K---AIDDKQ-------------------------------------------------
E3I0D8_RHOVT/51-147----------------HLVV.D---ALEDAK-------------------------------------------------
F8KUA6_HELBC/7-101----------------TRIV.E---LLEDKK-------------------------------------------------
C6D5V2_PAESJ/10-106----------------QITV.A---AAEDKK-------------------------------------------------
G4QH00_GLANF/8-104----------------QFII.D---KIEDMK-------------------------------------------------
K0T8E5_THAOC/404-526----------------......---.LTALG-------------------------------------------------
O86327_MYCTU/12-108----------------RVAA.G---AAAAKL-------------------------------------------------
C7NE56_LEPBD/13-105----------------QEII.A---IMEDKK-------------------------------------------------
K9TU63_9CYAN/35-131----------------.AIA.E---AAADRK-------------------------------------------------
R7F4J7_9BACT/11-109----------------QIVT.S---AVQDKK-------------------------------------------------
B9HIN9_POPTR/50-151----------------NEIE.K---VLTDVR-------------------------------------------------
X5DAH5_9BACT/12-110----------------EAIL.E---GIHRIK-------------------------------------------------
H2WNK0_CAEJA/65-168----------------EHVI.G---ALTEQR-------------------------------------------------
Q04FE5_OENOB/8-104----------------EKIV.Q---IADGKK-------------------------------------------------
R7JA64_9PORP/9-107----------------QAIV.N---GLQEKK-------------------------------------------------
D7CWT0_TRURR/6-101----------------QRIV.D---ALDDRR-------------------------------------------------
H2IXB4_RAHAC/8-104----------------DFVV.D---KVDDLK-------------------------------------------------
B1ZVV9_OPITP/13-109----------------KLCC.R---ALDEKK-------------------------------------------------
R6TBA4_9FIRM/11-107----------------STIV.K---ALDSKR-------------------------------------------------
B8E1S0_DICTD/12-107----------------.RIA.R---IVLEKK-------------------------------------------------
R5A3E4_9CLOT/8-104----------------KKAA.A---FLDNKK-------------------------------------------------
E8NE71_MICTS/12-108----------------QIAA.L---AADSKS-------------------------------------------------
B9DNI5_STACT/8-104----------------KLAV.E---AVESKR-------------------------------------------------
A9WK69_CHLAA/4-100----------------RRIV.E---LVEDKQ-------------------------------------------------
R5HDA8_9FIRM/9-105----------------QLAI.A---ALEDKK-------------------------------------------------
C7LYC9_ACIFD/51-146----------------.AIA.R---MAEDKH-------------------------------------------------
K4L4Y3_9FIRM/9-105----------------QKVV.D---FIDDKR-------------------------------------------------
Q4FP42_PELUB/9-105----------------DLIL.K---TLDSNK-------------------------------------------------
R6ESE1_9FIRM/22-118----------------KIAY.H---ALDEKK-------------------------------------------------
A7I1F9_CAMHC/190-283----------------ERIA.K---ILEDKK-------------------------------------------------
K9ZZD3_DEIPD/20-115----------------RAVV.Q---AARERR-------------------------------------------------
G0QND0_ICHMG/58-162----------------EAVI.A---FLELEQ-------------------------------------------------
D1CCZ4_THET1/16-112----------------RELV.D---VASERK-------------------------------------------------
C7RQU7_ACCPU/8-104----------------KLVV.D---ALEDIK-------------------------------------------------
B9GK05_POPTR/129-223----------------.EMA.K---VASDVK-------------------------------------------------
Q5SHF3_THET8/12-107----------------ERIK.E---LLAEKK-------------------------------------------------
K4KHM4_SIMAS/37-132----------------.IVI.Q---ALEDVK-------------------------------------------------
R6CD09_9FIRM/15-111----------------KTII.K---ALDSKR-------------------------------------------------
A0ZLR5_NODSP/38-134----------------.TVA.E---AALDRK-------------------------------------------------
R5Q2J4_9BACT/9-107----------------DSIT.K---GIQEKK-------------------------------------------------
A0A068XU24_ECHMU/101-202----------------SEVV.Q---FLGAEK-------------------------------------------------
D4ZSA1_ARTPN/39-134----------------..AA.I---AADDRK-------------------------------------------------
G1NDG8_MELGA/5-104----------------DFVV.N---LLRQEN-------------------------------------------------
R6QB74_9FIRM/8-103----------------KTAV.K---AIDSKK-------------------------------------------------
F9UNR7_LACPL/8-104----------------QLTV.E---AADDKR-------------------------------------------------
A1SHP8_NOCSJ/12-108----------------HTAA.R---AASEKL-------------------------------------------------
J9W1F9_LACBU/8-104----------------EVVV.R---AADSKR-------------------------------------------------
Q47JQ2_DECAR/8-104----------------KIVV.S---ALEDIK-------------------------------------------------
B2V9I4_SULSY/8-105----------------KKII.E---KAEEKK-------------------------------------------------
E3GLQ0_EUBLK/11-107----------------EKVK.E---WIDAKN-------------------------------------------------
A3N2P9_ACTP2/7-103----------------EFLT.K---TLDDLK-------------------------------------------------
A0LSX7_ACIC1/13-109----------------.AAA.E---AAAEKL-------------------------------------------------
E0TFT9_PARBH/42-138----------------AIVQ.S---QLDDDQ-------------------------------------------------
F4GJF5_SPHCD/10-107----------------EKIV.S---FINDHK-------------------------------------------------
D6Z191_DESAT/20-116----------------RIAA.A---AALNMK-------------------------------------------------
R6RRV9_9BACE/9-107----------------EKIK.E---GIQEKK-------------------------------------------------
G0A0U8_METMM/8-104----------------KLVE.T---ELDERK-------------------------------------------------
C5D4V8_GEOSW/8-104----------------QLVV.R---AADDKK-------------------------------------------------
E6JZX0_PARDN/12-109----------------RIAA.A---AADRMK-------------------------------------------------
S6AAN5_9PROT/8-104----------------QAVI.S---ALEDIK-------------------------------------------------
R7BRJ0_9ACTN/15-110----------------..AA.R---AADERK-------------------------------------------------
B4U9M4_HYDS0/5-102----------------KLIK.T---LLEDKK-------------------------------------------------
D4J8G6_9FIRM/9-105----------------KLAI.A---ALEDKK-------------------------------------------------
R6EX89_9BACT/9-107----------------EAIV.K---GIQEKK-------------------------------------------------
A4VTA2_STRSY/8-104----------------KVVV.Q---AADDKR-------------------------------------------------
T2DLB5_ALTMD/8-104----------------QFVK.D---KIDDMK-------------------------------------------------
K9UU95_9CYAN/43-134----------------......---.GSERK-------------------------------------------------
X2H6J8_9GAMM/8-103----------------.FII.D---KIDDLK-------------------------------------------------
F8F078_TRECH/16-112----------------..LA.K---LIFEHK-------------------------------------------------
G8JWM0_ERECY/86-219----------------TSIT.A---YLRDKL-------------------------------------------------
Q73LW7_TREDE/15-110----------------...G.K---LLRDFK-------------------------------------------------
R5BYH5_9FIRM/9-105----------------RTAC.K---ALDEKK-------------------------------------------------
H6NIK1_9BACL/9-105----------------ELVV.D---AAEDKK-------------------------------------------------
F0SVG5_SYNGF/9-105----------------KIVT.D---YILDKK-------------------------------------------------
R7R2A4_9FIRM/8-104----------------KLII.D---ALEDKK-------------------------------------------------
R7LB71_9BACT/9-107----------------NSII.D---GIQEKK-------------------------------------------------
E4TYH5_SULKY/6-98----------------EKIS.A---ILDQNK-------------------------------------------------
I3WID0_BIFBI/12-110----------------RVAA.V---AADRMK-------------------------------------------------
G1KP02_ANOCA/11-110----------------EDIV.S---FLRQEN-------------------------------------------------
R5RDD8_9PROT/19-114----------------DIAV.K---SLDDGK-------------------------------------------------
F8EN32_RUNSL/16-114----------------RLVV.K---GMQEKK-------------------------------------------------
R5SGY3_9GAMM/13-109----------------.VIA.R---FLDEKI-------------------------------------------------
D9QBW4_CORP2/12-108----------------SLAA.R---AADEKQ-------------------------------------------------
R5LGW6_9FIRM/6-103----------------NTIY.N---AIDDKK-------------------------------------------------
C0R0F4_BRAHW/47-143----------------.KAA.K---ALYDKK-------------------------------------------------
W1QI88_OGAPD/62-199----------------..LL.E---FVAQKL-------------------------------------------------
F9YTI3_CAPCC/14-112----------------THIL.K---GIEKVK-------------------------------------------------
R5YP83_9PROT/10-105----------------ELVT.K---VLDDNK-------------------------------------------------
F9D1M0_PREDD/9-107----------------ETIT.Q---GIQEKK-------------------------------------------------
S2JP82_MUCC1/153-260----------------ETIR.S---LLEESK-------------------------------------------------
YM62_CAEEL/65-167----------------ENVV.G---ALTDQR-------------------------------------------------
B5EEI2_GEOBB/16-109----------------..CA.A---FALDKK-------------------------------------------------
B8I1C2_CLOCE/8-104----------------DEIV.A---AMEDKK-------------------------------------------------
R6K4L0_9BACE/9-107----------------QQIT.E---GIQDKK-------------------------------------------------
E6W3S5_DESIS/8-105----------------ERIH.Q---LADEKH-------------------------------------------------
K7IQU4_NASVI/90-189----------------EDLV.E---LLKKDN-------------------------------------------------
B7G5J9_PHATC/2-97----------------......---AADGRK-------------------------------------------------
B7FPM4_PHATC/162-271----------------DEIA.A---CLKALG-------------------------------------------------
K9YCI5_HALP7/25-122----------------WTIA.H---AADSRK-------------------------------------------------
Q11XG7_CYTH3/15-113----------------DTVV.F---AMQEKK-------------------------------------------------
A0A088A1M0_APIME/113-212----------------EDLV.S---LLQKDN-------------------------------------------------
R5TZZ5_9FIRM/10-106----------------KIAC.Y---ALSDKK-------------------------------------------------
V4J0M6_9DELT/18-114----------------EVCH.R---VATDSK-------------------------------------------------
R7HB19_9FIRM/11-107----------------KTAV.A---ALQDKK-------------------------------------------------
Q4U8K5_THEAN/211-313----------------NQIV.D---ILQREQ-------------------------------------------------
D5X4P2_THIK1/8-104----------------RTIV.D---ALEDVK-------------------------------------------------
F5XNG3_MICPN/12-108----------------QAAA.A---AAADKL-------------------------------------------------
Q6D7M0_PECAS/9-104----------------.FVI.D---KVDDLK-------------------------------------------------
G2KW74_LACSM/8-104----------------ETVV.K---AADERR-------------------------------------------------
I1XI99_METNJ/9-104----------------.LVI.D---ALEDIK-------------------------------------------------
F4HAS9_GALAU/3-99----------------ETIV.E---QLDNLK-------------------------------------------------
B8DJS5_DESVM/19-114----------------.TFV.G---WLEEKK-------------------------------------------------
Q747Q6_GEOSL/15-109----------------.QCA.R---FALDKK-------------------------------------------------
W0RI79_9BACT/14-110----------------QRAA.Q---AALDLK-------------------------------------------------
D6GRY3_FILAD/5-101----------------KTII.S---AIKDKL-------------------------------------------------
K9SPG4_9CYAN/36-131----------------..AA.A---AADDRK-------------------------------------------------
A0LPG4_SYNFM/32-126----------------..CA.E---EADKLK-------------------------------------------------
L0GSY4_9GAMM/8-104----------------SLVL.E---TLADMK-------------------------------------------------
R6GQD4_9FIRM/22-115----------------.KIA.T---LLDEKK-------------------------------------------------
C7MPQ9_SACVD/12-108----------------TAAA.R---AAADKK-------------------------------------------------
S5SWN0_9CORY/13-108----------------.IAA.L---AADERK-------------------------------------------------
F4PVH6_DICFS/525-623----------------HEVM.D---VLAETK-------------------------------------------------
W0JK56_DESAE/2-93----------------NKIL.D---ILCEKK-------------------------------------------------
M4VFB7_9DELT/227-324----------------EFCA.Q---TLFDKK-------------------------------------------------
G8BW66_TETPH/84-227----------------.RIT.N---FIKNKL-------------------------------------------------
B3ER25_AMOA5/16-114----------------TAIV.E---GMQDKK-------------------------------------------------
Q3Z9G1_DEHM1/8-104----------------RQMV.S---IASEKQ-------------------------------------------------
E6TW12_BACCJ/8-104----------------DLAV.R---AADDKI-------------------------------------------------
W5N0T0_LEPOC/99-198----------------DFLV.A---LLRQEN-------------------------------------------------
D6XWC7_BACIE/8-104----------------TLAV.K---AIDDKN-------------------------------------------------
H6RLG7_BLASD/13-108----------------.VAA.Q---AAADKL-------------------------------------------------
ATP25_ZYGRC/85-217----------------RHIS.Q---YLCDEL-------------------------------------------------
Q3IZI6_RHOS4/3-95----------------.....A---SLDDDK-------------------------------------------------
C5CB00_MICLC/12-109----------------TTAA.A---AAADKL-------------------------------------------------
T1IN47_STRMM/146-245----------------.DLV.D---VLRLEK-------------------------------------------------
W8F8R6_9BACT/15-113----------------DVVV.R---GMQEKK-------------------------------------------------
Q1QXB2_CHRSD/8-104----------------TLVM.N---TLEELK-------------------------------------------------
Q7URC6_RHOBA/74-171----------------TEAA.R---VALDNN-------------------------------------------------
D3PKV4_MEIRD/12-108----------------HLVK.E---ALEDKK-------------------------------------------------
Q5FRT0_GLUOX/51-147----------------TVIT.T---SLDEDK-------------------------------------------------
H2LUV3_ORYLA/97-196----------------DVLV.S---LLRQEN-------------------------------------------------
E3HA88_ILYPC/6-102----------------QTVV.D---AIESKK-------------------------------------------------
R5G8H7_9PORP/20-117----------------EAIV.E---GIKEKK-------------------------------------------------
R5RHQ5_9FIRM/9-105----------------AMAC.N---ALEDKK-------------------------------------------------
R5XAQ7_9FIRM/8-103----------------KIAV.K---AADSKK-------------------------------------------------
K7SIQ4_PROA4/13-108----------------.IAA.R---AAAGKS-------------------------------------------------
D4H0Y6_DENA2/8-104----------------DLIL.K---ELVERK-------------------------------------------------
D2RNC7_ACIFV/8-104----------------NKIA.A---AAADKK-------------------------------------------------
R6IQY9_9CLOT/8-103----------------KTAV.R---AIDSKQ-------------------------------------------------
M3HMI8_CANMX/81-220----------------SEFV.N---LLANEY-------------------------------------------------
C7M7C0_CAPOD/12-111----------------SNII.A---GIEKVK-------------------------------------------------
R6GWL1_9FIRM/10-105----------------.AAT.R---ALDSKK-------------------------------------------------
R6NCD6_9FIRM/5-101----------------EIIQ.K---ALEDKK-------------------------------------------------
R6A3V4_9ACTN/43-140----------------RAAA.Q---AAYDKK-------------------------------------------------
R6DIG1_9BACE/9-107----------------QKIT.E---AIQEKK-------------------------------------------------
D3UIX0_HELM1/7-101----------------DFII.E---ILGSKK-------------------------------------------------
R5N925_9BACT/9-107----------------NAIT.E---GIQDKK-------------------------------------------------
D6WL03_TRICA/57-156----------------EDLI.E---VLHSEN-------------------------------------------------
A9V8V9_MONBE/155-258----------------EDVV.R---SALDMK-------------------------------------------------
R7KSJ6_9BURK/8-104----------------RVIV.N---ALDDVK-------------------------------------------------
F9ZTY5_ACICS/9-105----------------DLVV.H---ALDEHK-------------------------------------------------
G2LE33_CHLTF/32-127----------------.QVI.H---ALQEKK-------------------------------------------------
Q8DY34_STRA5/8-104----------------QLVV.K---AADEKR-------------------------------------------------
K4IPF9_PSYTT/13-111----------------THII.Q---GIEEVK-------------------------------------------------
W0F3W7_9SPHI/26-124----------------KTII.S---AIHEKK-------------------------------------------------
G8AIT6_AZOBR/37-132----------------.LVE.K---SLDDDQ-------------------------------------------------
R6DUN9_9FIRM/8-103----------------KNIA.K---ILDKKK-------------------------------------------------
R5AKW9_9CLOT/10-106----------------KGIL.E---TLYDKK-------------------------------------------------
B5Y803_COPPD/2-97----------------EAIQ.R---LLDEKK-------------------------------------------------
A6QCD7_SULNB/8-101----------------DNIV.K---VLDEKK-------------------------------------------------
D4K7J1_9FIRM/12-108----------------IEIA.K---ILDKKK-------------------------------------------------
B6YRM7_AZOPC/12-110----------------NIIL.K---ALKNKK-------------------------------------------------
R5QWA2_9FIRM/5-101----------------KTIV.K---VLDEKL-------------------------------------------------
F2F3K1_SOLSS/7-103----------------NITY.K---AIDDKR-------------------------------------------------
E4NB25_KITSK/12-109----------------TVAA.Q---AAADKL-------------------------------------------------
Q6A9H4_PROAC/12-108----------------RVVA.Y---AALDKK-------------------------------------------------
Q21FD1_SACD2/8-104----------------KLIN.D---ALEDLK-------------------------------------------------
W0EAU7_9FIRM/8-104----------------QDAL.S---IVEEKK-------------------------------------------------
E1WYV6_HALMS/7-98----------------......---.LGNFK-------------------------------------------------
F0V8J6_NEOCL/449-551----------------EEFV.T---ILQQEY-------------------------------------------------
E4TJ98_CALNY/7-103----------------RKIK.E---KLLEKM-------------------------------------------------
D7WC86_9CORY/13-108----------------.VAA.K---AADEKL-------------------------------------------------
E4U6Z9_OCEP5/12-107----------------TKIT.Q---ALEDKK-------------------------------------------------
Q8NN58_CORGL/12-108----------------TIAA.K---AADEKK-------------------------------------------------
R7B4U9_9ACTN/13-109----------------.IAA.K---AADEHK-------------------------------------------------
E1ZH82_CHLVA/239-341----------------QEVA.D---ILAEAR-------------------------------------------------
U3GY66_9CORY/12-108----------------TIAA.H---AAAEKL-------------------------------------------------
R7IT94_9FIRM/11-107----------------KIAY.A---ALDDKK-------------------------------------------------
D8S2B1_SELML/13-114----------------REVA.K---ILRKLR-------------------------------------------------
K4E5A1_TRYCR/232-326----------------.ELL.E---VLRSLK-------------------------------------------------
F6CQD9_DESK7/10-106----------------KVVV.E---AAEDKK-------------------------------------------------
R6KF46_9FIRM/11-107----------------KVAV.E---ALKEKK-------------------------------------------------
I0HW02_RUBGI/8-104----------------RAIV.D---GLEDVK-------------------------------------------------
Q8YPM4_NOSS1/37-133----------------.TIA.E---AASDRK-------------------------------------------------
C1EE68_MICSR/526-636----------------EELV.R---ILLKAK-------------------------------------------------
C5KAT1_PERM5/235-334----------------EQIT.R---LLQDEQ-------------------------------------------------
H6L6C8_SAPGL/21-119----------------AVAV.E---AMQDRK-------------------------------------------------
G4T293_META2/8-104----------------KIVQ.D---VLDERK-------------------------------------------------
I3UBD3_ADVKW/8-104----------------RLVI.N---ALEDVK-------------------------------------------------
H2FY28_OCESG/8-104----------------DFIV.D---KLDDLK-------------------------------------------------
R7CUD2_9BACE/6-104----------------ENIT.K---GIQEKK-------------------------------------------------
J9JUC8_ACYPI/125-224----------------EHLV.E---VLQKNN-------------------------------------------------
C0ZB11_BREBN/10-106----------------QLVV.K---AAEDKK-------------------------------------------------
K0KVP5_WICCF/177-309----------------.PLL.K---FCSDKL-------------------------------------------------
S6EFN2_ZYGB2/82-213----------------.KIS.N---FLRDEL-------------------------------------------------
S9W0T4_SCHCR/94-219----------------QEVL.E---TLSQRY-------------------------------------------------
D4JS04_9FIRM/8-104----------------KEGI.K---ALDSKK-------------------------------------------------
G8TML0_NIAKG/49-147----------------KAII.H---AIKEKK-------------------------------------------------
I0K9S3_9BACT/50-148----------------DLIV.K---GMQEKK-------------------------------------------------
A0A068NYM9_9BACT/8-103----------------QQIS.E---AADEMK-------------------------------------------------
Q2GCL3_NEOSM/17-109----------------SLIL.E---SLSVHK-------------------------------------------------
Q5E6V1_VIBF1/12-106----------------..LF.N---NVDDMK-------------------------------------------------
D0J0H1_COMT2/20-116----------------RAIV.D---GLEDVK-------------------------------------------------
C8WIS8_EGGLE/17-112----------------..AA.C---AADEKK-------------------------------------------------
Q606I9_METCA/10-106----------------GIVV.A---ALDEGK-------------------------------------------------
B4RD60_PHEZH/47-142----------------.LIL.A---RLDEDK-------------------------------------------------
Q2JQ53_SYNJB/16-111----------------..AA.R---AAEEKK-------------------------------------------------
A6Q542_NITSB/8-101----------------KRIK.E---VIEDKK-------------------------------------------------
G0VLT2_MEGEL/20-116----------------EIAC.K---AADDKK-------------------------------------------------
G8Y063_PICSO/101-239----------------ESFV.K---LLANDY-------------------------------------------------
Q7VRA9_BLOFL/4-100----------------NFIL.N---YLDDLK-------------------------------------------------
H1XSE2_9BACT/8-104----------------KKIA.D---LALDKK-------------------------------------------------
Q47MW6_THEFY/12-109----------------TIAA.T---AAADKL-------------------------------------------------
F2KV42_PREDF/9-107----------------ALIT.K---GIQDKK-------------------------------------------------
A1AVZ7_RUTMC/8-104----------------KTVT.D---TIEKLK-------------------------------------------------
R5NMF0_9FIRM/8-104----------------KTIY.N---ALDDKK-------------------------------------------------
E4RIQ7_HALHG/12-107----------------.IAA.Q---AADDKK-------------------------------------------------
R5Z3M1_9FIRM/5-102----------------EIVI.H---AILEKK-------------------------------------------------
E8N386_ANATU/2-95----------------...V.H---ALEEKK-------------------------------------------------
E3D0R6_9BACT/33-122----------------......---.LTDKH-------------------------------------------------
Q92BM7_LISMO/9-104----------------.LTA.K---AADDKR-------------------------------------------------
S6CGZ3_9GAMM/8-104----------------DLVV.A---TLEDMK-------------------------------------------------
Q9A1F0_STRP1/16-112----------------KIVV.E---ATEEKR-------------------------------------------------
A5G904_GEOUR/16-109----------------..CA.A---CALDKK-------------------------------------------------
B3RRW9_TRIAD/91-190----------------AQVT.D---LLRQER-------------------------------------------------
F6EQY0_AMYSD/13-108----------------.IAA.L---AAADKK-------------------------------------------------
R6ALX9_9CLOT/27-123----------------KRIV.D---VADAKR-------------------------------------------------
E1G5L4_LOALO/54-150----------------KEIV.D---ILRAER-------------------------------------------------
Q5P2U1_AROAE/8-104----------------KTVV.D---ALEDIK-------------------------------------------------
R5WH81_9DELT/389-485----------------QTIC.K---ALSEKS-------------------------------------------------
R6SBY2_9FIRM/9-105----------------RVAY.Q---ALDEKK-------------------------------------------------
U6B5K9_9RHIZ/20-117----------------QLVI.E---VLQETK-------------------------------------------------
D1BM92_VEIPT/13-109----------------.ELA.Q---AAFDKK-------------------------------------------------
B8IEM3_METNO/6-98----------------.....R---CLEDMK-------------------------------------------------
A1SU09_PSYIN/8-104----------------KFVL.Q---HLEDFK-------------------------------------------------
K8GKE5_9CYAN/32-128----------------.TAI.R---AADDRK-------------------------------------------------
Q2N6F3_ERYLH/12-107----------------.LVL.E---QLDEDQ-------------------------------------------------
A3QH51_SHELP/14-110----------------QFVV.D---KVEDLK-------------------------------------------------
C4Z098_EUBE2/9-105----------------KVII.D---ALQDKK-------------------------------------------------
D3EQN9_ATETH/15-112----------------KTIA.M---AAKDRK-------------------------------------------------
E6U7Y1_ETHHY/22-118----------------EKAV.E---ILDNRK-------------------------------------------------
G0GDI3_SPITZ/12-109----------------REIA.E---FLEDHK-------------------------------------------------
K9Q2R2_9CYAN/18-114----------------.SIA.E---AADDRK-------------------------------------------------
E0W225_PEDHC/107-206----------------EELV.E---VLRKEK-------------------------------------------------
I0I1R8_CALAS/2-97----------------.....D---IIEEKL-------------------------------------------------
E0RUY2_BUTPB/13-108----------------.MAV.D---ALEDRK-------------------------------------------------
D5UTC0_TSUPD/14-108----------------..AA.L---AADDKL-------------------------------------------------
D4M5X8_9FIRM/9-105----------------KLAY.T---ALSDKK-------------------------------------------------
B1H031_UNCTG/11-107----------------EKAA.E---IADNKK-------------------------------------------------
A6LNB0_THEM4/5-101----------------KVIW.R---KLLEKE-------------------------------------------------
G2SP30_LACRR/8-104----------------KVVV.E---AADSKR-------------------------------------------------
Q3IJ97_PSEHT/8-104----------------AFAI.D---KIEDMK-------------------------------------------------
R5EE57_9GAMM/8-104----------------KKCV.K---TLKDSK-------------------------------------------------
R6DH31_9CLOT/8-104----------------KTIV.K---VLDKKK-------------------------------------------------
Q12QY1_SHEDO/9-104----------------.FVV.D---KVDDLK-------------------------------------------------
IOJAP_ZYMMO/21-117----------------KLVT.D---SLDDDQ-------------------------------------------------
Q0VN47_ALCBS/9-105----------------QLVI.D---ALEEVK-------------------------------------------------
Q8DJK1_THEEB/29-125----------------.TAA.Y---AADDRK-------------------------------------------------
G0IXL6_CYCMS/8-106----------------KVIV.K---GMEDKK-------------------------------------------------
E6WZ07_NITSE/8-101----------------DRIV.N---LLDSKK-------------------------------------------------
W4YD31_STRPU/344-443----------------DDLV.S---ILRDEN-------------------------------------------------
D7BBA8_MEISD/14-107----------------..IR.Q---ALDDKK-------------------------------------------------
X2H7X0_9NEIS/15-110----------------.VSV.N---ALEDIK-------------------------------------------------
G6D1G9_DANPL/107-206----------------EDLV.E---LLQREN-------------------------------------------------
Q2G298_STAA8/8-104----------------AIAV.D---AIDNKK-------------------------------------------------
H8KN20_SOLCM/15-113----------------DVII.H---GIQEKK-------------------------------------------------
F6AEU5_PSEF1/13-109----------------KVAI.A---ALEEIK-------------------------------------------------
A8Y3I6_CAEBR/59-161----------------ETIV.G---ALGEQK-------------------------------------------------
L0KBB8_HALHC/16-107----------------.....A---SAAAKK-------------------------------------------------
F8E7X1_FLESM/8-104----------------RKII.G---LLDDKK-------------------------------------------------
Q3A1E2_PELCD/9-105----------------.LCA.S---YALDKK-------------------------------------------------
D5EEJ0_AMICL/14-107----------------..LL.D---ALADKR-------------------------------------------------
K9XKK1_9CHRO/37-133----------------.AAA.Q---AASDRK-------------------------------------------------
O51725_BORBU/11-108----------------NDLC.K---IISDFN-------------------------------------------------
B0SRU3_LEPBP/13-113----------------KKIK.Q---TLVEKK-------------------------------------------------
J7QF24_METSZ/35-131----------------QKVF.A---SLDETK-------------------------------------------------
R6BA50_9CLOT/8-104----------------RKIV.Q---VMDSKK-------------------------------------------------
D3SLN3_THEAH/7-102----------------.KIK.K---LLEDKK-------------------------------------------------
Q2GLC3_ANAPZ/10-104----------------DLVV.A---VLDEHS-------------------------------------------------
F2N7T7_CORGP/47-144----------------RVAA.Q---AAFDKK-------------------------------------------------
Q7VJ93_HELHP/11-105----------------ERIT.T---LLADKK-------------------------------------------------
A8LKJ3_DINSH/8-103----------------.LTL.T---SLDQDK-------------------------------------------------
U5QDK7_9CYAN/13-109----------------.AAV.R---AADDKK-------------------------------------------------
R5CBV8_9BACE/9-107----------------EQIT.E---GIQDKK-------------------------------------------------
U3K4T0_FICAL/9-108----------------DLVV.A---LLRQEN-------------------------------------------------
D2VAH7_NAEGR/112-210----------------EEVC.D---LLDKNF-------------------------------------------------
B3EK36_CHLPB/27-123----------------KRAA.E---LSLERK-------------------------------------------------
D8LM97_ECTSI/43-138----------------.TAV.K---AADERK-------------------------------------------------
K9WGD2_9CYAN/28-124----------------.TIA.E---AADDRK-------------------------------------------------
F2NRK4_TRES6/11-108----------------.EIA.K---LMEDGK-------------------------------------------------
G4Q705_ACIIR/8-105----------------NAIA.A---AAADKK-------------------------------------------------
C5BNN1_TERTT/7-103----------------KVVI.N---ALEDLK-------------------------------------------------
J9Z794_LEPFM/48-141----------------EQMA.R---FLQEKK-------------------------------------------------
R7KVA5_9FIRM/8-104----------------ELIV.K---TLDSKK-------------------------------------------------
F2JQX0_CELLD/10-106----------------KQIA.T---AINNKK-------------------------------------------------
A3LQS7_PICST/33-171----------------EEFL.K---LVAEEY-------------------------------------------------
R6GPR7_9CLOT/8-100----------------QKCE.E---FLENKK-------------------------------------------------
C7R7J9_KANKD/8-104----------------DLVV.D---QLEGSK-------------------------------------------------
Q0ABM8_ALKEH/14-109----------------.LLR.E---ALEDIK-------------------------------------------------
R7GK75_9CLOT/203-298----------------EVVL.K---ALSKVN-------------------------------------------------
W0J190_9BACT/16-112----------------RNVV.I---ALADKK-------------------------------------------------
R7HV95_9CLOT/13-109----------------KIAY.H---ALDEKK-------------------------------------------------
T2GFT8_DESGI/18-114----------------RLLA.A---RLHDKQ-------------------------------------------------
R6UIY6_9FIRM/6-102----------------SIVQ.K---AIDEKK-------------------------------------------------
K9RW58_SYNP3/23-119----------------.AVA.E---AADDRK-------------------------------------------------
R6VTB1_9FIRM/16-113----------------EEIR.A---VLDEKK-------------------------------------------------
N0B789_9RHIZ/47-143----------------EDVV.H---WLDDAK-------------------------------------------------
W0DX52_9GAMM/8-104----------------ELVT.K---TLDDGK-------------------------------------------------
Q24SP4_DESHY/10-104----------------..AV.N---LVEDKK-------------------------------------------------
U6GU24_EIMAC/436-549----------------EEFM.S---LLAQEG-------------------------------------------------
T0VFU6_9STRE/8-104----------------ELVV.K---AADEKR-------------------------------------------------
G8BC02_CANPC/81-218----------------..LV.E---LLVKKY-------------------------------------------------
A9KMF1_CLOPH/10-106----------------RLAF.K---ALEDKK-------------------------------------------------
B8IY74_DESDA/31-127----------------ADVA.Q---WLEEHK-------------------------------------------------
F2I3K1_PELSM/11-107----------------SIIK.K---ILDDNK-------------------------------------------------
R6S9M8_9FIRM/7-102----------------DLVK.K---MIDEKK-------------------------------------------------
G8PDQ2_PEDCP/8-104----------------EMVV.K---AADNKR-------------------------------------------------
A0LCY9_MAGMM/19-115----------------HTIQ.A---KLDDKK-------------------------------------------------
R7XYP9_9ACTN/12-108----------------QIAA.L---AAADKI-------------------------------------------------
C6BY18_DESAD/18-114----------------QLVA.E---WLDEKQ-------------------------------------------------
A5WCA7_PSYWF/21-117----------------NMVQ.E---TLDDLK-------------------------------------------------
R6ZB75_9CLOT/9-105----------------KLAV.K---ALEDKK-------------------------------------------------
X2GYY9_9BACI/7-103----------------QAAY.K---AIDDKH-------------------------------------------------
A0A068X2K5_HYMMI/99-199----------------.EIV.Q---FLRAER-------------------------------------------------
Q5M321_STRT2/8-104----------------ELVV.K---AADEKR-------------------------------------------------
K9W317_9CYAN/28-124----------------.LAA.E---AADDRK-------------------------------------------------
C9RAT7_AMMDK/8-104----------------DLVI.E---AAQEKK-------------------------------------------------
Q31RX3_SYNE7/23-118----------------..AA.T---AADDRK-------------------------------------------------
E2ABW0_CAMFO/117-216----------------EDLV.A---LLEGDK-------------------------------------------------
B7ZSU4_XENTR/104-203----------------NTLV.S---LLRQEN-------------------------------------------------
E6S731_INTC7/12-108----------------KAAA.D---AAEEKI-------------------------------------------------
J9RNQ7_9ACTN/12-108----------------KVAA.L---AAAEKL-------------------------------------------------
Q74ID2_LACJO/14-110----------------DLTV.E---AIDERH-------------------------------------------------
R5PG49_9CLOT/8-104----------------RTIV.K---ALDDKK-------------------------------------------------
C3M9Y3_RHISN/41-137----------------KLVL.E---SLEDSK-------------------------------------------------
K9RB59_9CYAN/38-135----------------STIA.E---AGLDRK-------------------------------------------------
Q4Y4A2_PLACH/249-351----------------EQVV.S---ILKHEK-------------------------------------------------
R5SL59_9FIRM/6-102----------------ELIC.E---ALSNKK-------------------------------------------------
A9NGN0_ACHLI/5-95----------------QQTI.E---ILEKIN-------------------------------------------------
I3YSI4_AEQSU/13-111----------------AEII.R---GIEDVK-------------------------------------------------
R5VE54_9BACE/9-107----------------EKII.E---GIQEKK-------------------------------------------------
F7QH28_9BRAD/22-118----------------SLIL.S---RLDDMK-------------------------------------------------
D3PE18_DEFDS/5-102----------------KLIY.N---VLDDKK-------------------------------------------------
Q3J7T3_NITOC/8-104----------------EFVV.S---ALEALK-------------------------------------------------
R5K9K4_9CLOT/9-105----------------AIVY.K---ALDDKK-------------------------------------------------
O67309_AQUAE/5-101----------------KLIK.E---LLENKK-------------------------------------------------
E2C2S6_HARSA/121-220----------------EDLV.T---LLELNK-------------------------------------------------
ATP25_LACTC/125-266----------------ETIA.T---FLRDKL-------------------------------------------------
Q3ANY6_CHLCH/23-120----------------QRIA.E---LALEKK-------------------------------------------------
R7JTP2_9FIRM/9-105----------------KLAL.E---ALEDKK-------------------------------------------------
D9R139_CLOSW/9-105----------------KTAY.A---ALSDKK-------------------------------------------------
E3F1H1_KETVY/62-158----------------DAVM.A---SLDDDK-------------------------------------------------
I2H8T5_TETBL/114-252----------------.EIC.K---YLDEKL-------------------------------------------------
C4LJT9_CORK4/12-108----------------QIAA.R---AASDKI-------------------------------------------------
B7JXB1_CYAP8/32-128----------------.AIA.Q---AADDRK-------------------------------------------------
B0RDF7_CLAMS/12-108----------------KVAA.S---AADSKQ-------------------------------------------------
X5DNJ2_9CORY/13-108----------------.IAA.R---AASERL-------------------------------------------------
B2IKW2_BEII9/21-117----------------RTVL.T---SLEDSK-------------------------------------------------
Q9CJS0_PASMU/6-102----------------DFII.D---KLDDLK-------------------------------------------------
E2SB72_9ACTN/12-108----------------RAAA.A---AADDKS-------------------------------------------------
Q10VW4_TRIEI/29-126----------------STIV.N---AALDRK-------------------------------------------------
A6WDM3_KINRD/18-114----------------TTAA.A---AAVDKL-------------------------------------------------
I4A2C0_ORNRL/11-109----------------DSVV.L---GIEDLK-------------------------------------------------
I2EQ24_EMTOG/14-112----------------RLVV.H---GMLEKK-------------------------------------------------
S5XVR4_PARAH/2-98----------------ERVL.A---SLDDDK-------------------------------------------------
E1SSX4_FERBD/9-104----------------.FAV.D---KVDDLK-------------------------------------------------
D5AKK2_RHOCB/55-151----------------ALVL.S---SLDDDK-------------------------------------------------
F0SS65_RUBBR/56-150----------------..CA.K---TADELK-------------------------------------------------
R5X7F3_9CLOT/8-104----------------KVAY.D---AIDDKL-------------------------------------------------
E1R019_OLSUV/10-107----------------KAAA.V---AADDKK-------------------------------------------------
D5SVA3_PLAL2/30-124----------------..CA.R---LAEEFR-------------------------------------------------
R6GP78_9FIRM/10-106----------------.MAA.R---ALSDKK-------------------------------------------------
R6XQE4_9FIRM/9-105----------------RIAY.E---ALADKK-------------------------------------------------
B7KCB2_CYAP7/31-128----------------RTIL.T---AADDRK-------------------------------------------------
B9E6Y1_MACCJ/11-107----------------ELAF.N---ACDNKR-------------------------------------------------
R5GKV6_9FIRM/8-104----------------EIAV.K---ALDSRK-------------------------------------------------
A0RQT7_CAMFF/6-99----------------EKIT.R---LLDEKK-------------------------------------------------
A8F8G2_PSELT/2-95----------------...L.Q---LMNEKE-------------------------------------------------
Q9WXZ4_THEMA/6-102----------------RKIL.K---KISEKG-------------------------------------------------
R6QEW5_9FIRM/9-105----------------KIAY.Q---ALEEKL-------------------------------------------------
F8C4U4_THEGP/8-104----------------KIIV.D---LLESKK-------------------------------------------------
I4DAU1_DESAJ/9-106----------------TEVI.H---LAEDKK-------------------------------------------------
F4EZF2_SELS3/10-107----------------RAIA.R---AASDKK-------------------------------------------------
R6EX51_9BACT/10-108----------------ETIT.K---GIQEKK-------------------------------------------------
C7Q898_CATAD/13-108----------------.AAA.Q---AASDKV-------------------------------------------------
Q31IE2_THICR/10-105----------------.LIV.S---TLEDSK-------------------------------------------------
B0C3C4_ACAM1/29-124----------------..LA.E---AADDRK-------------------------------------------------
R5GV36_9BACT/9-107----------------QAII.E---GIQEKK-------------------------------------------------
Q2RV08_RHORT/3-98----------------EIVE.T---ALDEDK-------------------------------------------------
I0DX27_PROSM/8-104----------------QFII.N---QLDDAK-------------------------------------------------
R5FJ79_9ACTN/20-115----------------..AA.R---AADERK-------------------------------------------------
F7V655_CLOSS/202-298----------------SVAC.A---ALEEKK-------------------------------------------------
IOJAM_ARATH/49-148----------------.EVE.K---ILADVK-------------------------------------------------
E1R6B7_SPISS/8-103----------------..LA.E---EISSHK-------------------------------------------------
D1AUY8_STRM9/6-98----------------KLVV.D---VIEDKK-------------------------------------------------
W5W1D7_9PSEU/13-108----------------.VAA.A---AAADKK-------------------------------------------------
F2JXD4_MARM1/8-105----------------SHAV.E---ALEDVK-------------------------------------------------
R5Q0E4_9PROT/67-162----------------ELIE.K---TLSAGK-------------------------------------------------
A1BJS1_CHLPD/26-122----------------RRIA.E---LSLEKK-------------------------------------------------
F9Z618_ODOSD/9-107----------------NKII.E---ALEDNK-------------------------------------------------
B5YGK3_THEYD/10-104----------------..TA.E---FLHDKK-------------------------------------------------
D6ZGB4_MOBCV/15-108----------------...G.Q---AAKSKK-------------------------------------------------
Q2SA29_HAHCH/8-104----------------EIVI.K---ALEDIK-------------------------------------------------
C7R5L6_JONDD/13-108----------------.TAA.R---AASDKK-------------------------------------------------
R5YKL7_9FIRM/8-104----------------KTAV.A---ALEDKK-------------------------------------------------
C1FH80_MICSR/4-102----------------.QLA.T---LADETR-------------------------------------------------
C4XU12_DESMR/17-113----------------AQVA.A---WLYEKK-------------------------------------------------
ATP25_CANAL/82-221----------------QEFV.T---LLTVEY-------------------------------------------------
R7F936_9CLOT/7-103----------------NKIV.K---ILDEKK-------------------------------------------------
Q1H3S4_METFK/10-105----------------.AVV.D---ALEDIK-------------------------------------------------
E4TS81_MARTH/27-125----------------NIVV.K---GMQERK-------------------------------------------------
C5X4I8_SORBI/118-211----------------..LA.K---AASEIK-------------------------------------------------
B1XIK5_SYNP2/18-114----------------.DIA.A---AADDRK-------------------------------------------------
Q8RBA1_CALS4/10-105----------------.KIC.R---VLDEKK-------------------------------------------------
Q87RQ3_VIBPA/9-104----------------.FLA.D---KADDMK-------------------------------------------------
E8R1R1_ISOPI/52-148----------------RLCA.R---LAADNR-------------------------------------------------
Q3AF31_CARHZ/10-106----------------NIAM.D---AALDKK-------------------------------------------------
A3I392_9BACT/8-106----------------KVII.N---GMEEKK-------------------------------------------------
Q7VC47_PROMA/8-105----------------ELAA.K---AADDLK-------------------------------------------------
R5HDA5_9FIRM/9-104----------------.LLA.Q---ALDSKK-------------------------------------------------
F2IFG0_FLUTR/25-123----------------DAII.E---GMQENK-------------------------------------------------
Q8F6E4_LEPIN/16-115----------------RIIR.D---IMTDKK-------------------------------------------------
C3YER5_BRAFL/19-118----------------DELV.E---ELRGEN-------------------------------------------------
E4WVJ5_OIKDI/92-192----------------EKVV.D---LLKQEA-------------------------------------------------
R5IZX4_9FIRM/10-105----------------KI.Y.D---AIDDKI-------------------------------------------------
I6X5U0_PROPF/12-109----------------TIAA.E---AAAGKL-------------------------------------------------
I0IB03_PHYMF/45-140----------------.EAA.T---LAHDRR-------------------------------------------------
A1AV34_PELPD/21-115----------------.RCA.E---LASDKK-------------------------------------------------
B6ITL0_RHOCS/33-127----------------.LVL.Q---SLDGDK-------------------------------------------------
E8WVY3_GRATM/12-108----------------.AAA.A---ACEDKK-------------------------------------------------
A4G2M3_HERAR/8-104----------------ALVI.D---ALEDVK-------------------------------------------------
R5SG81_9BACE/7-105----------------KVIT.D---AMLEKK-------------------------------------------------
V5WI46_9SPIO/20-117----------------KNTA.R---FMDEIK-------------------------------------------------
D7GCX0_PROFC/12-108----------------RVAA.E---AALGKL-------------------------------------------------
D5EVB2_PRER2/6-104----------------ETIK.D---AIQEKK-------------------------------------------------
F8ADL0_THEID/24-120----------------RLMA.Q---LALNKK-------------------------------------------------
Q9CIX8_LACLA/8-105----------------EVVV.K---AADDKK-------------------------------------------------
Q4FV91_PSYA2/15-111----------------TLVE.N---ALDDMK-------------------------------------------------
A7HJX7_FERNB/2-95----------------...I.K---LLEKKE-------------------------------------------------
G8XAX0_FLACA/13-111----------------ANII.K---GIEDVK-------------------------------------------------
R5MJL8_9FIRM/8-103----------------KLTV.E---TLDRKK-------------------------------------------------
Q3B6P4_CHLL7/26-122----------------RRAA.E---LTLEKK-------------------------------------------------
A0CFH5_PARTE/123-260----------------..LI.S---FLEINQ-------------------------------------------------
D3SCP4_THISK/8-104----------------ELVT.T---ALEDIK-------------------------------------------------
R6PRZ7_9FIRM/13-109----------------KVAY.K---ALEDKF-------------------------------------------------
K9VMY5_9CYAN/30-127----------------VTVA.Q---AAEDRK-------------------------------------------------
D4KXG1_9FIRM/8-104----------------KIAV.K---ALEDKK-------------------------------------------------
R5L7P0_9SPIR/27-124----------------.KAA.K---ILDDKK-------------------------------------------------
ATP25_DEBHA/109-247----------------NTFL.E---LLSNEY-------------------------------------------------
R5SKZ4_9CLOT/9-105----------------KIVY.E---ALDEKK-------------------------------------------------
E1VB18_HALED/20-116----------------TLVM.D---ALEELK-------------------------------------------------
B2A6C1_NATTJ/9-106----------------KNIA.K---KLDDKK-------------------------------------------------
I3TPX1_TISMK/24-120----------------DLVR.A---SLDDDK-------------------------------------------------
A1WYZ2_HALHL/9-105----------------.RIR.E---SLDAIK-------------------------------------------------
R7I4F9_9BURK/8-104----------------RIIV.D---ALVEIK-------------------------------------------------
Q6LN95_PHOPR/8-104----------------DLIV.D---KVDDLK-------------------------------------------------
C8WQ80_ALIAD/10-106----------------RRAA.T---ACLDKK-------------------------------------------------
R7N5Q1_9FIRM/15-110----------------.LAI.E---ALEDKK-------------------------------------------------
R6LSF0_9CLOT/9-105----------------KIAY.N---ALDEKK-------------------------------------------------
I1ITD6_BRADI/41-146----------------SEVE.K---VLRDVR-------------------------------------------------
D1AZJ0_SULD5/185-278----------------EKIV.T---ALSDKK-------------------------------------------------
M0TAY3_MUSAM/51-152----------------KEVE.K---ILGDVK-------------------------------------------------
D8PC97_9BACT/12-107----------------.AVA.S---AILDKK-------------------------------------------------
A6TQK2_ALKMQ/10-106----------------KNIV.K---AIDDKL-------------------------------------------------
I3MWU9_ICTTR/40-139----------------DMLV.S---LLRQEN-------------------------------------------------
A4SWG8_POLSQ/8-104----------------RVII.D---ALEDVK-------------------------------------------------
Q7MS87_WOLSU/155-248----------------QEIV.E---ILDSKK-------------------------------------------------
D7CP02_SYNLT/8-104----------------KRIA.D---VASEEK-------------------------------------------------
R6ERE3_9FIRM/11-104----------------...G.K---VLSDKK-------------------------------------------------
C6XL35_HIRBI/12-108----------------QMIL.D---RLDDDK-------------------------------------------------
I1BWL4_RHIO9/123-222----------------ESLR.D---LLVESK-------------------------------------------------
G1X0K2_ARTOA/334-462----------------...L.N---YLIKEL-------------------------------------------------
K9SQI6_9SYNE/18-112----------------...A.L---AADDRK-------------------------------------------------
B2KD55_ELUMP/10-104----------------..TA.R---YADEKK-------------------------------------------------
I0AM81_IGNAJ/8-104----------------EKIA.N---LVFNKK-------------------------------------------------
ATP25_VANPO/109-251----------------.SII.E---MLKTEL-------------------------------------------------
M1C016_SOLTU/116-211----------------MAVA.K---VASDVK-------------------------------------------------
R5QB53_9BURK/8-104----------------QTII.N---ALEDVK-------------------------------------------------
L0ES52_LIBCB/10-105----------------DAVI.K---SLENSK-------------------------------------------------
Q1QQT5_NITHX/14-110----------------KLVL.S---RLEDMK-------------------------------------------------
B1VGL5_CORU7/24-120----------------SLAA.Q---AADEKK-------------------------------------------------
R7MR88_9FIRM/8-104----------------EKIV.R---TLDSKR-------------------------------------------------
ATP25_CANGA/122-262----------------HILV.K---HLQKQL-------------------------------------------------
R7NQG0_9FIRM/8-104----------------HLIA.K---ALSSKK-------------------------------------------------
R7K4Z6_9CLOT/10-105----------------.TAY.E---ALDEKK-------------------------------------------------
G8UKS2_TANFA/9-107----------------NAVV.K---GLQEKK-------------------------------------------------
B8ENA7_METSB/40-135----------------RTIL.T---ALDDAK-------------------------------------------------
F6GD04_LACS5/13-111----------------TTII.S---GIEDVK-------------------------------------------------
R6HRJ9_9PROT/15-110----------------EIIE.K---TLDDNK-------------------------------------------------
D1BA22_THEAS/33-122----------------......---.LMDKH-------------------------------------------------
C7PFY2_CHIPD/25-123----------------STII.K---AIQEKK-------------------------------------------------
Q0BRE4_GRABC/97-192----------------.VII.E---SLEDDK-------------------------------------------------
R5IBC6_9PORP/9-107----------------TKIV.E---GIQEKK-------------------------------------------------
H2AMA4_KAZAF/78-205----------------RDIC.K---FLQDDL-------------------------------------------------
A7IH11_XANP2/41-137----------------ALVT.A---RLEDDK-------------------------------------------------
H6LK21_ACEWD/11-107----------------QKIK.E---WIDNKN-------------------------------------------------
E4T8D0_PALPW/9-107----------------NKIV.E---GIQERK-------------------------------------------------
D9S2B0_THEOJ/12-106----------------..TA.K---ILSDKK-------------------------------------------------
R6PP02_9FIRM/8-104----------------KIAQ.A---ALDDKL-------------------------------------------------
R6UG98_9CLOT/8-104----------------KLAA.K---ALSAKK-------------------------------------------------
V5SFF4_9RHIZ/29-125----------------KQVV.H---WIDEAK-------------------------------------------------
D7B3J7_NOCDD/12-109----------------RVAA.E---AASDKL-------------------------------------------------
F6IFE3_9SPHN/10-106----------------ALVL.Q---SLDDDQ-------------------------------------------------
R5EVV3_9FIRM/10-105----------------.EVT.K---ALDAKK-------------------------------------------------
K9YL55_CYASC/31-127----------------.IIA.D---AADDRK-------------------------------------------------
H3GI95_PHYRM/159-258----------------DEVM.E---ALEKEK-------------------------------------------------
F7BHS5_ORNAN/46-145----------------DMVV.S---LLRQEN-------------------------------------------------
C1A7N4_GEMAT/16-110----------------..AA.A---LASELK-------------------------------------------------
F4NTG8_BATDJ/276-378----------------SHVL.K---VIADER-------------------------------------------------
F8KZF8_PARAV/10-105----------------NVIA.Q---AIFDKK-------------------------------------------------
D0MDZ8_RHOM4/26-123----------------RHAV.D---AALDKK-------------------------------------------------
D9QV64_ACEAZ/9-106----------------ELIA.E---TADDKK-------------------------------------------------
ATP25_SCHPO/93-216----------------..VL.N---LLKKKY-------------------------------------------------
E6X7D5_CELAD/13-111----------------SFIL.E---GIEEVK-------------------------------------------------
A8EWM1_ARCB4/6-99----------------EDIK.T---ILSDKK-------------------------------------------------
W0EUD9_9PORP/8-106----------------ETIV.E---GIQEKK-------------------------------------------------
Q9HX22_PSEAE/8-104----------------QVAI.D---ALEDLK-------------------------------------------------
B3E3Q9_GEOLS/19-113----------------.RCA.E---LASDKK-------------------------------------------------
C1F5X5_ACIC5/12-108----------------.TAA.A---ICDEKK-------------------------------------------------
F0JEE6_DESDE/18-114----------------RNVA.G---WLDDKQ-------------------------------------------------
K0B0C3_CLOA9/6-102----------------SIIV.K---AGDDKK-------------------------------------------------
D3FXJ1_BACPE/8-104----------------TLAI.N---AIDDKR-------------------------------------------------
F2J6T6_POLGS/21-117----------------DTVL.A---SLDESK-------------------------------------------------
R7ESF0_9FIRM/20-117----------------EEIY.H---VLDAHR-------------------------------------------------
B9KGM7_ANAMF/15-109----------------DSVV.A---VLDEHS-------------------------------------------------
R5E2B8_9FIRM/11-107----------------KAAI.E---AMKDKK-------------------------------------------------
Q98EZ9_RHILO/18-114----------------NTVL.A---SLEDSK-------------------------------------------------
G8PNV7_PSEUV/27-123----------------ALIL.N---SLEDSK-------------------------------------------------
R5CEC3_9FIRM/12-108----------------KLAL.E---ALEDKK-------------------------------------------------
N0B340_9BACI/8-104----------------KTVV.K---AADDKR-------------------------------------------------
E8SIE5_STAPH/9-104----------------.LTV.E---AADAKK-------------------------------------------------
D8LLX7_ECTSI/95-196----------------DEVV.K---AVEAQG-------------------------------------------------
R6R4Z7_9CLOT/8-104----------------KMAV.K---ALDSKK-------------------------------------------------
Q2YC52_NITMU/8-104----------------KTVV.A---ALDEIK-------------------------------------------------
Q2IMF9_ANADE/3-97----------------..IA.A---AALDKK-------------------------------------------------
R7G449_9PROT/8-104----------------QLIC.D---TLVAKK-------------------------------------------------
F4LVY7_TEPAE/11-106----------------.EAA.G---ILKDKK-------------------------------------------------
A6L1N1_BACV8/9-107----------------KKIT.E---GIQEKK-------------------------------------------------
R5RZ49_9FIRM/10-105----------------.AAA.K---ALDSKK-------------------------------------------------
R7C9H6_9CLOT/10-106----------------QIVY.D---ALDEKL-------------------------------------------------
Q5WHH8_BACSK/6-102----------------KMAV.A---ALDDKK-------------------------------------------------
Q6AJX9_DESPS/18-114----------------EICA.Q---IALDNK-------------------------------------------------
I4AHE2_FLELS/14-112----------------QAVV.A---GLQDRK-------------------------------------------------
R7BM01_9FIRM/8-104----------------QIIY.N---ALDDKK-------------------------------------------------
L0G1E7_ECHVK/8-106----------------KIIV.K---GMEDKK-------------------------------------------------
W5KWU5_ASTMX/92-191----------------DLLV.S---LLRQEN-------------------------------------------------
I7F098_PHAIB/14-110----------------ARVL.S---SLNDDK-------------------------------------------------
I0JP65_HALH3/8-104----------------TIAA.Q---ACDEKR-------------------------------------------------
W1PUX9_AMBTC/52-153----------------EEVK.K---VLSDLR-------------------------------------------------
R7AP40_9CLOT/8-104----------------KLAV.K---ALEDKK-------------------------------------------------
D3F9N1_CONWI/13-110----------------AAIA.E---YADDRK-------------------------------------------------
Q46LB2_PROMT/8-105----------------ELAA.V---ACDDRK-------------------------------------------------
R6PCX2_9CLOT/9-105----------------KIAC.A---ALADKK-------------------------------------------------
ATP25_KLULA/73-205----------------ETIS.K---YLNDKL-------------------------------------------------
G8LV07_CLOCD/8-104----------------EKIV.E---ILNDKK-------------------------------------------------
C8WAH7_ATOPD/10-107----------------KTAA.I---AADQKK-------------------------------------------------
R6XRX2_9FIRM/7-99----------------EILN.K---AVVK..-------------------------------------------------
B8FMU2_DESAA/13-106----------------...F.D---ALGQRK-------------------------------------------------
R6VXF1_9BACT/3-101----------------ETIT.E---GIQEKK-------------------------------------------------
E1QJM4_DESB2/22-118----------------KLCA.A---AALQKK-------------------------------------------------
A5UYA6_ROSS1/19-115----------------RRAV.T---LAEDKQ-------------------------------------------------
E3MG32_CAERE/60-163----------------.NVV.G---ALTKQR-------------------------------------------------
R7FMH5_9CLOT/6-100----------------KKLG.K---KLADMK-------------------------------------------------
H2J515_MARPK/14-110----------------KKIY.K---VIDEKD-------------------------------------------------
E6SKC0_THEM7/9-104----------------.AIA.R---AAEAKK-------------------------------------------------
B3PKN0_CELJU/18-114----------------QAII.N---ALEDLK-------------------------------------------------
A4S573_OSTLU/206-310----------------.ELV.Q---LLVRAR-------------------------------------------------
C6W7P7_DYAFD/16-114----------------ELVV.K---GMTEKK-------------------------------------------------
R6I0A5_9FIRM/9-105----------------KIAA.K---ALSDKK-------------------------------------------------
Q03VE9_LEUMM/13-109----------------NTAV.E---AVDNKK-------------------------------------------------
Q310U3_DESAG/19-115----------------QRLA.A---LLNDKK-------------------------------------------------
R6W6Y8_9BACT/9-107----------------ETIV.K---GIQEKK-------------------------------------------------
Q30PQ1_SULDN/6-98----------------EKIT.D---VLDKNK-------------------------------------------------
R5CLL0_9BACT/9-107----------------ETIT.K---GIQEKK-------------------------------------------------
F0NZC4_WEEVC/12-110----------------DSIV.D---GISKVK-------------------------------------------------
K9S5F4_9CYAN/37-134----------------KTIV.E---AAEDRK-------------------------------------------------
C9R6R0_AGGAD/5-101----------------DFVV.N---KLDNLK-------------------------------------------------
R5HU75_9FIRM/12-108----------------QIAC.K---AIDDKK-------------------------------------------------
R5Q081_9FIRM/19-115----------------REIV.K---ILDDRK-------------------------------------------------
R5FP90_9FIRM/5-101----------------KYAI.E---ALKDVN-------------------------------------------------
A3DEU1_CLOTH/8-104----------------EKIV.S---ILEEKK-------------------------------------------------
Q1G9B8_LACDA/8-104----------------DLVL.N---AISERH-------------------------------------------------
A4VR05_PSEU5/8-104----------------QLAV.A---ALEDLK-------------------------------------------------
H8MPB9_CORCM/74-172----------------RRIG.N---LLLDKK-------------------------------------------------
Q0AKW8_MARMM/39-134----------------.LIL.D---SLDDDK-------------------------------------------------
U5T5I4_9GAMM/14-109----------------.CVV.T---ALDDLK-------------------------------------------------
F0S0T6_DESTD/8-104----------------KIAL.K---AALDKK-------------------------------------------------
O25960_HELPY/6-100----------------ETIT.A---LLDEKK-------------------------------------------------
M9R1R3_9RHOB/46-142----------------AAVL.K---SLDDDK-------------------------------------------------
F5YJG7_TREPZ/15-111----------------..LA.A---LIRDHR-------------------------------------------------
R6DEK3_9CLOT/9-105----------------KTAY.L---ALDEKK-------------------------------------------------
Q65H38_BACLD/8-104----------------KIAA.E---ACDDKR-------------------------------------------------
R7FAW8_9FIRM/8-105----------------EVIV.K---ALDSKR-------------------------------------------------
F3Z458_DESAF/57-153----------------KTVA.T---WLRDKK-------------------------------------------------
D3PVY5_STANL/13-109----------------.AAA.Q---AAADKK-------------------------------------------------
I2F216_9BACT/14-110----------------KEIA.E---IIDEKL-------------------------------------------------
Q2RKZ2_MOOTA/8-104----------------QLAA.Q---AVLEKK-------------------------------------------------
S5RPA2_9PROT/9-104----------------.MVI.K---ILKDIK-------------------------------------------------
R5PUQ2_9BACT/9-107----------------DTIT.R---AIQEKK-------------------------------------------------
H1YG85_9SPHI/15-113----------------ELAV.H---GIQEKK-------------------------------------------------
R6G428_9FIRM/10-105----------------.LAV.E---ALEDKK-------------------------------------------------
D7BPC9_ARCHD/13-109----------------.IAA.R---AAADVK-------------------------------------------------
K9P3M8_CYAGP/9-105----------------.LAA.E---ACDDRK-------------------------------------------------
B0JP67_MICAN/22-119----------------ETIV.T---AAEDKK-------------------------------------------------
Q03RL2_LACBA/8-104----------------EIAV.K---AAENKR-------------------------------------------------
H0UKA1_9BACT/11-106----------------NAIV.S---ALEDKK-------------------------------------------------
K4LK74_THEPS/10-105----------------.SAA.Q---AAARKK-------------------------------------------------
D6ZEV6_SEGRD/12-108----------------RVAA.A---AAEDKL-------------------------------------------------
K9Z2B7_CYAAP/30-126----------------.MIA.E---AADDRK-------------------------------------------------
D4KFF0_9FIRM/10-106----------------QLIA.K---AASDKK-------------------------------------------------
R6C1U9_9CLOT/11-107----------------KLAI.K---ALEDKK-------------------------------------------------
E9FU74_DAPPU/58-157----------------EEFV.D---ILSQQK-------------------------------------------------
C7MN28_CRYCD/14-110----------------.IAA.K---AADEKK-------------------------------------------------
M5E773_9GAMM/8-104----------------SLVI.E---ALEDMK-------------------------------------------------
F6ZF75_MONDO/81-180----------------DLLV.S---LLRQEN-------------------------------------------------
R5K116_9CLOT/8-104----------------KLIV.H---SLEEKK-------------------------------------------------
O84774_CHLTR/10-106----------------KVIV.K---AIDNKK-------------------------------------------------
D2PUU4_KRIFD/12-109----------------TAAA.E---AAHDKK-------------------------------------------------
R5B5K2_9FIRM/9-105----------------AVIV.K---ALDAKK-------------------------------------------------
D6YRN1_WADCW/10-106----------------QAIA.Q---AIYDKK-------------------------------------------------
K0J7A3_AMPXN/8-104----------------KYVV.K---AADDKR-------------------------------------------------
Q0P8K9_CAMJE/6-99----------------DLIV.K---ILDEKK-------------------------------------------------
R5DCD6_9FIRM/9-105----------------KIAY.E---ALDEKK-------------------------------------------------
R7CNP0_9FIRM/6-102----------------QTIC.D---ALANKK-------------------------------------------------
D1AAX1_THECD/12-109----------------RIAA.E---AAGDKL-------------------------------------------------
B7Q172_IXOSC/85-184----------------EELV.E---VLRDEK-------------------------------------------------
B8C8G7_THAPS/1-100----------------..IV.H---SADMRK-------------------------------------------------
A5EVS4_DICNV/8-104----------------NLII.N---SLEELK-------------------------------------------------
Q7CW98_AGRFC/55-151----------------ETVL.A---SLEDSK-------------------------------------------------
A7MK38_CROS8/88-183----------------.FVI.D---KIDDLK-------------------------------------------------
F4CD17_SPHS2/15-113----------------EIII.H---GIQEKK-------------------------------------------------
J9R497_RIEAN/12-110----------------DTII.R---AIQDTK-------------------------------------------------
K9UMC3_9CHRO/24-120----------------.LAA.E---AADDRK-------------------------------------------------
Q7V1P0_PROMP/9-105----------------.MAA.K---ACDIKK-------------------------------------------------
R5ALT6_9BACT/11-109----------------DCIT.E---SIRDRK-------------------------------------------------
R5QK94_9FIRM/9-105----------------RIAY.D---ALNEKK-------------------------------------------------
Q38VU1_LACSS/8-104----------------KIAV.K---AADGKR-------------------------------------------------
H9UK90_SPIAZ/16-113----------------TEAA.E---KIAEQA-------------------------------------------------
G2TNI2_BACCO/8-104----------------KTVV.K---ACDDKR-------------------------------------------------
Q6MBT6_PARUW/10-106----------------TEVA.Q---AIYDKK-------------------------------------------------
R6A7V5_9CLOT/34-124----------------......---.LAMDR-------------------------------------------------
L0DJT1_SINAD/58-154----------------RICA.R---IADDNR-------------------------------------------------
B2FPR3_STRMK/26-122----------------ASVR.Q---ATEDLK-------------------------------------------------
A7HT63_PARL1/61-157----------------ALVL.E---SLDEDK-------------------------------------------------
F9VG82_LACGL/8-105----------------ETVV.K---AADDKK-------------------------------------------------
Q2YLI9_BRUA2/7-102----------------.AAL.A---SLENSK-------------------------------------------------
B0VG47_CLOAI/9-104----------------EVII.G---WLKEKK-------------------------------------------------
C6XXK3_PEDHD/15-113----------------EIAV.H---GIQEKK-------------------------------------------------
D9SD71_GALCS/10-105----------------.AVV.A---ALEDIK-------------------------------------------------
B0UVQ4_HISS2/5-101----------------DFLV.S---KLDDLK-------------------------------------------------
Q8XXC1_RALSO/8-104----------------RVIV.D---ALEDVK-------------------------------------------------
U5N9D4_9BURK/23-119----------------RAIV.D---GLESVK-------------------------------------------------
B2GGE5_KOCRD/13-109----------------.AAA.L---AADQKK-------------------------------------------------
R5B495_9CLOT/22-117----------------.MIC.D---ALYNKK-------------------------------------------------
B1YKR7_EXIS2/8-104----------------KLIV.N---AIDDKR-------------------------------------------------
R6Z4U4_9FIRM/8-104----------------RIAY.D---ALDEKL-------------------------------------------------
R7FU76_9FIRM/9-105----------------KIAF.E---ALEDKK-------------------------------------------------
Q2RZI5_SALRD/27-124----------------ARVA.D---AMADKR-------------------------------------------------
G2J1W2_PSEUL/8-104----------------KLAV.E---ALEDVK-------------------------------------------------
B7J9S2_ACIF2/10-105----------------.LAI.S---VLDEHK-------------------------------------------------
R5WGL8_9BACT/6-104----------------GTIV.S---AIEDKK-------------------------------------------------
G2IMP8_9SPHN/35-130----------------.IVL.Q---SLDDDQ-------------------------------------------------
Q087K6_SHEFN/8-104----------------DFVI.D---KVDDLK-------------------------------------------------
IOJAP_SYNY3/32-129----------------WTIA.Q---AAEERK-------------------------------------------------
M4AHS6_XIPMA/111-210----------------DVLI.S---LLRQEN-------------------------------------------------
G8ZLS5_TORDC/62-203----------------ATIT.D---QLKERL-------------------------------------------------
Q6F840_ACIAD/13-109----------------KVVH.D---ALTDVK-------------------------------------------------
A4HIE4_LEIBR/27-122----------------KAIA.D---ILTSLK-------------------------------------------------
C9RLC6_FIBSS/18-111----------------.....G---ILFELR-------------------------------------------------
F5Y7D3_TREAZ/5-100----------------..LG.K---LLEDHK-------------------------------------------------
A9ITN4_BORPD/8-104----------------RAVI.D---ALEDVK-------------------------------------------------
R7LCG4_9BACT/75-171----------------KKCR.D---AMDDKK-------------------------------------------------
B9KZU5_THERP/16-113----------------ARLAAE---TAADAM-------------------------------------------------
R6BS45_9BACT/9-107----------------ETIK.E---GIQEKK-------------------------------------------------
Q22U76_TETTS/206-310----------------EAVI.S---FLELEQ-------------------------------------------------
Q7V7C5_PROMM/12-109----------------EMAA.E---ACDDRK-------------------------------------------------
A6LD24_PARD8/9-107----------------KTIV.E---GLQEKR-------------------------------------------------
V4JHI0_9GAMM/9-105----------------DLIV.E---TLNDMK-------------------------------------------------
R9YKS2_9PROT/5-99----------------KRIL.K---SINGTK-------------------------------------------------
B0TBV4_HELMI/10-106----------------IAIA.E---AAADKK-------------------------------------------------
R7PRI7_9FIRM/6-102----------------KMIC.Q---AISSKK-------------------------------------------------
R6TPV4_9STAP/7-99----------------EILN.K---AVVKK.-------------------------------------------------
R5AYU7_9BACE/9-107----------------KLIT.E---GIQERK-------------------------------------------------
C5CEP8_KOSOT/6-102----------------REIV.K---ILYDKE-------------------------------------------------
G4UJS9_NEUT9/132-292----------------.PLV.K---FVSDEL-------------------------------------------------
G0N093_CAEBE/60-162----------------.SVV.G---ALTEQK-------------------------------------------------
A4J7H3_DESRM/10-106----------------DIAH.Q---AANEKK-------------------------------------------------
G8QZC8_OWEHD/15-113----------------EAIK.D---GMENLK-------------------------------------------------
E8UCD5_TAYEM/8-104----------------RIVV.D---ALEDVK-------------------------------------------------
R7BSA0_9FIRM/8-104----------------DIIC.A---ELDEHK-------------------------------------------------
R7QW75_9FIRM/9-105----------------KLAV.T---ALEEKK-------------------------------------------------
B1WTU4_CYAA5/32-128----------------.TIA.E---AADDRK-------------------------------------------------
F0QZ30_BACSH/9-107----------------EKIT.E---GIQEKK-------------------------------------------------
R5VK80_9CLOT/10-106----------------RTAY.D---ALDEKL-------------------------------------------------
I7HEH2_9HELI/17-111----------------QHIQ.T---LLEDKK-------------------------------------------------
A1A1R8_BIFAA/12-110----------------RIAA.A---AADRMK-------------------------------------------------
ATP25_ASHGO/88-221----------------.NVT.E---YMRDKL-------------------------------------------------
F4KXS4_HALH1/20-117----------------DLIV.D---SIQEIK-------------------------------------------------
A5D414_PELTS/10-106----------------NIAV.K---AAEDKK-------------------------------------------------
R6NC63_9CLOT/8-104----------------KEAA.K---ILDSKK-------------------------------------------------
Q83DY7_COXBU/8-104----------------NLVI.N---TLDEHK-------------------------------------------------
W0BD95_9GAMM/9-105----------------ETLI.A---SLEDIQ-------------------------------------------------
Q6MGS6_BDEBA/227-324----------------EFCA.N---VLFAKK-------------------------------------------------
D3E4X0_GEOS4/10-106----------------NVAV.A---AAEDKK-------------------------------------------------
A6VM71_ACTSZ/7-103----------------KFLT.E---KLDALK-------------------------------------------------
R7A8R3_9FIRM/5-102----------------EIVL.K---AISEKK-------------------------------------------------
F8L9P7_SIMNZ/11-106----------------.ELA.L---TLYKKK-------------------------------------------------
I4B2F1_TURPD/18-115----------------KVLV.A---ALDAKK-------------------------------------------------
C7N5Z8_SLAHD/15-111----------------.IAA.N---AADDKK-------------------------------------------------
C5C3Y0_BEUC1/13-108----------------.EAA.R---AAADKK-------------------------------------------------
C7LNN2_DESBD/6-102----------------EQIV.T---WLSDKK-------------------------------------------------
R4LD67_9ACTN/13-110----------------.TAA.Q---AAADKK-------------------------------------------------
C7MDI1_BRAFD/13-109----------------.VAG.Q---AAADKL-------------------------------------------------
R6ZYM4_9FIRM/13-107----------------..AV.M---ALEDKK-------------------------------------------------
R4FM08_RHOPR/97-195----------------QELV.E---YIKSNK-------------------------------------------------
G0HCC1_CORVD/13-109----------------.IAA.R---AAAEKF-------------------------------------------------
Q1IVS3_KORVE/11-108----------------ALAV.S---AAQEKK-------------------------------------------------
W5XR92_9CORY/12-108----------------ELAA.H---AADEKS-------------------------------------------------
C4LCB5_TOLAT/8-104----------------DFVV.D---KLDDMK-------------------------------------------------
I0GK03_CALEA/17-113----------------NFIV.K---VMEEKK-------------------------------------------------
R6SD79_9CLOT/3-99----------------RLAV.E---ALDEKK-------------------------------------------------
E7AAH6_HELFC/7-101----------------DRIV.E---LLEDKK-------------------------------------------------
C8X2A5_DESRD/21-115----------------..LL.Q---WLEEKQ-------------------------------------------------
Q5ZVR3_LEGPH/9-105----------------EKLL.K---SLEDIQ-------------------------------------------------
F4LQI7_TREBD/10-107----------------.EIA.Q---LMEDGK-------------------------------------------------
D4J3C3_BUTFI/8-104----------------KIVC.K---ALDDKK-------------------------------------------------
K9TF10_9CYAN/32-128----------------.AIA.R---AADDRK-------------------------------------------------
Q3SG63_THIDA/8-104----------------RLVV.A---ALEDIK-------------------------------------------------
R7IGE6_9FIRM/8-104----------------QEAA.Q---ELYKNK-------------------------------------------------
Q82C74_STRAW/12-109----------------NTAA.Q---AAADKL-------------------------------------------------
K9XVN0_STAC7/31-127----------------.KIA.E---AADDKK-------------------------------------------------
K4J0M5_BIFAP/12-109----------------RVAA.R---AANDVK-------------------------------------------------
D3DJ79_HYDTT/6-102----------------KLIR.E---LLESKK-------------------------------------------------
R7KD51_9FIRM/8-105----------------STIC.E---YLSEKK-------------------------------------------------
A1R781_ARTAT/12-108----------------RHAA.R---AAADKL-------------------------------------------------
R7B0J5_9BACE/11-107----------------RIAI.E---ALRDKK-------------------------------------------------
F4A061_MAHA5/12-106----------------..IG.R---MMDDKK-------------------------------------------------
G4VJP1_SCHMA/94-193----------------.ELM.K---ALEREN-------------------------------------------------
R5QVM6_9FIRM/5-101----------------EVII.K---ALDDKL-------------------------------------------------
Q65RG9_MANSM/5-101----------------DFLV.D---KLDALK-------------------------------------------------
W5WX18_9CORY/12-108----------------SVAA.R---AASDKL-------------------------------------------------
Q5NFW4_FRATT/8-104----------------EIVL.E---ALDDLK-------------------------------------------------
Q0AWK2_SYNWW/9-105----------------QAIA.V---YCLDEK-------------------------------------------------
Q54B26_DICDI/464-559----------------DEVM.N---FLATTH-------------------------------------------------
B0WVG4_CULQU/121-219----------------.DLV.T---VLRLNN-------------------------------------------------
R5NV97_9PORP/9-107----------------NKII.E---SLDENK-------------------------------------------------
Q1GDM8_RUEST/15-111----------------ERIL.S---SLDEDK-------------------------------------------------
D2QKI7_SPILD/17-114----------------.FVV.R---GMQEKK-------------------------------------------------
B8F687_HAEPS/7-103----------------QFLT.E---TLEGLK-------------------------------------------------
D8QQ28_SELML/79-179----------------TALA.T---AANEVK-------------------------------------------------
Q9PBG4_XYLFA/35-131----------------STVH.E---AVETLK-------------------------------------------------
D8UJ79_VOLCA/508-659----------------EEIA.T---WLVKAR-------------------------------------------------
A9BGV5_PETMO/11-107----------------KEIV.E---LLEEKD-------------------------------------------------
X5HL15_9RICK/7-99----------------SLIL.E---KLSKHK-------------------------------------------------
I3ZBA9_TERRK/11-108----------------RAAV.D---ACDSKK-------------------------------------------------
C8XF22_NAKMY/12-108----------------TIAA.Q---AAADKK-------------------------------------------------
E4RQ84_LEAB4/12-110----------------DLII.N---GIQEKK-------------------------------------------------
U9U9V9_RHIID/51-151----------------.EII.R---LLEEEG-------------------------------------------------
R6XJJ4_9BACT/7-104----------------RVMA.D---AMLDKK-------------------------------------------------
K4RIG6_HELHE/4-97----------------ARIV.A---MLEEKK-------------------------------------------------
F4B2T6_DOKS4/13-111----------------AKIV.E---GIEDVK-------------------------------------------------
R4KQ58_9FIRM/11-107----------------QLAV.E---AAEGKR-------------------------------------------------
Q0SH66_RHOJR/12-108----------------RIAA.V---AADEKL-------------------------------------------------
R5QJ41_9FIRM/12-107----------------.AAI.D---ALEDKK-------------------------------------------------
W8KVW8_HALHR/8-104----------------QIVT.D---ALEDMK-------------------------------------------------
E6VZ32_DESAO/19-113----------------..LA.E---WLDEKQ-------------------------------------------------
K6YTN0_9ALTE/9-104----------------.FVI.E---KVEDLK-------------------------------------------------
W8UBA1_YEREN/8-104----------------EFVI.D---KLDDLK-------------------------------------------------
R6AXF5_9BACT/9-107----------------NTII.D---GIQEKK-------------------------------------------------
I0IKW0_LEPFC/44-136----------------.AMA.R---FLLDRK-------------------------------------------------
R5FVB9_9FIRM/8-104----------------QKIC.E---ILDFKK-------------------------------------------------
D6S4W0_9LACO/8-104----------------DITL.D---AISDRH-------------------------------------------------
R5U623_9FIRM/9-105----------------RLAY.Q---ALDDKK-------------------------------------------------
F8GJZ3_NITSI/8-104----------------NIVV.D---ALEDIK-------------------------------------------------
A4XKG8_CALS8/6-98----------------.QIV.R---ILSQKK-------------------------------------------------
R7G8T5_9FIRM/5-101----------------DVIK.K---AIDEKK-------------------------------------------------
F4GWP5_PUSST/8-104----------------RLVI.D---ALEDVK-------------------------------------------------
R6QDZ5_9CLOT/11-108----------------SVIA.R---ILDDKL-------------------------------------------------
R5ELM4_9CLOT/8-104----------------KIAI.A---ALDDKK-------------------------------------------------
G7VA32_THELD/10-105----------------SRIV.S---TLIDKQ-------------------------------------------------
E3DMY5_HALPG/12-107----------------.LAA.D---TADDKK-------------------------------------------------
A8MHK3_ALKOO/10-106----------------QKVV.H---CIDDKS-------------------------------------------------
D5V5P9_ARCNC/5-98----------------ETIV.K---VLEDKK-------------------------------------------------
R5YMX1_9FIRM/8-104----------------KIAY.D---ALDDKK-------------------------------------------------
R7HM20_9BACT/8-106----------------NLIV.E---GIQERK-------------------------------------------------
G8QXT8_SPHPG/10-107----------------KTIG.Q---FLEDHK-------------------------------------------------
V5XFV4_MYCNE/12-108----------------SIAA.R---AASDKL-------------------------------------------------
D2NSW1_ROTMD/33-130----------------RIAA.R---AAEEKQ-------------------------------------------------
V8NPE7_OPHHA/602-701----------------DDMV.S---LMRQEN-------------------------------------------------
C1MLU7_MICPC/83-177----------------..LA.V---IADETR-------------------------------------------------
M1P9Z1_DESSD/18-114----------------TICV.K---AALDTK-------------------------------------------------
Q9A2X4_CAUCR/7-102----------------.LIL.D---RLDDDK-------------------------------------------------
B8HKL6_CYAP4/30-126----------------.TIA.H---TADDRK-------------------------------------------------
R5VBQ6_9FIRM/7-103----------------QILI.E---TILDKK-------------------------------------------------
ATP25_CLAL4/96-228----------------.....T---LMACDY-------------------------------------------------
F8I0U6_WEIKK/11-107----------------EVAV.K---AGGQKR-------------------------------------------------
C4KCZ9_THASP/8-104----------------KIVV.A---ALEDIK-------------------------------------------------
ATP25_PICGU/88-224----------------..FL.E---LVAKDY-------------------------------------------------
D4LCT4_RUMC1/8-104----------------EVIV.R---ALDMKR-------------------------------------------------
A8L0S1_FRASN/13-108----------------.AAA.Q---AAADKI-------------------------------------------------
D4IQ57_9BACT/6-104----------------ETIV.S---AIEDKK-------------------------------------------------
R7K5C7_9FIRM/10-106----------------ELAC.K---TLAEKK-------------------------------------------------
B1I5R8_DESAP/10-106----------------EAAV.R---AAGEKR-------------------------------------------------
E9J4J3_SOLIN/121-220----------------EDLV.E---LLEREK-------------------------------------------------
R7P8V8_9BACT/9-107----------------AAIV.E---GIREKK-------------------------------------------------
R7GL65_9FIRM/5-101----------------ECIV.K---AMNDKL-------------------------------------------------
F2I5U3_AERUA/11-107----------------ELIV.K---AADDRL-------------------------------------------------
I3VX60_THESW/11-106----------------.KIL.K---ILDDKK-------------------------------------------------
F0ZWV5_DICPU/383-477----------------EEVS.E---FLGNSH-------------------------------------------------
J7R6P1_KAZNA/88-227----------------RVIG.S---YLTDEL-------------------------------------------------
B2UMY0_AKKM8/11-108----------------RMCA.R---AADDAK-------------------------------------------------
R6XNW3_9FIRM/6-102----------------ELII.D---KLVGIR-------------------------------------------------
I5AQV5_EUBCE/9-105----------------ALAV.A---ALEDKK-------------------------------------------------
IOJAP_TREPA/8-104----------------SAVA.E---ALCDAR-------------------------------------------------
I3Z0Q1_BELBD/8-106----------------KIIV.K---GMEDKK-------------------------------------------------
R7FYP6_9FIRM/22-118----------------RAIA.D---VLDSMK-------------------------------------------------
ATP25_CANTT/82-221----------------SELV.H---LIAEEY-------------------------------------------------
K9T830_9CYAN/33-130----------------ETIA.Q---AADDRK-------------------------------------------------
G4RH05_PELHB/25-121----------------DLIL.A---SLDDAK-------------------------------------------------
F7XVP2_MIDMI/9-104----------------DVIL.N---SLDQDQ-------------------------------------------------
Q2LSS9_SYNAS/2-96----------------..CV.N---AILEKK-------------------------------------------------
Q182L0_PEPD6/8-104----------------KIAY.D---AIEDKL-------------------------------------------------
X4Z9U4_9BACL/10-106----------------RLTL.N---AVEDKK-------------------------------------------------
I6YYA6_MELRP/8-104----------------KKIA.S---IIESKK-------------------------------------------------
K4BYI4_SOLLC/54-155----------------EEVE.A---ILRDVK-------------------------------------------------
F2UAC2_SALR5/139-239----------------EDVV.R---NIFEMK-------------------------------------------------
R5FER8_9BACT/9-107----------------NIIT.R---GIQEKK-------------------------------------------------
J9YZQ7_9PROT/15-111----------------QAIV.N---SLEDNK-------------------------------------------------
I4BW42_ANAMD/16-108----------------....PK---VLASKK-------------------------------------------------
D5V9T6_MORCR/11-107----------------ALVT.T---TLDDLK-------------------------------------------------
Q03GA3_PEDPA/8-104----------------ELLV.K---AADSKR-------------------------------------------------
D5EJ39_CORAD/18-113----------------..CAIT---ALDDKK-------------------------------------------------
G4KSV6_OSCVS/9-104----------------.AAV.R---ALDEKK-------------------------------------------------
Q818D4_BACCR/9-104----------------.LAA.K---AADDKR-------------------------------------------------
R6FXQ7_9FIRM/8-104----------------KIAY.N---ALDEKK-------------------------------------------------
U1NRB0_ASCSU/227-325----------------.ELV.D---ILRAER-------------------------------------------------
Q484R0_COLP3/9-104----------------.FVI.E---KLEDMK-------------------------------------------------
M5A2E2_9ACTN/14-110----------------.LAA.R---KADDRQ-------------------------------------------------
L7VK85_9FLAO/10-105----------------KAIL.N---SIEKIK-------------------------------------------------
F2NNL5_MARHT/12-107----------------RWVH.Q---ALSDKK-------------------------------------------------
E1Z8J3_CHLVA/4-97----------------......---IAWETK-------------------------------------------------
G0WF35_NAUDC/65-189----------------..IT.S---ELQ.KL-------------------------------------------------
R5KVH1_9FIRM/8-104----------------KIAY.N---AIDDKK-------------------------------------------------
A9WUT6_RENSM/16-112----------------RAAA.H---AASEKL-------------------------------------------------
I1YT23_PREI7/9-107----------------ETIV.E---GIQEKK-------------------------------------------------
R7JD55_9FUSO/13-109----------------.VIA.R---ALDEKL-------------------------------------------------
G9WG40_9LACT/8-104----------------ERIV.T---AIDSKK-------------------------------------------------
C7NH29_KYTSD/12-108----------------RTAA.R---AADDKF-------------------------------------------------
R6CH16_9FIRM/8-104----------------KQIC.E---ALADKK-------------------------------------------------
C6X352_FLAB3/12-110----------------DKIV.E---AIQDTK-------------------------------------------------
A4RXN6_OSTLU/16-109----------------...A.V---IADDTR-------------------------------------------------
C7RHK0_ANAPD/5-100----------------ETIL.K---TLNDKL-------------------------------------------------
V9TWB7_9PROT/2-96----------------..VL.E---LLEEDK-------------------------------------------------
B9DTM8_STRU0/8-104----------------EIVV.K---AADEKR-------------------------------------------------
Q6AFX5_LEIXX/14-108----------------..AA.A---AADARS-------------------------------------------------
R6QUB8_9FIRM/8-104----------------KTAY.E---AISDKK-------------------------------------------------
B5YNF2_THAPS/450-581----------------.ELS.T---SLSAQG-------------------------------------------------
D3AY29_POLPA/476-574----------------AEIM.E---VLAETK-------------------------------------------------
I4WTH1_9GAMM/17-113----------------KSVI.D---ALEELK-------------------------------------------------
F5WTA4_ERYRF/6-102----------------DVIV.K---TIDEKK-------------------------------------------------
Q1MPK9_LAWIP/52-145----------------...T.G---WLEEHK-------------------------------------------------
Q5LX03_RUEPO/22-118----------------DRIL.T---SLNDDK-------------------------------------------------
A9TEA2_PHYPA/63-157----------------.ALA.E---AANDVK-------------------------------------------------
D3ICT2_9BACT/9-107----------------ETIV.K---GIQEKK-------------------------------------------------
R6I9I1_9FIRM/8-103----------------NEIV.K---ILDKKK-------------------------------------------------
C3PHZ3_CORA7/12-108----------------ETAA.L---AADEKL-------------------------------------------------
D3HSE6_LEGLN/9-105----------------DKLL.H---LLDDNQ-------------------------------------------------
E6UF33_RUMA7/11-107----------------EIIV.K---ALDSKR-------------------------------------------------
R6WPM6_9CLOT/8-105----------------ERIC.C---LLDEKK-------------------------------------------------
K3X3T5_PYTUL/107-206----------------DEVL.A---ALEKEK-------------------------------------------------
D8K1D9_DEHLB/11-108----------------RRIA.D---LALEKQ-------------------------------------------------
R7DMR6_9FIRM/7-103----------------SAVI.R---AIDDKL-------------------------------------------------
E1VWM4_ARTAR/12-109----------------KVAA.H---AASEKM-------------------------------------------------
D5MJ59_9BACT/30-126----------------QLAV.A---AAFEVK-------------------------------------------------
C5ZXG7_9HELI/10-104----------------KFII.Q---ILEDKK-------------------------------------------------
B3DVR4_METI4/4-101----------------QSCK.K---VILEKK-------------------------------------------------
K0C587_CYCSP/7-103----------------TKVT.E---ALDDKK-------------------------------------------------
H1ZA70_MYROD/13-111----------------ANII.K---GIEAVK-------------------------------------------------
C7JCS4_ACEP3/42-138----------------ALIT.A---SLEDDK-------------------------------------------------
Q1GVM4_SPHAL/25-120----------------.LIL.H---QLDEDQ-------------------------------------------------
R5IE32_9BACT/5-103----------------DIIA.E---AMLEKK-------------------------------------------------
G0S6Z3_CHATD/120-279----------------..LL.K---YVSDEL-------------------------------------------------
B4KZ09_DROMO/104-203----------------EDLV.E---LLRKEN-------------------------------------------------
F3ZSP8_9BACE/11-109----------------NQIV.E---SIQDKK-------------------------------------------------
B3QSE4_CHLT3/45-141----------------RRAA.E---LAFSKK-------------------------------------------------
R5C106_9FIRM/15-109----------------...A.Q---AGFDKK-------------------------------------------------
R6T077_9CLOT/36-132----------------EAIA.E---VLENRK-------------------------------------------------
R6NVN6_9FIRM/10-106----------------KLAY.Q---ALSEKK-------------------------------------------------
H8GJL3_METAL/8-104----------------NVVR.T---VLDDKK-------------------------------------------------
W8T6F3_EUBAC/10-106----------------KTIY.E---SIDDKL-------------------------------------------------
Q82XC6_NITEU/9-105----------------ETAI.M---ALEDLK-------------------------------------------------
A1S8T2_SHEAM/8-104----------------QFVV.D---KIEDLK-------------------------------------------------
B4EV09_PROMH/8-104----------------QFII.D---KLEDSK-------------------------------------------------
M1E8G8_9FIRM/12-107----------------.EII.N---CIKEKQ-------------------------------------------------
A0KN92_AERHH/9-104----------------.FIV.D---KIDDMK-------------------------------------------------
A8ZRY5_DESOH/13-106----------------...L.T---AINGMK-------------------------------------------------
I6S4I9_ENTHA/2-94----------------.....Q---AADSKR-------------------------------------------------
F4WK15_ACREC/124-223----------------DQLV.E---LLERDK-------------------------------------------------
B8CXR9_HALOH/15-110----------------.LAA.E---AAEDKK-------------------------------------------------
D0L1I9_HALNC/40-138----------------DWVV.A---ALEDLK-------------------------------------------------
V6F0E1_9PROT/8-103----------------SLVY.T---SLDDGK-------------------------------------------------
D4MZP3_ANAHA/9-105----------------KIAY.D---ALDDKL-------------------------------------------------
W8RZP4_9RHOB/25-121----------------SRVL.T---SLDDDK-------------------------------------------------
R6NDQ1_9FIRM/8-104----------------RIAC.E---AMEDKK-------------------------------------------------
B9L8C0_NAUPA/5-98----------------AKIK.E---LLEEKK-------------------------------------------------
F7YU42_9THEM/9-105----------------RLLL.K---LMREKE-------------------------------------------------
B8GV08_THISH/8-104----------------ELVI.K---ALEDLK-------------------------------------------------
E7F2E7_DANRE/83-181----------------.LLV.S---ALRQEN-------------------------------------------------
A9T8N1_PHYPA/162-263----------------EEVK.E---ILDKTR-------------------------------------------------
G3AI15_SPAPN/101-235----------------.....H---VVGQEY-------------------------------------------------
X4QTP2_9ACTO/14-109----------------..AA.R---AASAGK-------------------------------------------------
C8W5N8_DESAS/10-106----------------DLII.D---ACEDKK-------------------------------------------------
D0LK39_HALO1/35-131----------------.HVALQ---AALDNK-------------------------------------------------
R6DLX5_9FIRM/12-104----------------.....Q---TLSAKK-------------------------------------------------
S0ET20_CHTCT/14-110----------------RVIA.S---AADSVK-------------------------------------------------
Q5FIX7_LACAC/8-104----------------DFTT.K---AISDRH-------------------------------------------------
ATP25_PHANO/99-265----------------KTIL.E---YISITA-------------------------------------------------
Q038B3_LACC3/9-105----------------EVAV.K---AGDSKR-------------------------------------------------
R6NHF7_9CLOT/9-105----------------REIV.K---VLDEKK-------------------------------------------------
R5YA62_9BACE/9-107----------------QTII.E---GIQEKK-------------------------------------------------
R6M0U4_9FIRM/9-105----------------AIAA.K---ALDSKK-------------------------------------------------
Q9KTF0_VIBCH/10-104----------------..LF.D---KADDMK-------------------------------------------------
D5XBC0_THEPJ/11-106----------------.AAV.R---AAEDKK-------------------------------------------------
ATP25_PICPG/78-215----------------.ELV.K---YFIKDL-------------------------------------------------
G3B8J3_CANTC/85-222----------------.EFL.R---LLAEEY-------------------------------------------------
I0GTD8_SELRL/8-104----------------QAIC.K---AASDKK-------------------------------------------------
F6DLB0_DESRL/10-106----------------DIAY.R---AAEDKK-------------------------------------------------
R7BVC4_9BURK/20-116----------------QLIV.D---ALDDVK-------------------------------------------------
Q2GHB7_EHRCR/18-112----------------ELIV.F---ILDKHK-------------------------------------------------
R7J059_9BACT/9-107----------------QLII.D---GIQERK-------------------------------------------------
IOJAP_HAEIN/5-101----------------EFLM.E---TLDGLK-------------------------------------------------
Q67SC2_SYMTH/5-99----------------..AA.I---AAEGKK-------------------------------------------------
R5ECA2_9BURK/8-104----------------RVIV.N---ALEDVK-------------------------------------------------
R7MJL0_9CLOT/12-108----------------.AVA.Q---FLDDKL-------------------------------------------------
H3AY78_LATCH/158-257----------------DVVV.T---LLRQEN-------------------------------------------------
G3VZZ7_SARHA/11-110----------------NLLV.S---LLRQEN-------------------------------------------------
Q08NZ3_STIAD/68-165----------------HKAA.K---LLADKK-------------------------------------------------
R6ETJ2_9FIRM/10-106----------------KLAV.E---ALDDKK-------------------------------------------------
Q1DCX4_MYXXD/14-112----------------HRIG.N---LLVDKK-------------------------------------------------
D1AKP5_SEBTE/6-98----------------KKAI.E---IIESKK-------------------------------------------------
M1WNH7_DESPC/18-113----------------.LVA.N---WLDEKQ-------------------------------------------------
F6FPQ7_ISOV2/13-108----------------.VAA.R---AASDRK-------------------------------------------------
F2LXZ8_HIPMA/3-95----------------EKLL.K---ILEDKK-------------------------------------------------
Q8KG28_CHLTE/44-140----------------RRVA.E---LSLEKK-------------------------------------------------
A2U334_9FLAO/13-111----------------AVII.K---GIDDVK-------------------------------------------------
L0DYT0_THIND/8-104----------------ELVT.R---ALEDMK-------------------------------------------------
Q87VV8_PSESM/8-104----------------QVAI.A---ALEEVK-------------------------------------------------
A5GSM6_SYNR3/8-104----------------QLAA.E---AADDRK-------------------------------------------------
R6A9P5_9FIRM/6-102----------------QTIC.E---ALSNKK-------------------------------------------------
Q5QYE0_IDILO/8-104----------------EFVI.D---KIDDLK-------------------------------------------------
E3DAG2_GARV3/12-110----------------RIAA.A---AADRLK-------------------------------------------------
D3R1R0_MAGIU/8-105----------------DIIV.N---ILDAKK-------------------------------------------------
L7W7C8_NONDD/13-111----------------AQIV.A---GIEDVK-------------------------------------------------
Q8EPV3_OCEIH/8-104----------------KHVA.E---ACDDKR-------------------------------------------------
B8DU79_BIFA0/12-110----------------RVAA.T---AADGMK-------------------------------------------------
E3IV14_FRASU/13-108----------------.IAA.Q---AAADKL-------------------------------------------------
Q5HNV5_STAEQ/8-104----------------NIAV.E---VAENKK-------------------------------------------------
ATP25_YEAST/105-246----------------RKIA.D---LLTGKL-------------------------------------------------
D2R8D5_PIRSD/24-119----------------..AA.I---AAEENR-------------------------------------------------
I4CCS0_DESTA/15-111----------------ETLL.R---AALSKK-------------------------------------------------
D5WXL5_KYRT2/10-106----------------RLAA.D---AAADKK-------------------------------------------------
E8REX9_DESPD/18-114----------------AVCA.R---VALDTK-------------------------------------------------
Q21WP9_RHOFT/19-115----------------RAIV.D---GLEDVK-------------------------------------------------
R6TTM2_9FIRM/13-109----------------EKIV.T---ILDLHK-------------------------------------------------
L7VM09_CLOSH/8-104----------------DEIV.A---ALEEKK-------------------------------------------------
F0S9I9_PSESL/16-113----------------.AIV.H---GIQEKK-------------------------------------------------
Q1AVU5_RUBXD/25-121----------------ETAA.G---AANAMF-------------------------------------------------

PF03445

Q74E96_GEOSL/70-216--------------------------------------------------------------------------------
Q3SMK2_THIDA/311-451--------------------------------------------------------------------------------
A5FH19_FLAJ1/315-456--------------------------------------------------------------------------------
Q21RX0_RHOFT/287-419--------------------------------------------------------------------------------
Q2IEC2_ANADE/287-421--------------------------------------------------------------------------------
Q72EX4_DESVH/364-509--------------------------------------------------------------------------------
B9M647_GEODF/87-225--------------------------------------------------------------------------------
Q5KZZ8_GEOKA/30-169--------------------------------------------------------------------------------
Q0A740_ALKEH/45-190--------------------------------------------------------------------------------
Q0A741_ALKEH/289-440--------------------------------------------------------------------------------
Q2SC90_HAHCH/335-475--------------------------------------------------------------------------------
B3E878_GEOLS/160-298--------------------------------------------------------------------------------
Q0A6Y9_ALKEH/155-300--------------------------------------------------------------------------------
A6VT54_MARMS/299-436--------------------------------------------------------------------------------
Q5QUI2_IDILO/291-428--------------------------------------------------------------------------------
Q1QZ78_CHRSD/292-424--------------------------------------------------------------------------------
A7II29_XANP2/249-381--------------------------------------------------------------------------------
Q4FUP8_PSYA2/335-467--------------------------------------------------------------------------------
Q315G6_DESAG/341-482--------------------------------------------------------------------------------
B3EBD1_GEOLS/155-293--------------------------------------------------------------------------------
Q0A6Z3_ALKEH/338-481--------------------------------------------------------------------------------
A7HH07_ANADF/294-428--------------------------------------------------------------------------------
Q89MS6_BRADU/287-419--------------------------------------------------------------------------------
Q8NQY4_CORGL/299-437--------------------------------------------------------------------------------
A9C1C5_DELAS/300-433--------------------------------------------------------------------------------
Q3AAI0_CARHZ/302-445--------------------------------------------------------------------------------
Q0AAW3_ALKEH/298-443--------------------------------------------------------------------------------
Q6AK79_DESPS/536-676--------------------------------------------------------------------------------
O29291_ARCFU/289-422--------------------------------------------------------------------------------
Q6LLZ3_PHOPR/291-423--------------------------------------------------------------------------------
A7HF43_ANADF/290-424--------------------------------------------------------------------------------
Q5WB02_BACSK/16-152--------------------------------------------------------------------------------
A0KJY8_AERHH/290-422--------------------------------------------------------------------------------
A6W3F4_MARMS/295-433--------------------------------------------------------------------------------
O67874_AQUAE/297-438--------------------------------------------------------------------------------
Q0A6Z6_ALKEH/50-188--------------------------------------------------------------------------------
Q0AAE6_ALKEH/308-446--------------------------------------------------------------------------------
A7HH08_ANADF/291-424--------------------------------------------------------------------------------
A0QUE9_MYCS2/19-146--------------------------------------------------------------------------------
A0L6G8_MAGMM/300-438--------------------------------------------------------------------------------
A4SW93_POLSQ/291-424--------------------------------------------------------------------------------
Q0VMJ3_ALCBS/291-422--------------------------------------------------------------------------------
A5UUU0_ROSS1/301-438--------------------------------------------------------------------------------
Q2RWQ7_RHORT/287-419--------------------------------------------------------------------------------
Q5E0M6_VIBF1/300-437--------------------------------------------------------------------------------
Q30QK1_SULDN/290-422--------------------------------------------------------------------------------
A1VJH4_POLNA/291-424--------------------------------------------------------------------------------
A0M2M4_GRAFK/316-457--------------------------------------------------------------------------------
A1WYA2_HALHL/306-457--------------------------------------------------------------------------------
A1TZ30_MARHV/318-457--------------------------------------------------------------------------------
A5GB63_GEOUR/87-228--------------------------------------------------------------------------------
A1STJ2_PSYIN/318-456--------------------------------------------------------------------------------
A7HBY5_ANADF/161-300--------------------------------------------------------------------------------
Q47FJ9_DECAR/33-173--------------------------------------------------------------------------------
Q2IP15_ANADE/291-425--------------------------------------------------------------------------------
A7HHL2_ANADF/317-456--------------------------------------------------------------------------------
Q47FJ8_DECAR/323-463--------------------------------------------------------------------------------
Q1GL32_RUEST/285-422--------------------------------------------------------------------------------
Q8KDK9_CHLTE/323-469--------------------------------------------------------------------------------
Q9K6I7_BACHD/316-461--------------------------------------------------------------------------------
Q5P177_AROAE/314-454--------------------------------------------------------------------------------
Q31GK9_THICR/297-430--------------------------------------------------------------------------------
A7HH09_ANADF/26-158--------------------------------------------------------------------------------
Q7NTV8_CHRVO/285-417--------------------------------------------------------------------------------
Q124J8_POLSJ/165-305--------------------------------------------------------------------------------
A7HF42_ANADF/295-425--------------------------------------------------------------------------------
Q7MSB7_WOLSU/294-426--------------------------------------------------------------------------------
B0UVN5_HISS2/302-436--------------------------------------------------------------------------------
B6IWA9_RHOCS/320-456--------------------------------------------------------------------------------
Q5SK35_THET8/277-408--------------------------------------------------------------------------------
Q72EX3_DESVH/178-317--------------------------------------------------------------------------------
Q7MCI2_VIBVY/302-436--------------------------------------------------------------------------------
Q88QY0_PSEPK/323-461--------------------------------------------------------------------------------
Q8EDA6_SHEON/299-436--------------------------------------------------------------------------------
Q9HZ07_PSEAE/290-420--------------------------------------------------------------------------------

PF03710

GLNE_RHILO/579-826------LKLMAT------------IMGAAPR-------------------------------------------------
GLNE_CORGL/627-871------GQRLMR------------ILGNSPY-------------------------------------------------
GLNE_VIBCH/33-281------LNQLRY------------VLGLSQF-------------------------------------------------
GLNE_HAEIN/589-842------LQQVIE------------LCAQSQL-------------------------------------------------
GLNE_PASMU/587-841------LTQLIE------------LCAQSRM-------------------------------------------------
GLNE_ECOLI/552-806------LKHLIS------------LCAASPM-------------------------------------------------
GLNE_CAUCR/70-317------WGSLAP------------VFAASPY-------------------------------------------------
GLNE_PSEAE/47-298------LEDFRR------------VAAASDF-------------------------------------------------
GLNE_ECOLI/29-277------SAQAKS------------VLTFSDF-------------------------------------------------
GLNE_PASMU/46-295------IGQLRY------------AIAMSDF-------------------------------------------------
GLNE_CAUCR/589-828------FELIVE------------VMAFAPR-------------------------------------------------
GLNE_VIBCH/556-810------LVQLVR------------LCTASPM-------------------------------------------------
GLNE_HAEIN/46-299------VYQLGY------------AIAMSDF-------------------------------------------------
GLNE_RHILO/58-307------QDFLAA------------VFDLSPF-------------------------------------------------
M9X424_MANHA/24-271------.QPLVT------------AISLSNF-------------------------------------------------
GLNE_MYCTU/589-828------.KRLMH------------VLGTSAY-------------------------------------------------
Q5F608_NEIG1/520-754------.AQLAQ------------IMSQSSW-------------------------------------------------
GLNE_PSEAE/576-830------LERLLT------------LCAASPM-------------------------------------------------

PF09139

F4Q0F6_DICFS/78-418------IKMIME.QFPK..IKY..GFAYGSG-------------------------------------------------
C5G7N5_AJEDR/130-496------LRQILW.QFKAP.IRY..AFAYGSG-------------------------------------------------
H6BQ12_EXODN/141-510------LRQILW.KFRAP.IRY..AFAYGSG-------------------------------------------------
A8NRM0_COPC7/89-410------LESIVA.KFDAP.IRY..AFAYGSG-------------------------------------------------
G1XLW6_ARTOA/133-472------LRHLLW.EFKAP.IRY..AFAYGSG-------------------------------------------------
E9J9M0_SOLIN/10-328------LRQLLG.EFPGN.MKF..CFAYGSG-------------------------------------------------
G4N333_MAGO7/122-492------LGDIVK.SFQAP.IIY..AFAYGSG-------------------------------------------------
D8M4A9_BLAHO/3-344------FEQYLS.KLPE..YDF..AITYGSG-------------------------------------------------
S3BZ14_OPHP1/165-542------LRQILW.QFRAP.IRY..AFAYGSG-------------------------------------------------
U1HUS9_ENDPU/150-521------LRQILW.KFKAP.IRY..AFAYGSG-------------------------------------------------
C1E0D3_MICSR/10-340------LRAVLE.DVPP..VNH..AFGYGSG-------------------------------------------------
L0P740_PNEJ8/104-428------LKEILR.EFKAP.IQF..SFAYGSG-------------------------------------------------
C9S6T4_VERA1/142-510------LTRLLR.SYRAP.IMY..AFAYGSG-------------------------------------------------
B4NJ58_DROWI/5-342------YRRTVT.RFPLGSVSY..IFAYGSG-------------------------------------------------
E9F7E1_METRA/91-463------LRIMLR.QFNAP.IVY..CFAYGSG-------------------------------------------------
A5E243_LODEL/82-429------LEGIVK.SFHAP.MET..AIGYGSG-------------------------------------------------
W1Q7W0_OGAPD/134-519------LRKVVW.EFNAP.IRY..AFGYGSK-------------------------------------------------
B6K4K1_SCHJY/52-376------FERIVN.SFDAP.IDV..AIAYGSG-------------------------------------------------
H0Z110_TAEGU/13-327------FR.VLA.HFLQE.LSL..AFAYCSG-------------------------------------------------
M3B232_PSEFD/164-542------LRQVLW.QFKAP.IRY..AFAYGSG-------------------------------------------------
E0VMJ8_PEDHC/16-330------FNRILS.KFPLEDLTY..CFAYGSG-------------------------------------------------
B0WG01_CULQU/11-332------FYRILS.RFPPN.FAF..CFAYGSG-------------------------------------------------
D6WLK1_TRICA/13-336------YARILS.KFPQN.FTF..CFAYGSA-------------------------------------------------
K3ZJ60_SETIT/15-326------LAGPLR.DILPP.VDF..CCAYGST-------------------------------------------------
E9CXS5_COCPS/124-488------LRQILW.QFRAP.IRY..AFAYGSG-------------------------------------------------
A0ECV7_PARTE/9-316------LKQFIQ.TLPQ..SEL..SFAYGSA-------------------------------------------------
B9GN14_POPTR/9-326------LKSFLK.VLPP..VGF..CCVYGSS-------------------------------------------------
S8AI20_PENO1/118-482------LRQILW.QFRAP.IRY..AFAYGSG-------------------------------------------------
W5N967_LEPOC/13-328------YRKILS.RFPQD.MSL..AFAYGSG-------------------------------------------------
Q0UPI9_PHANO/59-415------LRGILR.QF.PP.ITY..AFAYGSG-------------------------------------------------
A7S007_NEMVE/10-319------FRDIVS.RFPDG.ITL..AFAYGSG-------------------------------------------------
K9G9U1_PEND2/123-487------LRMILW.QFKAP.IRY..AFAYGSG-------------------------------------------------
TAM41_DICDI/68-424------INELLK.LFPP..IKY..GFAYGSG-------------------------------------------------
I1K386_SOYBN/6-319------FRSFLQ.VLPP..VEF..ACVYGSS-------------------------------------------------
M7PAY1_PNEMU/94-420------LKTVLW.KFKAP.IRF..SFAYGSG-------------------------------------------------
S8FW20_FOMPI/63-368------LEDIVA.QFNAP.IRY..AFAYGSG-------------------------------------------------
C5MHG3_CANTT/128-440------LQGIVK.SFTAP.IDV..SIGYGSG-------------------------------------------------
Q2H207_CHAGB/144-517------LKAIPW.QFRAP.IRY..AFAYGSG-------------------------------------------------
A8Q506_MALGO/15-385------ILHILQ.SMNLPMVQY..AFAYGSG-------------------------------------------------
T1JUS5_TETUR/9-355------LKNLIS.FLPSS.YCF..AFAYGSA-------------------------------------------------
G1KJZ6_ANOCA/15-329------FRRILA.HFPPE.LSL..AFAYGSG-------------------------------------------------
K2RZS9_MACPH/50-418------LRQILW.QFRAP.IRY..AFAYGSG-------------------------------------------------
M2UHY6_COCH5/80-448------LRGILR.KF.PP.VTY..AFAYGSG-------------------------------------------------
C4QXR2_PICPG/110-482------LQKVLW.KFNAP.IRF..AAGYGSG-------------------------------------------------
G3APF1_SPAPN/81-416------LEEIVK.TFNAP.IDV..SIGYGSG-------------------------------------------------
C7Z478_NECH7/122-494------LRLMLR.QFNAP.IVY..CFAYGSG-------------------------------------------------
Q6CC57_YARLI/155-503------LRQVLW.TFKAP.IRY..SFAYGSG-------------------------------------------------
K7IVD4_NASVI/11-329------FKNILQ.EFPRN.MKF..CFAYGSG-------------------------------------------------
J9K2F7_ACYPI/5-309------LNRILT.KFPTKHLVY..CFAYGSG-------------------------------------------------
TAM41_DROME/5-338------YRRTVA.RFPLGSVSY..MFAYGSG-------------------------------------------------
M7TNP0_EUTLA/89-460------MRQLLW.RFRAP.IRY..AFAYGSG-------------------------------------------------
U4L0D7_PYROM/82-426------LRQLLW.QFEAP.VRW..AIAYGSG-------------------------------------------------
W1PVI6_AMBTC/11-327------LAAPLN.DLPH..VDF..CCAYGSS-------------------------------------------------
S2J8V7_MUCC1/67-383------LKDVVS.QFNAP.VRY..AIAYGSG-------------------------------------------------
E1FWI9_LOALO/14-325------LKYLLD.ILPLDTVEY..ACAYGSG-------------------------------------------------
R7Z3U1_CONA1/137-506------LRQILW.QFRAP.IKY..AFAYGSG-------------------------------------------------
R9AIR3_WALI9/86-407------LEKVIN.SFNAP.IRY..GFAYGSG-------------------------------------------------
G8B9Z5_CANPC/74-380------LVDLVN.TFDSK.ISA..AVGYGSG-------------------------------------------------
Q9SN75_ARATH/9-326------LSSFLS.VLPP..VDF..CCVYGST-------------------------------------------------
G8YHN8_PICSO/69-420------VERLLQ.SFKSS.IEV..SFGYGSG-------------------------------------------------
B4K948_DROMO/5-334------YRRVVA.RFPLGNVSY..MFAYGSG-------------------------------------------------
S9W8F4_SCHCR/52-374------LKGLLD.TFNAP.IQV..AIGYGSG-------------------------------------------------
N1J4Q0_BLUG1/111-475------LRRTLW.HFRAP.IRF..AFAYGSG-------------------------------------------------
J3PFP4_GAGT3/124-495------LGDIVK.SFQAP.IIY..AFAYGSG-------------------------------------------------
A3LVC5_PICST/51-374------LRGIID.TFNSS.IKV..SIGYGSG-------------------------------------------------
Q6BKV0_DEBHA/67-411------LSQLIA.NFKSP.IKF..SIGYGSG-------------------------------------------------
A7EQJ2_SCLS1/136-507------LRQILW.QFRAP.IRY..AFAYGSG-------------------------------------------------
F1L2S9_ASCSU/10-321------LGALLE.CVPLDTVRF..AFAYGSG-------------------------------------------------
G3JTW8_CORMM/137-509------LRVMLR.QFNAP.IVY..CFAYGSG-------------------------------------------------
V5G174_BYSSN/130-494------LRQILW.QFKAP.IRY..AFAYGSG-------------------------------------------------
F4PEP7_BATDJ/67-400------LESIVS.SFRAP.VRF..ALAYGSG-------------------------------------------------
Q5AGE7_CANAL/141-463------LQEIVN.SFDAP.IDV..SIGYGSG-------------------------------------------------
G3XQA7_ASPNA/29-371------LNYIIA.KFPP..VAH..AFAYGSG-------------------------------------------------
B6QBB5_TALMQ/135-501------LRQILW.KFRAP.IRY..AFAYGSG-------------------------------------------------
F2DNW5_HORVD/11-326------LAGPLR.DLLPP.VDF..CCAYGST-------------------------------------------------
I7M213_TETTS/17-335------LDSIIQRDFPK..IDF..AFGYGSG-------------------------------------------------
M9MEW7_PSEA3/116-467------LHNILA.CFDTP.VRF..AFAYGSG-------------------------------------------------
R8BP23_TOGMI/11-384------LRQILW.QFRAP.IRY..AFAYGSG-------------------------------------------------
M2M255_BAUCO/36-426------LRQILW.RFRAP.IRY..AFAYGSG-------------------------------------------------
T1F6T9_HELRO/4-318------.QKFLK.FFPE..VRM..AFAYGSG-------------------------------------------------
F4REF8_MELLP/113-453------LSNIIQ.SFKAP.IRY..AIGYGSG-------------------------------------------------
M5E4Z7_MALS4/64-428------ILSILN.AMRLPKYNY..AFAYGSG-------------------------------------------------
U5H5E0_USTV1/137-472------LEEILA.DFKAP.VRF..AFAYGSG-------------------------------------------------
G3B682_CANTC/65-370------LTGLVN.HFDG..TST..SIGYGSG-------------------------------------------------
H3FZA6_PRIPA/8-319------VKELIS.DLPLGSVNF..AFAYGSG-------------------------------------------------
H2S0L1_TAKRU/13-328------YRRILS.EFPQD.ISL..AFAYGSG-------------------------------------------------
D8PZS1_SCHCM/93-412------LESIVA.QFNAP.IRY..AFAYGSG-------------------------------------------------
D7T9Q8_VITVI/9-326------LASLLK.FLPP..VEF..CCVYGSA-------------------------------------------------
G0T2B5_RHOG2/147-502------LEEVMK.SFKAP.VRY..AFAYGSG-------------------------------------------------
B7PKK9_IXOSC/7-319------WSKIIS.AFPGK.FTL..AFCYGSG-------------------------------------------------
F9WXS4_ZYMTI/148-520------LRSIIW.QFRAP.IRY..AFAYGSG-------------------------------------------------
B9SQ77_RICCO/9-325------LKNFLE.VLPS..VEF..CCVYGSA-------------------------------------------------
M0S210_MUSAM/10-320------LAGPLE.LLPA..VDF..CCVYGSS-------------------------------------------------
E9R3D7_ASPFU/128-493------LRQILW.QFRAP.IRY..AFAYGSG-------------------------------------------------
I4Y9B7_WALMC/21-342------LEAVFH.SFRAP.IRY..GFAYGSG-------------------------------------------------
D3B0C8_POLPA/348-663------IKKILS.QFPK..IKY..GFAYGSG-------------------------------------------------
A5DAD6_PICGU/58-371------LEALAR.RFDGP.VEF..TFGYGSG-------------------------------------------------
TAM41_CAEBR/4-316------YRELIS.VLPLDTVEY..AFAYGSG-------------------------------------------------
H3AQ57_LATCH/13-328------FRRILS.HFPPD.ISL..AFAYGSG-------------------------------------------------
G4U2Y1_PIRID/94-414------LEEIVG.TFHSP.IRY..AFAYGSG-------------------------------------------------
H2Y1H7_CIOIN/13-342------LSRLLS.RFPGD.MSL..AFSYGSG-------------------------------------------------
Q5KAN9_CRYNJ/49-385------LRPVIS.TFQAP.IDW..AAAYGSG-------------------------------------------------
E9HGG3_DAPPU/25-340------FRHILS.LFPED.LVF..AFSYGSG-------------------------------------------------
Q7PQL6_ANOGA/11-332------FFRLLS.KFPQG.FSF..CFAYGSG-------------------------------------------------
F1MZC5_BOVIN/13-327------FRKILS.HFPEE.LSL..AFAYGSG-------------------------------------------------
B7GA00_PHATC/17-343------.RKLLEDTLPLDNVVY..AFGYGSG-------------------------------------------------
B4JF38_DROGR/5-334------YRRIVT.RFPLGNVSY..MFAYGSG-------------------------------------------------
Q16J98_AEDAE/11-332------FYRILS.RFPPN.ITF..CFAYGSG-------------------------------------------------
E3K171_PUCGT/48-392------LNSIIN.SFKPP.IRY..ALAYGSA-------------------------------------------------
D5GF34_TUBMM/84-434------LRSLLW.QFRAP.VRY..AFAYGSG-------------------------------------------------
G9MXT6_HYPVG/81-452------LRMMLR.QFNAP.IVY..CFAYGSG-------------------------------------------------
U9TGF8_RHIID/101-418------LRKLLN.NFHAP.IRY..AIAYGSG-------------------------------------------------
L8FTT4_PSED2/132-505------LRQVLW.QFRAP.IRY..AFAYGSG-------------------------------------------------
A0A0C4EL14_PUCT1/30-349------LGAIIS.SFRPP.IRY..AFAYGSA-------------------------------------------------
TAM41_SCHPO/61-385------LTKVVN.YFQAP.IDV..AVGYGSG-------------------------------------------------
R4XIF8_TAPDE/76-410------LRSVLW.KFKAP.IRY..AFAYGSG-------------------------------------------------
B8N4Y6_ASPFN/11-362------LQQITQ.QFRAP.ISY..SIAYGSG-------------------------------------------------
K5VSI5_PHACS/87-407------LESIVA.QFNAP.IRY..AFAYGSG-------------------------------------------------
T0K1A0_COLGC/136-508------LTNVVR.EFRAP.VMY..AMAYGSG-------------------------------------------------
D7FQS1_ECTSI/13-328------LGELIS.AFPE..AEF..AFAYGSG-------------------------------------------------
K5VXR0_AGABU/90-409------LEDVVA.KFNAP.IRY..AFAYGSG-------------------------------------------------
F2PR85_TRIEC/162-525------LRQILW.QFKAP.IRY..AFAYGSG-------------------------------------------------
F7BSM1_MONDO/13-327------FRRILA.NFPDN.LSL..AFAYGSA-------------------------------------------------
C1MRC2_MICPC/9-342------LGVVLN.DLPP..VVH..AFAYGSA-------------------------------------------------
C3ZAA9_BRAFL/5-319------LSKIVS.NFPQEGLAF..AFAYGSG-------------------------------------------------
G4V8Y8_SCHMA/10-360------LKRLID.TLNTDRTNYVASFAYGSV-------------------------------------------------
V2X315_MONRO/94-415------LESIVA.QFNAP.IRY..AFAYGSG-------------------------------------------------
M5BIJ2_THACB/103-424------LEEIAA.GFDAP.IRY..AFAYGSG-------------------------------------------------
W5JMS0_ANODA/11-332------FYRILS.RFPPG.FSF..CFAYGSG-------------------------------------------------
M2RN09_CERS8/89-398------LESIVA.QFNAP.IRY..AFAYGSG-------------------------------------------------
E5SKP7_TRISP/223-538------LERIAS.ILPRTSVSM..MFAYGSG-------------------------------------------------

PF09970

A2BMQ9_HYPBU/4-185----TLNDLSWLFRKLQEH-GIKGVVIGSTV--------------------------IE--------------------L
Q9YEU3_AERPE/3-181----SRRGVASSLRVLLDR-GFRFTIIGGTV--------------------------VE--------------------Y
Q0W0P2_METAR/6-201----NFRIYREAASVLEAN-GI.PYVVGGGI--------------------------AV--------------------M
A3DMD4_STAMF/4-178----TLEDLAVVLGKLSSY-GVKFVVIGDTV--------------------------VQ--------------------L
B8D508_DESK1/4-179----SIDELAGIMKTLQDE-GVKAVVIGDTV--------------------------VQ--------------------L
A8AAR7_IGNH4/4-184----TLDDLIYVMKKLQEA-GLDAVIIGGTS--------------------------VE--------------------L
Q8ZWK5_PYRAE/12-191----YKTALRKVAKSLNEK-GVEFVLIGSAV--------------------------LP--------------------F
A4YD77_METS5/3-181----AFEKIGEILSQIKEK-M.DFVIIGDTV--------------------------VD--------------------L
A8MBZ4_CALMQ/6-188----YSLALLRVGGVLGGR-GVGFVVVGSLI--------------------------LP--------------------L

PF08843

P96356_MYCTU/44-279----QFAAT..LTDDTGAP-LL..LVKGGSS------------------------..LE-------------------.L
A4QBB6_CORGB/41-280----IVLSR...IFANDPN-SW..VLKGGTA------------------------..L.-------------------.I
A4TG06_MYCGI/45-278----RFMAR...VFNANEP-PW..VVAGGIG------------------------..ML-------------------IR
Q3L9Z1_RHOE4/41-273----RFLAR...VFSSPDS-RW..ILTGGGG------------------------..ML-------------------VR
Q0RZM2_RHOJR/41-272----RFLTR...VFDADPD-GW..ILKGGIG------------------------..MM-------------------.V
A1BD69_CHLPD/21-282----RDIKE...VADGLAI-HF..FVVGAFA------------------------RDLN-------------------.F
A1VQW1_POLNA/3-254----ADVEA...VAAPMGI-AI..VITGAFA------------------------RDLH-------------------.L
Q8XT48_RALSO/19-276----IIMDR...VARQANL-RY..LVVGATA------------------------RDIL-------------------.M
B1YQB6_BURA4/27-287----QAVGT...TCVQLDT-AF..VVAGATA------------------------RDIL-------------------.M
Q63YV1_BURPS/19-278----RDVKH...ACAQLGA-KF..VLAGATA------------------------RDIL-------------------.M
Q82BM7_STRAW/85-332----LVLAA..IADSAWVD-AL..VLRGSVL------------------------..MS-------------------.A
A4X8Y5_SALTO/290-509----HVLTT..IAATTWSQ-QL..VLRGSVT------------------------..MA-------------------.A
A5FTN4_ACICJ/24-250----EVVRS.IFVKSTERE-I...ALKGGFA------------------------..MR-------------------.A
A5CLY9_CLAM3/43-277----RFLCR...VFADDEP-MF..VLKGGTG------------------------..ML-------------------AR
B4SCH8_PELPB/39-286----TLLNG....LHIQGL-QL..AFGGGTS------------------------..LA-------------------..
Q5X025_LEGPL/35-302----QSLSK......IENE-YFRLVFCGGTC------------------------..LA-------------------.K
A0A0C9P991_LEGPN/35-300----RLLVG......ISND-YFELVFQGGTS------------------------..LS-------------------.K
Q3ICX9_PSEHT/18-286----KLLSE....LSFDTH-LL..VFSGGTA------------------------..LT-------------------KS
Q7MZL3_PHOLL/34-307----RLLQP....LAFDTH-KL..VFAGGTA------------------------..LA-------------------.K
B3EES9_CHLL2/39-305----EKLAD....IDVDGI-QL..IFCGGTC------------------------..LS-------------------.K
A1W687_ACISJ/40-308----RALFA....LQPEGV-QL..VFCGGTS------------------------..LS-------------------.K
B1HK77_BURPE/40-306----RALST....LAHEHV-TL..VFCGGTN------------------------..LS-------------------.K
A6DS96_9BACT/37-309----ALLEI..FSNETLAE-YT..VFKGGTS------------------------..LS-------------------.K
Q64WK6_BACFR/36-314----KILRD..ISMSEYAD-KT..YFKGGTS------------------------..LS-------------------.K
Q7MW16_PORGI/42-316----EILRA..LSKSSYSQ-QI..VFKGGTS------------------------..LS-------------------.K
A4VC40_BACUN/48-319----SLMAA.....GDKDN-RA..IFKGGTS------------------------..LT-------------------.K
A4TFZ6_MYCGI/38-313----EVLRT...IAASHRD-EI..VFKGGTS------------------------..LQ-------------------.K
Q8EAV5_SHEON/44-326----ILYVD.IAPKLTARS-QIPFVFKGGTS------------------------..LS-------------------.K
E0TEK2_PARBH/39-305----.......WGLQQLDY-KF..ELKGGTS------------------------..LS-------------------.K
A0A016HWW3_BACFG/41-334----YALFH.....TSVSE-YL..LFKGGTS------------------------..LS-------------------.K
A3J913_9ALTE/48-337----RLLYD...ENLLGAH-ST..AFKGGTA------------------------..LS-------------------.K
A6THM9_KLEP7/48-339----RLLFD.....EGFLH-PYTVAFKGGTS------------------------..LS-------------------.K
A9KUC3_SHEB9/48-338----RLLYD...ERLLGDC-SV..AFKGGTA------------------------..LS-------------------.K
Q82T38_NITEU/42-327----RALFV.....SPLSA-DL..TFKGGTS------------------------..LS-------------------.K
Q0BSX7_GRABC/42-325----STLYG.....SALGE-HL..VFKGGTS------------------------..LS-------------------.K
Q8KW71_9RHOB/44-328----DALFG.....SDLGE-HL..VFKGGTS------------------------..LS-------------------.K
Q7D419_AGRFC/45-352----DFFFN...RRKDDAI-GL..YFKGGTS------------------------..LS-------------------.K
A5ETQ0_BRASB/46-335----DALYH...RLPADRP-RL..LFKGGTS------------------------..LS-------------------.K
Q47DL1_DECAR/45-335----DALFN...GLATGGP-RL..LFKGGTS------------------------..LS-------------------.K
A1TXM9_MARHV/49-331----QALFS.....MPGAH-PM..AFKGGTS------------------------..LS-------------------.K
Q5WTN4_LEGPL/43-334----DQIFS....NEDLSP-HV..IFKGGTS------------------------..LS-------------------.K
A0LER7_SYNFM/41-321----RELFG....LQNWGQ-HL..AFKGGTS------------------------..LS-------------------.K
A3ZP42_9PLAN/42-324----GILFE.....SEFAS-DL..VFKGGTS------------------------..LS-------------------.K
Q2SRA8_MYCCT/41-317----DYIFN....QSKWSM-SF..TFKGGTS------------------------..LS-------------------.K
Q6MDY6_PARUW/41-327----ERLFS....LQKLKP-HL..TFKGGTS------------------------..LS-------------------.K
B0T9L0_CAUSK/43-328----GLLFD....PARSTG-SM..IFKGGTS------------------------..LS-------------------.K
Q212U2_RHOPB/41-335----KRLFA...LQGEEFA-SL..VFKGGTS------------------------..LS-------------------.K
Q3A7V2_PELCD/41-315----DKLFA....HPPLAH-VL..MFKGGTS------------------------..LS-------------------.K
A2SRV5_METLZ/41-321----DYLFH....DCPWKN-TL..TFKGGTS------------------------..LS-------------------.K
Q70K67_9ACTN/39-270----LFLAR..LFRSPDAE-QW..ILTGGSA------------------------..LQ-------------------.F
A0A083W0R0_MYCBI/36-282----YLLSQ...TVQFGDN-RL..VFKGGTS------------------------..LR-------------------KC
Q0AYA4_SYNWW/12-213----PILDRLVECDILTDR-GF..YLAGGTA------------------------..LA-------------------.I
A4AL11_9ACTN/32-263----RFLAR..LVESPYAD-SF..VLKGGVL------------------------..LA-------------------..
V7MI27_MYCAV/21-255----RIMAR...LQAAEPG-LW..VLKGGMA------------------------..LE-------------------.V
Q2IEN8_ANADE/40-269----RYLAR...LVRVLGD-AA..TLKGGLV------------------------..LE-------------------.L
A6P1W9_9FIRM/34-254----EFLRR..LEKSQYAE-NL..VLKGGLF------------------------..IY-------------------.S
A7B855_RUMGN/34-254----EFLRK..LSKSGCED-TL..ILKGGLF------------------------..IY-------------------.T
B4SEI7_PELPB/39-257----RFLYR..LSISSFAD-RF..ILKGALL------------------------..LR-------------------.V
A8ZZS0_DESOH/39-259----RFLYR..LAQSRHAN-RF..ILKGALM------------------------..LR-------------------.I
Q5KV23_GEOKA/37-258----RLLYR..LSISNYRD-KF..VLKGGLF------------------------..LF-------------------.S
A6LIS3_PARD8/36-258----RLLYR..VSVSQYKD-NF..LLKGGSL------------------------..LY-------------------.A
Q64Q44_BACFR/39-261----RLLYR..LSISRFYD-HF..FLKGGAL------------------------..LY-------------------.A
A7LUN8_BACO1/37-259----RLLYR..ISQTHYRE-NF..YLKGGAL------------------------..MY-------------------.A
A6DSE9_9BACT/33-256----RFLYR..LGLSEHKN-RI..TLKGAML------------------------..FI-------------------.L
Q0F353_9PROT/38-260----RLLYR..LSVSRYRD-EF..VLKGAML------------------------..FS-------------------.Y
A0LJY5_SYNFM/39-260----RLLYR..IGRSEWRS-RF..LLKGAML------------------------..YT-------------------.L
Q5GY13_XANOR/41-262----RVLYR..LSVSEQQG-QF..LLKGALL------------------------..FD-------------------.I
A3Z4Q5_9SYNE/35-255----RLLYR..IGISEYCD-RF..LLKGAML------------------------..FA-------------------.L
A1VW15_POLNA/35-256----RLLYR..LSQSAHAD-RF..VLKGALL------------------------..FT-------------------.L
A1W4H8_ACISJ/35-256----RLLAR..VSTSPHAD-RF..LLKGALL------------------------..FA-------------------.L
A6UKN5_SINMW/38-258----RLLFR..LSRSPHAG-RF..VLKGAML------------------------..MM-------------------.S
Q1M7T1_RHIL3/81-300----RLLYR..LSLSEHRD-RF..ILKGAML------------------------..FV-------------------.T
Q3Y113_ENTFC/32-252----KLLER..IVESPYHD-DF..VLKGGFL------------------------..IG-------------------.S
Q8E4P3_STRA3/32-253----VILKK..LSQSSYSD-HY..IFKGGFL------------------------..LS-------------------.N
Q6MU66_MYCMS/32-253----SILEK..IVKSKNKQ-NF..VIKGGFL------------------------..LS-------------------.N
Q932V7_MYCBV/32-254----SILRR..ISKSNERD-NF..VFKGGFL------------------------..LS-------------------.N
Q6MDV8_PARUW/32-251----RFLSR..LSRSTYTQ-QF..IFKGGFL------------------------..LA-------------------.Y
Q6M9M4_PARUW/38-258----RFLVR..LARSKYRD-QF..VLKGGIL------------------------..LS-------------------..
Q48616_9LACT/30-263----RFLTR..LSASQYKE-KF..VLKGGFL------------------------..IG-------------------.V
A5ZR43_9FIRM/34-257----RFLER..ISLSEYKN-QF..ILKGGML------------------------..VA-------------------.A
A6NXL8_9FIRM/29-249----RLLVR..LAASAYKE-KF..VLKGGML------------------------..VA-------------------.A
Q5QWW7_IDILO/14-223----RCLDN.FNSHYLTEH-AI..LFGGGTR------------------------..IA-------------------.L
Q4BV89_CROWT/13-234----KILNS.FNPTILQES-YA..YFGGGTL------------------------..LA-------------------.L
A3JKF1_9ALTE/13-197----SVLEA.MNPELLKDL-QC..FFCGGTA------------------------..IA-------------------.L
A2SDV7_METPP/12-231----TVLAA.LDADVLVAN-DC..LFGGGTA------------------------..MA-------------------.L
A1VJ73_POLNA/12-232----QVLRA.LNAPLLREN-LC..LFGGGTA------------------------..IA-------------------.L
Q2KB15_RHIEC/41-246----AALRL.MRADFFLAN-KC..WFAGGTA------------------------..IV-------------------.M
A0A0U1QTN6_YERP3/14-242----GILDS.IDANFIEDA-EC..YFAGGTA------------------------..IV-------------------.M
A4Z034_BRASO/13-212----DGLQD.LKQQGLPAP-EW..VLGGGTA------------------------....-------------------.L
A4XFS5_CALS8/11-198----LILDC....AKIPEE-EW..TFGGGTA------------------------..LS-------------------.L
Q120Y5_POLSJ/21-211----.TLTD.YLATVVDHP-TW..SFGGGTV------------------------....-------------------.L
Q21T10_RHOFT/21-211----KLMAH..LERQTSHP-LW..TFGGGTV------------------------..LM-------------------.L
A1WFU2_VEREI/21-211----GLMLH..LEEATIEP-QW..TFGGGTV------------------------..LM-------------------.L
A0A0A5LPY8_BURCE/21-212----TLIEE.IRKHGTSSP-FW..TFGGGTV------------------------..LM-------------------.L
Q7WXF2_CUPNH/19-210----TLMEE.VRKHGGIEP-FW..TFGGGTV------------------------..LM-------------------.L
A0RUS7_CENSY/6-237----NSLCYISTDEVLKDV-QF..AFRGGTT------------------------..LS-------------------KV
Q0W4I1_METAR/29-258----LALEQ....LRPLFP-DA..IFKGGTA------------------------..LN-------------------.R
O58109_PYRHO/28-258----YLLFQ...LWEIFGR-KV..ILKGGTA------------------------..LN-------------------.R
B3E891_GEOLS/35-303----ALLGH....LAESDL-NF..VFKGGTS------------------------..LL-------------------.L
A3XKF9_LEEBM/37-314----SLLEH....LKVSGL-DF..VFKGGTS------------------------..LV-------------------.L
A7M3Q0_BACO1/35-306----SLLEM....LVKAGC-PL..VFKGGTA------------------------..LM-------------------.L
Q8G4C8_BIFLO/40-283----RILDA..MMREGFFS-SL..VFQGGTS------------------------..LR-------------------.L
A6W084_MARMS/31-273----DIMAV..MVKQGVMQ-SL..TFIGGTS------------------------..LR-------------------.L
Q1NX48_9DELT/33-274----DILRL..LNDAGLLA-GL..TFIGGTC------------------------..LR-------------------.A
A3JJK0_9ALTE/33-275----DILRE..LSHADLLK-KL..TFIGGTC------------------------..LR-------------------.A
A1WLS4_VEREI/34-292----EIFQA..LDDAGLLK-HL..VFQGGTS------------------------..LR-------------------.L
Q7N0F8_PHOLL/35-281----DILYC..LDTNGLLD-QL..TFQGGTS------------------------..LR-------------------.L
Q7N990_PHOLL/35-281----DILFC..LSKDGLLK-EI..TFQGGTS------------------------..LR-------------------.L
Q1RR56_STRAM/9-205----RLLAD.ILDLG.SPY-PL..VLTGGYA------------------------..VQ-------------------..
Q93P81_9BACT/17-212----QFMSA......EVFK-TF..RLVGGTA------------------------..LS-------------------.L
Q11WD0_CYTH3/17-213----KLMQA......DEFK-DF..RLVGGTA------------------------..LS-------------------.L
A6E7P3_9SPHI/16-212----VLMQE......PIFK-HF..RLVGGTA------------------------..LS-------------------.L
A7HFJ3_ANADF/43-305----WALGQ......HFGD-AL..LLKGGTL------------------------..LS-------------------.K
Q2JEV0_FRASC/11-201----RIFFG.....LPESA-GF..AVAGGAA------------------------..L.-------------------.I
A0A0C9PEK8_LEGPN/30-299----ELLED.FTSFPQFKD-KF..ALKGGTA------------------------..LN-------------------.L
Q2LU48_SYNAS/35-302----QLLDA.IRSHPFLKD-KL..VLKGGTA------------------------..LN-------------------.L
Q1LN31_CUPMC/10-279----RLLTQ.VAPLVFVDD-TF..ALKGGTA------------------------..IN-------------------.L
Q8P655_XANCP/10-280----RLLLD.IAPAVFAND-IF..AMKGGTA------------------------..IN-------------------.L
A4JU43_BURVG/10-285----RLMLG.IAPIIFDTP-LF..AMKGGTA------------------------..LN-------------------.L
Q58AR5_CUPMC/10-285----RLLID.IAPPVFDTD-KF..AMKGGTA------------------------..IN-------------------.L
A1VVH0_POLNA/10-280----QLLLA.IAPAIFETP-LF..ALKGGTA------------------------..LN-------------------.L
A0YF78_9GAMM/10-274----KLLLD.VLPEVSKEA-CF..AMHGGTA------------------------..IN-------------------.L
Q3ARB4_CHLCH/11-282----DLLLQ.ILPLVAKEK-VF..ALKGGTA------------------------..IN-------------------.L
M4TXV3_9XANT/17-288----RLLVE.ILPVLAQEP-RF..ALKGGTA------------------------..IN-------------------.L
A3W959_9RHOB/11-281----ALLVR.VLPYVAKEE-IF..ALKGGTA------------------------..IN-------------------.L
E0TGY4_PARBH/11-280----RLLVD.ILPAVAAEE-DF..ALKGGTA------------------------..IN-------------------.L
Q7ND98_GLOVI/12-283----RLLVS.LLPQVAKQE-CF..ALKGGTA------------------------..LN-------------------.L
A6F2Q0_9ALTE/14-284----TLLLQ.LVPFVAKHQ-CF..ALKGGTA------------------------..IN-------------------.L
A6X803_OCHA4/12-281----RLLMR.LIPIVARET-CF..SLKGGTA------------------------..IN-------------------.L
A3UHI0_9RHOB/12-283----ALLIR.TIPFVAQEQ-CF..ALKGGTA------------------------..IN-------------------.L
Q11AE5_CHESB/12-283----QLLMQ.VLPFVADEK-EF..ALKGGTA------------------------..IN-------------------.L
Q2LU07_SYNAS/47-285----ADLCS........GC-KLPPVFRGGTC------------------------..LS-------------------.K
A1TBN2_MYCVP/31-246----AFLSR......EFGD-RI..HFIGGTA------------------------..LA-------------------.R
A1U7W6_MARHV/12-228----QIMQAICEIIHDEGK-PL..VLKGGTA------------------------..LL-------------------.L
A7NJN2_ROSCS/29-227----CILGA..LQRAGAMI-PL..AFHGGTA------------------------..LR-------------------.F
A5D0Y6_PELTS/89-288----KTLKI..FSRVNKHG-DF..YFTGGTA------------------------..LA-------------------.V
Q07LJ4_RHOP5/30-260----RALVA.IFSDPFLRG-EL..RFRGGTA------------------------..LN-------------------KL
A3WUQ2_9BRAD/30-251----RALVN.LFEDAFLRD-EL..RFRGGTA------------------------..LN-------------------KL
Q5X0F2_LEGPL/30-282----RAIVE.IFSNPFLAS-EL..AFRGGTA------------------------..LH-------------------KL
A0M137_GRAFK/30-253----RALVE.IFSDDFLRE-NL..AFRGGTA------------------------..LH-------------------KL
A7LVH9_BACO1/30-253----RALVA.IFSDDFLAS-KL..AFRGGTA------------------------..LH-------------------KL
D5T6J5_LEGP2/30-253----RALVE.LFNDPLISE-SI..AFRGGTA------------------------..LY-------------------KL
Q3SW13_NITWN/30-253----RALVE.IFSHPVLSQ-AL..AFRGGTA------------------------..LY-------------------KL
A1BFK9_CHLPD/30-252----RALVE.IFSNSFLAE-SL..AFRGGTA------------------------..LF-------------------.K
B9M297_GEODF/30-250----RALVE.LYSHPLLAE-NL..AFRGGTA------------------------..LF-------------------.K
O54654_HALSA/29-256----WILWG..IFTSDFGE-NL..MFKGGTA------------------------..LS-------------------KL
Q82TQ8_NITEU/35-265----WFLTG..LAGHPLRD-VL..AFKGGTA------------------------..LR-------------------.R
Q3B1Q4_CHLL7/29-234----WVLAG.LASQEEVAD-SW..VFKGGTC------------------------..LK-------------------.K
A8ZVR5_DESOH/29-286----WMLAG.IFNHPAIGK-SW..AFKGGTC------------------------..LK-------------------.K
A6GZS9_FLAPJ/29-275----HFIAA.IFNEPELKE-TL..IFKGGTC------------------------..LK-------------------.K
Q1Q4B8_9BACT/29-269----HYLNG.LYNRSLFKE-CF..RFKGGTC------------------------..LR-------------------KL
A1BFT1_CHLPD/31-275----VALYG..LWRAGFFQ-VA..AFQGGTC------------------------..LR-------------------.I
Q0YUP4_9CHLB/31-275----VALYA..LWRAGFFE-KA..AFQGGTS------------------------..LR-------------------.I
Q74DE8_GEOSL/31-281----VALLG..LWRSKFFE-HA..AFYGGTA------------------------..LR-------------------.I
Q1NX65_9DELT/31-281----IALCG..LWRGKFFE-HA..AFYGGTA------------------------..LR-------------------.I
A6VTK2_MARMS/28-267----IALAG..LYRGGFFQ-KA..AFYGGTC------------------------..LR-------------------.I
A6LDX6_PARD8/32-268----VILAG..LYAGGFFE-SA..AFYGGTC------------------------..LR-------------------.I
A0RWG6_CENSY/28-254----NLLSV..MVDFPKID-KM..VFKGGTS------------------------..LK-------------------.K
A0RWG1_CENSY/28-244----SLLSI..IADFPGID-KI..VFKGGTS------------------------..VK-------------------KM
A7LH05_9HELI/21-239----KLMRA..IVKNLADT-PM..VLKGGTA------------------------..LY-------------------.L
Q649Z3_9ARCH/29-245----IALRS....IYASTN-DL..AFKGGTC------------------------..LW-------------------.F
Q6L332_PICTO/28-244----LLLYE...IYNEFND-EL..IFKGGTS------------------------..LK-------------------.Y
Q3F100_BACTI/38-319----LSLCA.LLSSDIFVD-KT..VLTGGSV------------------------..LN-------------------.L
A0A063UM99_BORBO/15-280----LVVKA.ILSDDKLFE-NL..VLKGGNA------------------------..ID-------------------.L
Q138J1_RHOPS/18-217----QIWRS...LEPAGDL-NF..VLYGGTA------------------------..VA-------------------.L
A4JFW1_BURVG/16-258----KLWPD...LAPVKDL-GF..TLYGGTA------------------------..IA-------------------.L
Q8KW54_9RHOB/74-323----LFLAT.LAMTRPYCQ-QV..FLKGGIL------------------------..MG-------------------.V
A6GR58_9BURK/30-277----IVLSA.IGSSAPLRT-QM..VMKGGML------------------------..MA-------------------.I
Q7N7R6_PHOLL/25-274----IVLQA.IASNEYLKP-KM..IMKGGIL------------------------..LG-------------------.L
Q3JF57_NITOC/25-272----TILTA.IAGTPSLQT-AM..IMKGGVL------------------------..LA-------------------.L
A1X5X8_ECOLX/40-289----IILKS.ISIEESLNE-MM..VMKGGTL------------------------..LG-------------------.V

PF14907

D4IJI6_9BACT/30-280----DAAQWREIYDLSSVQ-GVLAQAWDGMQ------------------------.LLP................E..A.
D6D2Z8_9BACE/32-294----TDAQWWDVYRMAVRQ-TVTGIVCRGLH------------------------.HLP................E..A.
E3EIB5_PAEPS/42-310----QEMDWSRLLRLIEHH-RVVPTVYLQLK------------------------.TLN................H..P.
E6SSN3_BACT6/27-274----SANDWQTLYRMAQAQ-ALLAIAFDGVS------------------------.LLP................D..E.
A6L7U2_BACV8/35-288----SPALWQACYRLACTQ-GVMALAWDGIQ------------------------.TLP................A..C.
D5EUU1_PRER2/28-271----NADDWRWLYQMAVRQ-SLVGVCYQGVC------------------------.QLS................G..K.
F2KYQ1_PREDF/45-298----AEMDWDALYDFGYKQ-AILGVFFHGIK------------------------.RLS................Q..S.
A1AK32_PELPD/41-295----SPEEWRDFLSLAAEQ-RVRPLLWHRLR------------------------.EKG................L..E.
D0MHT5_RHOM4/36-289----QPLDWERLYRLMLRH-GVVALAYRNLL------------------------.QAA................P..D.
C8VWU0_DESAS/27-271----ETLDWEKLYQLSIWH-GISNMAWYGIM------------------------.QLD................T..E.
C8W2H3_DESAS/29-273----YKLDWEKLYKFAAWH-GVSNMACYGLN------------------------.RLT................C..D.
F0SY73_SYNGF/27-282----HNVNQSELLNLAMEQ-KVSAYLYTLVG------------------------.KKF................D..V.
B0CEE6_ACAM1/41-296----PSMDWHTLVRLANVH-GVQTLLYQSVK------------------------.SIG................K..E.
E6X194_NITSE/55-325----PKFDIQNLLELSSRH-GVLPLVYKNLK------------------------.AIEKSIQTSSSQNDTPPTQN....
A5G508_GEOUR/51-304----ECTDWGAFTALVNRH-EVSALVYAALR------------------------.KHA................D..N.
B8I678_CLOCE/34-315----GGIDWSEAIYQMITH-RTLPMFRYNLK------------------------.KFN................L..Y.
B8HPX3_CYAP4/33-304----KSIDWKTLIQTSIAQ-GVMPILYESLK------------------------.TIE................Q..K.
A6QAF7_SULNB/69-323----EHLTLHTLISLANQH-GILPLIYKTLS------------------------.SLN................A..E.
C8W5K5_DESAS/42-296----KPTDWQFFAHLAVHH-RVYPIVYKTLS------------------------.QLN................N..P.
A0LED8_SYNFM/43-296----GRLDWDALLRLAEAH-KILPILHAVLK------------------------.ESH................W..R.
C8W092_DESAS/36-289----QSVNWDLFLHLAVYH-RLFPLAYKTLC------------------------.SLN................N..P.
B3U4I7_9BACT/63-313----DGIDWELVWKLSRTH-GVAPLVYRNLV------------------------.TIC................P..A.
B8HL63_CYAP4/37-290----HPLDWPYLEAIALRH-QVFPLFYRRLE------------------------.SLG................L..E.
C6CW48_PAESJ/39-291----HGLDWPLFLRFAVYH-ETYPILYPLLV------------------------.QLN................A..K.
E3GKM5_EUBLK/27-271----LGCDWDVVYREARRH-SVAGMADYGLE------------------------.KLA................E..E.
Q5V4C2_HALMA/33-294----DAPDWDRVVALARYH-GIVQLLYEGLE------------------------.AMARE............SGD..E.
B0CA05_ACAM1/43-304----HSIDWHHFLRLTKFH-KVIPPVYQCLK------------------------.QHT................H..K.
E4NR20_HALBP/45-311----PEVEADEVLTAAHHL-GVGPLVASHLT------------------------.DAD.....................
D0MJ16_RHOM4/27-280----GLADPAEVARLAVQQ-GVGPLLYRALK------------------------.AAS................P..A.
D5C0P8_NITHN/38-283----SSLNWDKLLYYAQVH-ALTPLVHEVIA------------------------.SQY................Q....
E4T3H3_PALPW/32-289----EVKDWDYLTKTIIDR-GIAPLLFKKLP------------------------.ALK................N..S.
B8HYI9_CYAP4/46-308----PGLDWTYVLNQANDH-GLMPLLYRQLV------------------------.SLT................H..A.
Q2S9G8_HAHCH/40-294----ESSDWECFLQQLRWH-RVTPLVWRNLS------------------------.AAG.....................
E0RZJ9_BUTPB/57-297----DGIDIGELINYAAKG-HIYYPIASSLI------------------------.KLD................I..D.
F2NH29_DESAR/30-285----GKIAWPDFLRWVDRH-RVAPLVYENLR------------------------.RYG................G..N.
E6UIV6_RUMA7/27-267----KDIDIERLYQLAKYH-TVRAAVNIALK------------------------.SAG.....................
B3DZF9_METI4/33-292----GSFHWELFYNLCFVH-GLWGFVLDNLN------------------------.GRF.....................
F2JWV8_MARM1/27-283----NEEEVSLLARTCAQH-RIGPLLSESIK------------------------.KAN.....................
D9SE91_GALCS/39-298----PLIHADALIWLAIRH-RIEPLLYHNLK------------------------.QHA................V..G.
D1CIV7_THET1/37-287----QPFDWPRLLAIAHSQ-DVVPVLPYSPL------------------------.WSA................V..R.
D2QFF6_SPILD/34-281----QPINWHRVYTLAVRH-RLTPFLYRSLY------------------------.QIP.....................
D4LAD3_RUMC1/30-273----EQMQLRPMLSLAQQH-TLGAMTCMSFE------------------------.HAG................L..L.
Q7N4C9_PHOLL/37-311----TEFPWDRFLSVVNRQ-KIVGIVYKSLS------------------------.EMK................L..L.
E6UK59_RUMA7/32-272----DKINLSQLYEVAQTH-SLTAITAYAID------------------------.SSN.....................
E8X100_GRATM/35-290----NDIDWRAFLAAAHSH-RLSPLALCGLQ------------------------.SAA................L..S.
D1YWY8_METPS/61-314----SISQWYELFSALKPH-GILPLLYWQIL------------------------.HIP................Q..E.
A9AY74_HERA2/29-280----SPNDWKVLAHLADYH-EVEGLLWSVLR------------------------.HQA.....................
E8UZW2_TERSS/40-293----SSIDWSRLLRIAHRN-RVKGLVFSSLS------------------------.THG.....................
Q5ZRD2_LEGPH/18-272----TSFSAPEILKTAQRM-RLTNSVYTILR------------------------.EHY.....................
Q2W7B9_MAGSA/35-286----AIGDWSQVVAGATSH-HVVPLVADLAL------------------------.RPG................A..A.
Q47DA0_DECAR/28-284----TLTDWDDTLRLARQA-RLLGLLGHRLC------------------------.EQK................DIWA.
A5VF23_SPHWW/48-301----DRFDWDELIGMAARG-RLLVQVQHGLL------------------------.VSG................I..A.
C7RTZ8_ACCPU/29-287----PPADWELLLRVARRV-RLLGRLESELS------------------------.RLG................L..L.
A9NH68_ACHLI/22-261----DSQDELELTKIIFEN-GLVGLLFETID------------------------.KSS................F....
E4NA58_KITSK/44-325----PDLDWGAFTDAAARH-KLLPLVGRHVH------------------------.RHR................L..D.
Q220U3_RHOFT/22-279----SGQQWDLLIRQARRT-KLLARLAHTLE------------------------.RAG................L..L.
C8VW96_DESAS/31-295----SHSKPECLTNRLNEL-QVIALFYDAVS------------------------.SEK................V..P.
Q1IJX8_KORVE/41-297----EQVGDEVAWQVAKQH-ELEGNLGHRLI------------------------.DIL................G..E.
Q0ACH9_ALKEH/23-281----RLGDWDALLRVARVA-SLEARLHALLQ------------------------.ERD................L..F.
Q2G399_NOVAD/40-294----DEEGWSDLAALAEDK-RAAPLVRRSIA------------------------.IAG................I..Q.
Q82U71_NITEU/28-285----DNRQWELLLRLARRA-QLSGYLAAKLE------------------------.KDG................L..L.
E8X2I6_GRATM/22-260----SDVEWEQAFELAEAE-QVLPSFVSTLR------------------------.RSG................L..P.
Q2N714_ERYLH/28-286----TEADWQRIDIIAAQH-RLSPHLHGRLE------------------------.RGE................L..D.
A1K446_AZOSB/28-282----TPPQWTALLAAARAA-NLLGTLAARLT------------------------.DAG................I..D.
Q3SG05_THIDA/23-278----SMADWDTLVRQARAA-GLLARLAHRLR------------------------.EHG................M..A.
A0L573_MAGMM/21-281----PPAEQEPLLRMLRVE-GLLAHVGARLQ------------------------.ASP................H..W.
A1SY03_PSYIN/35-284----KKVNFDRLQTLIIQH-RTHPCIYNNIR------------------------.QHF................I..E.
A5VCA1_SPHWW/21-272----APDGWTSLLAIARAE-RLDGSLAYRLA------------------------.DMP.....................
Q1GTD6_SPHAL/21-273----APRDWDRVITVARAE-AMLGTLAHRLD------------------------.ETP.....................
C6W7P4_DYAFD/31-292----APFDPQKYLALAKWH-QIRPLAFEHAA------------------------.EKS................L..D.
A2U3F5_9FLAO/33-287----NAVNWDDIVKLSTAH-YVFPALFCNLK------------------------.KAN................F..L.
Q2RPP9_RHORT/33-290----DGATWDRLIPLARHA-GVLGRLGYLID------------------------.AAG................L..T.
Q98C81_RHILO/47-300----PNLSAAAVADIARLN-KVATFVLKVLS------------------------.RAP................V..G.
D3SEY4_THISK/21-280----TAAEWAPLLAAARES-ALPGTLWHLAD------------------------.DAG................L..A.
D4Z532_SPHJU/20-266----DAGGWNALVAMARAE-RLIGTLALRIG------------------------.DRP.....................
Q5P7H0_AROAE/23-275----DTARWEHVLRLARMT-GLHGRLAAS..------------------------.NDG................N..S.
D9R9Y8_CLOSW/28-270----RQPDWEKMYRLADYH-NVAHAVYYGIM------------------------.GLE.....................
C8X6N8_NAKMY/33-276----SATEIDEFVDAARLH-RIAPLAYVATR------------------------.GLD.....................
E8WZ57_GRATM/42-294----SEREWKSNLKWLDTS-GLALYLLGHLQ------------------------.ELG................V..G.
A1WX94_HALHL/26-285----PESLWTGILAVGREN-LLLGALWHRAV------------------------.SCG................V..E.
C4ZNM3_THASP/23-275----PEARWDRVLRLARMT-GLHGRLAAANA------------------------.DNP.....................
B9JQN6_AGRRK/37-306----SAEEFAQLFAAIRIH-RVAGLVQQLIK------------------------.AQQ................D..NS
Q15WK0_PSEA6/24-278----THTEWEFLIRIAREA-SVLPRVAYALD------------------------.SVI...................E.
E3FNY0_STIAD/23-272----RGAPWEDFVDWAIAQ-GLAPLAAYNLE------------------------YRLG................G..A.
A7HIS8_ANADF/20-254----PDADPALLADVLEAH-GLAPLASYQLE------------------------.TTR................L..G.
Q1DDG5_MYXXD/51-300----RGAPWEEYVDWAIMQ-GLAPLAAYNLE------------------------.YRL................G..A.
C2X1P1_BACCE/40-289----SDIDWELFLEQAVHH-RVYPVIYQKLK------------------------.QVD................E..E.
D4KWT4_9FIRM/552-802----.ETEWESILSIADRH-RVLPLLYDVLE------------------------.NIL................P..E.
D4MW73_ANAHA/28-281----.TQDWEKIYDISQKQ-QLAPMIYQQIF------------------------.SNE................S..F.
F2G8P1_ALTMD/26-277----..KTLSELFVFLRAA-NLLSIFAHKIK------------------------.RKN................M..V.
I1YWC5_PREI7/27-278----.KKDFSALQNIANMQ-TVNGLVYSSLI------------------------.NNN................V..K.
I3YL41_ALIFI/31-278----.DPEWSRVYGQAAQQ-GVLAVAWESVR------------------------.RLS................P..D.
I3YQI9_ALIFI/33-278----..RQWDDIFRMAADQ-GVCAVIGDGME------------------------.RLP................E..K.
Q8KKS5_RHIEC/2-289----........VWRAEHN-RTVPLLENHLR------------------------.RLD................L..L.
Q8XN73_CLOPE/29-276----...KWNEIMCEANAH-EISALIYSSIY------------------------.GIK................S..L.
R5QD91_9FIRM/30-263----.KEEIERVIKCARVH-GVLPFLQECPV------------------------.FME.....................
R5QEH8_9FIRM/29-271----.ETDWGKFYRICKFH-KIQSMVCPGIQ------------------------.KLP................K..E.
R5XE76_9CLOT/30-276----...DLVYIYKMSEIH-HVVPMIYNAAY------------------------.NED................F..F.
R6KK05_9BACE/28-278----.SADWEEIYQLARTQ-ALLAITFDGVL------------------------.SLP................A..E.
R6QP25_9CLOT/29-271----.GVDWEKLYRICKFH-KIEAVVAHGID------------------------.KIS................G..K.
R7JPI5_9BACT/51-294----SEEDWTRLFTLAAQH-GVTALLFDTIL------------------------.RLP................E..Q.

PF10706

A6TJ11_KLEP7/73-246MDTTQVTLIHKILAAADER-NLPLWIGGGWA--------------------------ID--------------------A
Q8YL66_NOSS1/1-174MNDLHIELIHQLFAASDKI-NLPLWLQGGWA--------------------------ID--------------------A

PF04991

Q753A8_ASHGO/506-745---------------TNSS-NLVTWVAHGSM--------------------------YA-------------------WM
A5DCG8_PICGU/263-461---------------AREA-GIDTWLAHGSA--------------------------LG-------------------WY
A6LC14_PARD8/39-262---------------CRKH-DISYWMCSGTL--------------------------LG-------------------AV
Q87Q28_VIBPA/24-242---------------CERH-DLEYSLAGGTL--------------------------LG-------------------AI
Q03SH4_LACBA/23-245---------------CHQL-GLPYFLMGGSL--------------------------LG-------------------AI
A7TLM6_VANPO/513-754---------------TKAN-GIISWLSHGTL--------------------------YG-------------------YF
A6M2A9_CLOB8/33-257---------------CDKH-NIRYFLDAGTL--------------------------IG-------------------AV
YJ31_YEAST/469-720---------------VKAN-GLISWLSHGTL--------------------------YG-------------------YL
Q03GP1_PEDPA/22-243---------------CDKH-DIKYMLIGGTL--------------------------LG-------------------AI
A8AZQ7_STRGC/28-259---------------CKEH-GLISYMVAGTL--------------------------IG-------------------SL
A6LBV7_PARD8/43-251---------------AKEN-NIPYWIDGGSL--------------------------IG-------------------IV
A5UNE2_METS3/36-262---------------CEEN-DIEYFADSGTL--------------------------IG-------------------AI
A5UND9_METS3/81-296---------------CKKH-DIDYWLEGGTL--------------------------IG-------------------AV
Q6FSB7_CANGA/473-717---------------TKAN-GLITWLSHGTL--------------------------FS-------------------HL
Q832Q2_ENTFA/24-252---------------CRSN-NLHYTLFYGTL--------------------------IG-------------------VE
A5UNH1_METS3/30-252---------------CEEN-NIEYFIYGGSA--------------------------LG-------------------AV
MNN4_YEAST/490-746---------------TKAN-GIISWLSHGTL--------------------------YG-------------------YL
A7TID6_VANPO/522-767---------------TKAN-GIISWLAHGTV--------------------------YG-------------------YL
A6LD13_PARD8/44-278---------------CEKE-GLTLMLSGGSC--------------------------LG-------------------AV
Q6FRE8_CANGA/512-760---------------AIAN-GLVSWLSHGTL--------------------------YG-------------------YM
A6LI11_PARD8/44-274---------------CSKY-GLCFMLGGGSV--------------------------LG-------------------AV
Q2NIC1_METST/35-244---------------CQKY-ELKYWLDYGTL--------------------------LG-------------------AI
A6L4H8_BACV8/26-253---------------CKRH-DLTYYVYGGTL--------------------------LG-------------------AI
Q9CIZ2_LACLA/24-251---------------CREN-GIEYTLAGGSL--------------------------IG-------------------AI
Q832P6_ENTFA/27-250---------------CEEH-NLTCYFCGGGC--------------------------IG-------------------AI
Q6CV94_KLULA/470-711---------------VKAN-GLISWLAHGTM--------------------------YG-------------------WM
B0URY8_HISS2/24-243---------------CAKN-DIQYSLGGGTL--------------------------IG-------------------AV
D6CZV8_9BACE/24-240---------------CKEH-NLRYYIMAGTM--------------------------LG-------------------AV
G0VHC4_NAUCC/584-836---------------TRAN-GLISWLGHGTL--------------------------YG-------------------YL
LICD_HAEIN/24-243---------------CERY-KISYSLGGGTL--------------------------IG-------------------AI
Q1G8I9_LACDA/45-275---------------CQKY-DIPWYLSGGSL--------------------------LG-------------------AV
Q6CV92_KLULA/338-579---------------..SN-DLTAWLAHGTL--------------------------YG-------------------WL
Q8CWR1_STRR6/24-245---------------CKKH-DIPYFLSYGTM--------------------------LG-------------------AI
Q8DPD7_STRR6/25-246---------------CKEH-DLLCYLCGGGA--------------------------IG-------------------AL
Q8DPI0_STRR6/24-243---------------CKKH-NINYIINYGTL--------------------------IG-------------------AV
Q8DYQ6_STRA5/24-249---------------ARDN-KIEYSLGGGSL--------------------------LG-------------------AM
Q8R630_FUSNN/25-234---------------CNEN-KIRYWLDSGTL--------------------------LG-------------------AV
R5K6F7_9CLOT/25-248---------------CEKH-GLRYYLCGGTL--------------------------LG-------------------AV
R5U2Q7_9BACE/28-256---------------CRKH-DIPYFVIGGTA--------------------------IG-------------------AL
R6N240_9CLOT/23-251---------------CDEE-QIRYYLSSGTL--------------------------LG-------------------AV
R6N4Y5_9CLOT/26-257---------------CEKH-SLEYFAVDGTL--------------------------LG-------------------AV
R6X1W1_9PORP/32-241---------------CRKH-GIRYWLSSGTL--------------------------LG-------------------AV
R7EDL2_9BACE/24-240---------------CKEH-GLRYYIMAGTM--------------------------LG-------------------AV
R7EEU8_9BACE/31-244---------------CTKY-DIPYWLDGGTL--------------------------LG-------------------AI
R7EJM5_9BACE/32-245---------------CRKH-KLSYWLDGGTL--------------------------LG-------------------AM

PF04229

Q7UQR9_RHOBA/21-182----------PIRLMHHDA.RWKQEFEQTRS-------------------------------------------------
F4FG59_VERMA/4-164----------AVEIVDYQP.AWGVDFTELGS-------------------------------------------------
H6L1E0_SAPGL/5-166----------TIEVCPYRE.DWPQAFAKEKA-------------------------------------------------
E4N0U3_KITSK/9-181----------.VLVLPYDP.DWPARAADLAA-------------------------------------------------
D1BEG0_SANKS/7-190----------PARLARYDD.TWPVRAAEVLA-------------------------------------------------
T0T7N8_9STRE/5-167----------DVVVISYQE.SWKDDFEQISK-------------------------------------------------
F0R0L2_BACSH/21-180----------KIILHEYDP.QWKLLFQHEKA-------------------------------------------------
R6RXV9_9CLOT/9-171----------TVKLIPHQE.EWDQNAKEMIG-------------------------------------------------
C7M6I7_CAPOD/21-178----------PINLTQHNP.LWKEWYEEERS-------------------------------------------------
K9PW19_9CYAN/3-165----------KVEVVAHNL.SWKKEFEQESR-------------------------------------------------
F8I524_SULAT/19-179----------RVHVEPYNP.LWAVRFQDEAA-------------------------------------------------
D9S0W3_THEOJ/3-164----------KVVVTDYNP.MWPAMFEAEAA-------------------------------------------------
R6D2S7_9CLOT/3-163----------.VIVTAYNP.NWPALYEQEAQ-------------------------------------------------
C1A083_RHOE4/211-392----------.PELAPADP.SWPAQAERIIG-------------------------------------------------
E1VYF6_ARTAR/165-333----------.IEIAEPSP.HWVPDFLALHA-------------------------------------------------
W6R4W1_9RHIZ/3-163----------PVRVVDYDP.KWPDLFEAARA-------------------------------------------------
W5TQQ6_9NOCA/29-187----------PVEIVAYDP.NWPQRFETQAA-------------------------------------------------
B2TLP2_CLOBB/5-165----------HVIVEDYNP.KWKESFESIKD-------------------------------------------------
B9JDR1_AGRRK/3-162----------PIRLVDYDP.AWPALFQSRSA-------------------------------------------------
I0H1C1_ACTM4/212-377----------NLRIVPFDP.EWPARADRLIA-------------------------------------------------
F9UMA6_LACPL/43-192----------PIQLTAYQS.DWQKQATEYQT-------------------------------------------------
Y3154_VIBCH/37-187----------...ADEYQA.SCENLYRKYEL-------------------------------------------------
Q81YH7_BACAN/4-173----------RITIEEYNI.KWESEFNKLQT-------------------------------------------------
E6S9I6_INTC7/214-387----------..AVVAPRS.DWGERGARLVA-------------------------------------------------
W5TJ52_9NOCA/212-391----------AIEVTDHDP.AWAQQAQRLIA-------------------------------------------------
K9XBR5_9CHRO/3-167----------EIIIVEYDP.HWSQQFEAEAT-------------------------------------------------
E3GIN1_EUBLK/3-163----------PIILKKHNP.NYKDWYEEEKQ-------------------------------------------------
K0KAS1_SACES/227-393----------PLNVLPYDP.TWPEQAARVGA-------------------------------------------------
A8AWN1_STRGC/18-179----------PIFLREHQL.EWKDWYEEERL-------------------------------------------------
D4J128_BUTFI/5-166----------HVVVLPYNE.KWKQDFTTIKE-------------------------------------------------
A4FKT9_SACEN/207-379----------SPVLVEPDP.EWPRTARRLLA-------------------------------------------------
B6QAD6_TALMQ/29-191----------PITIIEYDI.IWPEQFSIVHQ-------------------------------------------------
D1AHI7_SEBTE/18-178----------PIILKDYNP.EYRNWFGAEKQ-------------------------------------------------
R4KDL8_CLOPA/5-164----------HVVVEDYNP.NWKYEFEKIEA-------------------------------------------------
A5G319_ACICJ/3-168----------HVEMAEYDP.AWPGMFETEAR-------------------------------------------------
H6N9P1_9BACL/2-161----------KVRLSEYSE.NWTRLFQEEAD-------------------------------------------------
Q2K5X8_RHIEC/4-163----------PVELVSYDR.EWPEAFQRIRA-------------------------------------------------
Q8DTG8_STRMU/18-179----------PIFLVEHKE.EWEDWYEEEKE-------------------------------------------------
C4KZG2_EXISA/3-162----------KVEVVKYNP.EWNQKFEEEAS-------------------------------------------------
E4NR36_HALBP/5-165----------PITIAEYNP.EWPDIFERERQ-------------------------------------------------
I7EVS4_PHAIB/4-164----------...VVAPDP.TWPAQAQAEAG-------------------------------------------------
K0NHL1_DESTT/8-169----------TVRVVDHNS.GWADLAAQACR-------------------------------------------------
K0JPZ1_SACES/83-263----------PPVLHDHDP.DLPVVARRLLD-------------------------------------------------
H6NPI6_9BACL/17-180----------PVTLAPPDP.QWPAQGENLRQ-------------------------------------------------
Q88IL4_PSEPK/6-162----------..KITPYDP.TWPARFLTDKP-------------------------------------------------
Q65HR6_BACLD/152-312----------KVKVVSYKE.EWKGEFFKEKK-------------------------------------------------
D8MSB8_ERWBE/3-163----------IVVVAPYDQ.QWPVQYQAERA-------------------------------------------------
R5WT49_9BACT/2-163----------NIRVVPYNP.EWPAAYEHEAA-------------------------------------------------
R5MRQ0_9BACE/17-180----------PILLTEHQE.NWKDLYIQEEE-------------------------------------------------
L0IAX8_HALRX/8-169----------TVELVTHRE.CWRGTFEAEAN-------------------------------------------------
Q55AI9_DICDI/5-191----------SVTVVEHDP.RWKELFLEEEK-------------------------------------------------
B0C1Z8_ACAM1/3-165----------TVEVVSHNP.AWKMIFQTEAS-------------------------------------------------
A7MK97_CROS8/6-166----------QIVLEPYNP.AWPAQFAEEEK-------------------------------------------------
C8W1B5_DESAS/176-344----------PIVLREYNP.AYPRWFAEEKA-------------------------------------------------
Q83EE3_COXBU/18-178----------IIEVVPYDP.DWSNQFEKEAL-------------------------------------------------
D3FQ45_BACPE/3-163----------KVQVVPYQK.DWPDAFYRERE-------------------------------------------------
B8NAT5_ASPFN/26-188----------LIEIVEPDP.TWPESFAIIAR-------------------------------------------------
D2PRV9_KRIFD/5-169----------RITITEYDV.HWPALFEQQRR-------------------------------------------------
C5C5E0_BEUC1/9-171----------PVRVVPARA.GWAAEGSELVA-------------------------------------------------
M2MR17_BAUCO/24-208----------ELTIVEPDS.QWIDHFETFKA-------------------------------------------------
K1W9P8_TRIAC/2-167----------PIQVVEYDP.AWPEYFASLSA-------------------------------------------------
I0H425_ACTM4/12-172----------VIRIADHDP.AWPARFAEMGD-------------------------------------------------
Q81PM3_BACAN/8-166----------KVFLVPWTE.EWEFEFMKEKQ-------------------------------------------------
V5FMN7_BYSSN/27-191----------RLEVVEYDP.TWPESFRVISK-------------------------------------------------
A5I088_CLOBH/18-180----------PIILEEHNP.LWEEWYLEEKK-------------------------------------------------
R6CHS7_9CLOT/8-171----------RVTLYPHQT.EWDEQARRTME-------------------------------------------------
K9QG42_9NOSO/2-163----------KVEVVPHNP.NWRSQFENESK-------------------------------------------------
F0RLV6_DEIPM/12-172----------TIEVVPYDP.AWPAQFEAIAA-------------------------------------------------
YZZE_STRCO/25-180----------EIGLSDYDA.RWAETYLRHRR-------------------------------------------------
R4TB77_AMYOR/212-382----------.PKIAPYDE.TWPVQAERALA-------------------------------------------------
Q480R9_COLP3/9-169----------VIEVVDYDP.NWKNIFEIEKV-------------------------------------------------
R7K5K1_9FIRM/2-163----------KVEVVDYRP.EWAEMYAAEAE-------------------------------------------------
K9XRX3_STAC7/4-167----------KVEVLPHNP.KWRDEFAKEAN-------------------------------------------------
D2R1G3_PIRSD/2-160----------NIEVASYDP.RWPLLFAAERD-------------------------------------------------
C7N2S7_SLAHD/18-179----------PISLVEHND.AWRQQYAEIAS-------------------------------------------------
W5W422_9PSEU/211-378----------APELVPYDP.SWPEQAARVAA-------------------------------------------------
R4PVG6_9BACT/9-168----------TVKLVNYSR.DWPSDFLHEKE-------------------------------------------------
Y4798_PSEAE/21-183----------RIEVLPADP.AWPQHFAAEAE-------------------------------------------------
R5AL68_9BACT/11-171----------PIVLAAYNP.DWSEWAKEEIL-------------------------------------------------
Q5ZY58_LEGPH/204-370----------HIDIVAYNT.EWPLLAKAEMV-------------------------------------------------
U5RPT9_9CLOT/8-169----------KVRLLPHCE.EWKEEFEEVKK-------------------------------------------------
C8WR35_ALIAD/281-442----------PVSLTEVST.RHLLAFERERE-------------------------------------------------
YQKA_BACSU/153-313----------KVEIILYNE.KWAECFDEEKE-------------------------------------------------
B8FH40_DESAA/17-183----------KIDMAPYNP.ARPEMFRQEAE-------------------------------------------------
I0DNI9_PROSM/44-202----------KIEIRDYDP.IWATLFIQEKA-------------------------------------------------
D6ZD81_SEGRD/214-391----------..VLAEPDP.TWQAQAARLIA-------------------------------------------------
S6AG51_PSERE/6-162----------..TISHYDH.NWPALFSAERA-------------------------------------------------
G8RQ26_MYCRN/217-398----------EPVLVPSDP.SWPDQARRIAA-------------------------------------------------
G0G9J0_AMYMS/26-185----------TVTLADYDP.EWPKLFEREAE-------------------------------------------------
H5WXT5_9PSEU/241-411----------.PVLVEPDP.SWPRQAERALA-------------------------------------------------
A0QU49_MYCS2/32-190----------PVAIVAPDP.RWPARYRRLAE-------------------------------------------------
K9RII6_9CYAN/3-167----------EIEIVKHNP.NWANMFEAEAE-------------------------------------------------
R7YMF0_CONA1/4-163----------PVIVEDYNP.AWPSDFEAIRA-------------------------------------------------
Q7MJH4_VIBVY/9-159----------..HAEEYQA.SCEQRYQKYKS-------------------------------------------------
K0JYW2_SACES/116-273----------TVELVPYDD.GVVAQYEQDRA-------------------------------------------------
C6CZF7_PAESJ/4-164----------QWRIAVHNP.QWHDMFQETAA-------------------------------------------------
I4EWN3_MODMB/45-201----------QISVVDYDA.RWPTRFREIAE-------------------------------------------------
R6USG1_9FIRM/169-332----------PIVIRPYNE.QYTAWYDAQQL-------------------------------------------------
G3JC83_CORMM/22-188----------TITIVDADP.SWPCTFAQLAS-------------------------------------------------
R6K9E4_9BACE/11-174----------PIILTEYQK.DWERLYKLEEQ-------------------------------------------------
Q5HQZ0_STAEQ/13-170----------......SVK.QFTYEYNKVKD-------------------------------------------------
A3QDM7_SHELP/4-183----------SIVVIDHQM.SWHQAFKVEKA-------------------------------------------------
Q8TK81_METAC/20-182----------IVRVVPYDP.EWKTEFLKIKA-------------------------------------------------
I7BP47_NATSJ/8-170----------PIELVPARYDAWRECFVAERD-------------------------------------------------
A6WAJ0_KINRD/50-209----------PAVVVDYDP.HWREDFDMLRS-------------------------------------------------
A0JWM9_ARTS2/214-385----------..VLAPADP.TWGTQAARLAG-------------------------------------------------
C7YUZ2_NECH7/30-193----------PLAIVEPDP.SWPATFDLLKA-------------------------------------------------
F8L3S4_SIMNZ/8-166----------TIDLLPYDP.SWKDQAEKEIE-------------------------------------------------
M2YLJ2_DOTSN/41-212----------..AILPPDP.QWFSHFETFKA-------------------------------------------------
Q1D1T3_MYXXD/32-190----------KVAVAPYDA.GWPTRYAELAV-------------------------------------------------
R8BXH6_TOGMI/31-193----------PIEIVESDP.AWPATFERVAS-------------------------------------------------
V6K242_STRNV/29-199----------QVTLGEYDP.HWPAVYEREAA-------------------------------------------------
D6GQ99_FILAD/18-178----------PIFLVEHNP.LWKVWYEEERN-------------------------------------------------
I0JMF1_HALH3/3-163----------RVQVNLYDE.TWPLRYEAERK-------------------------------------------------
D2SB44_GEOOG/32-188----------TVVVQDPDP.EWPVRFSAVRD-------------------------------------------------
W8EQN2_9BACT/18-186----------PVELVAHDA.GWKDLFEQEKQ-------------------------------------------------
C6WGV0_ACTMD/28-186----------AVVIAPYDP.AWPARYAELAR-------------------------------------------------
D3EI21_GEOS4/6-165----------AIHLEPYDK.QWADRFNDEHR-------------------------------------------------
M3AHS4_PSEFD/34-203----------KVSIVEYNP.LWPERFLSAKS-------------------------------------------------
V9X9E8_9NOCA/211-393----------.PVLVPARE.EWHRQAQRLVA-------------------------------------------------
R5A7J0_9CLOT/21-180----------TIQLQDYNP.AWPKQYQVEEK-------------------------------------------------
I2EU23_EMTOG/3-172----------...IQEYRE.SWIEDFKAIKS-------------------------------------------------
E6UAG3_RUMA7/4-166----------PVVVEQYNE.EWAADFQAIKA-------------------------------------------------
R5VAK1_9FIRM/4-165----------HIVVREYDP.NYPLMFEKEKK-------------------------------------------------
I2F809_9BACT/5-167----------PVIVAEYDS.SWPELFRREAE-------------------------------------------------
A0A0D2YDZ7_FUSO4/30-193----------PIAIVEPDP.KWPEHFARAKA-------------------------------------------------
W5W1G6_9PSEU/88-244----------TIHIAEPDP.DWPARFQAERA-------------------------------------------------
C4ZJM8_THASP/15-182----------RVEIVPYDP.AWPGLFAEEVA-------------------------------------------------
Y1888_BACHD/32-191----------SITLLEYDP.RWPKLFDREAK-------------------------------------------------
D5UGE0_CELFN/2-161----------RVFVVPYDE.CWPSAFESVRR-------------------------------------------------
K0ETX6_9NOCA/211-393----------ELRLVPANP.EWAAQAQRLIA-------------------------------------------------
Q0ANT8_MARMM/3-164----------.VDVVDYDP.GWPARFTDERK-------------------------------------------------
B9M8V0_GEODF/15-182----------EVAIVPYDP.RWRDLFEEERR-------------------------------------------------
E9FC77_METRA/32-195----------.LEIVEPDP.TWPQQFERLKA-------------------------------------------------
Q5UW62_HALMA/8-169----------TVELVPHQE.EWKHHYENEVA-------------------------------------------------
D7AV49_NOCDD/30-189----------RVRLSEYDP.KWPYLFRREDG-------------------------------------------------
W5WGD4_9PSEU/84-261----------.PELAEWDP.SWSITAERLLN-------------------------------------------------
V5XFQ0_MYCNE/214-379----------DAAVVPYDA.SWPDQAQRILA-------------------------------------------------
G2XBV0_VERDV/31-198----------PLIVEPYNA.AWPTMYLAVAL-------------------------------------------------
A0A016PCG5_GIBZA/30-193----------TIAIDEPDP.SWPHHFDLAKT-------------------------------------------------
C6WB47_ACTMD/210-381----------PPKVVDPDP.TWPAQAARIAA-------------------------------------------------
Q0SI30_RHOJR/210-391----------.PELAPPNS.QWPAQADRLIA-------------------------------------------------
A3CX26_METMJ/18-179----------HVRVVDYDP.VWPDLFRTEAR-------------------------------------------------
D5BAN2_ZUNPS/18-185----------PIHLEDHNP.AWKTIFEKEKK-------------------------------------------------
D1BE93_SANKS/25-181----------HVDLHDYDE.RWPVLYREHEQ-------------------------------------------------
J7L577_NOCAA/28-187----------RIAIVPHDP.KWPYLFRQEAD-------------------------------------------------
I0JT44_HALH3/47-207----------TVSLRSYHP.EWPVLFEQEQE-------------------------------------------------
W0BB67_9GAMM/10-170----------LIEVVPYDF.NWPLQFEQEAK-------------------------------------------------
Q4KFG9_PSEF5/6-162----------..KISLYDD.HWPAAFAGEKA-------------------------------------------------
R5EZV1_9CLOT/22-183----------PVFLTEHRP.VWAQWYQEERE-------------------------------------------------
Q189F3_PEPD6/18-179----------PIFLTTHKE.CWKNWFKEEQY-------------------------------------------------
R5J8J7_9CLOT/11-172----------.LIIMDYTE.DYKRIYDAEKE-------------------------------------------------
E8N7N1_MICTS/6-189----------PAAIAEHRP.EWAARAAALLV-------------------------------------------------
COAE_MYCPA/210-395----------PVRLVPPDP.EWPAQAQRIVN-------------------------------------------------
Q82TF0_NITEU/35-196----------RIQLAEYDL.RWPSMFSVAAD-------------------------------------------------
Q81CT5_BACCR/4-164----------QIVIKPYQK.EWVEEYIKEKE-------------------------------------------------
I0KB45_9BACT/5-175----------PIHIADYSP.AWASAFDDLAA-------------------------------------------------
D2Q1S7_KRIFD/4-173----------SITIVRPDP.TWAAQFDKTAQ-------------------------------------------------
D3PXU1_STANL/211-382----------TITMADYSP.QWPSRFERLAA-------------------------------------------------
B2VVX8_PYRTR/3-161----------.VVVEQYNT.EWPQQFERIKA-------------------------------------------------
W6RMG9_9RHIZ/5-164----------.VELVPYDA.SWPDHFLRIAD-------------------------------------------------
Q837C3_ENTFA/3-163----------.VIVTEYQP.AWVEQFEEEAQ-------------------------------------------------
E8SKB4_STAPH/10-169----------...TENQQP.FYATQYEKYQH-------------------------------------------------
G8SCS9_ACTS5/212-375----------ELHIVPPDP.GWPQAAERLIT-------------------------------------------------
H6R024_NOCCG/201-383----------ELRLVAPDP.DWDAQAQRLIA-------------------------------------------------
D3HRN8_LEGLN/9-169----------LIEVHPYDA.NWPMHFLQEAG-------------------------------------------------
F0JD71_DESDE/16-183----------RIRLVPPDP.AWPRLFEEEKA-------------------------------------------------
H6LKW2_ACEWD/9-173----------PIILKEHNP.KYKEWYEIEKR-------------------------------------------------
COAE_MYCLE/210-398----------PAGLVTSDP.IWLGQAKRIVA-------------------------------------------------
R9TA40_9EURY/18-177----------PIRLTEHNA.EWKDQYAEMAI-------------------------------------------------
R5NDU7_9BACT/18-177----------PIYLTEHQP.YWKEWYTDEES-------------------------------------------------
E3FUL3_STIAD/60-221----------.LEVRAYDP.SWPVLFERERQ-------------------------------------------------
C7QZ85_JONDD/13-170----------PVELKEADP.LWPLVAAEWSN-------------------------------------------------
U5LFL0_9BACI/7-168----------KVDVQPYSR.SWADSFQEEKQ-------------------------------------------------
B1YEV6_EXIS2/3-163----------QVIVTPYQS.SWPDAFQQAKE-------------------------------------------------
G9N0Q7_HYPVG/30-192----------KIEIVEPDA.SWPQSFKLLKE-------------------------------------------------
D0LRK4_HALO1/63-218----------....KDYDP.AWHVWFAAERQ-------------------------------------------------
K9UHL6_9CHRO/4-165----------KVEVVPHDR.NWQSAFADEAQ-------------------------------------------------
Q0U0A7_PHANO/2-162----------PITVLSYDP.AWADDLAQIKK-------------------------------------------------
K9X9I3_9CHRO/3-165----------KVEVVPHNP.QWQDAFVKEKQ-------------------------------------------------
H1ZDJ0_MYROD/6-189----------....EPYNP.KWKEQFEKIKS-------------------------------------------------
C6CSH6_PAESJ/2-161----------EVRLSDYKE.EWAQMFREEAE-------------------------------------------------
I0KC39_9BACT/4-171----------PVEIVPFDP.RWFDLFDQERK-------------------------------------------------
A5I0C7_CLOBH/9-169----------IIEVVPHNP.RWKIGYEKEAN-------------------------------------------------
D1CF17_THET1/8-168----------PVIVVPYDP.EWPNLFQAFAH-------------------------------------------------
U5VXI8_9ACTN/209-373----------ALHVVPSDP.TWPEQAERVIA-------------------------------------------------
R7XXE7_9ACTN/3-160----------.VEVVAWSA.DWARDFERVAA-------------------------------------------------
C7N047_SACVD/214-386----------PPKLVPADP.TWPAQAARILP-------------------------------------------------
R4KA00_CLOPA/5-167----------KVIVVPYDS.KWNDEFEKIKF-------------------------------------------------
F2F973_SOLSS/9-173----------EVVLVPYEA.GWKSEFADTKK-------------------------------------------------
E3HNB6_ACHXA/38-195----------.VAVVPYDP.DWPVRYGRLES-------------------------------------------------
B1MAV8_MYCA9/211-383----------.PELMPADP.TWPVQAQRVIN-------------------------------------------------
R7NHU4_9MOLU/7-167----------IVELVDYDS.NWDNEYRKEEE-------------------------------------------------
G0G0L6_AMYMS/196-366----------.PKIAEYDL.GWPAQAERVLA-------------------------------------------------
S5RIM5_9STRE/14-176----------EVLLLSYQE.SWKDDFEKIAK-------------------------------------------------
A8FEV1_BACP2/150-310----------KVEVIEYQT.SWPDECRRELA-------------------------------------------------
Q2KDV8_RHIEC/3-162----------AIKVVDYDP.SWPLLFAEISA-------------------------------------------------
W6R743_9RHIZ/15-174----------TVSLAEPNT.LWQQAYANEAH-------------------------------------------------
R5T2X8_9FIRM/18-179----------PIFLVPHKK.EWAGWYREEKG-------------------------------------------------
G4L3G4_TETHN/32-191----------PIKLVDYNP.NWVDLFEREAK-------------------------------------------------
K9U9A9_9CYAN/3-168----------NIVIVEYDR.QWVELFEQEAI-------------------------------------------------
Y2534_DEIRA/32-184----------..DLISPDPGRWAARFDRHRW-------------------------------------------------
A8FA86_BACP2/8-167----------EVFLVPWSA.EWGKEFEREKK-------------------------------------------------
R8BCT1_TOGMI/34-197----------TIEIVEPDP.SWPAAYAEVEA-------------------------------------------------
R5X925_9FIRM/14-176----------AVAVEAHKA.EWEAAAKKTIE-------------------------------------------------
GRPB_BACPE/8-173----------EVILVTHSE.NWKRLFDKEKS-------------------------------------------------
R6RNY7_9FIRM/13-174----------.VTLMPYQE.EWKENAESAIE-------------------------------------------------
E3EIR7_PAEPS/4-166----------QVVISEYNP.QWVAEYTRERA-------------------------------------------------
A5I050_CLOBH/2-163----------KVQVVEYNS.EWPNLYLEEAE-------------------------------------------------
H1VDI7_COLHI/31-193----------.LSIEPPDP.AWPAQFEEIRT-------------------------------------------------
N4UZ58_COLOR/309-472----------PLAIEPPNP.DWPAHFDTLRE-------------------------------------------------
C8XAW5_NAKMY/211-382----------.PRLVAPRA.SWADDARRLAA-------------------------------------------------
C8WAQ0_ATOPD/20-179----------PIFLVEHND.KWDAFYSEMEA-------------------------------------------------
K0K1A8_SACES/37-195----------NVVITPYDP.EWPLRYQALAT-------------------------------------------------
D9SV06_CLOC7/4-168----------EMLVVPYND.EWPQIYEEEKK-------------------------------------------------
D7BEE1_MEISD/4-169----------PIELLEYDP.SWPARFEAERT-------------------------------------------------
Q74CV0_GEOSL/2-165----------RIAIEEYSS.AWERAFLAERK-------------------------------------------------
U5L973_9BACI/9-172----------EVRLADHSP.GWKTEFQKVRK-------------------------------------------------
R7K4C0_9FIRM/184-345----------PIELMPHDD.GFARLFSEEKK-------------------------------------------------
A1R6F2_ARTAT/218-384----------......SKG.EWAAQAERLAE-------------------------------------------------
Q2G068_STAA8/12-170----------.....DLTN.CFQSQYTEIES-------------------------------------------------
Q0RJB4_FRAAA/11-173----------PVDLVAHDP.GWAGRFAEQRD-------------------------------------------------
A1CSD9_ASPCL/61-222----------LIEIVDYNP.LWPAHFSGIAD-------------------------------------------------
F8B2Q7_FRADG/43-199----------VIRIVDYDP.AWPGRFQAERG-------------------------------------------------
D4M8N7_9BACT/11-171----------PIFLVRHHE.EWDDWYAEEKS-------------------------------------------------
R6IAQ5_9FIRM/8-176----------DVRLFEHNK.EWKIEGERTVN-------------------------------------------------
F0T2H2_SYNGF/9-169----------.VALYDHEI.SWEENAALTME-------------------------------------------------
D3EFC9_GEOS4/5-164----------.LIVVEYNP.NWVKKFEELRD-------------------------------------------------
B6QP89_TALMQ/30-189----------KISIVEPNP.AWPQRFLDTKA-------------------------------------------------
R6CC32_9CLOT/13-180----------EVQIFPYDP.QWKVEFEKIKG-------------------------------------------------
M2RUD6_COCSN/3-161----------.VTVDQYRE.EWPKQFEKIKA-------------------------------------------------
J5JV21_BEAB2/22-188----------TIDIVDPDP.SWPATFAQLAT-------------------------------------------------
Q4WKR7_ASPFU/23-185----------PIEIVDYDP.SWPTTFASIAQ-------------------------------------------------
M3BXF1_SPHMS/30-197----------KVAIVVPNP.LWSQRFLEAKS-------------------------------------------------
F4LJZ3_TREBD/18-177----------PIFLTAHQD.CWEQWYSGEET-------------------------------------------------
L0KBF6_HALHC/18-182----------PIILREHNP.EYKEWYLKEKE-------------------------------------------------
F0ZS88_DICPU/4-173----------..EIEPHNI.NWKNEFLKFDK-------------------------------------------------
B0RAH0_CLAMS/4-161----------MIRLEEHRS.GWADAFHAEAA-------------------------------------------------
E1RF13_METP4/16-180----------PIILSDYNP.AWPEIYAAEKK-------------------------------------------------
W6RXI5_9CLOT/18-181----------PIILKEHNP.EYSSWYLEEKE-------------------------------------------------
E8ND31_MICTS/47-196----------RA........GWDRAFEIVAD-------------------------------------------------
A1AP29_PELPD/17-185----------RIEVVPYDA.CWPLLFEEEKA-------------------------------------------------
G8PS80_PSEUV/5-164----------KVKVVDAQA.RWAEDFQQEQE-------------------------------------------------
C5C2T3_BEUC1/32-194----------PITVVDYDE.SWPAQFDRVAA-------------------------------------------------
G9NLT9_HYPAI/30-192----------KLEIADPNP.LWPQSYELLKD-------------------------------------------------
J5JAK5_BEAB2/35-197----------PLAIEEPKP.EWPRRFAILEA-------------------------------------------------
A6WBN4_KINRD/58-214----------ELELHDHDE.RWADTYRWHRA-------------------------------------------------
C8VG40_EMENI/27-192----------RIEIVEPDP.AWPAAFAVIEA-------------------------------------------------
F4L6A7_HALH1/6-175----------KITISPYNP.EWQQSFLQLKV-------------------------------------------------
E3J2T3_FRASU/21-178----------RIVIAAYRP.EWVERFAFERD-------------------------------------------------
COAE_MYCTU/210-395----------PARLVPADP.SWPDQARRIVN-------------------------------------------------
C0QYF8_BRAHW/3-170----------IIEIVDYDP.NWKNLYKEEEV-------------------------------------------------
Q6CG34_YARLI/3-172----------.IVICPPSP.SWPAEYETLRA-------------------------------------------------
C2X2A2_BACCE/3-163----------RIVVVPYEN.HWIEKFQMEAE-------------------------------------------------
I2B7X5_SHIBC/41-199----------NINVDRYDP.EWPRIFTREKA-------------------------------------------------
R6QU09_9FIRM/17-181----------PIVLCGHKE.EWKQMYENEKK-------------------------------------------------
A1SCK2_NOCSJ/16-200----------PAALQAHDP.AWAPRAAGYLA-------------------------------------------------
G8LV75_CLOCD/29-188----------PITLVEYDP.NWEELFEREAH-------------------------------------------------
C1ABX5_GEMAT/4-164----------TVRVVAYDA.SWPDVFEQLRA-------------------------------------------------
F8L5H4_SIMNZ/6-169----------KIEVVPYDP.SWPEQFEVEAG-------------------------------------------------
A1TAF0_MYCVP/210-390----------EARLVPSDP.SWPAQAQRILA-------------------------------------------------
E5ADM9_LEPMJ/589-747----------.VVVEQYDP.KWPEEFERIKS-------------------------------------------------
W0E5J7_9FIRM/3-163----------VVVVNDYNY.QWPSMFKVEAD-------------------------------------------------
D6D4R0_9BACE/19-178----------PITLTAHQD.YWADWYKEEAE-------------------------------------------------
G7MD75_9CLOT/6-165----------.VVVEDYNP.EWKNEFEHIKN-------------------------------------------------
D3E8X8_GEOS4/3-165----------EVIVTPYNP.DWKDEYNREKA-------------------------------------------------
E1QDH8_DESB2/16-184----------PVEIVDPDP.RWPALFAREKA-------------------------------------------------
L0J6E6_MYCSM/3-164----------.VTVVEYDT.HWPRQFAEQRD-------------------------------------------------
R6R8F5_9FIRM/2-160----------...VLPYDP.AWKADFAAIRQ-------------------------------------------------
L0DYV6_THIND/8-167----------GVTLVGYDA.SWPTEFRREAQ-------------------------------------------------
F8D8W2_HALXS/8-171----------TVELEPYND.EWQRAFETEAE-------------------------------------------------
E3FRK9_STIAD/45-209----------NIDVREYDP.RWPETFEAEKH-------------------------------------------------
R6CUV5_9CLOT/17-184----------EVRIVPYDP.QWKAEFEKIKA-------------------------------------------------
R5RQF7_9FIRM/7-166----------KVEVVPYNE.DWPRKYALEAN-------------------------------------------------
Q5ZWJ7_LEGPH/174-340----------SVELVPYDS.QWPKIAEVEIK-------------------------------------------------
L0IZF9_MYCSM/209-374----------KLELTPYDP.TWADDAARIIK-------------------------------------------------
B2HQZ8_MYCMM/210-396----------PARVVPADP.SWPEQAQRIVA-------------------------------------------------
G9N260_HYPVG/30-192----------PIEIVEPDP.SWPKTFELLKT-------------------------------------------------
A4FFQ9_SACEN/32-191----------PVTLVDYDP.RWPELFRREAD-------------------------------------------------
J7L574_NOCAA/29-191----------PIHVVDHDP.EWAVWFFQVAA-------------------------------------------------
R7A6W2_9FIRM/28-187----------TIYLSEYDP.NWPLVYKQLSK-------------------------------------------------
R4SP20_AMYOR/28-187----------TVTLAEYDP.EWPELFDREAK-------------------------------------------------
E9SZZ4_RHOHA/222-405----------PPVVRPADP.DWAAQGRRLVE-------------------------------------------------
K9VQD2_9CYAN/4-164----------KVEVVPHDP.NWCSAFETESK-------------------------------------------------
R5LK04_9MOLU/7-167----------TVKLEEYNP.KWKDMYLEEEK-------------------------------------------------
Q0CCF9_ASPTN/28-183----------PLEIVEYNP.EWKPRFQDISQ-------------------------------------------------
D3FCW0_CONWI/18-181----------.VRILPPDR.SWAVRFEREAA-------------------------------------------------
Q81PZ3_BACAN/4-164----------QIVIKPYEK.EWHEEYLIEKE-------------------------------------------------
A6WEQ7_KINRD/4-189----------PAVLHPYDP.AWPGRAAELLA-------------------------------------------------
I5AW69_EUBCE/66-227----------PIFLVAHDD.RWEESFDEVEK-------------------------------------------------
B9JCE0_AGRRK/17-178----------CVTLAVPNA.RWQEAYALEAA-------------------------------------------------
A6T980_KLEP7/3-163----------ILTVVDYDE.MWPTLFENERT-------------------------------------------------
G3JP53_CORMM/36-199----------PLAITEAQP.SWASRFAALEA-------------------------------------------------
T0JR78_COLGC/30-193----------PLAIEPPNP.AWPEHFEFLKA-------------------------------------------------
Q12KI9_SHEDO/3-162----------.VDVVPYRL.GWRKDFEIEKE-------------------------------------------------
S3E6I7_GLAL2/3-173----------QITILPHNP.LWLSKFEAQKK-------------------------------------------------
R6IMI3_9CLOT/8-178----------AVALYPHEK.AWETEAQATMA-------------------------------------------------
M1MIC4_9CLOT/5-169----------NVVVLPYDF.NWSHEFEKIKI-------------------------------------------------
D5ELY3_CORAD/2-162----------KIEVVPYSD.EWPEAFKKEKR-------------------------------------------------
F4FGK1_VERMA/211-377----------RVTLTEPDP.TWPQQYARLAA-------------------------------------------------
B9E8H7_MACCJ/3-152----------QVMIVPYDS.IWQHLYIGEKK-------------------------------------------------
G8NQJ1_GRAMM/17-177----------TVIVVEYDP.SWPALFRFFYE-------------------------------------------------

PF04607

Q8F1P4_LEPIN/241-352--------------------GRAKHFYSIYR-------------------------------------------------
Q7NBS7_MYCGA/247-359--------------------SRIKSVYSTYQ-------------------------------------------------
Q83GJ6_TROWT/256-367--------------------GRPKEIYSIYQ-------------------------------------------------
YWAC_BACSU/57-179--------------------SRVKSFESIVN-------------------------------------------------
Q8DU97_STRMU/42-162--------------------GRVKPIESIKE-------------------------------------------------
Q7NGY9_GLOVI/272-383--------------------GRPKHLWGIYQ-------------------------------------------------
Q8H5X7_ORYSJ/326-435--------------------GRNKSMYSIYS-------------------------------------------------
Q7VM28_HAEDU/245-356--------------------GRPKHIYSIWK-------------------------------------------------
Q9X388_BACAN/65-209--------------------SRVKDAGHLID-------------------------------------------------
Q8EBQ4_SHEON/250-361--------------------GRPKHIYSIWR-------------------------------------------------
Q7MAV7_PORGI/253-368--------------------GRTKSINSIRN-------------------------------------------------
Q8LSZ7_CHLRE/410-527--------------------GRPKNLYGIFM-------------------------------------------------
Q7NRS8_CHRVO/260-371--------------------GRPKHIYSIWK-------------------------------------------------
Q8XKG7_CLOPE/50-185--------------------TRVKSASSLKE-------------------------------------------------
Q8A9W5_BACTN/249-366--------------------GRTKSIHSIWN-------------------------------------------------
Q8XJZ8_CLOPE/66-208--------------------SRIKNPDRLIE-------------------------------------------------
Q8DLB2_THEEB/256-367--------------------GRPKHLYSIYQ-------------------------------------------------
Q9KBP0_BACHD/57-179--------------------SRVKSPESIVN-------------------------------------------------
Q88BE4_PSESM/235-346--------------------GRQKHLYGIYK-------------------------------------------------
Q7U332_HAEDU/235-346--------------------GREKHLYALYE-------------------------------------------------
Q9K903_BACHD/43-163--------------------GRVKPISSILD-------------------------------------------------
Q89K51_BRADU/270-381--------------------GRRKKPFSIWT-------------------------------------------------
Q830U9_ENTFA/54-174--------------------GRVKPVDSILT-------------------------------------------------
SPOT_SYNY3/267-378--------------------GRPKHLYGIYY-------------------------------------------------
Q8FPL1_COREF/265-376--------------------GRPKHYWSIYQ-------------------------------------------------
Q97DY0_CLOAB/61-183--------------------DRVKDPKSIMD-------------------------------------------------
Q9CIJ5_LACLA/36-155--------------------GRVKRRESIRN-------------------------------------------------
Q8EJU8_SHEON/235-346--------------------GREKNLYSIYN-------------------------------------------------
Q8DUK1_STRMU/46-172--------------------ARIKTNESMIE-------------------------------------------------
Q9RTX1_DEIRA/64-194--------------------ARLKKPASLAD-------------------------------------------------
Q8DZK6_STRA5/44-164--------------------GRVKSVESIQE-------------------------------------------------
O25466_HELPY/265-376--------------------TRVKRPYSIYL-------------------------------------------------
Q820X2_COXBU/235-346--------------------GREKHLYSIYR-------------------------------------------------
YJBM_BACSU/45-164--------------------GRVKPVASILE-------------------------------------------------
Q9CH66_LACLA/57-179--------------------HRLKSPESIAG-------------------------------------------------
Q8P5T8_XANCP/255-366--------------------SRIKTPWSIYS-------------------------------------------------
Q7U362_BORPE/282-393--------------------GREKTLYGVYR-------------------------------------------------
Q83BW2_COXBU/241-352--------------------GRAKHIYSIFR-------------------------------------------------
Q9A812_CAUCR/255-366--------------------GREKSPYSIWR-------------------------------------------------
Q8XJ23_CLOPE/233-344--------------------GRPKHFYSIYR-------------------------------------------------
Q885Y7_PSESM/259-370--------------------GRAKHIYSIWR-------------------------------------------------
Q9WZI8_THEMA/289-400--------------------GRYKHYYSIWR-------------------------------------------------
Q8RAL8_CALS4/234-345--------------------GRPKHFYSIYK-------------------------------------------------
Q7U324_HELHP/252-362--------------------SRVKRYYSIFL-------------------------------------------------
Q97LC0_CLOAB/45-165--------------------GRVKEISSILE-------------------------------------------------
SPOT_AQUAE/237-348--------------------YRSKHYYSIWE-------------------------------------------------
Q7MAV5_PORGI/262-377--------------------ARVKSVYSIWK-------------------------------------------------
SPOT_BORBU/252-364--------------------VRSKHFYSIFR-------------------------------------------------
Q818C3_BACCR/50-172--------------------TRLKQPESIIK-------------------------------------------------
Q8KC80_CHLTE/244-357--------------------GRAKHLYSIYN-------------------------------------------------
RELA_HAEIN/253-364--------------------GRPKHIYSIWR-------------------------------------------------
Q8XXG1_RALSO/249-360--------------------GREKTLYSIYR-------------------------------------------------
Q7TTS4_SYNPX/282-392--------------------GRPKHLFGIWS-------------------------------------------------
Q92D54_LISMO/43-163--------------------GRVKPVASILD-------------------------------------------------
Q8FNX4_COREF/61-188--------------------TRLKEWSSLKA-------------------------------------------------
Q81GK0_BACCR/48-168--------------------GRVKSVASIID-------------------------------------------------
Q9PQK8_UREPA/246-355--------------------WRLKGIYSTYK-------------------------------------------------
Q7D045_AGRFC/236-347--------------------GRQKKPYSVFR-------------------------------------------------
Q889A5_PSESM/52-191--------------------SRIKDPGHLTE-------------------------------------------------
Q7MBD5_CHRVO/250-361--------------------GREKNLYSIYK-------------------------------------------------
Q7MUI3_PORGI/30-160--------------------HRTKSVMSIKN-------------------------------------------------
Q8CXQ4_MYCPE/252-362--------------------ERIKGIYSTYK-------------------------------------------------
Q8A0M3_BACTN/251-368--------------------ARVKSIYSIWN-------------------------------------------------
CRSH_ARATH/309-434--------------------GRYKSRYSMMK-------------------------------------------------
Q898M4_CLOTE/66-201--------------------SRVKSPKSLKE-------------------------------------------------
Q8DYZ3_STRA5/45-171--------------------GRIKTSDSMIE-------------------------------------------------
Q8NR76_CORGL/66-188--------------------SRLKTPESIVK-------------------------------------------------
Q8G4H5_BIFLO/112-234--------------------RRLKSVSSIIG-------------------------------------------------
RELA_MYCLE/290-401--------------------GRPKHYWSIYQ-------------------------------------------------
Q8Y8U1_LISMO/51-173--------------------SRVKSLESIGA-------------------------------------------------
Q8RF04_FUSNN/66-209--------------------RRVKKPTHLIE-------------------------------------------------
Q8XZ30_RALSO/254-365--------------------GRPKHIYSIWR-------------------------------------------------
Q8P6N1_XANCP/244-355--------------------GRPKHIYSIWR-------------------------------------------------
Q8ERT0_OCEIH/42-162--------------------ARVKPIPSIIE-------------------------------------------------
Q7VTF3_BORPE/258-369--------------------GRPKHIYSIWN-------------------------------------------------
Q7MAH7_WOLSU/253-363--------------------SRIKRHYSIYL-------------------------------------------------
B0TF84_HELMI/237-347--------------------GRPKHFYSIYR-------------------------------------------------
B5I035_9ACTN/197-306--------------------GRPKHYYSVYQ-------------------------------------------------
D3FSJ4_BACPE/58-179--------------------SRLKSPESIVK-------------------------------------------------
I1QPB8_ORYGL/428-537--------------------GRHKSLYSIHN-------------------------------------------------
M1A0E5_SOLTU/182-305--------------------GRYKSRYSTMK-------------------------------------------------
M1B3M7_SOLTU/437-545--------------------GRHKSLYSIYC-------------------------------------------------
SPOT_ECOLI/235-345--------------------GREKHLYSIYC-------------------------------------------------
Q1D7G8_MYXXD/252-362--------------------GRFKHVYSIYK-------------------------------------------------
Q2FXU1_STAA8/240-350--------------------GRPKHIYSIYR-------------------------------------------------
Q2G204_STAA8/43-162--------------------GRVKPIASIID-------------------------------------------------
Q2G2L7_STAA8/77-198--------------------RRVKEMRSLIE-------------------------------------------------
RSH_BRUA2/235-344--------------------SRQKKPWSVFR-------------------------------------------------
CRSH1_ORYSJ/316-438--------------------GRYKSRFSTMK-------------------------------------------------
Q8DPU2_STRR6/44-163--------------------GRVKPIESIKE-------------------------------------------------
Q8DXB2_STRA5/240-348--------------------GRPKHIYSIYR-------------------------------------------------
Q8R5V7_FUSNN/234-344--------------------GRFKHFYSIYK-------------------------------------------------
Q9A0A1_STRP1/53-178--------------------SRIKSEASMIE-------------------------------------------------
R4UJ80_9MOLU/240-350--------------------GRSKSIYSIHR-------------------------------------------------

PF14792

Q5KBS5_CRYNJ/778-890---------------------------------------------AK---------------------------------
DPOLB_RAT/149-262---------------------------------------------VK---------------------------------
DPOLB_DANRE/148-263---------------------------------------------LD---------------------------------
A7SJ46_NEMVE/149-263---------------------------------------------VK---------------------------------
C3YJ28_BRAFL/322-432---------------------------------------------AE---------------------------------
C7YGY5_NECH7/618-739---------------------------------------------AQ---------------------------------
F0ZLU7_DICPU/181-297---------------------------------------------LF---------------------------------
A7SK52_NEMVE/213-322---------------------------------------------TE---------------------------------
A2QQG4_ASPNC/509-626---------------------------------------------VQ---------------------------------
A9V5M0_MONBE/167-298---------------------------------------------LR---------------------------------
D7G2F8_ECTSI/183-296---------------------------------------------AQ---------------------------------
B7QKW0_IXOSC/150-261---------------------------------------------CR---------------------------------
E9EVQ2_METRA/556-677---------------------------------------------AA---------------------------------
D2A436_TRICA/901-1007---------------------------------------------L.---------------------------------
E3QD37_COLGM/619-740---------------------------------------------AA---------------------------------
B6HVS0_PENRW/522-633---------------------------------------------VQ---------------------------------
A7EMR3_SCLS1/618-744---------------------------------------------AQ---------------------------------
E4ZMZ8_LEPMJ/596-715---------------------------------------------LR---------------------------------
C5FJW6_ARTOC/469-580---------------------------------------------VL---------------------------------
B7QK41_IXOSC/277-387---------------------------------------------AL---------------------------------
B2AY49_PODAN/639-751---------------------------------------------AF---------------------------------
C9SJH6_VERA1/548-691---------------------------------------------AA---------------------------------
D8SG82_SELML/125-237---------------------------------------------VE---------------------------------
E3RX41_PYRTT/579-692---------------------------------------------LK---------------------------------
Q2HFI0_CHAGB/649-794---------------------------------------------AA---------------------------------
C1E884_MICSR/525-667---------------------------------------------VA---------------------------------
A9TCX5_PHYPA/342-457---------------------------------------------GS---------------------------------
C5Z7H1_SORBI/359-473---------------------------------------------GT---------------------------------
B9HVB4_POPTR/315-429---------------------------------------------GE---------------------------------
Q0UN18_PHANO/574-687---------------------------------------------LA---------------------------------
A4S364_OSTLU/149-268---------------------------------------------AN---------------------------------
D8R616_SELML/125-233---------------------------------------------VE---------------------------------
A0BDW1_PARTE/419-531---------------------------------------------ID---------------------------------
B8JIE9_DANRE/378-488---------------------------------------------AH---------------------------------
C5GK07_AJEDR/525-637---------------------------------------------LF---------------------------------
F2U5R6_SALR5/160-281---------------------------------------------IS---------------------------------
F7CJ14_CALJA/78-188---------------------------------------------AQ---------------------------------
Q245F6_TETTS/717-832---------------------------------------------FK---------------------------------
Q4QI79_LEIMA/354-499---------------------------------------------RK---------------------------------

PF01909

CID16_SCHPO/908-1034---------------------------------------------G.---------------------------------
CID1_SCHPO/69-169---------------------------------------------P.---------------------------------
O26508_METTH/6-97---------------------------------------------E.---------------------------------
O26564_METTH/21-113---------------------------------------------Q.---------------------------------
CCA_METTH/29-141---------------------------------------------G.---------------------------------
O27980_ARCFU/6-90---------------------------------------------..---------------------------------
CCA_ARCFU/28-133---------------------------------------------..---------------------------------
O28300_ARCFU/48-135---------------------------------------------S.---------------------------------
O28312_ARCFU/101-191---------------------------------------------..---------------------------------
O28500_ARCFU/441-531---------------------------------------------S.---------------------------------
O28587_ARCFU/7-100---------------------------------------------KF---------------------------------
O28660_ARCFU/27-113---------------------------------------------..---------------------------------
O29641_ARCFU/5-90---------------------------------------------..---------------------------------
O29943_ARCFU/5-101---------------------------------------------KD---------------------------------
O30239_ARCFU/8-91---------------------------------------------..---------------------------------
PAP_CANAL/68-160---------------------------------------------..---------------------------------
O44768_CAEEL/71-163---------------------------------------------PT---------------------------------
O66796_AQUAE/86-173---------------------------------------------K.---------------------------------
CID11_SCHPO/72-179---------------------------------------------KD---------------------------------
PAPS2_ARATH/82-179---------------------------------------------ED---------------------------------
O97205_LEIMA/1069-1163---------------------------------------------LN---------------------------------
TDT_HUMAN/311-403---------------------------------------------L.---------------------------------
TDT_MOUSE/312-404---------------------------------------------P.---------------------------------
PAPOA_BOVIN/82-175---------------------------------------------..---------------------------------
PAP_YEAST/69-161---------------------------------------------..---------------------------------
OAS2_HUMAN/373-475---------------------------------------------ST---------------------------------
Y073_HAEIN/14-110---------------------------------------------P.---------------------------------
TRF5_YEAST/201-326---------------------------------------------S.---------------------------------
PAP2_YEAST/204-318---------------------------------------------P.---------------------------------
GLND_RHIME/87-183---------------------------------------------A.---------------------------------
P72997_SYNY3/7-99---------------------------------------------Q.---------------------------------
P73498_SYNY3/14-107---------------------------------------------Q.---------------------------------
P73970_SYNY3/10-96---------------------------------------------G.---------------------------------
OAS1A_RAT/38-140---------------------------------------------TV---------------------------------
Q09995_CAEEL/75-168---------------------------------------------..---------------------------------
PAP_SCHPO/68-161---------------------------------------------..---------------------------------
Y128_METJA/11-98---------------------------------------------K.---------------------------------
Y141_METJA/7-99---------------------------------------------KD---------------------------------
Y435_METJA/7-92---------------------------------------------..---------------------------------
Y604_METJA/7-100---------------------------------------------RG---------------------------------
Y1086_METJA/124-219---------------------------------------------V.---------------------------------
CCA_METJA/35-147---------------------------------------------Y.---------------------------------
Y1217_METJA/11-98---------------------------------------------K.---------------------------------
Y1305_METJA/10-110---------------------------------------------GD---------------------------------
Y1379_METJA/11-100---------------------------------------------K.---------------------------------
TUT4_HUMAN/976-1065---------------------------------------------D.---------------------------------
Q9RTF8_DEIRA/9-95---------------------------------------------G.---------------------------------
Q9RWI9_DEIRA/14-98---------------------------------------------..---------------------------------
Q9RXQ9_DEIRA/18-105---------------------------------------------..---------------------------------
Q9U2P3_CAEEL/73-166---------------------------------------------..---------------------------------
CID14_SCHPO/266-381---------------------------------------------P.---------------------------------
PAPA_CANAL/68-161---------------------------------------------..---------------------------------
Q9VC07_DROME/53-140---------------------------------------------P.---------------------------------
Q9WZ83_THEMA/22-113---------------------------------------------KK---------------------------------
Q9X096_THEMA/7-103---------------------------------------------G.---------------------------------
Q9X2Z5_BACAN/31-119---------------------------------------------..---------------------------------
Q9X304_BACAN/10-108---------------------------------------------PN---------------------------------
GLND_CORGL/12-98---------------------------------------------LP---------------------------------
GLND_VIBF1/55-151---------------------------------------------I.---------------------------------
OAS3_HUMAN/780-872---------------------------------------------SP---------------------------------
CCA_AERPE/39-163---------------------------------------------LS---------------------------------
Q9YCI7_AERPE/22-112---------------------------------------------..---------------------------------
Q9YFN6_AERPE/17-110---------------------------------------------RT---------------------------------
Q3Y244_ENTFC/6-114---------------------------------------------Y.---------------------------------
Q5HNP5_STAEQ/17-112---------------------------------------------GS---------------------------------
PAPD7_HUMAN/245-352---------------------------------------------P.---------------------------------
CCA_SULSO/25-127---------------------------------------------N.---------------------------------
CCA_THEAC/29-134---------------------------------------------L.---------------------------------

PF07528

O62349_CAEEL/113-354---------------------------------------------SD---------------------------------
Q7PYL7_ANOGA/111-351---------------------------------------------SN---------------------------------
ILF3_MOUSE/94-342---------------------------------------------DL---------------------------------
ILF2_DROME/105-345---------------------------------------------NN---------------------------------

PF12633

K0C9C6_CYCSP/30-225---------------------------------------------KIFLEL---------------LPLLFHVNHPVLPG
Q7MYN2_PHOLL/4-200---------------------------------------------KQVYSL---------------LPVLLHYHHSMMPG
C9R2R0_AGGAD/4-204---------------------------------------------QQVFRL---------------IPLLLHFNHPDLPG
M1WST2_DESPC/651-841---------------------------------------------QVYLRL---------------LPYLLDTTVFEKKF
F6AGP1_PSEF1/20-216---------------------------------------------QRVLTL---------------LPLLFHVNHPLLPG
F4HFE0_GALAU/3-201---------------------------------------------QYVLNL---------------VCVLLHHNIPELPG
B3PH57_CELJU/19-216---------------------------------------------QQFMQL---------------LPLLFHVNHPMLPG
G4T2L3_META2/23-218---------------------------------------------RVFLEL---------------LPLLFHQNVPLLPG
K4KKJ3_SIMAS/20-214---------------------------------------------CDALRL---------------LPLLLHINHPRLPG
B8F5L0_HAEPS/22-213---------------------------------------------QSVFSL---------------LPALLHYNIPSLPA
B0UWZ7_HISS2/4-207---------------------------------------------QRVLQL---------------LTLLLHINHPLMGG
Q8E9H1_SHEON/9-202---------------------------------------------KHLFRL---------------IPFLIQQNSVQYPG
C5BLM3_TERTT/19-214---------------------------------------------QLVLDA---------------IPLLFHTNHPMMPG
J7SL77_MORMO/4-201---------------------------------------------KDVYSL---------------LPVLLHHHHPDMPG
I0DV26_PROSM/4-199---------------------------------------------CKVYSL---------------LPVLFHYHHPMIPG
A3Q9P3_SHELP/3-203---------------------------------------------RHLMQL---------------IPVLFHYHRSDFPG
M5DMW4_9GAMM/16-206---------------------------------------------QAVIDV---------------LAVLLHVNHPRLPG
E6WHF8_PANSA/15-211---------------------------------------------QHVYSL---------------LPTLLHYHHPLMPG
F7YQ90_VIBA7/4-199---------------------------------------------QRVFHF---------------IPALLHFNHPIIPG
E6VWA6_DESAO/664-855---------------------------------------------QAYLRM---------------LPHLLETDVFETRF
Q9HTS8_PSEAE/21-217---------------------------------------------ERVLRL---------------LPLLFHINHPLLPG
A6VL92_ACTSZ/4-203---------------------------------------------RYVFQL---------------IALLLHANHPNLPG
Q2SQ66_HAHCH/20-215---------------------------------------------QVVLEL---------------LPLLFHVNHPLLPG
A3N160_ACTP2/35-224---------------------------------------------QHVFSL---------------LPLLIHTNLPELPA
E4PK78_MARAH/20-216---------------------------------------------QMVLEI---------------LPLVFHLNHPALPG
W8VBQ3_YEREN/4-200---------------------------------------------QRVYSL---------------LPTLLHCHHPLMPG
B4F1X4_PROMH/4-202---------------------------------------------KQVYGL---------------IPVLLHYHHPQLPG
Q9KVL9_VIBCH/4-199---------------------------------------------QRVFHL---------------IPALFQFNHPLIPG
Q6LLN1_PHOPR/4-203---------------------------------------------EQVFDL---------------LSILLHYNHPAVPG
D4ZCR6_SHEVD/7-207---------------------------------------------RDLLRL---------------IPVLLHYHRAEYPG
Q7VND7_HAEDU/2-191---------------------------------------------QHVFSL---------------LPLLLHTNCPELPV
A4VGX1_PSEU5/20-216---------------------------------------------QQVLKL---------------LPLLFHVNHPILPG
F9ZY47_METMM/21-216---------------------------------------------YEFLQL---------------LPLLFHQNHPLLPG
M4R7B7_BIBTR/21-222---------------------------------------------KQVFCL---------------LPLLLQYNHPLLPA
CYAA_PASMU/4-205---------------------------------------------QHVFQL---------------LTLLLHINHPNLPG
Q88B03_PSESM/20-216---------------------------------------------QSVLTL---------------LPLFFHVNHPLLPG
Q65VX6_MANSM/4-207---------------------------------------------QHVFQL---------------IALLLHLNHPALPG
Q2NQF3_SODGM/4-200---------------------------------------------QHVYSL---------------LPTLLHFHHPMLPG
A1TXX4_MARHV/20-216---------------------------------------------QMVLEL---------------LPLVFHRNHPALPG
CYAA_HAEIN/4-209---------------------------------------------QHVLAI---------------VPLLLHLNHPQLPG
M9X3J4_MANHA/29-225---------------------------------------------MHVFSL---------------IPLLIHLNHPVLPA
E1VFT5_9GAMM/19-214---------------------------------------------QQFLHA---------------LPLLLHVNHASLPG
M4X4Y6_PSEDE/20-216---------------------------------------------QLVLRL---------------LPLLLDVNHPLLPG
C6BYH9_DESAD/680-878---------------------------------------------RKLLKI---------------IPALLHTNVFEIKS
I5AZY9_9DELT/15-214---------------------------------------------LELFIK---------------IPFLIHINHPQFEG
Q088L2_SHEFN/10-203---------------------------------------------LHLFHL---------------IPFLIHHNQINVPG
X2H648_9GAMM/4-197---------------------------------------------QHVFSF---------------LPALFHFHDPKLPG
A1SR20_PSYIN/12-237---------------------------------------------LTVFRT---------------FPLLLHYNHPSLPG
Q87KJ0_VIBPA/4-199---------------------------------------------QQVFHL---------------IPALLNYNHPVIPG
H8GI61_METAL/21-218---------------------------------------------RQFLDT---------------LPLVLDINDPALPG
Q21EM4_SACD2/20-215---------------------------------------------QLCLDA---------------LPLLFHTNHPMMPG
A4XNY1_PSEMY/20-216---------------------------------------------QLVLKL---------------LPLLLHVNHPLLPG
D6Z233_DESAT/8-206---------------------------------------------NIIFAA---------------VPYLLHVNHPDLPG
C5BBD1_EDWI9/4-201---------------------------------------------QQVYTL---------------LPTLLHFHHPLMPG
B7VMD8_VIBTL/4-199---------------------------------------------QRVFNL---------------IPALLHFNHPMMPG
Q88CF9_PSEPK/20-216---------------------------------------------QQVLSL---------------LPLLFHVNHPLLPG
C4LDV3_TOLAT/4-196---------------------------------------------RRMLSM---------------LPVLLHYHHPHLPG
M4U351_9GAMM/4-197---------------------------------------------YNVFQT---------------FPILLHYNQVNLPG
E0SKN1_DICD3/4-200---------------------------------------------QQVYSL---------------LPVLLHHHHPLMPG
D5C200_NITHN/12-205---------------------------------------------RVFLDA---------------LPLLFHTNHPLLPG
A0KFH7_AERHH/4-200---------------------------------------------QQVFQL---------------LPVMLHFNHPLLPG

PF10620

D3FW19_BACPE/3-199.....GFLSKETFPD----------------------WVYSVLR.EAPFVV---------------VRRAPQ.MDGI...
B4EEI1_BURCJ/9-215...........LVRA----------------------WAE.....RGWPLI---------------VRRASPDEADAGR.
F2F9N8_SOLSS/4-194.....QIDYFGQYPD----------------------WMNEDEM.AQGIAV---------------VRRMKV.EDGK...
R5PTN8_9BURK/4-199.....SLRDSL..AP----------------------LIDGFWQPASMPVV---------------VRRDAH.NADW...
Q20XM6_RHOPB/11-212.....TLISDSSTPA----------------------WVFAALD.AAPVVV---------------VRRGRA.AAGL...
G8NWE2_GRAMM/10-208.....VHPACMAEPP----------------------WVQTAMK.HSPWVV---------------VRRVNA.PVGK...
Q6FBG5_ACIAD/8-200.....MLPEDA..PH----------------------WVKDAVG.DDRPVV---------------VRRAKS.DSGI...
Q478I8_DECAR/2-209WQA........A.GD----------------------WIA.....AGRPLV---------------AARQPV.DCEC...
G8M515_9BURK/7-206.......PPFADAPG----------------------WVAAALE.RAPFAV---------------VRRAPRIGDQ....
Q13P70_BURXL/22-223.....RLQTFDAEPA----------------------WVREAFQ.RAPYAV---------------VRRALA.ADGF...
B0UJ86_METS4/6-208...........HVAE----------------------WAQ.....MRRPVI---------------LRRSHPGEEGL...
E0SJB7_DICD3/5-200.....ALEGID..AP----------------------WVDSQWR.PALPVV---------------VRRDVD.PAGR...
B1Y603_LEPCP/24-240............LAH----------------------WAA.....HDLPLV---------------VTRQPESAADAEA.
B6JE84_OLICO/7-212AIRTAHSQDIAVIES----------------------WIR.....AGRPLI---------------ARTRSDRDADGL..
I0DQT6_PROSM/4-200.....DLPVES.LPE----------------------WVISQWN.KQLPLV---------------VRREAT.DENK...
MDCG_BRADU/13-217...........LLAR----------------------WPK.....MRWPTI---------------RRRALPHEATG...
D5AVP5_RHOCB/5-220MRD..PGTRKLVRDA----------------------MSK.....AHIPGI---------------VCRPTGPCPDGG..
Q2RUR7_RHORT/4-220MRG..PDIEARIEHV----------------------LIS.....RGIPGI---------------VCRPTAPCGEGE..
D3HKK0_LEGLN/3-206SCHEENRLIKEHVSA----------------------WFA.....KGLPCI---------------FAKQLPNDKF....
A0R6Q2_MYCS2/5-197.....RLSGDA..PS----------------------WVAAALA.VTPWVV---------------VRRGRA.ASGR...
I3U924_ADVKW/2-208AQA........ALQR----------------------WLH.....ARHPLV---------------VARQPA.AADAQ..
A4G557_HERAR/3-213HAK........ELMR----------------------WAE.....HDWPAI---------------VRRSDA.DAQPDT.
H5WND7_9BURK/5-214............LAH----------------------WAA.....HALPLV---------------VSRQPAPRLQPQAL
W0PCX9_9BURK/2-210AHH........ALQR----------------------WLH.....AERPLV---------------VARQAV.QAGAQ..
A8AQP5_CITK8/6-200.....ALEGVT..ES----------------------WVDDVWH.TRLPVV---------------VRRDVD.AQGR...
D8IXS4_HERSS/5-221............LAR----------------------WRQ.....MRWPVV---------------VRRAEA.DAGADE.
Q4FSL5_PSYA2/2-211D.............N----------------------MIM.....AEQPFT---------------VCRQSTQYLSK...
G0ABH8_COLFT/3-212............LER----------------------WQS.....HDWPAV---------------LRRREP.DTPEEQ.
C5AE29_BURGB/13-235A.ADA...A..VIRA----------------------WAA.....CGRPLM---------------VRRAGPCEAGAPG.
C5CZJ3_VARPS/8-216............LAH----------------------WAL.....HRLPLV---------------MTRQPAHAGADGW.
Q21XD0_RHOFT/5-210...........ILAH----------------------WRS.....TSLPLV---------------VCRQRVEAAPDQ..
A1WLX1_VEREI/8-240MRAGTGAGAVQAFIA----------------------RAQ.....QGLAVV---------------GRSANADDIPGW..
Q89UY6_BRADU/6-207...........IIDG----------------------WAR.....ADRPLI---------------VRRPACSDAAGM..
C5APL6_METEA/6-211...........HVAA----------------------WVN.....DGRPVI---------------LRRSHPGEDAGR..
F6AEK3_PSEF1/6-203.....QLPQEA..PA----------------------WARAALG.EHVPVV---------------VRRAPA.EPGW...
MDCG_PSEAE/8-202.....HLPENA..PA----------------------WVCAALK.AGWPVV---------------VRRAPA.DPAR...
A4VRY6_PSEU5/6-198.....QLPADA..PA----------------------WAVAVLA.AGQPVV---------------VRRAVV.APGQ...
D7A7S9_STAND/7-217GLERLSDEPRRLVEG----------------------WCE.....RGWPLI---------------VRRPCEGHETG...
B2JLU1_BURP8/24-227.....KLEPFDAEPA----------------------WVRDAFA.RAPFVV---------------VRRAQA.AAGF...
MDCG_XANCP/3-204PSQALTPGAQPRLQA----------------------WFA.....AGFPAV---------------VARRDGAEQPGQ..
I2BDH6_SHIBC/7-201.....PPQGIT..DP----------------------WVAEYWH.CGLPVV---------------VRRDTD.PQGR...
A9BUU4_DELAS/12-224............LTH----------------------WRD.....HALPLV---------------VARQSAEHAAAGL.
H0Q3G4_9RHOO/2-205ADFGVTEDHRAELGD----------------------WIA.....RGLPLV---------------VGRQLGQPGG....
G2IWN4_PSEUL/8-208.....ALCTDTPLPD----------------------WAGADWL.ARAPLV---------------VRRAPAGADGR...
MDCG_KLEP7/6-200.....ALEDIA..EP----------------------WVAQQWR.AALPVV---------------VRRDVD.DQAR...
H2IQE3_RAHAC/5-202.....ALESDDVLPE----------------------WVNTGWR.TALPLV---------------VRRDKR.ADGA...
S6AL15_PSERE/6-197.....QLPGEA..PD----------------------WARQALA.AGQPVV---------------VRRAMC.APGL...
A1VKU0_POLNA/11-212.....SLVFSGPPPP----------------------WATPDWL.AVAPVV---------------VRRATLADPAQ...
MDCG_PSESM/9-203.....ALPDDA..PQ----------------------WAVDTLL.AGQPVV---------------VRRQAM.PAGQ...
H8MH16_CORCM/7-204...........HVTA----------------------WRA.....QGRPFA---------------VARQDLPDREDD..
B8EMG7_METSB/15-229AGAPVKIPP..IVTE----------------------WAA.....RGRPLI---------------ARRRGPGDPAGA..
E6WJH1_PANSA/6-195.....ALVGIT..EA----------------------WVAELWH.CQQPVV---------------VRRDVM.QQGL...
B1M799_METRJ/6-209...........HLEH----------------------WAA.....SGRPLI---------------VRRRIPGETGDA..
MDCG_AZOVD/9-206.....RLDAAA..PT----------------------WAAEVLA.AGRPVV---------------VRRAPA.RDGW...
W0LLU0_9ENTR/3-217WLSSLPDWQ....RS----------------------FNA.....GDIPGI---------------VRRHLPAEAKTE..
A5VEB4_SPHWW/8-205RIEGVAAAPEVLLAD----------------------WVA.....QGRPFI---------------ARRPACADRGDR..
B2UKC7_RALPJ/7-206.....VATDDAPLPD----------------------WAITACR.QGSPVV---------------VRRAPRGNDGA...
Q21AG0_RHOPB/4-220FRQ..PALQEQVRRA----------------------FAA.....DAIPGI---------------VCGPKAALPPNY..
A2SDW3_METPP/11-216LAGLGDPTDAQAVVD----------------------WAQ.....AGRPFI---------------GRAAQPGDGAGR..
A1T0S3_PSYIN/7-202.....IHQEN...PN----------------------WYANHI..ITRPVV---------------VRRAK..DHPL...
B2FSQ2_STRMK/6-203........HEPRLAA----------------------WFA.....QGLPAM---------------VARSAADDPDPR..
B8IJN7_METNO/6-210...........HVAD----------------------WAR.....HRRPVI---------------VRRRHPDEEPGS..

PF10127

YCGL_BACSU/1-249..KIVYAVESGSRAW----------------------GFPSQ..DSDYDV.---------------.RFIYVPKKEWYFS
A8MHZ8_ALKOO/1-249..KILYAVESGSRGW----------------------GFESK..DSDYDV.---------------.RFIYIHKPEWYLS
Q0ATC2_MARMM/14-264..RILFAIESGSRAW----------------------GFPSP..DSDYDA.---------------.RFVYARPRDWYLS
Q5YSM9_NOCFA/7-254..NTVLRGQVGSGLH----------------------GVTTG..ADDRDE.---------------.MGVCIEPPEYVIG
A3QAH3_SHELP/6-255..KVLYAVESGSRAW----------------------GFESP..NSDYDV.---------------.RFIYAHPKDWYVS
Q8Y2V7_RALSO/25-271..RVLFACESGSRGW----------------------GFASP..DSDYDV.---------------.RFVYVHRPAWYLS
Q97IY9_CLOAB/10-256..KILHAVESGSRAW----------------------GFASP..DSDYDV.---------------.RFIYVRPREYYLR
A6LZ95_CLOB8/1-237GENIIYLTLSGSIGY----------------------GTNID..NSDVDL.---------------.RGITIERKENIYG
A8F9S9_BACP2/1-249..KICLAVESGSRAW----------------------GFPST..DSDYDV.---------------.RFLYVPRKEWYWA
Q2RSZ8_RHORT/22-270..SLPHAALTGPLAW----------------------GLPDD..GVSAPVV---------------CACVFIRPAQAYLG
Q8SCS5_BPDPK/11-264..KIIYACESGSRGW----------------------GFAST..NSDYDV.---------------.RFIYVNHPSHYVR
A9B3Q0_HERA2/60-291..WIHYRCVVGSRAY----------------------GLDTP..ESDTDW.---------------.RGFFVPAAAVDWG
A7MPB9_CROS8/11-258..KVLYACESGSRGW----------------------GFASP..DSDYDV.---------------.RFLYVHPPEWYLR
Q9S235_STRCO/1-245..PVLFATVSGAHLY----------------------GFPSR..DSDVDL.---------------.RGAHLLPAADLVG
Q65NN4_BACLD/1-249..KILYAVESGSRAW----------------------GLPSQ..DSDYDV.---------------.RFIYVHQKDWYLS
Q7ULC4_RHOBA/63-303YERVIYRCVIGSRAY----------------------GLDDE..DSDTDR.---------------.RGIYLPPAELHWS
A9BRG4_DELAS/16-262..TVLFACESGSRGW----------------------GFASP..DSDYDV.---------------.RFIYVHRLPWYLT
Q7NZ84_CHRVO/14-259..RVLYACESGSRAW----------------------GFASP..DSDYDV.---------------.RFLYVHRPQWYLQ
Q24TP5_DESHY/3-250..KILYACESGSRAW----------------------GFPSV..DSDYDV.---------------.RFIYVHPVEWYLS
Q7ULC3_RHOBA/4-250..PLLFATISGAHLY----------------------GFPSA..NSDFDL.---------------.RGVHLLPLQTVVG
Q099H0_STIAD/9-253..QHLVVSLTGAHAY----------------------GFPSP..DSDLDL.---------------.KCVHITPTAHLLR
Q7MZH9_PHOLL/11-258..RILYACESGSRGW----------------------GFAST..SSDYDV.---------------.RFIYVHAPSWYLR
Q0BVF7_GRABC/14-264..RILLAVESGSRAW----------------------GFPSP..DSDYDV.---------------.RFVYVRNRDEYLR
A6LZ96_CLOB8/1-249..KILYAIESGSRGW----------------------GFESK..DSDFDV.---------------.RFIYIHPVEWYLS
Q2SQI3_HAHCH/1-246..RVLYACESGSRAW----------------------GFASR..DSDYDV.---------------.RFIYQRPLSHYLS
B4EM27_BURCJ/21-266..CVLFACESGSRGW----------------------GFASP..DSDYDV.---------------.RFVYAHRRDWYLS
Q814A4_BACCR/1-249..KILFAVESGSRAW----------------------GFPSK..DSDYDV.---------------.RFVYIHPVEWYLS
Q853S4_BPMBZ/16-276LDGLIYLSEVGSTLH----------------------GVSTDATSDDIDE.---------------.MGIAIEPPRCVIG
Q9HVK0_PSEAE/13-260..VVLYACESGSRAW----------------------GFASP..DSDYDV.---------------.RFVYVHQPEWYQR

PF04439

R7KZ10_9FIRM/1-274VYAVRETKHFYEDKH----------------------WIDR----FGERLY...-------.....MQ..CPDELDRSLG
W6S1S8_9CLOT/1-279VYVVNETNSFIEDKK----------------------WIEN----FGEILY...-------.....MQ..YPDE...SPY
L0EDK7_THECK/1-279VYAVTEVEPFVRDRS----------------------WIGR----FGDVLI...-------.....MQ..TPDD...AAL
R7M6A2_9CLOT/3-279TFFVTDMQSFINSDE----------------------WLNV----FGERLI...-------.....MQ..KPED...MEL
F0RJQ6_DEIPM/17-291TLYVRDLPSFTADHG----------------------WIDR----FGERMI...-------.....LQ..IP.....VLM
C9A7Q4_ENTCA/1-276VYVMDDIQPLVDDPS----------------------WLEA----FGPIMI...-------.....RQ..TPEA...STI
R5BA48_9CLOT/1-282VFSVNDVRRMINGRK----------------------WLKP----FGDIAI...-------.....MQ..EPDSVDMAWG
A8AXL5_STRGC/1-268VYIVEDLHALVADLA----------------------WLER----FGERVI...-------.....EQHVLLDH......
J7SKW9_MORMO/1-275ELIGSSHDELFQDSR----------------------WLSR----FGVPLI...-------.....IR..........KA
C0ZBY2_BREBN/3-281SYFVTEMASFKENDQ----------------------WLDV----FGNRIM...-------.....MQ..KPED...MEL
F8KV03_PARAV/7-263SLFCTEIETFTYNDT----------------------WLSA----FGNVWICVH-------EKLCLAQQIVPTR......
R6MWH0_9CLOT/1-270VFLVDAMEPFLSNPR----------------------WIDC----FGRRII...-------.....MQ..IPEP......
D1API7_SEBTE/1-279VYVVNEIKTFLDAEN----------------------WIDV----FGKRLY...-------.....MQ..LPEALDKSLG
Q81EL0_BACCR/1-279MYVVNDIQSFTSNHN----------------------WIHR----FGEIMI...-------.....VQ..MPEE...MLL
E8N0I5_ANATU/1-276VFVVTDDAPFKQDRS----------------------WMRC----FGDLMI...-------.....VQ..VPEE....MG
T0U4V5_9ENTE/1-276VYIVDNMQELIAEPS----------------------WLEE----FGQIMI...-------.....MQ..TPES...SVL
F5WV16_ERYRF/1-277AFIVDNLEYFINHQS----------------------WLEP----FGKVLM...-------.....MQ..RPDD...FTL
Q7N6T3_PHOLL/8-279ELIGSGTDELIGNDL----------------------WFKQ----LGDVMV...-------.....AL..........HL
D6DFM9_CLOSC/1-277TFFVTDMDSFTSDDK----------------------WLDI----FGERLI...-------.....LQ..KPED...MEL
C6VZK2_DYAFD/8-288IYVIEDLAPFLQDHS----------------------WVDV----FGERMI...-------.....MQ..MPED...MEL
F4C3Y1_SPHS2/10-290IYVVESLEPRYLNAD----------------------WLEV----FGELMI...-------.....MQ..IPED...MEL
Q9KFZ4_BACHD/1-282VYVVTDIAPFIQEQQ----------------------WLKK----FGEPLM...-------.....IQ..EPDQLDAGIG
D3HMA9_LEGLN/5-280VYLVTDVEPFVDDKN----------------------WVRQ----FGELLI...-------.....MQ..MPEE...MDG
G4L4M5_TETHN/1-277TYIVDDIDPFIKNRQ----------------------WLDK----LGKRLI...-------.....MQ..TPDE...MGL
A5N4U0_CLOK5/1-276VYVVTETRSFREDKA----------------------WIDR----FGERLY...-------.....MQ..YPEE...NIY
F3ZWD0_MAHA5/1-282VYVVTETRSFLEDKD----------------------WISV----FGELAI...-------.....CQ..EPDKIDSVLG
Q830C7_ENTFA/1-279VYIVEPCAEFFETAT----------------------WIAK----FGQPLI...-------.....MQ..RPKE...MTL
E1R322_SPISS/4-281VCYVTDVEPYKIEKD----------------------VVPY----FGETII...-------.....VE..QPNF...GPW
D3EE58_GEOS4/1-279SFHVTDMESFIQDPN----------------------WIDV----FGERLI...-------.....LQ..TPED...MAL
F5YA41_TREAZ/1-278VYLVTERESFIRDPS----------------------WIDV----FGKRVI...-------.....LQ..TPED...MSL
K0J1M0_AMPXN/1-279VYLVTEMESFLNQPD----------------------WIAV----FGERLI...-------.....MQ..TPED...MTL
D9SUI2_CLOC7/1-279IYVVNDTKSFREDRS----------------------WIDR----FGQRLY...-------.....MQ..YPEE...NSK
A8MEJ4_ALKOO/1-277TYFVIDIKSFISNDE----------------------WLKK----FGNIIM...-------.....MQ..KPED...MAL
A6TTG7_ALKMQ/1-278VYFVNDFEYFACNHS----------------------WIDI----FGERIM...-------.....LE..MPSY...KDY
Q5WJQ6_BACSK/1-279SYFVTDIDSFKENDQ----------------------WLDP----FGKAIM...-------.....MQ..KPED...MKL
E3EGQ4_PAEPS/1-279SYFVTDMDSFKESDQ----------------------WLNV----FGDRLM...-------.....MQ..KPED...MEL
G7M0J2_9CLOT/1-279VYVVNETKPFREKKN----------------------WIDR----FGERLY...-------.....MQ..YPDE...NSY
I0JN00_HALH3/1-279VYMVTELNAFIADHS----------------------WIDV----FGKRLI...-------.....MQ..MPDE...MQL
Q5ZTL0_LEGPH/5-281VYLVTEIESFVHDKN----------------------WINQ----FGELLI...-------.....MQ..TPDE...MDG
Q5WBU9_BACSK/1-278VYIVRDVDSFVSDPG----------------------WIDC----FGERII...-------.....MQ..TPEK...MTL
H1ZC54_MYROD/8-281VFVVEDMPSLLDDRS----------------------WFLA----LGTPIL...-------.....QQ..RPDE...MEL
Q65P34_BACLD/1-285VYVVTDMQSFLDEPG----------------------WVDV----FGERII...-------.....MQ..TPEA...MEL
R7EXP0_9FIRM/1-276EYIVRDTAPFIADKS----------------------WIDR----FGERLF...-------.....MQ..YPDD...CPF
D9SN58_CLOC7/1-281VYIVNEIQSFTKDDH----------------------WLDQ----FGDRLI...-------.....MQ..KSVD...WYS
E3EJ73_PAEPS/1-278VFLVSSMDSFIQERG----------------------WIHH----FGELII...-------.....MQ..TPDE....HA
H6NNB4_9BACL/1-279VFFVRQVGPFVRDRS----------------------WIRR----FGGMMI...-------.....MQ..TPDE...MET
R6VSM5_9FIRM/1-276VYIVKETASFQKDNS----------------------WIDR----FGERLY...-------.....MQ..YPED...SVY
Q3Y246_ENTFC/1-277TYFVSDIEPFISNDD----------------------WLNQ----FGNIIM...-------.....MQ..KPED...MEL
J9R2N9_RIEAN/1-283EFVFEDNTNYISDKS----------------------WTLK----FGNPIA...-------.....MI..EEDE......
C6XTS4_PEDHD/4-284IYVVKSLDPFLRDHT----------------------WIDV----FGERMI...-------.....LQ..MPED...MEL
Q24XY2_DESHY/1-282VFVVTETDSFLADKD----------------------WIGG----FGKPLI...-------.....VQ..EPDLNDNAWG
K8E427_CARML/1-279MYVVTELTSFIEDSR----------------------WVDY----FGPRLI...-------.....MQ..LPDE...SAL
E0RXK3_BUTPB/1-281TFFVSDIREFTADKN----------------------YMRK----FGDILI...-------.....MQ..TPDD...WYM
R5RFU0_9FIRM/1-279TFLVTDVNSYLDSDE----------------------WLSV----FGDLLF...-------.....MQ..KPEG...MDL
AADK_BACSU/1-279SYFVTDVESFKENDQ----------------------WLEI----FGKRIM...-------.....MQ..KPED...MEL
I0DXB6_PROSM/4-277ELVGSGVTALFHDQQ----------------------WIHQ----FGQPLV...-------.....AL..........HL
R5A566_9CLOT/1-278VYLVTDVTPY.KQGD----------------------ISPA----FGELLV...-------.....MQ..RTDE...MEL

PF03296

Q9EN10_AMEPV/129-284----------------------------------------------------------------------VYKQKLKNVT
PAP1_CPRVZ/123-270----------------------------------------------------------------------.......RVT
PAP1_DPV83/122-269----------------------------------------------------------------------.......NIA
PAP1_MCV1/122-269----------------------------------------------------------------------.......NVA
Q6TVV2_ORFSA/120-268----------------------------------------------------------------------.......AVL
PAP1_VAR67/131-279----------------------------------------------------------------------.......NVA
PAP1_FOWPN/124-271----------------------------------------------------------------------.......NVV

PF01743

PCNB_ECOLI/62-193---------------------------------------------LGKKP.-----------------------------
O66728_AQUAE/454-580---------------------------------------------LGKEV.-----------------------------
Q93795_CAEEL/38-162---------------------------------------------MNIRP.-----------------------------
CCA_BACSU/22-142---------------------------------------------MKRTI.-----------------------------
O83294_TREPA/24-145---------------------------------------------LNRSA.-----------------------------
O84710_CHLTR/23-143---------------------------------------------LGRPI.-----------------------------
O67911_AQUAE/37-172---------------------------------------------LGEPVG-----------------------------
O51649_BORBU/24-145---------------------------------------------LNKQP.-----------------------------
O83605_TREPA/50-165---------------------------------------------AGRTP.-----------------------------
PCNB_HAEIN/50-181---------------------------------------------LGKKP.-----------------------------
O25357_HELPY/22-146---------------------------------------------MGITP.-----------------------------
P74081_SYNY3/512-663---------------------------------------------LRHSQG-----------------------------
CCA1_YEAST/63-205---------------------------------------------LGQGS.-----------------------------
I1NH95_SOYBN/99-237---------------------------------------------LGKEC.-----------------------------
Q88DX1_PSEPK/56-188---------------------------------------------LGITP.-----------------------------
Q94K06_ARATH/110-247---------------------------------------------LGKES.-----------------------------
Q9CCY1_MYCLE/41-168---------------------------------------------LGRLD.-----------------------------

PF06042

F7YRG9_VIBA7/44-201--------------------------------------------------------------------------------
B9JA85_AGRRK/24-187--------------------------------------------------------------------------------
Q7NQC6_CHRVO/26-191--------------------------------------------------------------------------------
A9KPI8_CLOPH/31-195--------------------------------------------------------------------------------
A0A016Q9B1_GIBZA/30-194--------------------------------------------------------------------------------
C4L4W2_EXISA/22-184--------------------------------------------------------------------------------
E6X9J4_CELAD/24-180--------------------------------------------------------------------------------
T0TPF3_9STRE/22-184--------------------------------------------------------------------------------
E6TYF2_BACCJ/23-185--------------------------------------------------------------------------------
B2IE49_BEII9/22-182--------------------------------------------------------------------------------
R7F266_9BACI/28-194--------------------------------------------------------------------------------
Q47ZE1_COLP3/38-196--------------------------------------------------------------------------------
B7VSV6_VIBTL/5-162--------------------------------------------------------------------------------
B9DTD2_STRU0/21-182--------------------------------------------------------------------------------
G8S5F2_ACTS5/30-189--------------------------------------------------------------------------------
A8GHE5_SERP5/22-179--------------------------------------------------------------------------------
K9WRX7_9NOST/22-176--------------------------------------------------------------------------------
Q6LIY1_PHOPR/48-206--------------------------------------------------------------------------------
K9ZZZ5_DEIPD/21-185--------------------------------------------------------------------------------
K8E4K8_CARML/22-184--------------------------------------------------------------------------------
S8BA31_DACHA/30-194--------------------------------------------------------------------------------
T0TA19_9STRE/18-179--------------------------------------------------------------------------------
K9PHD3_9CYAN/22-177--------------------------------------------------------------------------------
A4Z2D9_BRASO/21-184--------------------------------------------------------------------------------
R8BBT8_TOGMI/30-194--------------------------------------------------------------------------------
Q0WCS8_YERPE/22-199--------------------------------------------------------------------------------
W0L9G9_9ENTR/22-179--------------------------------------------------------------------------------
E1V6J0_HALED/24-181--------------------------------------------------------------------------------
U4KG05_9VIBR/26-182--------------------------------------------------------------------------------
Q8EGD2_SHEON/29-193--------------------------------------------------------------------------------
Q8DVZ2_STRMU/21-183--------------------------------------------------------------------------------
E9ELM3_METRA/30-196--------------------------------------------------------------------------------
G8PQI6_PSEUV/58-222--------------------------------------------------------------------------------
A1S5C1_SHEAM/40-192--------------------------------------------------------------------------------
D4ZAN8_SHEVD/35-191--------------------------------------------------------------------------------
Q8YZI8_NOSS1/21-177--------------------------------------------------------------------------------
I3TT60_TISMK/24-184--------------------------------------------------------------------------------
M4XBK0_PSEDE/30-180--------------------------------------------------------------------------------
A0KID9_AERHH/44-203--------------------------------------------------------------------------------
B2J7L9_NOSP7/21-177--------------------------------------------------------------------------------
Q98CQ2_RHILO/58-222--------------------------------------------------------------------------------
A7HQY2_PARL1/21-184--------------------------------------------------------------------------------
G2SQN4_LACRR/23-176--------------------------------------------------------------------------------
C9A5U1_ENTCA/30-192--------------------------------------------------------------------------------
Q8E2A6_STRA5/19-180--------------------------------------------------------------------------------
D0J385_COMT2/22-181--------------------------------------------------------------------------------
C9SMQ7_VERA1/31-195--------------------------------------------------------------------------------
U5L946_9BACI/24-185--------------------------------------------------------------------------------
Q6F6M2_ACIAD/63-218--------------------------------------------------------------------------------
Q0ATF8_MARMM/35-199--------------------------------------------------------------------------------
Q12L07_SHEDO/33-198--------------------------------------------------------------------------------
B5I7I9_9ACTN/30-193--------------------------------------------------------------------------------
Q9KMH4_VIBCH/42-199--------------------------------------------------------------------------------
G3J5G4_CORMM/36-202--------------------------------------------------------------------------------
Q89V81_BRADU/22-184--------------------------------------------------------------------------------
Q5WAS6_BACSK/23-185--------------------------------------------------------------------------------
Q03U83_LACBA/22-184--------------------------------------------------------------------------------
H2IZW8_RAHAC/23-181--------------------------------------------------------------------------------
D3E7U6_GEOS4/21-179--------------------------------------------------------------------------------
F9UNI3_LACPL/22-183--------------------------------------------------------------------------------
Q9CGK8_LACLA/22-182--------------------------------------------------------------------------------
A4VSF2_STRSY/43-201--------------------------------------------------------------------------------
W8UHS0_YEREN/24-184--------------------------------------------------------------------------------
C5CXQ6_VARPS/13-176--------------------------------------------------------------------------------
H8L6T1_FRAAD/26-186--------------------------------------------------------------------------------
B9JP57_AGRRK/25-185--------------------------------------------------------------------------------
I1RDV7_GIBZE/30-194--------------------------------------------------------------------------------
C0ZRT4_RHOE4/21-184--------------------------------------------------------------------------------
I0JHP3_HALH3/24-186--------------------------------------------------------------------------------
B4RAU1_PHEZH/22-186--------------------------------------------------------------------------------
R7F5W6_9BACI/28-194--------------------------------------------------------------------------------
A0ZEL1_NODSP/6-161--------------------------------------------------------------------------------
F0LZI9_VIBFN/22-180--------------------------------------------------------------------------------
K0I121_9BURK/29-196--------------------------------------------------------------------------------
N0ATJ8_9BACI/22-184--------------------------------------------------------------------------------
K9QIT0_9NOSO/21-177--------------------------------------------------------------------------------
A6WX10_OCHA4/47-208--------------------------------------------------------------------------------
C6D3F5_PAESJ/25-186--------------------------------------------------------------------------------
Q7MJH5_VIBVY/23-178--------------------------------------------------------------------------------
F3ZCS6_9ACTN/62-226--------------------------------------------------------------------------------
A6VYX8_MARMS/22-179--------------------------------------------------------------------------------
A4VG22_PSEU5/22-182--------------------------------------------------------------------------------
F5Z4Y3_ALTSS/31-192--------------------------------------------------------------------------------
G4R9P5_PELHB/34-198--------------------------------------------------------------------------------
X4ZH19_9BACL/21-179--------------------------------------------------------------------------------
N4VT77_COLOR/30-193--------------------------------------------------------------------------------
G8PQI7_PSEUV/50-212--------------------------------------------------------------------------------
Q084X9_SHEFN/37-198--------------------------------------------------------------------------------
R4L9D2_9ACTN/23-182--------------------------------------------------------------------------------
Q8CZ82_STRR6/25-187--------------------------------------------------------------------------------
K9W6P1_9CYAN/21-184--------------------------------------------------------------------------------
D9QML6_BRESC/23-187--------------------------------------------------------------------------------
C9A9L8_ENTCA/21-183--------------------------------------------------------------------------------
C2WZT1_BACCE/24-186--------------------------------------------------------------------------------
K9RM73_9CYAN/21-177--------------------------------------------------------------------------------
V4KBT1_9ACTN/35-199--------------------------------------------------------------------------------
C7ZKJ8_NECH7/30-194--------------------------------------------------------------------------------
E3EIW9_PAEPS/24-182--------------------------------------------------------------------------------
Q2S808_HAHCH/20-179--------------------------------------------------------------------------------
Q9A3I2_CAUCR/24-192--------------------------------------------------------------------------------
T0LHD4_COLGC/33-197--------------------------------------------------------------------------------
Q5M5D3_STRT2/19-183--------------------------------------------------------------------------------
A8AUH1_STRGC/23-185--------------------------------------------------------------------------------

PF07984

L5LWP1_MYODS/17-336RLNGSAAGHVLVKDN...................G..LGCKDLDLIFHVALPTE.......VE...FHLVRDVVLCSLLN
A1Z745_DROME/52-381RLNGGAASHVLASED......................QPYNDLDLIFAIELSSP.......RV...FDRVKVAVLNTLLD
T1FNH1_HELRO/24-358RVNGSVALTVVGGDR...................C..QIYNDLDVLFNLSPTHEPGENPR.NDRVRFENIRRCALETLFR
T1J6X5_STRMM/39-359RLNGGAASHILTESG....................EAASYNDLDLIFAVDLSTP.......RS...CDRVKTAVLDSLLD
G3Q3S6_GASAC/31-351RLNGSTASHVLVRDN...................G..TSYKDLDIIFGVELPSQ.......EE...FQVIKESVLGCLLD
H2Z3D3_CIOSA/19-351RLNGSAATHVLSDQA...................I..PTYKDLDLIFAIEPPPE.......AS...LPTIKDTVMEILLE
H9GHA4_ANOCA/13-332RLNGSTASHILVKQN...................G..TSYKDLDIIFGVELPSE.......QE...FQVVKESVLNCLLD
B3RY60_TRIAD/11-330RLNGSGASFALGGHE...................A..PTYHDIDVIFRVKMDDQ.......EE...MDKVKQIVLDALLD
E4X262_OIKDI/463-783KLNGSCASHIISHDD...................D..IGFKDIDIIFNLVSTIDHPARDRLNE.......STTFMSVLLS
G4M0E2_SCHMA/159-490RLNGGAASYIIGQED...................Y..PVYNDIDVLVSVDLSSN.......SS..TIQKVKSAVLDALIS
W5NMQ1_LEPOC/15-334RLNGSTASHVLVQDN...................G..WLYKDLDVIFRVDLPSE.......AE...FQLVKEVVLGTLLD
A7T168_NEMVE/10-329RLNGSTASYILSRDS...................N..TAYNDIDLIFGVEIKSH.......TH...LQQIKSVVLSSLLN
T1K5N9_TETUR/11-330RLNGGAASYVLCPNN......................LTYNDLDLIFVVDLSTS.......RN...FDKVRSAVLDSLLD
I1FWF4_AMPQE/47-375RLNGSAASYCIAEDR.................ERSPALHYNDLDIIFMIQIKTK.......MD...LHIIKEEVLNSLFD
B3RUB7_TRIAD/6-351RLNGGTASYILNQHHYYKNNSQYQHHHQQQQLRPAIKPHYNDIDLVFNVDMSDD.......SQ...AQVILTTVLRTLLE
K1PBY4_CRAGI/10-333RLNGGAASYIFGTDS...................V..RSYNDVDLIFGVDLSRG.......SNHTELQKIKNCVLGCLVD
F7AS71_MONDO/19-338RLNGSTASHILTKQN...................G..TSYKDIDIIFGIGYLGE.......HE...FQVVKETVLDCLQD
H2LZV4_ORYLA/17-337RLNGATASHILVRDN...................G..LGYRDLDIIFGVELPRQ.......ED...FQVIKEVVLSSLRD
F7E7M3_XENTR/18-337RLNGSAASYVLHHDS...................G..LGYKDLDLIFMVDLKGP.......DA...FQVVKHAVLNCLLD
H3E7R5_PRIPA/59-392KINGGAATAIAASRE......................FTYSDIDLIISADFGEE.......DS...FNKAREALLAVVLD
J9JYZ0_ACYPI/99-447RLNGGAASHVLTTDT......................QPYNDLDLIFNISLSGN.......RD...FDRVKSAVLRALVD
E9HG11_DAPPU/7-330RINGGAASYVLALDR...................CQPQAYNDLDLIFGVDLSSA.......RT...YDRIKTAVLDSLLD
H9JEQ9_BOMMO/53-380RLNGGAASHVLGDNP......................QPYSDIDLIFTAELPTA.......RH...CDRVKAAVLGHLAT
FA46B_HUMAN/52-372RLHGSAASHVLHPES...................G..LGYKDLDLVFRVDLRSE.......AS...FQLTKAVVLACLLD
G3VWF6_SARHA/61-380RLNGSAASHVLHQDS...................G..LGYKDLDLIFCADLQGE.......EE...FQTVKDVVLDCLLD
Q86NJ5_CAEEL/50-400RLNGGAASFVASSDD......................FSYADLDLIFPIQIDEESDENVEKQI...FDAIRDSVFMTIRE
F1S1S5_PIG/9-328RLNGSTASYILASHN...................G..ISYKDLDVIFGVELPSD.......QE...FQVVKDVVLGCLLD
E9IG33_SOLIN/73-399RLNGGAASHVLATES......................QPYNDLDLIFAVELSSG.......RN...YDKVKAAVLGSLFD
W4YCY4_STRPU/13-330RMNGGAASYILSTET...................N..QSYNDLDLIFGVDLSKT.......EN...LDIIRDAVFECLLN
C3YH94_BRAFL/153-472RLNGSTASYILSDES...................A..FCYNDLDLIFGVSLESA.......SD...LQRIKDMVLDCLLD
H3D951_TETNG/18-337RLNGSAASHVLHQDS...................G..LGYKDLDLIFGLSLSDD.......GA...FRLVKDVVLDCLLD
E1FUA8_LOALO/18-327KMNGGAASYVVATEE......................FAYSDLDLIFPMSFENE.......QS...FDSVRSAVFDAMVQ

PF12281

A8I451_AZOC5/134-340--------------------------------------------------------------------------LLGAGI
B9JC00_AGRRK/105-319--------------------------------------------------------------------------LIGNAL
A1BBC9_PARDP/103-312--------------------------------------------------------------------------VFRLGG
Q126S1_POLSJ/108-319--------------------------------------------------------------------------FFRAGG
Q5P6X2_AROAE/109-317--------------------------------------------------------------------------.VARDF
Q89MC1_BRADU/114-315--------------------------------------------------------------------------LI.DHV
A9CH87_AGRFC/104-319--------------------------------------------------------------------------LFRLRA
Q98P17_RHILO/173-382--------------------------------------------------------------------------VFRLGG
Q8KKU1_RHIEC/104-319--------------------------------------------------------------------------LFRLRG
N0AYX3_9RHIZ/127-330--------------------------------------------------------------------------LFEQGI
B6IPR2_RHOCS/108-321--------------------------------------------------------------------------IFRLRG
V5SE53_9RHIZ/102-312--------------------------------------------------------------------------FFRLRS
Q9A9N3_CAUCR/103-311--------------------------------------------------------------------------AFRLRA
A8LU12_DINSH/105-313--------------------------------------------------------------------------TFRLGG
D6ZZH4_STAND/103-312--------------------------------------------------------------------------AFRLGG
Q3IVG2_RHOS4/104-312--------------------------------------------------------------------------VFRLGG
W6S626_9RHIZ/127-341--------------------------------------------------------------------------LFRLRA
M4S0H4_9SPHN/98-303--------------------------------------------------------------------------LFRGGA
Q3IV36_RHOS4/114-326--------------------------------------------------------------------------WLGRTL
B8IY04_METNO/103-315--------------------------------------------------------------------------VFRMRA
D5CPE9_SIDLE/109-318--------------------------------------------------------------------------.LQDHF
B3E5Q2_GEOLS/108-317--------------------------------------------------------------------------VFRVGG
A9BZ70_DELAS/2-210--------------------------------------------------------------------------PWRGQL
Q12C53_POLSJ/118-324--------------------------------------------------------------------------.VSEHF
Q0C240_HYPNA/104-317--------------------------------------------------------------------------VFRLRG
C3KPJ9_RHISN/33-247--------------------------------------------------------------------------IFRLRG
B4RE82_PHEZH/98-305--------------------------------------------------------------------------LFRAGA
Q0C284_HYPNA/109-317--------------------------------------------------------------------------TFRLGG
A4SVJ5_POLSQ/110-320--------------------------------------------------------------------------FFRAGS
A1AK69_PELPD/13-213--------------------------------------------------------------------------FF.THG
Q930T5_RHIME/105-319--------------------------------------------------------------------------LFRLRG
F2IVW1_POLGS/104-311--------------------------------------------------------------------------VFRLGG
A6WWH8_OCHA4/115-328--------------------------------------------------------------------------LLGAGI
C3KKL2_RHISN/104-319--------------------------------------------------------------------------FFRLRG
A2SPA0_METPP/110-321--------------------------------------------------------------------------LMGKSM

PF02410

E1VGT7_9GAMM/19-115--------------------------------------------------------------------------------
Q72BL7_DESVH/18-114--------------------------------------------------------------------------------
E3PRI2_CLOSD/8-104--------------------------------------------------------------------------------
E3I0D8_RHOVT/51-147--------------------------------------------------------------------------------
F8KUA6_HELBC/7-101--------------------------------------------------------------------------------
C6D5V2_PAESJ/10-106--------------------------------------------------------------------------------
G4QH00_GLANF/8-104--------------------------------------------------------------------------------
K0T8E5_THAOC/404-526--------------------------------------------------------------------------------
O86327_MYCTU/12-108--------------------------------------------------------------------------------
C7NE56_LEPBD/13-105--------------------------------------------------------------------------------
K9TU63_9CYAN/35-131--------------------------------------------------------------------------------
R7F4J7_9BACT/11-109--------------------------------------------------------------------------------
B9HIN9_POPTR/50-151--------------------------------------------------------------------------------
X5DAH5_9BACT/12-110--------------------------------------------------------------------------------
H2WNK0_CAEJA/65-168--------------------------------------------------------------------------------
Q04FE5_OENOB/8-104--------------------------------------------------------------------------------
R7JA64_9PORP/9-107--------------------------------------------------------------------------------
D7CWT0_TRURR/6-101--------------------------------------------------------------------------------
H2IXB4_RAHAC/8-104--------------------------------------------------------------------------------
B1ZVV9_OPITP/13-109--------------------------------------------------------------------------------
R6TBA4_9FIRM/11-107--------------------------------------------------------------------------------
B8E1S0_DICTD/12-107--------------------------------------------------------------------------------
R5A3E4_9CLOT/8-104--------------------------------------------------------------------------------
E8NE71_MICTS/12-108--------------------------------------------------------------------------------
B9DNI5_STACT/8-104--------------------------------------------------------------------------------
A9WK69_CHLAA/4-100--------------------------------------------------------------------------------
R5HDA8_9FIRM/9-105--------------------------------------------------------------------------------
C7LYC9_ACIFD/51-146--------------------------------------------------------------------------------
K4L4Y3_9FIRM/9-105--------------------------------------------------------------------------------
Q4FP42_PELUB/9-105--------------------------------------------------------------------------------
R6ESE1_9FIRM/22-118--------------------------------------------------------------------------------
A7I1F9_CAMHC/190-283--------------------------------------------------------------------------------
K9ZZD3_DEIPD/20-115--------------------------------------------------------------------------------
G0QND0_ICHMG/58-162--------------------------------------------------------------------------------
D1CCZ4_THET1/16-112--------------------------------------------------------------------------------
C7RQU7_ACCPU/8-104--------------------------------------------------------------------------------
B9GK05_POPTR/129-223--------------------------------------------------------------------------------
Q5SHF3_THET8/12-107--------------------------------------------------------------------------------
K4KHM4_SIMAS/37-132--------------------------------------------------------------------------------
R6CD09_9FIRM/15-111--------------------------------------------------------------------------------
A0ZLR5_NODSP/38-134--------------------------------------------------------------------------------
R5Q2J4_9BACT/9-107--------------------------------------------------------------------------------
A0A068XU24_ECHMU/101-202--------------------------------------------------------------------------------
D4ZSA1_ARTPN/39-134--------------------------------------------------------------------------------
G1NDG8_MELGA/5-104--------------------------------------------------------------------------------
R6QB74_9FIRM/8-103--------------------------------------------------------------------------------
F9UNR7_LACPL/8-104--------------------------------------------------------------------------------
A1SHP8_NOCSJ/12-108--------------------------------------------------------------------------------
J9W1F9_LACBU/8-104--------------------------------------------------------------------------------
Q47JQ2_DECAR/8-104--------------------------------------------------------------------------------
B2V9I4_SULSY/8-105--------------------------------------------------------------------------------
E3GLQ0_EUBLK/11-107--------------------------------------------------------------------------------
A3N2P9_ACTP2/7-103--------------------------------------------------------------------------------
A0LSX7_ACIC1/13-109--------------------------------------------------------------------------------
E0TFT9_PARBH/42-138--------------------------------------------------------------------------------
F4GJF5_SPHCD/10-107--------------------------------------------------------------------------------
D6Z191_DESAT/20-116--------------------------------------------------------------------------------
R6RRV9_9BACE/9-107--------------------------------------------------------------------------------
G0A0U8_METMM/8-104--------------------------------------------------------------------------------
C5D4V8_GEOSW/8-104--------------------------------------------------------------------------------
E6JZX0_PARDN/12-109--------------------------------------------------------------------------------
S6AAN5_9PROT/8-104--------------------------------------------------------------------------------
R7BRJ0_9ACTN/15-110--------------------------------------------------------------------------------
B4U9M4_HYDS0/5-102--------------------------------------------------------------------------------
D4J8G6_9FIRM/9-105--------------------------------------------------------------------------------
R6EX89_9BACT/9-107--------------------------------------------------------------------------------
A4VTA2_STRSY/8-104--------------------------------------------------------------------------------
T2DLB5_ALTMD/8-104--------------------------------------------------------------------------------
K9UU95_9CYAN/43-134--------------------------------------------------------------------------------
X2H6J8_9GAMM/8-103--------------------------------------------------------------------------------
F8F078_TRECH/16-112--------------------------------------------------------------------------------
G8JWM0_ERECY/86-219--------------------------------------------------------------------------------
Q73LW7_TREDE/15-110--------------------------------------------------------------------------------
R5BYH5_9FIRM/9-105--------------------------------------------------------------------------------
H6NIK1_9BACL/9-105--------------------------------------------------------------------------------
F0SVG5_SYNGF/9-105--------------------------------------------------------------------------------
R7R2A4_9FIRM/8-104--------------------------------------------------------------------------------
R7LB71_9BACT/9-107--------------------------------------------------------------------------------
E4TYH5_SULKY/6-98--------------------------------------------------------------------------------
I3WID0_BIFBI/12-110--------------------------------------------------------------------------------
G1KP02_ANOCA/11-110--------------------------------------------------------------------------------
R5RDD8_9PROT/19-114--------------------------------------------------------------------------------
F8EN32_RUNSL/16-114--------------------------------------------------------------------------------
R5SGY3_9GAMM/13-109--------------------------------------------------------------------------------
D9QBW4_CORP2/12-108--------------------------------------------------------------------------------
R5LGW6_9FIRM/6-103--------------------------------------------------------------------------------
C0R0F4_BRAHW/47-143--------------------------------------------------------------------------------
W1QI88_OGAPD/62-199--------------------------------------------------------------------------------
F9YTI3_CAPCC/14-112--------------------------------------------------------------------------------
R5YP83_9PROT/10-105--------------------------------------------------------------------------------
F9D1M0_PREDD/9-107--------------------------------------------------------------------------------
S2JP82_MUCC1/153-260--------------------------------------------------------------------------------
YM62_CAEEL/65-167--------------------------------------------------------------------------------
B5EEI2_GEOBB/16-109--------------------------------------------------------------------------------
B8I1C2_CLOCE/8-104--------------------------------------------------------------------------------
R6K4L0_9BACE/9-107--------------------------------------------------------------------------------
E6W3S5_DESIS/8-105--------------------------------------------------------------------------------
K7IQU4_NASVI/90-189--------------------------------------------------------------------------------
B7G5J9_PHATC/2-97--------------------------------------------------------------------------------
B7FPM4_PHATC/162-271--------------------------------------------------------------------------------
K9YCI5_HALP7/25-122--------------------------------------------------------------------------------
Q11XG7_CYTH3/15-113--------------------------------------------------------------------------------
A0A088A1M0_APIME/113-212--------------------------------------------------------------------------------
R5TZZ5_9FIRM/10-106--------------------------------------------------------------------------------
V4J0M6_9DELT/18-114--------------------------------------------------------------------------------
R7HB19_9FIRM/11-107--------------------------------------------------------------------------------
Q4U8K5_THEAN/211-313--------------------------------------------------------------------------------
D5X4P2_THIK1/8-104--------------------------------------------------------------------------------
F5XNG3_MICPN/12-108--------------------------------------------------------------------------------
Q6D7M0_PECAS/9-104--------------------------------------------------------------------------------
G2KW74_LACSM/8-104--------------------------------------------------------------------------------
I1XI99_METNJ/9-104--------------------------------------------------------------------------------
F4HAS9_GALAU/3-99--------------------------------------------------------------------------------
B8DJS5_DESVM/19-114--------------------------------------------------------------------------------
Q747Q6_GEOSL/15-109--------------------------------------------------------------------------------
W0RI79_9BACT/14-110--------------------------------------------------------------------------------
D6GRY3_FILAD/5-101--------------------------------------------------------------------------------
K9SPG4_9CYAN/36-131--------------------------------------------------------------------------------
A0LPG4_SYNFM/32-126--------------------------------------------------------------------------------
L0GSY4_9GAMM/8-104--------------------------------------------------------------------------------
R6GQD4_9FIRM/22-115--------------------------------------------------------------------------------
C7MPQ9_SACVD/12-108--------------------------------------------------------------------------------
S5SWN0_9CORY/13-108--------------------------------------------------------------------------------
F4PVH6_DICFS/525-623--------------------------------------------------------------------------------
W0JK56_DESAE/2-93--------------------------------------------------------------------------------
M4VFB7_9DELT/227-324--------------------------------------------------------------------------------
G8BW66_TETPH/84-227--------------------------------------------------------------------------------
B3ER25_AMOA5/16-114--------------------------------------------------------------------------------
Q3Z9G1_DEHM1/8-104--------------------------------------------------------------------------------
E6TW12_BACCJ/8-104--------------------------------------------------------------------------------
W5N0T0_LEPOC/99-198--------------------------------------------------------------------------------
D6XWC7_BACIE/8-104--------------------------------------------------------------------------------
H6RLG7_BLASD/13-108--------------------------------------------------------------------------------
ATP25_ZYGRC/85-217--------------------------------------------------------------------------------
Q3IZI6_RHOS4/3-95--------------------------------------------------------------------------------
C5CB00_MICLC/12-109--------------------------------------------------------------------------------
T1IN47_STRMM/146-245--------------------------------------------------------------------------------
W8F8R6_9BACT/15-113--------------------------------------------------------------------------------
Q1QXB2_CHRSD/8-104--------------------------------------------------------------------------------
Q7URC6_RHOBA/74-171--------------------------------------------------------------------------------
D3PKV4_MEIRD/12-108--------------------------------------------------------------------------------
Q5FRT0_GLUOX/51-147--------------------------------------------------------------------------------
H2LUV3_ORYLA/97-196--------------------------------------------------------------------------------
E3HA88_ILYPC/6-102--------------------------------------------------------------------------------
R5G8H7_9PORP/20-117--------------------------------------------------------------------------------
R5RHQ5_9FIRM/9-105--------------------------------------------------------------------------------
R5XAQ7_9FIRM/8-103--------------------------------------------------------------------------------
K7SIQ4_PROA4/13-108--------------------------------------------------------------------------------
D4H0Y6_DENA2/8-104--------------------------------------------------------------------------------
D2RNC7_ACIFV/8-104--------------------------------------------------------------------------------
R6IQY9_9CLOT/8-103--------------------------------------------------------------------------------
M3HMI8_CANMX/81-220--------------------------------------------------------------------------------
C7M7C0_CAPOD/12-111--------------------------------------------------------------------------------
R6GWL1_9FIRM/10-105--------------------------------------------------------------------------------
R6NCD6_9FIRM/5-101--------------------------------------------------------------------------------
R6A3V4_9ACTN/43-140--------------------------------------------------------------------------------
R6DIG1_9BACE/9-107--------------------------------------------------------------------------------
D3UIX0_HELM1/7-101--------------------------------------------------------------------------------
R5N925_9BACT/9-107--------------------------------------------------------------------------------
D6WL03_TRICA/57-156--------------------------------------------------------------------------------
A9V8V9_MONBE/155-258--------------------------------------------------------------------------------
R7KSJ6_9BURK/8-104--------------------------------------------------------------------------------
F9ZTY5_ACICS/9-105--------------------------------------------------------------------------------
G2LE33_CHLTF/32-127--------------------------------------------------------------------------------
Q8DY34_STRA5/8-104--------------------------------------------------------------------------------
K4IPF9_PSYTT/13-111--------------------------------------------------------------------------------
W0F3W7_9SPHI/26-124--------------------------------------------------------------------------------
G8AIT6_AZOBR/37-132--------------------------------------------------------------------------------
R6DUN9_9FIRM/8-103--------------------------------------------------------------------------------
R5AKW9_9CLOT/10-106--------------------------------------------------------------------------------
B5Y803_COPPD/2-97--------------------------------------------------------------------------------
A6QCD7_SULNB/8-101--------------------------------------------------------------------------------
D4K7J1_9FIRM/12-108--------------------------------------------------------------------------------
B6YRM7_AZOPC/12-110--------------------------------------------------------------------------------
R5QWA2_9FIRM/5-101--------------------------------------------------------------------------------
F2F3K1_SOLSS/7-103--------------------------------------------------------------------------------
E4NB25_KITSK/12-109--------------------------------------------------------------------------------
Q6A9H4_PROAC/12-108--------------------------------------------------------------------------------
Q21FD1_SACD2/8-104--------------------------------------------------------------------------------
W0EAU7_9FIRM/8-104--------------------------------------------------------------------------------
E1WYV6_HALMS/7-98--------------------------------------------------------------------------------
F0V8J6_NEOCL/449-551--------------------------------------------------------------------------------
E4TJ98_CALNY/7-103--------------------------------------------------------------------------------
D7WC86_9CORY/13-108--------------------------------------------------------------------------------
E4U6Z9_OCEP5/12-107--------------------------------------------------------------------------------
Q8NN58_CORGL/12-108--------------------------------------------------------------------------------
R7B4U9_9ACTN/13-109--------------------------------------------------------------------------------
E1ZH82_CHLVA/239-341--------------------------------------------------------------------------------
U3GY66_9CORY/12-108--------------------------------------------------------------------------------
R7IT94_9FIRM/11-107--------------------------------------------------------------------------------
D8S2B1_SELML/13-114--------------------------------------------------------------------------------
K4E5A1_TRYCR/232-326--------------------------------------------------------------------------------
F6CQD9_DESK7/10-106--------------------------------------------------------------------------------
R6KF46_9FIRM/11-107--------------------------------------------------------------------------------
I0HW02_RUBGI/8-104--------------------------------------------------------------------------------
Q8YPM4_NOSS1/37-133--------------------------------------------------------------------------------
C1EE68_MICSR/526-636--------------------------------------------------------------------------------
C5KAT1_PERM5/235-334--------------------------------------------------------------------------------
H6L6C8_SAPGL/21-119--------------------------------------------------------------------------------
G4T293_META2/8-104--------------------------------------------------------------------------------
I3UBD3_ADVKW/8-104--------------------------------------------------------------------------------
H2FY28_OCESG/8-104--------------------------------------------------------------------------------
R7CUD2_9BACE/6-104--------------------------------------------------------------------------------
J9JUC8_ACYPI/125-224--------------------------------------------------------------------------------
C0ZB11_BREBN/10-106--------------------------------------------------------------------------------
K0KVP5_WICCF/177-309--------------------------------------------------------------------------------
S6EFN2_ZYGB2/82-213--------------------------------------------------------------------------------
S9W0T4_SCHCR/94-219--------------------------------------------------------------------------------
D4JS04_9FIRM/8-104--------------------------------------------------------------------------------
G8TML0_NIAKG/49-147--------------------------------------------------------------------------------
I0K9S3_9BACT/50-148--------------------------------------------------------------------------------
A0A068NYM9_9BACT/8-103--------------------------------------------------------------------------------
Q2GCL3_NEOSM/17-109--------------------------------------------------------------------------------
Q5E6V1_VIBF1/12-106--------------------------------------------------------------------------------
D0J0H1_COMT2/20-116--------------------------------------------------------------------------------
C8WIS8_EGGLE/17-112--------------------------------------------------------------------------------
Q606I9_METCA/10-106--------------------------------------------------------------------------------
B4RD60_PHEZH/47-142--------------------------------------------------------------------------------
Q2JQ53_SYNJB/16-111--------------------------------------------------------------------------------
A6Q542_NITSB/8-101--------------------------------------------------------------------------------
G0VLT2_MEGEL/20-116--------------------------------------------------------------------------------
G8Y063_PICSO/101-239--------------------------------------------------------------------------------
Q7VRA9_BLOFL/4-100--------------------------------------------------------------------------------
H1XSE2_9BACT/8-104--------------------------------------------------------------------------------
Q47MW6_THEFY/12-109--------------------------------------------------------------------------------
F2KV42_PREDF/9-107--------------------------------------------------------------------------------
A1AVZ7_RUTMC/8-104--------------------------------------------------------------------------------
R5NMF0_9FIRM/8-104--------------------------------------------------------------------------------
E4RIQ7_HALHG/12-107--------------------------------------------------------------------------------
R5Z3M1_9FIRM/5-102--------------------------------------------------------------------------------
E8N386_ANATU/2-95--------------------------------------------------------------------------------
E3D0R6_9BACT/33-122--------------------------------------------------------------------------------
Q92BM7_LISMO/9-104--------------------------------------------------------------------------------
S6CGZ3_9GAMM/8-104--------------------------------------------------------------------------------
Q9A1F0_STRP1/16-112--------------------------------------------------------------------------------
A5G904_GEOUR/16-109--------------------------------------------------------------------------------
B3RRW9_TRIAD/91-190--------------------------------------------------------------------------------
F6EQY0_AMYSD/13-108--------------------------------------------------------------------------------
R6ALX9_9CLOT/27-123--------------------------------------------------------------------------------
E1G5L4_LOALO/54-150--------------------------------------------------------------------------------
Q5P2U1_AROAE/8-104--------------------------------------------------------------------------------
R5WH81_9DELT/389-485--------------------------------------------------------------------------------
R6SBY2_9FIRM/9-105--------------------------------------------------------------------------------
U6B5K9_9RHIZ/20-117--------------------------------------------------------------------------------
D1BM92_VEIPT/13-109--------------------------------------------------------------------------------
B8IEM3_METNO/6-98--------------------------------------------------------------------------------
A1SU09_PSYIN/8-104--------------------------------------------------------------------------------
K8GKE5_9CYAN/32-128--------------------------------------------------------------------------------
Q2N6F3_ERYLH/12-107--------------------------------------------------------------------------------
A3QH51_SHELP/14-110--------------------------------------------------------------------------------
C4Z098_EUBE2/9-105--------------------------------------------------------------------------------
D3EQN9_ATETH/15-112--------------------------------------------------------------------------------
E6U7Y1_ETHHY/22-118--------------------------------------------------------------------------------
G0GDI3_SPITZ/12-109--------------------------------------------------------------------------------
K9Q2R2_9CYAN/18-114--------------------------------------------------------------------------------
E0W225_PEDHC/107-206--------------------------------------------------------------------------------
I0I1R8_CALAS/2-97--------------------------------------------------------------------------------
E0RUY2_BUTPB/13-108--------------------------------------------------------------------------------
D5UTC0_TSUPD/14-108--------------------------------------------------------------------------------
D4M5X8_9FIRM/9-105--------------------------------------------------------------------------------
B1H031_UNCTG/11-107--------------------------------------------------------------------------------
A6LNB0_THEM4/5-101--------------------------------------------------------------------------------
G2SP30_LACRR/8-104--------------------------------------------------------------------------------
Q3IJ97_PSEHT/8-104--------------------------------------------------------------------------------
R5EE57_9GAMM/8-104--------------------------------------------------------------------------------
R6DH31_9CLOT/8-104--------------------------------------------------------------------------------
Q12QY1_SHEDO/9-104--------------------------------------------------------------------------------
IOJAP_ZYMMO/21-117--------------------------------------------------------------------------------
Q0VN47_ALCBS/9-105--------------------------------------------------------------------------------
Q8DJK1_THEEB/29-125--------------------------------------------------------------------------------
G0IXL6_CYCMS/8-106--------------------------------------------------------------------------------
E6WZ07_NITSE/8-101--------------------------------------------------------------------------------
W4YD31_STRPU/344-443--------------------------------------------------------------------------------
D7BBA8_MEISD/14-107--------------------------------------------------------------------------------
X2H7X0_9NEIS/15-110--------------------------------------------------------------------------------
G6D1G9_DANPL/107-206--------------------------------------------------------------------------------
Q2G298_STAA8/8-104--------------------------------------------------------------------------------
H8KN20_SOLCM/15-113--------------------------------------------------------------------------------
F6AEU5_PSEF1/13-109--------------------------------------------------------------------------------
A8Y3I6_CAEBR/59-161--------------------------------------------------------------------------------
L0KBB8_HALHC/16-107--------------------------------------------------------------------------------
F8E7X1_FLESM/8-104--------------------------------------------------------------------------------
Q3A1E2_PELCD/9-105--------------------------------------------------------------------------------
D5EEJ0_AMICL/14-107--------------------------------------------------------------------------------
K9XKK1_9CHRO/37-133--------------------------------------------------------------------------------
O51725_BORBU/11-108--------------------------------------------------------------------------------
B0SRU3_LEPBP/13-113--------------------------------------------------------------------------------
J7QF24_METSZ/35-131--------------------------------------------------------------------------------
R6BA50_9CLOT/8-104--------------------------------------------------------------------------------
D3SLN3_THEAH/7-102--------------------------------------------------------------------------------
Q2GLC3_ANAPZ/10-104--------------------------------------------------------------------------------
F2N7T7_CORGP/47-144--------------------------------------------------------------------------------
Q7VJ93_HELHP/11-105--------------------------------------------------------------------------------
A8LKJ3_DINSH/8-103--------------------------------------------------------------------------------
U5QDK7_9CYAN/13-109--------------------------------------------------------------------------------
R5CBV8_9BACE/9-107--------------------------------------------------------------------------------
U3K4T0_FICAL/9-108--------------------------------------------------------------------------------
D2VAH7_NAEGR/112-210--------------------------------------------------------------------------------
B3EK36_CHLPB/27-123--------------------------------------------------------------------------------
D8LM97_ECTSI/43-138--------------------------------------------------------------------------------
K9WGD2_9CYAN/28-124--------------------------------------------------------------------------------
F2NRK4_TRES6/11-108--------------------------------------------------------------------------------
G4Q705_ACIIR/8-105--------------------------------------------------------------------------------
C5BNN1_TERTT/7-103--------------------------------------------------------------------------------
J9Z794_LEPFM/48-141--------------------------------------------------------------------------------
R7KVA5_9FIRM/8-104--------------------------------------------------------------------------------
F2JQX0_CELLD/10-106--------------------------------------------------------------------------------
A3LQS7_PICST/33-171--------------------------------------------------------------------------------
R6GPR7_9CLOT/8-100--------------------------------------------------------------------------------
C7R7J9_KANKD/8-104--------------------------------------------------------------------------------
Q0ABM8_ALKEH/14-109--------------------------------------------------------------------------------
R7GK75_9CLOT/203-298--------------------------------------------------------------------------------
W0J190_9BACT/16-112--------------------------------------------------------------------------------
R7HV95_9CLOT/13-109--------------------------------------------------------------------------------
T2GFT8_DESGI/18-114--------------------------------------------------------------------------------
R6UIY6_9FIRM/6-102--------------------------------------------------------------------------------
K9RW58_SYNP3/23-119--------------------------------------------------------------------------------
R6VTB1_9FIRM/16-113--------------------------------------------------------------------------------
N0B789_9RHIZ/47-143--------------------------------------------------------------------------------
W0DX52_9GAMM/8-104--------------------------------------------------------------------------------
Q24SP4_DESHY/10-104--------------------------------------------------------------------------------
U6GU24_EIMAC/436-549--------------------------------------------------------------------------------
T0VFU6_9STRE/8-104--------------------------------------------------------------------------------
G8BC02_CANPC/81-218--------------------------------------------------------------------------------
A9KMF1_CLOPH/10-106--------------------------------------------------------------------------------
B8IY74_DESDA/31-127--------------------------------------------------------------------------------
F2I3K1_PELSM/11-107--------------------------------------------------------------------------------
R6S9M8_9FIRM/7-102--------------------------------------------------------------------------------
G8PDQ2_PEDCP/8-104--------------------------------------------------------------------------------
A0LCY9_MAGMM/19-115--------------------------------------------------------------------------------
R7XYP9_9ACTN/12-108--------------------------------------------------------------------------------
C6BY18_DESAD/18-114--------------------------------------------------------------------------------
A5WCA7_PSYWF/21-117--------------------------------------------------------------------------------
R6ZB75_9CLOT/9-105--------------------------------------------------------------------------------
X2GYY9_9BACI/7-103--------------------------------------------------------------------------------
A0A068X2K5_HYMMI/99-199--------------------------------------------------------------------------------
Q5M321_STRT2/8-104--------------------------------------------------------------------------------
K9W317_9CYAN/28-124--------------------------------------------------------------------------------
C9RAT7_AMMDK/8-104--------------------------------------------------------------------------------
Q31RX3_SYNE7/23-118--------------------------------------------------------------------------------
E2ABW0_CAMFO/117-216--------------------------------------------------------------------------------
B7ZSU4_XENTR/104-203--------------------------------------------------------------------------------
E6S731_INTC7/12-108--------------------------------------------------------------------------------
J9RNQ7_9ACTN/12-108--------------------------------------------------------------------------------
Q74ID2_LACJO/14-110--------------------------------------------------------------------------------
R5PG49_9CLOT/8-104--------------------------------------------------------------------------------
C3M9Y3_RHISN/41-137--------------------------------------------------------------------------------
K9RB59_9CYAN/38-135--------------------------------------------------------------------------------
Q4Y4A2_PLACH/249-351--------------------------------------------------------------------------------
R5SL59_9FIRM/6-102--------------------------------------------------------------------------------
A9NGN0_ACHLI/5-95--------------------------------------------------------------------------------
I3YSI4_AEQSU/13-111--------------------------------------------------------------------------------
R5VE54_9BACE/9-107--------------------------------------------------------------------------------
F7QH28_9BRAD/22-118--------------------------------------------------------------------------------
D3PE18_DEFDS/5-102--------------------------------------------------------------------------------
Q3J7T3_NITOC/8-104--------------------------------------------------------------------------------
R5K9K4_9CLOT/9-105--------------------------------------------------------------------------------
O67309_AQUAE/5-101--------------------------------------------------------------------------------
E2C2S6_HARSA/121-220--------------------------------------------------------------------------------
ATP25_LACTC/125-266--------------------------------------------------------------------------------
Q3ANY6_CHLCH/23-120--------------------------------------------------------------------------------
R7JTP2_9FIRM/9-105--------------------------------------------------------------------------------
D9R139_CLOSW/9-105--------------------------------------------------------------------------------
E3F1H1_KETVY/62-158--------------------------------------------------------------------------------
I2H8T5_TETBL/114-252--------------------------------------------------------------------------------
C4LJT9_CORK4/12-108--------------------------------------------------------------------------------
B7JXB1_CYAP8/32-128--------------------------------------------------------------------------------
B0RDF7_CLAMS/12-108--------------------------------------------------------------------------------
X5DNJ2_9CORY/13-108--------------------------------------------------------------------------------
B2IKW2_BEII9/21-117--------------------------------------------------------------------------------
Q9CJS0_PASMU/6-102--------------------------------------------------------------------------------
E2SB72_9ACTN/12-108--------------------------------------------------------------------------------
Q10VW4_TRIEI/29-126--------------------------------------------------------------------------------
A6WDM3_KINRD/18-114--------------------------------------------------------------------------------
I4A2C0_ORNRL/11-109--------------------------------------------------------------------------------
I2EQ24_EMTOG/14-112--------------------------------------------------------------------------------
S5XVR4_PARAH/2-98--------------------------------------------------------------------------------
E1SSX4_FERBD/9-104--------------------------------------------------------------------------------
D5AKK2_RHOCB/55-151--------------------------------------------------------------------------------
F0SS65_RUBBR/56-150--------------------------------------------------------------------------------
R5X7F3_9CLOT/8-104--------------------------------------------------------------------------------
E1R019_OLSUV/10-107--------------------------------------------------------------------------------
D5SVA3_PLAL2/30-124--------------------------------------------------------------------------------
R6GP78_9FIRM/10-106--------------------------------------------------------------------------------
R6XQE4_9FIRM/9-105--------------------------------------------------------------------------------
B7KCB2_CYAP7/31-128--------------------------------------------------------------------------------
B9E6Y1_MACCJ/11-107--------------------------------------------------------------------------------
R5GKV6_9FIRM/8-104--------------------------------------------------------------------------------
A0RQT7_CAMFF/6-99--------------------------------------------------------------------------------
A8F8G2_PSELT/2-95--------------------------------------------------------------------------------
Q9WXZ4_THEMA/6-102--------------------------------------------------------------------------------
R6QEW5_9FIRM/9-105--------------------------------------------------------------------------------
F8C4U4_THEGP/8-104--------------------------------------------------------------------------------
I4DAU1_DESAJ/9-106--------------------------------------------------------------------------------
F4EZF2_SELS3/10-107--------------------------------------------------------------------------------
R6EX51_9BACT/10-108--------------------------------------------------------------------------------
C7Q898_CATAD/13-108--------------------------------------------------------------------------------
Q31IE2_THICR/10-105--------------------------------------------------------------------------------
B0C3C4_ACAM1/29-124--------------------------------------------------------------------------------
R5GV36_9BACT/9-107--------------------------------------------------------------------------------
Q2RV08_RHORT/3-98--------------------------------------------------------------------------------
I0DX27_PROSM/8-104--------------------------------------------------------------------------------
R5FJ79_9ACTN/20-115--------------------------------------------------------------------------------
F7V655_CLOSS/202-298--------------------------------------------------------------------------------
IOJAM_ARATH/49-148--------------------------------------------------------------------------------
E1R6B7_SPISS/8-103--------------------------------------------------------------------------------
D1AUY8_STRM9/6-98--------------------------------------------------------------------------------
W5W1D7_9PSEU/13-108--------------------------------------------------------------------------------
F2JXD4_MARM1/8-105--------------------------------------------------------------------------------
R5Q0E4_9PROT/67-162--------------------------------------------------------------------------------
A1BJS1_CHLPD/26-122--------------------------------------------------------------------------------
F9Z618_ODOSD/9-107--------------------------------------------------------------------------------
B5YGK3_THEYD/10-104--------------------------------------------------------------------------------
D6ZGB4_MOBCV/15-108--------------------------------------------------------------------------------
Q2SA29_HAHCH/8-104--------------------------------------------------------------------------------
C7R5L6_JONDD/13-108--------------------------------------------------------------------------------
R5YKL7_9FIRM/8-104--------------------------------------------------------------------------------
C1FH80_MICSR/4-102--------------------------------------------------------------------------------
C4XU12_DESMR/17-113--------------------------------------------------------------------------------
ATP25_CANAL/82-221--------------------------------------------------------------------------------
R7F936_9CLOT/7-103--------------------------------------------------------------------------------
Q1H3S4_METFK/10-105--------------------------------------------------------------------------------
E4TS81_MARTH/27-125--------------------------------------------------------------------------------
C5X4I8_SORBI/118-211--------------------------------------------------------------------------------
B1XIK5_SYNP2/18-114--------------------------------------------------------------------------------
Q8RBA1_CALS4/10-105--------------------------------------------------------------------------------
Q87RQ3_VIBPA/9-104--------------------------------------------------------------------------------
E8R1R1_ISOPI/52-148--------------------------------------------------------------------------------
Q3AF31_CARHZ/10-106--------------------------------------------------------------------------------
A3I392_9BACT/8-106--------------------------------------------------------------------------------
Q7VC47_PROMA/8-105--------------------------------------------------------------------------------
R5HDA5_9FIRM/9-104--------------------------------------------------------------------------------
F2IFG0_FLUTR/25-123--------------------------------------------------------------------------------
Q8F6E4_LEPIN/16-115--------------------------------------------------------------------------------
C3YER5_BRAFL/19-118--------------------------------------------------------------------------------
E4WVJ5_OIKDI/92-192--------------------------------------------------------------------------------
R5IZX4_9FIRM/10-105--------------------------------------------------------------------------------
I6X5U0_PROPF/12-109--------------------------------------------------------------------------------
I0IB03_PHYMF/45-140--------------------------------------------------------------------------------
A1AV34_PELPD/21-115--------------------------------------------------------------------------------
B6ITL0_RHOCS/33-127--------------------------------------------------------------------------------
E8WVY3_GRATM/12-108--------------------------------------------------------------------------------
A4G2M3_HERAR/8-104--------------------------------------------------------------------------------
R5SG81_9BACE/7-105--------------------------------------------------------------------------------
V5WI46_9SPIO/20-117--------------------------------------------------------------------------------
D7GCX0_PROFC/12-108--------------------------------------------------------------------------------
D5EVB2_PRER2/6-104--------------------------------------------------------------------------------
F8ADL0_THEID/24-120--------------------------------------------------------------------------------
Q9CIX8_LACLA/8-105--------------------------------------------------------------------------------
Q4FV91_PSYA2/15-111--------------------------------------------------------------------------------
A7HJX7_FERNB/2-95--------------------------------------------------------------------------------
G8XAX0_FLACA/13-111--------------------------------------------------------------------------------
R5MJL8_9FIRM/8-103--------------------------------------------------------------------------------
Q3B6P4_CHLL7/26-122--------------------------------------------------------------------------------
A0CFH5_PARTE/123-260--------------------------------------------------------------------------------
D3SCP4_THISK/8-104--------------------------------------------------------------------------------
R6PRZ7_9FIRM/13-109--------------------------------------------------------------------------------
K9VMY5_9CYAN/30-127--------------------------------------------------------------------------------
D4KXG1_9FIRM/8-104--------------------------------------------------------------------------------
R5L7P0_9SPIR/27-124--------------------------------------------------------------------------------
ATP25_DEBHA/109-247--------------------------------------------------------------------------------
R5SKZ4_9CLOT/9-105--------------------------------------------------------------------------------
E1VB18_HALED/20-116--------------------------------------------------------------------------------
B2A6C1_NATTJ/9-106--------------------------------------------------------------------------------
I3TPX1_TISMK/24-120--------------------------------------------------------------------------------
A1WYZ2_HALHL/9-105--------------------------------------------------------------------------------
R7I4F9_9BURK/8-104--------------------------------------------------------------------------------
Q6LN95_PHOPR/8-104--------------------------------------------------------------------------------
C8WQ80_ALIAD/10-106--------------------------------------------------------------------------------
R7N5Q1_9FIRM/15-110--------------------------------------------------------------------------------
R6LSF0_9CLOT/9-105--------------------------------------------------------------------------------
I1ITD6_BRADI/41-146--------------------------------------------------------------------------------
D1AZJ0_SULD5/185-278--------------------------------------------------------------------------------
M0TAY3_MUSAM/51-152--------------------------------------------------------------------------------
D8PC97_9BACT/12-107--------------------------------------------------------------------------------
A6TQK2_ALKMQ/10-106--------------------------------------------------------------------------------
I3MWU9_ICTTR/40-139--------------------------------------------------------------------------------
A4SWG8_POLSQ/8-104--------------------------------------------------------------------------------
Q7MS87_WOLSU/155-248--------------------------------------------------------------------------------
D7CP02_SYNLT/8-104--------------------------------------------------------------------------------
R6ERE3_9FIRM/11-104--------------------------------------------------------------------------------
C6XL35_HIRBI/12-108--------------------------------------------------------------------------------
I1BWL4_RHIO9/123-222--------------------------------------------------------------------------------
G1X0K2_ARTOA/334-462--------------------------------------------------------------------------------
K9SQI6_9SYNE/18-112--------------------------------------------------------------------------------
B2KD55_ELUMP/10-104--------------------------------------------------------------------------------
I0AM81_IGNAJ/8-104--------------------------------------------------------------------------------
ATP25_VANPO/109-251--------------------------------------------------------------------------------
M1C016_SOLTU/116-211--------------------------------------------------------------------------------
R5QB53_9BURK/8-104--------------------------------------------------------------------------------
L0ES52_LIBCB/10-105--------------------------------------------------------------------------------
Q1QQT5_NITHX/14-110--------------------------------------------------------------------------------
B1VGL5_CORU7/24-120--------------------------------------------------------------------------------
R7MR88_9FIRM/8-104--------------------------------------------------------------------------------
ATP25_CANGA/122-262--------------------------------------------------------------------------------
R7NQG0_9FIRM/8-104--------------------------------------------------------------------------------
R7K4Z6_9CLOT/10-105--------------------------------------------------------------------------------
G8UKS2_TANFA/9-107--------------------------------------------------------------------------------
B8ENA7_METSB/40-135--------------------------------------------------------------------------------
F6GD04_LACS5/13-111--------------------------------------------------------------------------------
R6HRJ9_9PROT/15-110--------------------------------------------------------------------------------
D1BA22_THEAS/33-122--------------------------------------------------------------------------------
C7PFY2_CHIPD/25-123--------------------------------------------------------------------------------
Q0BRE4_GRABC/97-192--------------------------------------------------------------------------------
R5IBC6_9PORP/9-107--------------------------------------------------------------------------------
H2AMA4_KAZAF/78-205--------------------------------------------------------------------------------
A7IH11_XANP2/41-137--------------------------------------------------------------------------------
H6LK21_ACEWD/11-107--------------------------------------------------------------------------------
E4T8D0_PALPW/9-107--------------------------------------------------------------------------------
D9S2B0_THEOJ/12-106--------------------------------------------------------------------------------
R6PP02_9FIRM/8-104--------------------------------------------------------------------------------
R6UG98_9CLOT/8-104--------------------------------------------------------------------------------
V5SFF4_9RHIZ/29-125--------------------------------------------------------------------------------
D7B3J7_NOCDD/12-109--------------------------------------------------------------------------------
F6IFE3_9SPHN/10-106--------------------------------------------------------------------------------
R5EVV3_9FIRM/10-105--------------------------------------------------------------------------------
K9YL55_CYASC/31-127--------------------------------------------------------------------------------
H3GI95_PHYRM/159-258--------------------------------------------------------------------------------
F7BHS5_ORNAN/46-145--------------------------------------------------------------------------------
C1A7N4_GEMAT/16-110--------------------------------------------------------------------------------
F4NTG8_BATDJ/276-378--------------------------------------------------------------------------------
F8KZF8_PARAV/10-105--------------------------------------------------------------------------------
D0MDZ8_RHOM4/26-123--------------------------------------------------------------------------------
D9QV64_ACEAZ/9-106--------------------------------------------------------------------------------
ATP25_SCHPO/93-216--------------------------------------------------------------------------------
E6X7D5_CELAD/13-111--------------------------------------------------------------------------------
A8EWM1_ARCB4/6-99--------------------------------------------------------------------------------
W0EUD9_9PORP/8-106--------------------------------------------------------------------------------
Q9HX22_PSEAE/8-104--------------------------------------------------------------------------------
B3E3Q9_GEOLS/19-113--------------------------------------------------------------------------------
C1F5X5_ACIC5/12-108--------------------------------------------------------------------------------
F0JEE6_DESDE/18-114--------------------------------------------------------------------------------
K0B0C3_CLOA9/6-102--------------------------------------------------------------------------------
D3FXJ1_BACPE/8-104--------------------------------------------------------------------------------
F2J6T6_POLGS/21-117--------------------------------------------------------------------------------
R7ESF0_9FIRM/20-117--------------------------------------------------------------------------------
B9KGM7_ANAMF/15-109--------------------------------------------------------------------------------
R5E2B8_9FIRM/11-107--------------------------------------------------------------------------------
Q98EZ9_RHILO/18-114--------------------------------------------------------------------------------
G8PNV7_PSEUV/27-123--------------------------------------------------------------------------------
R5CEC3_9FIRM/12-108--------------------------------------------------------------------------------
N0B340_9BACI/8-104--------------------------------------------------------------------------------
E8SIE5_STAPH/9-104--------------------------------------------------------------------------------
D8LLX7_ECTSI/95-196--------------------------------------------------------------------------------
R6R4Z7_9CLOT/8-104--------------------------------------------------------------------------------
Q2YC52_NITMU/8-104--------------------------------------------------------------------------------
Q2IMF9_ANADE/3-97--------------------------------------------------------------------------------
R7G449_9PROT/8-104--------------------------------------------------------------------------------
F4LVY7_TEPAE/11-106--------------------------------------------------------------------------------
A6L1N1_BACV8/9-107--------------------------------------------------------------------------------
R5RZ49_9FIRM/10-105--------------------------------------------------------------------------------
R7C9H6_9CLOT/10-106--------------------------------------------------------------------------------
Q5WHH8_BACSK/6-102--------------------------------------------------------------------------------
Q6AJX9_DESPS/18-114--------------------------------------------------------------------------------
I4AHE2_FLELS/14-112--------------------------------------------------------------------------------
R7BM01_9FIRM/8-104--------------------------------------------------------------------------------
L0G1E7_ECHVK/8-106--------------------------------------------------------------------------------
W5KWU5_ASTMX/92-191--------------------------------------------------------------------------------
I7F098_PHAIB/14-110--------------------------------------------------------------------------------
I0JP65_HALH3/8-104--------------------------------------------------------------------------------
W1PUX9_AMBTC/52-153--------------------------------------------------------------------------------
R7AP40_9CLOT/8-104--------------------------------------------------------------------------------
D3F9N1_CONWI/13-110--------------------------------------------------------------------------------
Q46LB2_PROMT/8-105--------------------------------------------------------------------------------
R6PCX2_9CLOT/9-105--------------------------------------------------------------------------------
ATP25_KLULA/73-205--------------------------------------------------------------------------------
G8LV07_CLOCD/8-104--------------------------------------------------------------------------------
C8WAH7_ATOPD/10-107--------------------------------------------------------------------------------
R6XRX2_9FIRM/7-99--------------------------------------------------------------------------------
B8FMU2_DESAA/13-106--------------------------------------------------------------------------------
R6VXF1_9BACT/3-101--------------------------------------------------------------------------------
E1QJM4_DESB2/22-118--------------------------------------------------------------------------------
A5UYA6_ROSS1/19-115--------------------------------------------------------------------------------
E3MG32_CAERE/60-163--------------------------------------------------------------------------------
R7FMH5_9CLOT/6-100--------------------------------------------------------------------------------
H2J515_MARPK/14-110--------------------------------------------------------------------------------
E6SKC0_THEM7/9-104--------------------------------------------------------------------------------
B3PKN0_CELJU/18-114--------------------------------------------------------------------------------
A4S573_OSTLU/206-310--------------------------------------------------------------------------------
C6W7P7_DYAFD/16-114--------------------------------------------------------------------------------
R6I0A5_9FIRM/9-105--------------------------------------------------------------------------------
Q03VE9_LEUMM/13-109--------------------------------------------------------------------------------
Q310U3_DESAG/19-115--------------------------------------------------------------------------------
R6W6Y8_9BACT/9-107--------------------------------------------------------------------------------
Q30PQ1_SULDN/6-98--------------------------------------------------------------------------------
R5CLL0_9BACT/9-107--------------------------------------------------------------------------------
F0NZC4_WEEVC/12-110--------------------------------------------------------------------------------
K9S5F4_9CYAN/37-134--------------------------------------------------------------------------------
C9R6R0_AGGAD/5-101--------------------------------------------------------------------------------
R5HU75_9FIRM/12-108--------------------------------------------------------------------------------
R5Q081_9FIRM/19-115--------------------------------------------------------------------------------
R5FP90_9FIRM/5-101--------------------------------------------------------------------------------
A3DEU1_CLOTH/8-104--------------------------------------------------------------------------------
Q1G9B8_LACDA/8-104--------------------------------------------------------------------------------
A4VR05_PSEU5/8-104--------------------------------------------------------------------------------
H8MPB9_CORCM/74-172--------------------------------------------------------------------------------
Q0AKW8_MARMM/39-134--------------------------------------------------------------------------------
U5T5I4_9GAMM/14-109--------------------------------------------------------------------------------
F0S0T6_DESTD/8-104--------------------------------------------------------------------------------
O25960_HELPY/6-100--------------------------------------------------------------------------------
M9R1R3_9RHOB/46-142--------------------------------------------------------------------------------
F5YJG7_TREPZ/15-111--------------------------------------------------------------------------------
R6DEK3_9CLOT/9-105--------------------------------------------------------------------------------
Q65H38_BACLD/8-104--------------------------------------------------------------------------------
R7FAW8_9FIRM/8-105--------------------------------------------------------------------------------
F3Z458_DESAF/57-153--------------------------------------------------------------------------------
D3PVY5_STANL/13-109--------------------------------------------------------------------------------
I2F216_9BACT/14-110--------------------------------------------------------------------------------
Q2RKZ2_MOOTA/8-104--------------------------------------------------------------------------------
S5RPA2_9PROT/9-104--------------------------------------------------------------------------------
R5PUQ2_9BACT/9-107--------------------------------------------------------------------------------
H1YG85_9SPHI/15-113--------------------------------------------------------------------------------
R6G428_9FIRM/10-105--------------------------------------------------------------------------------
D7BPC9_ARCHD/13-109--------------------------------------------------------------------------------
K9P3M8_CYAGP/9-105--------------------------------------------------------------------------------
B0JP67_MICAN/22-119--------------------------------------------------------------------------------
Q03RL2_LACBA/8-104--------------------------------------------------------------------------------
H0UKA1_9BACT/11-106--------------------------------------------------------------------------------
K4LK74_THEPS/10-105--------------------------------------------------------------------------------
D6ZEV6_SEGRD/12-108--------------------------------------------------------------------------------
K9Z2B7_CYAAP/30-126--------------------------------------------------------------------------------
D4KFF0_9FIRM/10-106--------------------------------------------------------------------------------
R6C1U9_9CLOT/11-107--------------------------------------------------------------------------------
E9FU74_DAPPU/58-157--------------------------------------------------------------------------------
C7MN28_CRYCD/14-110--------------------------------------------------------------------------------
M5E773_9GAMM/8-104--------------------------------------------------------------------------------
F6ZF75_MONDO/81-180--------------------------------------------------------------------------------
R5K116_9CLOT/8-104--------------------------------------------------------------------------------
O84774_CHLTR/10-106--------------------------------------------------------------------------------
D2PUU4_KRIFD/12-109--------------------------------------------------------------------------------
R5B5K2_9FIRM/9-105--------------------------------------------------------------------------------
D6YRN1_WADCW/10-106--------------------------------------------------------------------------------
K0J7A3_AMPXN/8-104--------------------------------------------------------------------------------
Q0P8K9_CAMJE/6-99--------------------------------------------------------------------------------
R5DCD6_9FIRM/9-105--------------------------------------------------------------------------------
R7CNP0_9FIRM/6-102--------------------------------------------------------------------------------
D1AAX1_THECD/12-109--------------------------------------------------------------------------------
B7Q172_IXOSC/85-184--------------------------------------------------------------------------------
B8C8G7_THAPS/1-100--------------------------------------------------------------------------------
A5EVS4_DICNV/8-104--------------------------------------------------------------------------------
Q7CW98_AGRFC/55-151--------------------------------------------------------------------------------
A7MK38_CROS8/88-183--------------------------------------------------------------------------------
F4CD17_SPHS2/15-113--------------------------------------------------------------------------------
J9R497_RIEAN/12-110--------------------------------------------------------------------------------
K9UMC3_9CHRO/24-120--------------------------------------------------------------------------------
Q7V1P0_PROMP/9-105--------------------------------------------------------------------------------
R5ALT6_9BACT/11-109--------------------------------------------------------------------------------
R5QK94_9FIRM/9-105--------------------------------------------------------------------------------
Q38VU1_LACSS/8-104--------------------------------------------------------------------------------
H9UK90_SPIAZ/16-113--------------------------------------------------------------------------------
G2TNI2_BACCO/8-104--------------------------------------------------------------------------------
Q6MBT6_PARUW/10-106--------------------------------------------------------------------------------
R6A7V5_9CLOT/34-124--------------------------------------------------------------------------------
L0DJT1_SINAD/58-154--------------------------------------------------------------------------------
B2FPR3_STRMK/26-122--------------------------------------------------------------------------------
A7HT63_PARL1/61-157--------------------------------------------------------------------------------
F9VG82_LACGL/8-105--------------------------------------------------------------------------------
Q2YLI9_BRUA2/7-102--------------------------------------------------------------------------------
B0VG47_CLOAI/9-104--------------------------------------------------------------------------------
C6XXK3_PEDHD/15-113--------------------------------------------------------------------------------
D9SD71_GALCS/10-105--------------------------------------------------------------------------------
B0UVQ4_HISS2/5-101--------------------------------------------------------------------------------
Q8XXC1_RALSO/8-104--------------------------------------------------------------------------------
U5N9D4_9BURK/23-119--------------------------------------------------------------------------------
B2GGE5_KOCRD/13-109--------------------------------------------------------------------------------
R5B495_9CLOT/22-117--------------------------------------------------------------------------------
B1YKR7_EXIS2/8-104--------------------------------------------------------------------------------
R6Z4U4_9FIRM/8-104--------------------------------------------------------------------------------
R7FU76_9FIRM/9-105--------------------------------------------------------------------------------
Q2RZI5_SALRD/27-124--------------------------------------------------------------------------------
G2J1W2_PSEUL/8-104--------------------------------------------------------------------------------
B7J9S2_ACIF2/10-105--------------------------------------------------------------------------------
R5WGL8_9BACT/6-104--------------------------------------------------------------------------------
G2IMP8_9SPHN/35-130--------------------------------------------------------------------------------
Q087K6_SHEFN/8-104--------------------------------------------------------------------------------
IOJAP_SYNY3/32-129--------------------------------------------------------------------------------
M4AHS6_XIPMA/111-210--------------------------------------------------------------------------------
G8ZLS5_TORDC/62-203--------------------------------------------------------------------------------
Q6F840_ACIAD/13-109--------------------------------------------------------------------------------
A4HIE4_LEIBR/27-122--------------------------------------------------------------------------------
C9RLC6_FIBSS/18-111--------------------------------------------------------------------------------
F5Y7D3_TREAZ/5-100--------------------------------------------------------------------------------
A9ITN4_BORPD/8-104--------------------------------------------------------------------------------
R7LCG4_9BACT/75-171--------------------------------------------------------------------------------
B9KZU5_THERP/16-113--------------------------------------------------------------------------------
R6BS45_9BACT/9-107--------------------------------------------------------------------------------
Q22U76_TETTS/206-310--------------------------------------------------------------------------------
Q7V7C5_PROMM/12-109--------------------------------------------------------------------------------
A6LD24_PARD8/9-107--------------------------------------------------------------------------------
V4JHI0_9GAMM/9-105--------------------------------------------------------------------------------
R9YKS2_9PROT/5-99--------------------------------------------------------------------------------
B0TBV4_HELMI/10-106--------------------------------------------------------------------------------
R7PRI7_9FIRM/6-102--------------------------------------------------------------------------------
R6TPV4_9STAP/7-99--------------------------------------------------------------------------------
R5AYU7_9BACE/9-107--------------------------------------------------------------------------------
C5CEP8_KOSOT/6-102--------------------------------------------------------------------------------
G4UJS9_NEUT9/132-292--------------------------------------------------------------------------------
G0N093_CAEBE/60-162--------------------------------------------------------------------------------
A4J7H3_DESRM/10-106--------------------------------------------------------------------------------
G8QZC8_OWEHD/15-113--------------------------------------------------------------------------------
E8UCD5_TAYEM/8-104--------------------------------------------------------------------------------
R7BSA0_9FIRM/8-104--------------------------------------------------------------------------------
R7QW75_9FIRM/9-105--------------------------------------------------------------------------------
B1WTU4_CYAA5/32-128--------------------------------------------------------------------------------
F0QZ30_BACSH/9-107--------------------------------------------------------------------------------
R5VK80_9CLOT/10-106--------------------------------------------------------------------------------
I7HEH2_9HELI/17-111--------------------------------------------------------------------------------
A1A1R8_BIFAA/12-110--------------------------------------------------------------------------------
ATP25_ASHGO/88-221--------------------------------------------------------------------------------
F4KXS4_HALH1/20-117--------------------------------------------------------------------------------
A5D414_PELTS/10-106--------------------------------------------------------------------------------
R6NC63_9CLOT/8-104--------------------------------------------------------------------------------
Q83DY7_COXBU/8-104--------------------------------------------------------------------------------
W0BD95_9GAMM/9-105--------------------------------------------------------------------------------
Q6MGS6_BDEBA/227-324--------------------------------------------------------------------------------
D3E4X0_GEOS4/10-106--------------------------------------------------------------------------------
A6VM71_ACTSZ/7-103--------------------------------------------------------------------------------
R7A8R3_9FIRM/5-102--------------------------------------------------------------------------------
F8L9P7_SIMNZ/11-106--------------------------------------------------------------------------------
I4B2F1_TURPD/1