Sequence alignment for CL0260

PF03445

Q74E96_GEOSL/70-216--------------------------------------------------------------------------------
Q3SMK2_THIDA/311-451--------------------------------------------------------------------------------
A5FH19_FLAJ1/315-456--------------------------------------------------------------------------------
Q21RX0_RHOFT/287-419--------------------------------------------------------------------------------
Q2IEC2_ANADE/287-421--------------------------------------------------------------------------------
Q72EX4_DESVH/364-509--------------------------------------------------------------------------------
B9M647_GEODF/87-225--------------------------------------------------------------------------------
Q5KZZ8_GEOKA/30-169--------------------------------------------------------------------------------
Q0A740_ALKEH/45-190--------------------------------------------------------------------------------
Q0A741_ALKEH/289-440--------------------------------------------------------------------------------
Q2SC90_HAHCH/335-475--------------------------------------------------------------------------------
B3E878_GEOLS/160-298--------------------------------------------------------------------------------
Q0A6Y9_ALKEH/155-300--------------------------------------------------------------------------------
A6VT54_MARMS/299-436--------------------------------------------------------------------------------
Q5QUI2_IDILO/291-428--------------------------------------------------------------------------------
Q1QZ78_CHRSD/292-424--------------------------------------------------------------------------------
A7II29_XANP2/249-381--------------------------------------------------------------------------------
Q4FUP8_PSYA2/335-467--------------------------------------------------------------------------------
Q315G6_DESAG/341-482--------------------------------------------------------------------------------
B3EBD1_GEOLS/155-293--------------------------------------------------------------------------------
Q0A6Z3_ALKEH/338-481--------------------------------------------------------------------------------
A7HH07_ANADF/294-428--------------------------------------------------------------------------------
Q89MS6_BRADU/287-419--------------------------------------------------------------------------------
Q8NQY4_CORGL/299-437--------------------------------------------------------------------------------
A9C1C5_DELAS/300-433--------------------------------------------------------------------------------
Q3AAI0_CARHZ/302-445--------------------------------------------------------------------------------
Q0AAW3_ALKEH/298-443--------------------------------------------------------------------------------
Q6AK79_DESPS/536-676--------------------------------------------------------------------------------
O29291_ARCFU/289-422--------------------------------------------------------------------------------
Q6LLZ3_PHOPR/291-423--------------------------------------------------------------------------------
A7HF43_ANADF/290-424--------------------------------------------------------------------------------
Q5WB02_BACSK/16-152--------------------------------------------------------------------------------
A0KJY8_AERHH/290-422--------------------------------------------------------------------------------
A6W3F4_MARMS/295-433--------------------------------------------------------------------------------
O67874_AQUAE/297-438--------------------------------------------------------------------------------
Q0A6Z6_ALKEH/50-188--------------------------------------------------------------------------------
Q0AAE6_ALKEH/308-446--------------------------------------------------------------------------------
A7HH08_ANADF/291-424--------------------------------------------------------------------------------
A0QUE9_MYCS2/19-146--------------------------------------------------------------------------------
A0L6G8_MAGMM/300-438--------------------------------------------------------------------------------
A4SW93_POLSQ/291-424--------------------------------------------------------------------------------
Q0VMJ3_ALCBS/291-422--------------------------------------------------------------------------------
A5UUU0_ROSS1/301-438--------------------------------------------------------------------------------
Q2RWQ7_RHORT/287-419--------------------------------------------------------------------------------
Q5E0M6_VIBF1/300-437--------------------------------------------------------------------------------
Q30QK1_SULDN/290-422--------------------------------------------------------------------------------
A1VJH4_POLNA/291-424--------------------------------------------------------------------------------
A0M2M4_GRAFK/316-457--------------------------------------------------------------------------------
A1WYA2_HALHL/306-457--------------------------------------------------------------------------------
A1TZ30_MARHV/318-457--------------------------------------------------------------------------------
A5GB63_GEOUR/87-228--------------------------------------------------------------------------------
A1STJ2_PSYIN/318-456--------------------------------------------------------------------------------
A7HBY5_ANADF/161-300--------------------------------------------------------------------------------
Q47FJ9_DECAR/33-173--------------------------------------------------------------------------------
Q2IP15_ANADE/291-425--------------------------------------------------------------------------------
A7HHL2_ANADF/317-456--------------------------------------------------------------------------------
Q47FJ8_DECAR/323-463--------------------------------------------------------------------------------
Q1GL32_RUEST/285-422--------------------------------------------------------------------------------
Q8KDK9_CHLTE/323-469--------------------------------------------------------------------------------
Q9K6I7_BACHD/316-461--------------------------------------------------------------------------------
Q5P177_AROAE/314-454--------------------------------------------------------------------------------
Q31GK9_THICR/297-430--------------------------------------------------------------------------------
A7HH09_ANADF/26-158--------------------------------------------------------------------------------
Q7NTV8_CHRVO/285-417--------------------------------------------------------------------------------
Q124J8_POLSJ/165-305--------------------------------------------------------------------------------
A7HF42_ANADF/295-425--------------------------------------------------------------------------------
Q7MSB7_WOLSU/294-426--------------------------------------------------------------------------------
B0UVN5_HISS2/302-436--------------------------------------------------------------------------------
B6IWA9_RHOCS/320-456--------------------------------------------------------------------------------
Q5SK35_THET8/277-408--------------------------------------------------------------------------------
Q72EX3_DESVH/178-317--------------------------------------------------------------------------------
Q7MCI2_VIBVY/302-436--------------------------------------------------------------------------------
Q88QY0_PSEPK/323-461--------------------------------------------------------------------------------
Q8EDA6_SHEON/299-436--------------------------------------------------------------------------------
Q9HZ07_PSEAE/290-420--------------------------------------------------------------------------------

PF03710

GLNE_RHILO/579-826LKLMAT------------IMGAAPRLAAIITR------------------------------------------------
GLNE_CORGL/627-871GQRLMR------------ILGNSPYISELIIS------------------------------------------------
GLNE_VIBCH/33-281LNQLRY------------VLGLSQFVAQTLQR------------------------------------------------
GLNE_HAEIN/589-842LQQVIE------------LCAQSQLISEQLAH------------------------------------------------
GLNE_PASMU/587-841LTQLIE------------LCAQSRMIAEQVAR------------------------------------------------
GLNE_ECOLI/552-806LKHLIS------------LCAASPMIASQLAR------------------------------------------------
GLNE_CAUCR/70-317WGSLAP------------VFAASPYLAGLARR------------------------------------------------
GLNE_PSEAE/47-298LEDFRR------------VAAASDFVAEQAVR------------------------------------------------
GLNE_ECOLI/29-277SAQAKS------------VLTFSDFVQDSVIA------------------------------------------------
GLNE_PASMU/46-295IGQLRY------------AIAMSDFFAETLQK------------------------------------------------
GLNE_CAUCR/589-828FELIVE------------VMAFAPRLAATMAK------------------------------------------------
GLNE_VIBCH/556-810LVQLVR------------LCTASPMISEQLAR------------------------------------------------
GLNE_HAEIN/46-299VYQLGY------------AIAMSDFVEKVLQK------------------------------------------------
GLNE_RHILO/58-307QDFLAA------------VFDLSPFLRDTSRR------------------------------------------------
M9X424_MANHA/24-271.QPLVT------------AISLSNFVHQTLQK------------------------------------------------
GLNE_MYCTU/589-828.KRLMH------------VLGTSAYVPDLLMR------------------------------------------------
Q5F608_NEIG1/520-754.AQLAQ------------IMSQSSWVAAYLNK------------------------------------------------
GLNE_PSEAE/576-830LERLLT------------LCAASPMVAEQIAR------------------------------------------------

PF09139

F4Q0F6_DICFS/78-418IKMIME.QFPK..IKY..GFAYGSGVIAQKGY........................DVQDKQIQQQQRQQQPTTEELSPM
C5G7N5_AJEDR/130-496LRQILW.QFKAP.IRY..AFAYGSGVFPQSNR......................SAFPAESSHPAAPQAIQTGQGNSGKM
H6BQ12_EXODN/141-510LRQILW.KFRAP.IRY..AFAYGSGVFPQSSN......................TEGGNSKLHPSPPEAITKVQNGNQKM
A8NRM0_COPC7/89-410LESIVA.KFDAP.IRY..AFAYGSGVFEQDGY....................................AEKKKEGAEGPM
G1XLW6_ARTOA/133-472LRHLLW.EFKAP.IRY..AFAYGSGVFSQGTS..........................................SKDKPM
E9J9M0_SOLIN/10-328LRQLLG.EFPGN.MKF..CFAYGSGAFKQTNN...........................................DGNNM
G4N333_MAGO7/122-492LGDIVK.SFQAP.IIY..AFAYGSGVFPQSKL.................LGKAPSDELLRSVHTKPDPAIVRAQGESPKM
D8M4A9_BLAHO/3-344FEQYLS.KLPE..YDF..AITYGSGVFKQVGY.......................................SEKDHKNAM
S3BZ14_OPHP1/165-542LRQILW.QFRAP.IRY..AFAYGSGVFPQSKS.................DGRVPTEAEIKAIHPKAPQSIQRAQDGTPKM
U1HUS9_ENDPU/150-521LRQILW.KFKAP.IRY..AFAYGSGVFTQKGD...................PSAVSFPASTLHPNPPEAITKVQDGPQKM
C1E0D3_MICSR/10-340LRAVLE.DVPP..VNH..AFGYGSGVLPQP..............................LRDDEGPSASARDHAATGSV
L0P740_PNEJ8/104-428LKEILR.EFKAP.IQF..SFAYGSGVFKQKG...........................................NNKEPM
C9S6T4_VERA1/142-510LTRLLR.SYRAP.IMY..AFAYGSGIFPQAKP..................NRHVSDEEYRNVHPKPSQALKEVQASGPKS
B4NJ58_DROWI/5-342YRRTVT.RFPLGSVSY..IFAYGSGVKQQLGY............................KNVQQPAAKPSSSKSSSSNV
E9F7E1_METRA/91-463LRIMLR.QFNAP.IVY..CFAYGSGVFPQDDI..................SRSITEAEFRAVHPKPPEALVKAQKGSPKM
A5E243_LODEL/82-429LEGIVK.SFHAP.MET..AIGYGSGVLPQDGYPVDAGTATDTDTSIDTATDTSTAIDTASTSASTTAAMGTSKSDADPKQ
W1Q7W0_OGAPD/134-519LRKVVW.EFNAP.IRY..AFGYGSKVFDQGST..........................................KSSNSQ
B6K4K1_SCHJY/52-376FERIVN.SFDAP.IDV..AIAYGSGVFSQKGY.........................................DKKKKPM
H0Z110_TAEGU/13-327FR.VLA.HFLQE.LSL..AFAYCSGVAARGGP........................................GTGLGINM
M3B232_PSEFD/164-542LRQVLW.QFKAP.IRY..AFAYGSGVFGQKSS...................GSSTGSESLSPHPNPPKAVEDWQKGGAKI
E0VMJ8_PEDHC/16-330FNRILS.KFPLEDLTY..CFAYGSGVFDQLHN..........................................RSNKNM
B0WG01_CULQU/11-332FYRILS.RFPPN.FAF..CFAYGSGVKQQLGY.......................................DKAKKKQNM
D6WLK1_TRICA/13-336YARILS.KFPQN.FTF..CFAYGSAVKKQIEK..........................................KPKDNM
K3ZJ60_SETIT/15-326LAGPLR.DILPP.VDF..CCAYGSTLLHAR............................................PDGTSM
E9CXS5_COCPS/124-488LRQILW.QFRAP.IRY..AFAYGSGVFPQSGA........................ATGESCHPAAPPTIQRMQQGGGKM
A0ECV7_PARTE/9-316LKQFIQ.TLPQ..SEL..SFAYGSAVQPQFNY........................................DYTKNKPM
B9GN14_POPTR/9-326LKSFLK.VLPP..VGF..CCVYGSSLHPNN............................................NDKSTM
S8AI20_PENO1/118-482LRQILW.QFRAP.IRY..AFAYGSGVFPQSGS........................GAAGSTHPAAPAAIQKMQKGSGKM
W5N967_LEPOC/13-328YRKILS.RFPQD.MSL..AFAYGSGVFRQSGT.......................................THGQMGSNM
Q0UPI9_PHANO/59-415LRGILR.QF.PP.ITY..AFAYGSGVFPQSAA.................TASRTTN....SPHPNPPEAILKWQKGGGKM
A7S007_NEMVE/10-319FRDIVS.RFPDG.ITL..AFAYGSGVFKQIGN..........................................VSTDNM
K9G9U1_PEND2/123-487LRMILW.QFKAP.IRY..AFAYGSGVFAQNGS.......................GAPSSSLHPSAPTAIQNMQKGSGKM
TAM41_DICDI/68-424INELLK.LFPP..IKY..GFAYGSGVISQKGY..........................NRNGDGSTSTENPSKKEEQSPM
I1K386_SOYBN/6-319FRSFLQ.VLPP..VEF..ACVYGSSLHPSN............................................HDKTTM
M7PAY1_PNEMU/94-420LKTVLW.KFKAP.IRF..SFAYGSGIFKKKR...........................................NDKKPM
S8FW20_FOMPI/63-368LEDIVA.QFNAP.IRY..AFAYGSGVFEQDGY.........................................KQEEKPM
C5MHG3_CANTT/128-440LQGIVK.SFTAP.IDV..SIGYGSGILPQDGY....................................EQQEKQENTSKQ
Q2H207_CHAGB/144-517LKAIPW.QFRAP.IRY..AFAYGSGVFPQSKA.................SGKTPTEEELRAIHPKAPLAVQRAQDGTPKM
A8Q506_MALGO/15-385ILHILQ.SMNLPMVQY..AFAYGSGVFSQAPV......................................SQKVGNTPPM
T1JUS5_TETUR/9-355LKNLIS.FLPSS.YCF..AFAYGSAVFKQSIS.................AFDRSSSSTSKSKSFAASVLSNGSAKKDANM
G1KJZ6_ANOCA/15-329FRRILA.HFPPE.LSL..AFAYGSGVFQQAGA.......................................SSAETGNNM
K2RZS9_MACPH/50-418LRQILW.QFRAP.IRY..AFAYGSGVFPQSSD......................SGSTSLSPHPNPPDAIKKWQSGGQKV
M2UHY6_COCH5/80-448LRGILR.KF.PP.VTY..AFAYGSGVFPQSAA.................TASRTTQ....SPHPNPPDAILKWQKGGGKM
C4QXR2_PICPG/110-482LQKVLW.KFNAP.IRF..AAGYGSGVFTQANQ........................................KVSESKPQ
G3APF1_SPAPN/81-416LEEIVK.TFNAP.IDV..SIGYGSGILPQDGY............DLPKVSGTSAPASSTSSGGSSTTTTTTTTTTSSSQQ
C7Z478_NECH7/122-494LRLMLR.QFNAP.IVY..CFAYGSGVFPQEVS..................KPSISDAAFRAVHPNPPDALVKSQKGSPKM
F1R4V6_DANRE/13-328YRRIIN.RFPQD.FSL..AFAYGSAVFRQTGS.......................................SQGHMAKNM
Q6CC57_YARLI/155-503LRQVLW.TFKAP.IRY..SFAYGSGVFSQGKE.........................................SNASKPQ
K7IVD4_NASVI/11-329FKNILQ.EFPRN.MKF..CFAYGSGVFKQKSD...........................................PASNM
J9K2F7_ACYPI/5-309LNRILT.KFPTKHLVY..CFAYGSGVFQQAGR...........................................TDRAM
TAM41_DROME/5-338YRRTVA.RFPLGSVSY..MFAYGSGVKQQEGY................................GKVGNGNNLRPPPGTV
M7TNP0_EUTLA/89-460MRQLLW.RFRAP.IRY..AFAYGSGVFPQAKG...................GTPTEAEIKAIHPKAPLAVQKAQDGSPKM
U4L0D7_PYROM/82-426LRQLLW.QFEAP.VRW..AIAYGSGVFSQGTR........................................NAGGKPPM
W1PVI6_AMBTC/11-327LAAPLN.DLPH..VDF..CCAYGSSLLPNN............................................SNKKPM
S2J8V7_MUCC1/67-383LKDVVS.QFNAP.VRY..AIAYGSGVFRQSGY.........................................DEKKKPM
E1FWI9_LOALO/14-325LKYLLD.ILPLDTVEY..ACAYGSGAVPQGSD..........................................LRLGKM
R7Z3U1_CONA1/137-506LRQILW.QFRAP.IKY..AFAYGSGVFPQSDA.....................TATSAALSPHPHPPEAVLKWQKGGGKM
R9AIR3_WALI9/86-407LEKVIN.SFNAP.IRY..GFAYGSGVFQQPGY.........................................TDKDKPL
G8B9Z5_CANPC/74-380LVDLVN.TFDSK.ISA..AVGYGSGILPQNGY........................................DKPDKEKQ
Q9SN75_ARATH/9-326LSSFLS.VLPP..VDF..CCVYGSTLHPNN............................................QDKSKM
G8YHN8_PICSO/69-420VERLLQ.SFKSS.IEV..SFGYGSGVFQQSGY.........................................TGKSTPQ
B4K948_DROMO/5-334YRRVVA.RFPLGNVSY..MFAYGSGVKQQIGY....................................EKVDEKPNSKSV
S9W8F4_SCHCR/52-374LKGLLD.TFNAP.IQV..AIGYGSGVFQQAGY.........................................GSTAKPM
N1J4Q0_BLUG1/111-475LRRTLW.HFRAP.IRF..AFAYGSGVFPQSRQ....................TYSNVRPTSIHPNPPPAVLKAQGGTSKM
J3PFP4_GAGT3/124-495LGDIVK.SFQAP.IIY..AFAYGSGVFPQSKL.................LGRTPSDELVHSVHPDPDPAIVRAQGEKPKM
J4HVB6_FIBRA/89-403LESVVA.QFNAP.IRY..AFAYGSGVFEQDGY.........................................NNTDKPM
A3LVC5_PICST/51-374LRGIID.TFNSS.IKV..SIGYGSGVLPQAGY.........................ANERSNHGNNDSTTNNNIEAPVQ
Q6BKV0_DEBHA/67-411LSQLIA.NFKSP.IKF..SIGYGSGVFEQTGY.........................................KKSKKPQ
A7EQJ2_SCLS1/136-507LRQILW.QFRAP.IRY..AFAYGSGVFPQSKH...................TQATPSSITSIHSKPPPAIVEQQGGTPKM
F1L2S9_ASCSU/10-321LGALLE.CVPLDTVRF..AFAYGSGAIAQYGS..........................................QTEDKM
G3JTW8_CORMM/137-509LRVMLR.QFNAP.IVY..CFAYGSGVFPQGDL..................GRSISDAEFRAVHPKPPTALVKAQKGSPKM
V5G174_BYSSN/130-494LRQILW.QFKAP.IRY..AFAYGSGVFTQSAS........................ETPSQGHPAPPQAIQTVQQGKGKM
F4PEP7_BATDJ/67-400LESIVS.SFRAP.VRF..ALAYGSGVFQQKGY.........................DAIHSSLDSVNENKASSFNEKPM
Q5AGE7_CANAL/141-463LQEIVN.SFDAP.IDV..SIGYGSGILPQDGY................................DKDKSTSNNTANDSKQ
G3XQA7_ASPNA/29-371LNYIIA.KFPP..VAH..AFAYGSGVFPQSAK.......................ASTGPSVHENAPLAITQMQGGNQKM
B6QBB5_PENMQ/135-501LRQILW.KFRAP.IRY..AFAYGSGVFAQTAT......................AGAKSDPGHPAPPQAIRNVQQGKGKM
F2DNW5_HORVD/11-326LAGPLR.DLLPP.VDF..CCAYGSTLTHAR............................................PDGTSM
I7M213_TETTS/17-335LDSIIQRDFPK..IDF..AFGYGSGVFRQIGY........................................DYSKDSPM
M9MEW7_PSEA3/116-467LHNILA.CFDTP.VRF..AFAYGSGVFSQKEA................................GPEHSKRPATKDGKKM
R8BP23_TOGMI/11-384LRQILW.QFRAP.IRY..AFAYGSGVFPQSKA.................SGRTPTDEELRRIHPKAPLAVQRAQDGTPKM
M2M255_BAUCO/36-426LRQILW.RFRAP.IRY..AFAYGSGVFAQQSS....................KSMTETSMSPHPNPPKAVEDWQKGGAKI
T1F6T9_HELRO/4-318.QKFLK.FFPE..VRM..AFAYGSGVFKQKSH.........................................LDPSKNM
F4REF8_MELLP/113-453LSNIIQ.SFKAP.IRY..AIGYGSGVFPQKSY........................................DLKKQTPM
M5E4Z7_MALS4/64-428ILSILN.AMRLPKYNY..AFAYGSGVFSQTTK......................................AKAVGGTAPM
U5H5E0_USTV1/137-472LEEILA.DFKAP.VRF..AFAYGSGVFRQKGY.........................................AASEQPM
G3B682_CANTC/65-370LTGLVN.HFDG..TST..SIGYGSGVFEQAGY.........................................GSGSRPQ
H3FZA6_PRIPA/8-319VKELIS.DLPLGSVNF..AFAYGSGVVPQENE..........................................RMEDKM
H2S0L1_TAKRU/13-328YRRILS.EFPQD.ISL..AFAYGSGVFKQHGT.......................................NQGQMEKNM
D8PZS1_SCHCM/93-412LESIVA.QFNAP.IRY..AFAYGSGVFEQDGY....................................RTVEAPDGEKPM
D7T9Q8_VITVI/9-326LASLLK.FLPP..VEF..CCVYGSALHPNN............................................YNKSTM
G0T2B5_RHOG2/147-502LEEVMK.SFKAP.VRY..AFAYGSGVFRQKGY.........................................AKEDKPL
B7PKK9_IXOSC/7-319WSKIIS.AFPGK.FTL..AFCYGSGVFPQKGA.........................................AQPKGNM
F9WXS4_ZYMTI/148-520LRSIIW.QFRAP.IRY..AFAYGSGVFGQKSS.....................SGVSTDLSPHPHPPKAVEEWQKGGAKV
B9SQ77_RICCO/9-325LKNFLE.VLPS..VEF..CCVYGSALHPNN............................................QDKSSM
M0S210_MUSAM/10-320LAGPLE.LLPA..VDF..CCVYGSSLLPNN............................................SDKTSM
E9R3D7_ASPFU/128-493LRQILW.QFRAP.IRY..AFAYGSGVFPQSGS.......................AAGSSQCHPSAPAAIQNMQQGKGKM
I4Y9B7_WALSC/21-342LEAVFH.SFRAP.IRY..GFAYGSGVFKQTGY.........................................SDKDKPL
D3B0C8_POLPA/348-663IKKILS.QFPK..IKY..GFAYGSGVISQKGY.......................................ESNSNKQPM
A5DAD6_PICGU/58-371LEALAR.RFDGP.VEF..TFGYGSGVFDQAGY.........................................TKRAKPQ
TAM41_CAEBR/4-316YRELIS.VLPLDTVEY..AFAYGSGAIQQKDE..........................................NKAEKM
H3AQ57_LATCH/13-328FRRILS.HFPPD.ISL..AFAYGSGVFRQSGN.......................................SQGLMQNNM
G4U2Y1_PIRID/94-414LEEIVG.TFHSP.IRY..AFAYGSGVFEQEGS......................................SKLEKDKKPM
H2Y1H7_CIOIN/13-342LSRLLS.RFPGD.MSL..AFSYGSGIFPQNEN.........................................SPPLSNM
Q5KAN9_CRYNJ/49-385LRPVIS.TFQAP.IDW..AAAYGSGVLPQASY.....................................KPPAPGDAGPL
E9HGG3_DAPPU/25-340FRHILS.LFPED.LVF..AFSYGSGAFQQHGQ.........................................KSTEGNV
Q7PQL6_ANOGA/11-332FFRLLS.KFPQG.FSF..CFAYGSGVKQQLGY.......................................ESVRSKRNM
F1MZC5_BOVIN/13-327FRKILS.HFPEE.LSL..AFAYGSGVYRQAGP........................................SSDQKNAM
B7GA00_PHATC/17-343.RKLLEDTLPLDNVVY..AFGYGSGVLSQE......................................IVTKEKADDSNM
B4JF38_DROGR/5-334YRRIVT.RFPLGNVSY..MFAYGSGVKRQEGY....................................EMLDQKPDAKTV
Q16J98_AEDAE/11-332FYRILS.RFPPN.ITF..CFAYGSGVKQQLGQ.......................................DAAQKKRNM
E3K171_PUCGT/48-392LNSIIN.SFKPP.IRY..ALAYGSAVFPQNSY........................................QKQQQQPM
D5GF34_TUBMM/84-434LRSLLW.QFRAP.VRY..AFAYGSGVFSQGSK.................................FGGGSGSVAGGRKPM
G9MXT6_HYPVG/81-452LRMMLR.QFNAP.IVY..CFAYGSGVFPQEKA..................GRSVSEAEFRAVHPKPPEALVKAQKGSPKM
U9TGF8_RHIID/101-418LRKLLN.NFHAP.IRY..AIAYGSGVFPQKGY........................................NYDENKPM
L8FTT4_PSED2/132-505LRQVLW.QFRAP.IRY..AFAYGSGVFPQSKP.................SAPSSTPSSRTSIHPNAPSAIAKAQDGQPKM
A0A0C4EL14_PUCT1/30-349LGAIIS.SFRPP.IRY..AFAYGSAVFPQKSY........................................PQRNSHAM
TAM41_SCHPO/61-385LTKVVN.YFQAP.IDV..AVGYGSGVFRQAGY.........................................SQKENPM
R4XIF8_TAPDE/76-410LRSVLW.KFKAP.IRY..AFAYGSGVFSQKGY.........................................DGSTKPM
G7E6I3_MIXOS/149-482LQAVRA.SFRAP.IRY..AFAYGSGVFKQRGY.........................................DAKARPM
B8N4Y6_ASPFN/11-362LQQITQ.QFRAP.ISY..SIAYGSGVFPQTTN......................KTSSNPQLHPSPPPAISQAQKAHPKM
K5VSI5_PHACS/87-407LESIVA.QFNAP.IRY..AFAYGSGVFEQDGY....................................TISNPKSKDGPM
T0K1A0_COLGC/136-508LTNVVR.EFRAP.VMY..AMAYGSGVFPQSKT..................SRSVTDEEFRTVHPKPTSSLMEVQKGGPKM
D7FQS1_ECTSI/13-328LGELIS.AFPE..AEF..AFAYGSGVVKQQGY....................................AENVSNASDLPM
K5VXR0_AGABU/90-409LEDVVA.KFNAP.IRY..AFAYGSGVFEQDGR........................................EQDAETPM
F2PR85_TRIEC/162-525LRQILW.QFKAP.IRY..AFAYGSGVFPQSGT.........................SGGSCHPSPPQAIQAVQQGGGKM
F7BSM1_MONDO/13-327FRRILA.NFPDN.LSL..AFAYGSAVYRQAGP........................................NGGRKNIM
C1MRC2_MICPC/9-342LGVVLN.DLPP..VVH..AFAYGSAVFPQP............................................ASSGSV
C3ZAA9_BRAFL/5-319LSKIVS.NFPQEGLAF..AFAYGSGVFHQRGH.........................................KAMSQNM
G4V8Y8_SCHMA/10-360LKRLID.TLNTDRTNYVASFAYGSVVFPQK..........................................DRTSSNSL
V2X315_MONRO/94-415LESIVA.QFNAP.IRY..AFAYGSGVFEQDGY...................................NKPASPDDPNSPM
M5BIJ2_THACB/103-424LEEIAA.GFDAP.IRY..AFAYGSGVFNQDGY.........................................KDSDRPQ
W5JMS0_ANODA/11-332FYRILS.RFPPG.FSF..CFAYGSGVKQQLGY.......................................DTIRSKRNM
M2RN09_CERS8/89-398LESIVA.QFNAP.IRY..AFAYGSGVFDQAGQ...................................PSFSSASPAERPM
E5SKP7_TRISP/223-538LERIAS.ILPRTSVSM..MFAYGSGVIAQRNS..........................................EIKRNM

PF09970

A2BMQ9_HYPBU/4-185----------------------------------------------------------------------------TLND
Q9YEU3_AERPE/3-181----------------------------------------------------------------------------SRRG
Q0W0P2_METAR/6-201----------------------------------------------------------------------------NFRI
A3DMD4_STAMF/4-178----------------------------------------------------------------------------TLED
B8D508_DESK1/4-179----------------------------------------------------------------------------SIDE
A8AAR7_IGNH4/4-184----------------------------------------------------------------------------TLDD
Q8ZWK5_PYRAE/12-191----------------------------------------------------------------------------YKTA
A4YD77_METS5/3-181----------------------------------------------------------------------------AFEK
A8MBZ4_CALMQ/6-188----------------------------------------------------------------------------YSLA

PF08843

P96356_MYCTU/44-279----------------------------------------------------------------------------QFAA
A4QBB6_CORGB/41-280----------------------------------------------------------------------------IVLS
A4TG06_MYCGI/45-278----------------------------------------------------------------------------RFMA
Q3L9Z1_RHOE4/41-273----------------------------------------------------------------------------RFLA
Q0RZM2_RHOJR/41-272----------------------------------------------------------------------------RFLT
A1BD69_CHLPD/21-282----------------------------------------------------------------------------RDIK
A1VQW1_POLNA/3-254----------------------------------------------------------------------------ADVE
Q8XT48_RALSO/19-276----------------------------------------------------------------------------IIMD
B1YQB6_BURA4/27-287----------------------------------------------------------------------------QAVG
Q63YV1_BURPS/19-278----------------------------------------------------------------------------RDVK
Q82BM7_STRAW/85-332----------------------------------------------------------------------------LVLA
A4X8Y5_SALTO/290-509----------------------------------------------------------------------------HVLT
A5FTN4_ACICJ/24-250----------------------------------------------------------------------------EVVR
A5CLY9_CLAM3/43-277----------------------------------------------------------------------------RFLC
B4SCH8_PELPB/39-286----------------------------------------------------------------------------TLLN
Q5X025_LEGPL/35-302----------------------------------------------------------------------------QSLS
A0A0C9P991_LEGPN/35-300----------------------------------------------------------------------------RLLV
Q3ICX9_PSEHT/18-286----------------------------------------------------------------------------KLLS
Q7MZL3_PHOLL/34-307----------------------------------------------------------------------------RLLQ
B3EES9_CHLL2/39-305----------------------------------------------------------------------------EKLA
A1W687_ACISJ/40-308----------------------------------------------------------------------------RALF
B1HK77_BURPE/40-306----------------------------------------------------------------------------RALS
A6DS96_9BACT/37-309----------------------------------------------------------------------------ALLE
Q64WK6_BACFR/36-314----------------------------------------------------------------------------KILR
Q7MW16_PORGI/42-316----------------------------------------------------------------------------EILR
A4VC40_BACUN/48-319----------------------------------------------------------------------------SLMA
A4TFZ6_MYCGI/38-313----------------------------------------------------------------------------EVLR
Q8EAV5_SHEON/44-326----------------------------------------------------------------------------ILYV
E0TEK2_PARBH/39-305----------------------------------------------------------------------------....
A0A016HWW3_BACFG/41-334----------------------------------------------------------------------------YALF
A3J913_9ALTE/48-337----------------------------------------------------------------------------RLLY
A6THM9_KLEP7/48-339----------------------------------------------------------------------------RLLF
A9KUC3_SHEB9/48-338----------------------------------------------------------------------------RLLY
Q82T38_NITEU/42-327----------------------------------------------------------------------------RALF
Q0BSX7_GRABC/42-325----------------------------------------------------------------------------STLY
Q8KW71_9RHOB/44-328----------------------------------------------------------------------------DALF
Q7D419_AGRFC/45-352----------------------------------------------------------------------------DFFF
A5ETQ0_BRASB/46-335----------------------------------------------------------------------------DALY
Q47DL1_DECAR/45-335----------------------------------------------------------------------------DALF
A1TXM9_MARHV/49-331----------------------------------------------------------------------------QALF
Q5WTN4_LEGPL/43-334----------------------------------------------------------------------------DQIF
A0LER7_SYNFM/41-321----------------------------------------------------------------------------RELF
A3ZP42_9PLAN/42-324----------------------------------------------------------------------------GILF
Q2SRA8_MYCCT/41-317----------------------------------------------------------------------------DYIF
Q6MDY6_PARUW/41-327----------------------------------------------------------------------------ERLF
B0T9L0_CAUSK/43-328----------------------------------------------------------------------------GLLF
Q212U2_RHOPB/41-335----------------------------------------------------------------------------KRLF
Q3A7V2_PELCD/41-315----------------------------------------------------------------------------DKLF
A2SRV5_METLZ/41-321----------------------------------------------------------------------------DYLF
Q70K67_9ACTN/39-270----------------------------------------------------------------------------LFLA
A0A066RWX3_MYCTX/36-282----------------------------------------------------------------------------YLLS
Q0AYA4_SYNWW/12-213----------------------------------------------------------------------------PILD
A4AL11_9ACTN/32-263----------------------------------------------------------------------------RFLA
V7MI27_MYCAV/21-255----------------------------------------------------------------------------RIMA
Q2IEN8_ANADE/40-269----------------------------------------------------------------------------RYLA
A6P1W9_9FIRM/34-254----------------------------------------------------------------------------EFLR
A7B855_RUMGN/34-254----------------------------------------------------------------------------EFLR
B4SEI7_PELPB/39-257----------------------------------------------------------------------------RFLY
A8ZZS0_DESOH/39-259----------------------------------------------------------------------------RFLY
Q5KV23_GEOKA/37-258----------------------------------------------------------------------------RLLY
A6LIS3_PARD8/36-258----------------------------------------------------------------------------RLLY
Q64Q44_BACFR/39-261----------------------------------------------------------------------------RLLY
A7LUN8_BACO1/37-259----------------------------------------------------------------------------RLLY
A6DSE9_9BACT/33-256----------------------------------------------------------------------------RFLY
Q0F353_9PROT/38-260----------------------------------------------------------------------------RLLY
A0LJY5_SYNFM/39-260----------------------------------------------------------------------------RLLY
Q5GY13_XANOR/41-262----------------------------------------------------------------------------RVLY
A3Z4Q5_9SYNE/35-255----------------------------------------------------------------------------RLLY
A1VW15_POLNA/35-256----------------------------------------------------------------------------RLLY
A1W4H8_ACISJ/35-256----------------------------------------------------------------------------RLLA
A6UKN5_SINMW/38-258----------------------------------------------------------------------------RLLF
Q1M7T1_RHIL3/81-300----------------------------------------------------------------------------RLLY
Q3Y113_ENTFC/32-252----------------------------------------------------------------------------KLLE
Q8E4P3_STRA3/32-253----------------------------------------------------------------------------VILK
Q6MU66_MYCMS/32-253----------------------------------------------------------------------------SILE
Q932V7_MYCBV/32-254----------------------------------------------------------------------------SILR
Q6MDV8_PARUW/32-251----------------------------------------------------------------------------RFLS
Q6M9M4_PARUW/38-258----------------------------------------------------------------------------RFLV
Q48616_9LACT/30-263----------------------------------------------------------------------------RFLT
A5ZR43_9FIRM/34-257----------------------------------------------------------------------------RFLE
A6NXL8_9FIRM/29-249----------------------------------------------------------------------------RLLV
Q5QWW7_IDILO/14-223----------------------------------------------------------------------------RCLD
G5JBQ4_CROWT/13-234----------------------------------------------------------------------------KILN
A3JKF1_9ALTE/13-197----------------------------------------------------------------------------SVLE
A2SDV7_METPP/12-231----------------------------------------------------------------------------TVLA
A1VJ73_POLNA/12-232----------------------------------------------------------------------------QVLR
Q2KB15_RHIEC/41-246----------------------------------------------------------------------------AALR
A7FCE4_YERP3/14-242----------------------------------------------------------------------------GILD
A4Z034_BRASO/13-212----------------------------------------------------------------------------DGLQ
A4XFS5_CALS8/11-198----------------------------------------------------------------------------LILD
Q120Y5_POLSJ/21-211----------------------------------------------------------------------------.TLT
Q21T10_RHOFT/21-211----------------------------------------------------------------------------KLMA
A1WFU2_VEREI/21-211----------------------------------------------------------------------------GLML
A0A0A5LPY8_BURCE/21-212----------------------------------------------------------------------------TLIE
Q7WXF2_CUPNH/19-210----------------------------------------------------------------------------TLME
A0RUS7_CENSY/6-237----------------------------------------------------------------------------NSLC
Q0W4I1_METAR/29-258----------------------------------------------------------------------------LALE
O58109_PYRHO/28-258----------------------------------------------------------------------------YLLF
B3E891_GEOLS/35-303----------------------------------------------------------------------------ALLG
A3XKF9_LEEBM/37-314----------------------------------------------------------------------------SLLE
A7M3Q0_BACO1/35-306----------------------------------------------------------------------------SLLE
Q8G4C8_BIFLO/40-283----------------------------------------------------------------------------RILD
A6W084_MARMS/31-273----------------------------------------------------------------------------DIMA
Q1NX48_9DELT/33-274----------------------------------------------------------------------------DILR
A3JJK0_9ALTE/33-275----------------------------------------------------------------------------DILR
A1WLS4_VEREI/34-292----------------------------------------------------------------------------EIFQ
Q7N0F8_PHOLL/35-281----------------------------------------------------------------------------DILY
Q7N990_PHOLL/35-281----------------------------------------------------------------------------DILF
Q1RR56_STRAM/9-205----------------------------------------------------------------------------RLLA
Q93P81_9BACT/17-212----------------------------------------------------------------------------QFMS
Q11WD0_CYTH3/17-213----------------------------------------------------------------------------KLMQ
A6E7P3_9SPHI/16-212----------------------------------------------------------------------------VLMQ
A7HFJ3_ANADF/43-305----------------------------------------------------------------------------WALG
Q2JEV0_FRASC/11-201----------------------------------------------------------------------------RIFF
A0A0C9PEK8_LEGPN/30-299----------------------------------------------------------------------------ELLE
Q2LU48_SYNAS/35-302----------------------------------------------------------------------------QLLD
Q1LN31_RALME/10-279----------------------------------------------------------------------------RLLT
Q8P655_XANCP/10-280----------------------------------------------------------------------------RLLL
A4JU43_BURVG/10-285----------------------------------------------------------------------------RLML
Q58AR5_RALME/10-285----------------------------------------------------------------------------RLLI
A1VVH0_POLNA/10-280----------------------------------------------------------------------------QLLL
A0YF78_9GAMM/10-274----------------------------------------------------------------------------KLLL
Q3ARB4_CHLCH/11-282----------------------------------------------------------------------------DLLL
M4TXV3_9XANT/17-288----------------------------------------------------------------------------RLLV
A3W959_9RHOB/11-281----------------------------------------------------------------------------ALLV
E0TGY4_PARBH/11-280----------------------------------------------------------------------------RLLV
Q7ND98_GLOVI/12-283----------------------------------------------------------------------------RLLV
A6F2Q0_9ALTE/14-284----------------------------------------------------------------------------TLLL
A6X803_OCHA4/12-281----------------------------------------------------------------------------RLLM
A3UHI0_9RHOB/12-283----------------------------------------------------------------------------ALLI
Q11AE5_CHESB/12-283----------------------------------------------------------------------------QLLM
Q2LU07_SYNAS/47-285----------------------------------------------------------------------------ADLC
A1TBN2_MYCVP/31-246----------------------------------------------------------------------------AFLS
A1U7W6_MARHV/12-228----------------------------------------------------------------------------QIMQ
A7NJN2_ROSCS/29-227----------------------------------------------------------------------------CILG
A5D0Y6_PELTS/89-288----------------------------------------------------------------------------KTLK
Q07LJ4_RHOP5/30-260----------------------------------------------------------------------------RALV
A3WUQ2_9BRAD/30-251----------------------------------------------------------------------------RALV
Q5X0F2_LEGPL/30-282----------------------------------------------------------------------------RAIV
A0M137_GRAFK/30-253----------------------------------------------------------------------------RALV
A7LVH9_BACO1/30-253----------------------------------------------------------------------------RALV
D5T6J5_LEGP2/30-253----------------------------------------------------------------------------RALV
Q3SW13_NITWN/30-253----------------------------------------------------------------------------RALV
A1BFK9_CHLPD/30-252----------------------------------------------------------------------------RALV
B9M297_GEODF/30-250----------------------------------------------------------------------------RALV
O54654_HALSA/29-256----------------------------------------------------------------------------WILW
Q82TQ8_NITEU/35-265----------------------------------------------------------------------------WFLT
Q3B1Q4_PELLD/29-234----------------------------------------------------------------------------WVLA
A8ZVR5_DESOH/29-286----------------------------------------------------------------------------WMLA
A6GZS9_FLAPJ/29-275----------------------------------------------------------------------------HFIA
Q1Q4B8_9BACT/29-269----------------------------------------------------------------------------HYLN
A1BFT1_CHLPD/31-275----------------------------------------------------------------------------VALY
Q0YUP4_9CHLB/31-275----------------------------------------------------------------------------VALY
Q74DE8_GEOSL/31-281----------------------------------------------------------------------------VALL
Q1NX65_9DELT/31-281----------------------------------------------------------------------------IALC
A6VTK2_MARMS/28-267----------------------------------------------------------------------------IALA
A6LDX6_PARD8/32-268----------------------------------------------------------------------------VILA
A0RWG6_CENSY/28-254----------------------------------------------------------------------------NLLS
A0RWG1_CENSY/28-244----------------------------------------------------------------------------SLLS
A7LH05_9HELI/21-239----------------------------------------------------------------------------KLMR
Q649Z3_9ARCH/29-245----------------------------------------------------------------------------IALR
Q6L332_PICTO/28-244----------------------------------------------------------------------------LLLY
Q3F100_BACTI/38-319----------------------------------------------------------------------------LSLC
A0A063UM99_BORBO/15-280----------------------------------------------------------------------------LVVK
Q138J1_RHOPS/18-217----------------------------------------------------------------------------QIWR
A4JFW1_BURVG/16-258----------------------------------------------------------------------------KLWP
Q8KW54_9RHOB/74-323----------------------------------------------------------------------------LFLA
A6GR58_9BURK/30-277----------------------------------------------------------------------------IVLS
Q7N7R6_PHOLL/25-274----------------------------------------------------------------------------IVLQ
Q3JF57_NITOC/25-272----------------------------------------------------------------------------TILT
A1X5X8_ECOLX/40-289----------------------------------------------------------------------------IILK

PF14907

D4IJI6_9BACT/30-280----------------------------------------------------------------------------DAAQ
D6D2Z8_9BACE/32-294----------------------------------------------------------------------------TDAQ
E3EIB5_PAEPS/42-310----------------------------------------------------------------------------QEMD
E6SSN3_BACT6/27-274----------------------------------------------------------------------------SAND
A6L7U2_BACV8/35-288----------------------------------------------------------------------------SPAL
D5EUU1_PRER2/28-271----------------------------------------------------------------------------NADD
F2KYQ1_PREDF/45-298----------------------------------------------------------------------------AEMD
A1AK32_PELPD/41-295----------------------------------------------------------------------------SPEE
D0MHT5_RHOM4/36-289----------------------------------------------------------------------------QPLD
C8VWU0_DESAS/27-271----------------------------------------------------------------------------ETLD
C8W2H3_DESAS/29-273----------------------------------------------------------------------------YKLD
F0SY73_SYNGF/27-282----------------------------------------------------------------------------HNVN
B0CEE6_ACAM1/41-296----------------------------------------------------------------------------PSMD
E6X194_NITSE/55-325----------------------------------------------------------------------------PKFD
A5G508_GEOUR/51-304----------------------------------------------------------------------------ECTD
B8I678_CLOCE/34-315----------------------------------------------------------------------------GGID
B8HPX3_CYAP4/33-304----------------------------------------------------------------------------KSID
A6QAF7_SULNB/69-323----------------------------------------------------------------------------EHLT
C8W5K5_DESAS/42-296----------------------------------------------------------------------------KPTD
A0LED8_SYNFM/43-296----------------------------------------------------------------------------GRLD
C8W092_DESAS/36-289----------------------------------------------------------------------------QSVN
B3U4I7_9BACT/63-313----------------------------------------------------------------------------DGID
B8HL63_CYAP4/37-290----------------------------------------------------------------------------HPLD
C6CW48_PAESJ/39-291----------------------------------------------------------------------------HGLD
E3GKM5_EUBLK/27-271----------------------------------------------------------------------------LGCD
Q5V4C2_HALMA/33-294----------------------------------------------------------------------------DAPD
B0CA05_ACAM1/43-304----------------------------------------------------------------------------HSID
E4NR20_HALBP/45-311----------------------------------------------------------------------------PEVE
D0MJ16_RHOM4/27-280----------------------------------------------------------------------------GLAD
D5C0P8_NITHN/38-283----------------------------------------------------------------------------SSLN
E4T3H3_PALPW/32-289----------------------------------------------------------------------------EVKD
B8HYI9_CYAP4/46-308----------------------------------------------------------------------------PGLD
Q2S9G8_HAHCH/40-294----------------------------------------------------------------------------ESSD
E0RZJ9_BUTPB/57-297----------------------------------------------------------------------------DGID
F2NH29_DESAR/30-285----------------------------------------------------------------------------GKIA
E6UIV6_RUMA7/27-267----------------------------------------------------------------------------KDID
B3DZF9_METI4/33-292----------------------------------------------------------------------------GSFH
F2JWV8_MARM1/27-283----------------------------------------------------------------------------NEEE
D9SE91_GALCS/39-298----------------------------------------------------------------------------PLIH
D1CIV7_THET1/37-287----------------------------------------------------------------------------QPFD
D2QFF6_SPILD/34-281----------------------------------------------------------------------------QPIN
D4LAD3_RUMC1/30-273----------------------------------------------------------------------------EQMQ
D4L7W6_9FIRM/34-277----------------------------------------------------------------------------EGIK
Q7N4C9_PHOLL/37-311----------------------------------------------------------------------------TEFP
E6UK59_RUMA7/32-272----------------------------------------------------------------------------DKIN
E8X100_GRATM/35-290----------------------------------------------------------------------------NDID
D1YWY8_METPS/61-314----------------------------------------------------------------------------SISQ
A9AY74_HERA2/29-280----------------------------------------------------------------------------SPND
E8UZW2_TERSS/40-293----------------------------------------------------------------------------SSID
Q5ZRD2_LEGPH/18-272----------------------------------------------------------------------------TSFS
Q2W7B9_MAGSA/35-286----------------------------------------------------------------------------AIGD
Q47DA0_DECAR/28-284----------------------------------------------------------------------------TLTD
A5VF23_SPHWW/48-301----------------------------------------------------------------------------DRFD
C7RTZ8_ACCPU/29-287----------------------------------------------------------------------------PPAD
A9NH68_ACHLI/22-261----------------------------------------------------------------------------DSQD
E4NA58_KITSK/44-325----------------------------------------------------------------------------PDLD
Q220U3_RHOFT/22-279----------------------------------------------------------------------------SGQQ
C8VW96_DESAS/31-295----------------------------------------------------------------------------SHSK
Q1IJX8_KORVE/41-297----------------------------------------------------------------------------EQVG
Q0ACH9_ALKEH/23-281----------------------------------------------------------------------------RLGD
Q2G399_NOVAD/40-294----------------------------------------------------------------------------DEEG
Q82U71_NITEU/28-285----------------------------------------------------------------------------DNRQ
E8X2I6_GRATM/22-260----------------------------------------------------------------------------SDVE
Q2N714_ERYLH/28-286----------------------------------------------------------------------------TEAD
A1K446_AZOSB/28-282----------------------------------------------------------------------------TPPQ
Q3SG05_THIDA/23-278----------------------------------------------------------------------------SMAD
A0L573_MAGMM/21-281----------------------------------------------------------------------------PPAE
A1SY03_PSYIN/35-284----------------------------------------------------------------------------KKVN
A5VCA1_SPHWW/21-272----------------------------------------------------------------------------APDG
Q1GTD6_SPHAL/21-273----------------------------------------------------------------------------APRD
C6W7P4_DYAFD/31-292----------------------------------------------------------------------------APFD
A2U3F5_9FLAO/33-287----------------------------------------------------------------------------NAVN
Q2RPP9_RHORT/33-290----------------------------------------------------------------------------DGAT
Q98C81_RHILO/47-300----------------------------------------------------------------------------PNLS
D3SEY4_THISK/21-280----------------------------------------------------------------------------TAAE
D4Z532_SPHJU/20-266----------------------------------------------------------------------------DAGG
Q5P7H0_AROAE/23-275----------------------------------------------------------------------------DTAR
D9R9Y8_CLOSW/28-270----------------------------------------------------------------------------RQPD
C8X6N8_NAKMY/33-276----------------------------------------------------------------------------SATE
E8WZ57_GRATM/42-294----------------------------------------------------------------------------SERE
A1WX94_HALHL/26-285----------------------------------------------------------------------------PESL
C4ZNM3_THASP/23-275----------------------------------------------------------------------------PEAR
B9JQN6_AGRRK/37-306----------------------------------------------------------------------------SAEE
Q15WK0_PSEA6/24-278----------------------------------------------------------------------------THTE
E3FNY0_STIAD/23-272----------------------------------------------------------------------------RGAP
A7HIS8_ANADF/20-254----------------------------------------------------------------------------PDAD
Q1DDG5_MYXXD/51-300----------------------------------------------------------------------------RGAP
C2X1P1_BACCE/40-289----------------------------------------------------------------------------SDID
C3AT78_BACMY/45-292----------------------------------------------------------------------------.NID
D4KWT4_9FIRM/552-802----------------------------------------------------------------------------.ETE
D4MW73_9FIRM/28-281----------------------------------------------------------------------------.TQD
F2G8P1_ALTMD/26-277----------------------------------------------------------------------------..KT
I1YWC5_PREI7/27-278----------------------------------------------------------------------------.KKD
I3YL41_ALIFI/31-278----------------------------------------------------------------------------.DPE
I3YQI9_ALIFI/33-278----------------------------------------------------------------------------..RQ
Q8KKS5_RHIEC/2-289----------------------------------------------------------------------------....
Q8XN73_CLOPE/29-276----------------------------------------------------------------------------...K
R5QD91_9FIRM/30-263----------------------------------------------------------------------------.KEE
R5QEH8_9FIRM/29-271----------------------------------------------------------------------------.ETD
R5XE76_9CLOT/30-276----------------------------------------------------------------------------...D
R6KK05_9BACE/28-278----------------------------------------------------------------------------.SAD
R6QP25_9CLOT/29-271----------------------------------------------------------------------------.GVD
R7JPI5_9BACT/51-294----------------------------------------------------------------------------SEED

PF10706

A6TJ11_KLEP7/73-246------------------------------------------------------------------------MDTTQVTL
Q8YL66_NOSS1/1-174------------------------------------------------------------------------MNDLHIEL

PF04991

Q753A8_ASHGO/506-745--------------------------------------------------------------------------------
A5DCG8_PICGU/263-461--------------------------------------------------------------------------------
A6LC14_PARD8/39-262--------------------------------------------------------------------------------
Q87Q28_VIBPA/24-242--------------------------------------------------------------------------------
Q03SH4_LACBA/23-245--------------------------------------------------------------------------------
A7TLM6_VANPO/513-754--------------------------------------------------------------------------------
A6M2A9_CLOB8/33-257--------------------------------------------------------------------------------
YJ31_YEAST/469-720--------------------------------------------------------------------------------
Q03GP1_PEDPA/22-243--------------------------------------------------------------------------------
A8AZQ7_STRGC/28-259--------------------------------------------------------------------------------
A6LBV7_PARD8/43-251--------------------------------------------------------------------------------
A5UNE2_METS3/36-262--------------------------------------------------------------------------------
A5UND9_METS3/81-296--------------------------------------------------------------------------------
Q6FSB7_CANGA/473-717--------------------------------------------------------------------------------
Q832Q2_ENTFA/24-252--------------------------------------------------------------------------------
A5UNH1_METS3/30-252--------------------------------------------------------------------------------
MNN4_YEAST/490-746--------------------------------------------------------------------------------
A7TID6_VANPO/522-767--------------------------------------------------------------------------------
A6LD13_PARD8/44-278--------------------------------------------------------------------------------
Q6FRE8_CANGA/512-760--------------------------------------------------------------------------------
A6LI11_PARD8/44-274--------------------------------------------------------------------------------
Q2NIC1_METST/35-244--------------------------------------------------------------------------------
A6L4H8_BACV8/26-253--------------------------------------------------------------------------------
Q9CIZ2_LACLA/24-251--------------------------------------------------------------------------------
Q832P6_ENTFA/27-250--------------------------------------------------------------------------------
Q6CV94_KLULA/470-711--------------------------------------------------------------------------------
B0URY8_HISS2/24-243--------------------------------------------------------------------------------
D6CZV8_9BACE/24-240--------------------------------------------------------------------------------
G0VHC4_NAUCC/584-836--------------------------------------------------------------------------------
LICD_HAEIN/24-243--------------------------------------------------------------------------------
Q1G8I9_LACDA/45-275--------------------------------------------------------------------------------
Q6CV92_KLULA/338-579--------------------------------------------------------------------------------
Q8CWR1_STRR6/24-245--------------------------------------------------------------------------------
Q8DPD7_STRR6/25-246--------------------------------------------------------------------------------
Q8DPI0_STRR6/24-243--------------------------------------------------------------------------------
Q8DYQ6_STRA5/24-249--------------------------------------------------------------------------------
Q8R630_FUSNN/25-234--------------------------------------------------------------------------------
R5K6F7_9CLOT/25-248--------------------------------------------------------------------------------
R5U2Q7_9BACE/28-256--------------------------------------------------------------------------------
R6N240_9CLOT/23-251--------------------------------------------------------------------------------
R6N4Y5_9CLOT/26-257--------------------------------------------------------------------------------
R6X1W1_9PORP/32-241--------------------------------------------------------------------------------
R7EDL2_9BACE/24-240--------------------------------------------------------------------------------
R7EEU8_9BACE/31-244--------------------------------------------------------------------------------
R7EJM5_9BACE/32-245--------------------------------------------------------------------------------

PF04229

Q7UQR9_RHOBA/21-182--------------------------------------------------------------------------------
F4FG59_VERMA/4-164--------------------------------------------------------------------------------
H6L1E0_SAPGL/5-166--------------------------------------------------------------------------------
E4N0U3_KITSK/9-181--------------------------------------------------------------------------------
D1BEG0_SANKS/7-190--------------------------------------------------------------------------------
T0T7N8_9STRE/5-167--------------------------------------------------------------------------------
F0R0L2_BACSH/21-180--------------------------------------------------------------------------------
R6RXV9_9CLOT/9-171--------------------------------------------------------------------------------
C7M6I7_CAPOD/21-178--------------------------------------------------------------------------------
K9PW19_9CYAN/3-165--------------------------------------------------------------------------------
F8I524_SULAT/19-179--------------------------------------------------------------------------------
D9S0W3_THEOJ/3-164--------------------------------------------------------------------------------
R6D2S7_9CLOT/3-163--------------------------------------------------------------------------------
C1A083_RHOE4/211-392--------------------------------------------------------------------------------
E1VYF6_ARTAR/165-333--------------------------------------------------------------------------------
W6R4W1_9RHIZ/3-163--------------------------------------------------------------------------------
W5TQQ6_9NOCA/29-187--------------------------------------------------------------------------------
B2TLP2_CLOBB/5-165--------------------------------------------------------------------------------
B9JDR1_AGRRK/3-162--------------------------------------------------------------------------------
I0H1C1_ACTM4/212-377--------------------------------------------------------------------------------
F9UMA6_LACPL/43-192--------------------------------------------------------------------------------
Y3154_VIBCH/37-187--------------------------------------------------------------------------------
Q81YH7_BACAN/4-173--------------------------------------------------------------------------------
E6S9I6_INTC7/214-387--------------------------------------------------------------------------------
D5DGR0_BACMD/3-175--------------------------------------------------------------------------------
W5TJ52_9NOCA/212-391--------------------------------------------------------------------------------
K9XBR5_9CHRO/3-167--------------------------------------------------------------------------------
E3GIN1_EUBLK/3-163--------------------------------------------------------------------------------
K0KAS1_SACES/227-393--------------------------------------------------------------------------------
A8AWN1_STRGC/18-179--------------------------------------------------------------------------------
I3R2F8_HALMT/25-186--------------------------------------------------------------------------------
D4J128_BUTFI/5-166--------------------------------------------------------------------------------
A4FKT9_SACEN/207-379--------------------------------------------------------------------------------
B6QAD6_PENMQ/29-191--------------------------------------------------------------------------------
D1AHI7_SEBTE/18-178--------------------------------------------------------------------------------
R4KDL8_CLOPA/5-164--------------------------------------------------------------------------------
A5G319_ACICJ/3-168--------------------------------------------------------------------------------
H6N9P1_9BACL/2-161--------------------------------------------------------------------------------
Q2K5X8_RHIEC/4-163--------------------------------------------------------------------------------
Q8DTG8_STRMU/18-179--------------------------------------------------------------------------------
C4KZG2_EXISA/3-162--------------------------------------------------------------------------------
E4NR36_HALBP/5-165--------------------------------------------------------------------------------
I7EVS4_PHAIB/4-164--------------------------------------------------------------------------------
K0NHL1_DESTT/8-169--------------------------------------------------------------------------------
K0JPZ1_SACES/83-263--------------------------------------------------------------------------------
H6NPI6_9BACL/17-180--------------------------------------------------------------------------------
Q88IL4_PSEPK/6-162--------------------------------------------------------------------------------
Q65HR6_BACLD/152-312--------------------------------------------------------------------------------
D8MSB8_ERWBE/3-163--------------------------------------------------------------------------------
R5WT49_9BACT/2-163--------------------------------------------------------------------------------
R5MRQ0_9BACE/17-180--------------------------------------------------------------------------------
L0IAX8_HALRX/8-169--------------------------------------------------------------------------------
Q55AI9_DICDI/5-191--------------------------------------------------------------------------------
B0C1Z8_ACAM1/3-165--------------------------------------------------------------------------------
A7MK97_CROS8/6-166--------------------------------------------------------------------------------
C8W1B5_DESAS/176-344--------------------------------------------------------------------------------
Q83EE3_COXBU/18-178--------------------------------------------------------------------------------
D3FQ45_BACPE/3-163--------------------------------------------------------------------------------
B8NAT5_ASPFN/26-188--------------------------------------------------------------------------------
D2PRV9_KRIFD/5-169--------------------------------------------------------------------------------
C5C5E0_BEUC1/9-171--------------------------------------------------------------------------------
M2MR17_BAUCO/24-208--------------------------------------------------------------------------------
K1W9P8_TRIAC/2-167--------------------------------------------------------------------------------
I0H425_ACTM4/12-172--------------------------------------------------------------------------------
Q81PM3_BACAN/8-166--------------------------------------------------------------------------------
V5FMN7_BYSSN/27-191--------------------------------------------------------------------------------
A5I088_CLOBH/18-180--------------------------------------------------------------------------------
R6CHS7_9CLOT/8-171--------------------------------------------------------------------------------
K9QG42_9NOSO/2-163--------------------------------------------------------------------------------
F0RLV6_DEIPM/12-172--------------------------------------------------------------------------------
YZZE_STRCO/25-180--------------------------------------------------------------------------------
R4TB77_AMYOR/212-382--------------------------------------------------------------------------------
Q480R9_COLP3/9-169--------------------------------------------------------------------------------
R7K5K1_9FIRM/2-163--------------------------------------------------------------------------------
K9XRX3_STAC7/4-167--------------------------------------------------------------------------------
D2R1G3_PIRSD/2-160--------------------------------------------------------------------------------
C7N2S7_SLAHD/18-179--------------------------------------------------------------------------------
W5W422_9PSEU/211-378--------------------------------------------------------------------------------
R4PVG6_9BACT/9-168--------------------------------------------------------------------------------
Y4798_PSEAE/21-183--------------------------------------------------------------------------------
R5AL68_9BACT/11-171--------------------------------------------------------------------------------
Q5ZY58_LEGPH/204-370--------------------------------------------------------------------------------
U5RPT9_9CLOT/8-169--------------------------------------------------------------------------------
C8WR35_ALIAD/281-442--------------------------------------------------------------------------------
YQKA_BACSU/153-313--------------------------------------------------------------------------------
B8FH40_DESAA/17-183--------------------------------------------------------------------------------
I0DNI9_PROSM/44-202--------------------------------------------------------------------------------
D6ZD81_SEGRD/214-391--------------------------------------------------------------------------------
S6AG51_PSERE/6-162--------------------------------------------------------------------------------
G8RQ26_MYCRN/217-398--------------------------------------------------------------------------------
G0G9J0_AMYMS/26-185--------------------------------------------------------------------------------
H5WXT5_9PSEU/241-411--------------------------------------------------------------------------------
A0QU49_MYCS2/32-190--------------------------------------------------------------------------------
K9RII6_9CYAN/3-167--------------------------------------------------------------------------------
R7YMF0_CONA1/4-163--------------------------------------------------------------------------------
Q7MJH4_VIBVY/9-159--------------------------------------------------------------------------------
K0JYW2_SACES/116-273--------------------------------------------------------------------------------
C6CZF7_PAESJ/4-164--------------------------------------------------------------------------------
I4EWN3_MODMB/45-201--------------------------------------------------------------------------------
R6USG1_9FIRM/169-332--------------------------------------------------------------------------------
G3JC83_CORMM/22-188--------------------------------------------------------------------------------
R6K9E4_9BACE/11-174--------------------------------------------------------------------------------
Q5HQZ0_STAEQ/13-170--------------------------------------------------------------------------------
A3QDM7_SHELP/4-183--------------------------------------------------------------------------------
Q8TK81_METAC/20-182--------------------------------------------------------------------------------
I7BP47_NATSJ/8-170--------------------------------------------------------------------------------
A6WAJ0_KINRD/50-209--------------------------------------------------------------------------------
A0JWM9_ARTS2/214-385--------------------------------------------------------------------------------
C7YUZ2_NECH7/30-193--------------------------------------------------------------------------------
F8L3S4_SIMNZ/8-166--------------------------------------------------------------------------------
M2YLJ2_DOTSN/41-212--------------------------------------------------------------------------------
Q1D1T3_MYXXD/32-190--------------------------------------------------------------------------------
R8BXH6_TOGMI/31-193--------------------------------------------------------------------------------
V6K242_STRNV/29-199--------------------------------------------------------------------------------
D6GQ99_FILAD/18-178--------------------------------------------------------------------------------
I0JMF1_HALH3/3-163--------------------------------------------------------------------------------
D2SB44_GEOOG/32-188--------------------------------------------------------------------------------
W8EQN2_9BACT/18-186--------------------------------------------------------------------------------
C6WGV0_ACTMD/28-186--------------------------------------------------------------------------------
D3EI21_GEOS4/6-165--------------------------------------------------------------------------------
M3AHS4_PSEFD/34-203--------------------------------------------------------------------------------
V9X9E8_9NOCA/211-393--------------------------------------------------------------------------------
R5A7J0_9CLOT/21-180--------------------------------------------------------------------------------
I2EU23_EMTOG/3-172--------------------------------------------------------------------------------
E6UAG3_RUMA7/4-166--------------------------------------------------------------------------------
R5VAK1_9FIRM/4-165--------------------------------------------------------------------------------
I2F809_9BACT/5-167--------------------------------------------------------------------------------
A0A0D2YDZ7_FUSO4/30-193--------------------------------------------------------------------------------
W5W1G6_9PSEU/88-244--------------------------------------------------------------------------------
C4ZJM8_THASP/15-182--------------------------------------------------------------------------------
Y1888_BACHD/32-191--------------------------------------------------------------------------------
D5UGE0_CELFN/2-161--------------------------------------------------------------------------------
K0ETX6_9NOCA/211-393--------------------------------------------------------------------------------
Q0ANT8_MARMM/3-164--------------------------------------------------------------------------------
B9M8V0_GEODF/15-182--------------------------------------------------------------------------------
E9FC77_METRA/32-195--------------------------------------------------------------------------------
Q5UW62_HALMA/8-169--------------------------------------------------------------------------------
D7AV49_NOCDD/30-189--------------------------------------------------------------------------------
W5WGD4_9PSEU/84-261--------------------------------------------------------------------------------
V5XFQ0_MYCNE/214-379--------------------------------------------------------------------------------
G2XBV0_VERDV/31-198--------------------------------------------------------------------------------
A0A016PCG5_GIBZA/30-193--------------------------------------------------------------------------------
C6WB47_ACTMD/210-381--------------------------------------------------------------------------------
Q0SI30_RHOJR/210-391--------------------------------------------------------------------------------
A3CX26_METMJ/18-179--------------------------------------------------------------------------------
D5BAN2_ZUNPS/18-185--------------------------------------------------------------------------------
D1BE93_SANKS/25-181--------------------------------------------------------------------------------
J7L577_NOCAA/28-187--------------------------------------------------------------------------------
I0JT44_HALH3/47-207--------------------------------------------------------------------------------
W0BB67_9GAMM/10-170--------------------------------------------------------------------------------
Q4KFG9_PSEF5/6-162--------------------------------------------------------------------------------
R5EZV1_9CLOT/22-183--------------------------------------------------------------------------------
Q189F3_PEPD6/18-179--------------------------------------------------------------------------------
R5J8J7_9CLOT/11-172--------------------------------------------------------------------------------
E8N7N1_MICTS/6-189--------------------------------------------------------------------------------
COAE_MYCPA/210-395--------------------------------------------------------------------------------
Q82TF0_NITEU/35-196--------------------------------------------------------------------------------
Q81CT5_BACCR/4-164--------------------------------------------------------------------------------
I0KB45_9BACT/5-175--------------------------------------------------------------------------------
D2Q1S7_KRIFD/4-173--------------------------------------------------------------------------------
D3PXU1_STANL/211-382--------------------------------------------------------------------------------
B2VVX8_PYRTR/3-161--------------------------------------------------------------------------------
W6RMG9_9RHIZ/5-164--------------------------------------------------------------------------------
Q837C3_ENTFA/3-163--------------------------------------------------------------------------------
E8SKB4_STAPH/10-169--------------------------------------------------------------------------------
G8SCS9_ACTS5/212-375--------------------------------------------------------------------------------
H6R024_NOCCG/201-383--------------------------------------------------------------------------------
D5DHV4_BACMD/6-164--------------------------------------------------------------------------------
D3HRN8_LEGLN/9-169--------------------------------------------------------------------------------
F0JD71_DESDE/16-183--------------------------------------------------------------------------------
H6LKW2_ACEWD/9-173--------------------------------------------------------------------------------
COAE_MYCLE/210-398--------------------------------------------------------------------------------
R9TA40_9EURY/18-177--------------------------------------------------------------------------------
R5NDU7_9BACT/18-177--------------------------------------------------------------------------------
E3FUL3_STIAD/60-221--------------------------------------------------------------------------------
C7QZ85_JONDD/13-170--------------------------------------------------------------------------------
U5LFL0_9BACI/7-168--------------------------------------------------------------------------------
B1YEV6_EXIS2/3-163--------------------------------------------------------------------------------
G9N0Q7_HYPVG/30-192--------------------------------------------------------------------------------
D0LRK4_HALO1/63-218--------------------------------------------------------------------------------
K9UHL6_9CHRO/4-165--------------------------------------------------------------------------------
Q0U0A7_PHANO/2-162--------------------------------------------------------------------------------
K9X9I3_9CHRO/3-165--------------------------------------------------------------------------------
H1ZDJ0_MYROD/6-189--------------------------------------------------------------------------------
C6CSH6_PAESJ/2-161--------------------------------------------------------------------------------
I0KC39_9BACT/4-171--------------------------------------------------------------------------------
A5I0C7_CLOBH/9-169--------------------------------------------------------------------------------
D1CF17_THET1/8-168--------------------------------------------------------------------------------
U5VXI8_9ACTN/209-373--------------------------------------------------------------------------------
R7XXE7_9ACTN/3-160--------------------------------------------------------------------------------
C7N047_SACVD/214-386--------------------------------------------------------------------------------
R4KA00_CLOPA/5-167--------------------------------------------------------------------------------
F2F973_SOLSS/9-173--------------------------------------------------------------------------------
E3HNB6_ACHXA/38-195--------------------------------------------------------------------------------
B1MAV8_MYCA9/211-383--------------------------------------------------------------------------------
R7NHU4_9MOLU/7-167--------------------------------------------------------------------------------
G0G0L6_AMYMS/196-366--------------------------------------------------------------------------------
S5RIM5_9STRE/14-176--------------------------------------------------------------------------------
A8FEV1_BACP2/150-310--------------------------------------------------------------------------------
Q2KDV8_RHIEC/3-162--------------------------------------------------------------------------------
W6R743_9RHIZ/15-174--------------------------------------------------------------------------------
R5T2X8_9FIRM/18-179--------------------------------------------------------------------------------
G4L3G4_TETHN/32-191--------------------------------------------------------------------------------
K9U9A9_9CYAN/3-168--------------------------------------------------------------------------------
Y2534_DEIRA/32-184--------------------------------------------------------------------------------
A8FA86_BACP2/8-167--------------------------------------------------------------------------------
R8BCT1_TOGMI/34-197--------------------------------------------------------------------------------
R5X925_9FIRM/14-176--------------------------------------------------------------------------------
GRPB_BACPE/8-173--------------------------------------------------------------------------------
R6RNY7_9FIRM/13-174--------------------------------------------------------------------------------
E3EIR7_PAEPS/4-166--------------------------------------------------------------------------------
A5I050_CLOBH/2-163--------------------------------------------------------------------------------
H1VDI7_COLHI/31-193--------------------------------------------------------------------------------
N4UZ58_COLOR/309-472--------------------------------------------------------------------------------
C8XAW5_NAKMY/211-382--------------------------------------------------------------------------------
C8WAQ0_ATOPD/20-179--------------------------------------------------------------------------------
K0K1A8_SACES/37-195--------------------------------------------------------------------------------
D9SV06_CLOC7/4-168--------------------------------------------------------------------------------
D7BEE1_MEISD/4-169--------------------------------------------------------------------------------
Q74CV0_GEOSL/2-165--------------------------------------------------------------------------------
U5L973_9BACI/9-172--------------------------------------------------------------------------------
R7K4C0_9FIRM/184-345--------------------------------------------------------------------------------
A1R6F2_ARTAT/218-384--------------------------------------------------------------------------------
Q2G068_STAA8/12-170--------------------------------------------------------------------------------
Q0RJB4_FRAAA/11-173--------------------------------------------------------------------------------
A1CSD9_ASPCL/61-222--------------------------------------------------------------------------------
F8B2Q7_FRADG/43-199--------------------------------------------------------------------------------
D4M8N7_9BACT/11-171--------------------------------------------------------------------------------
R6IAQ5_9FIRM/8-176--------------------------------------------------------------------------------
F0T2H2_SYNGF/9-169--------------------------------------------------------------------------------
D3EFC9_GEOS4/5-164--------------------------------------------------------------------------------
B6QP89_PENMQ/30-189--------------------------------------------------------------------------------
R6CC32_9CLOT/13-180--------------------------------------------------------------------------------
M2RUD6_COCSN/3-161--------------------------------------------------------------------------------
J5JV21_BEAB2/22-188--------------------------------------------------------------------------------
Q4WKR7_ASPFU/23-185--------------------------------------------------------------------------------
M3BXF1_SPHMS/30-197--------------------------------------------------------------------------------
F4LJZ3_TREBD/18-177--------------------------------------------------------------------------------
L0KBF6_HALHC/18-182--------------------------------------------------------------------------------
F0ZS88_DICPU/4-173--------------------------------------------------------------------------------
B0RAH0_CLAMS/4-161--------------------------------------------------------------------------------
E1RF13_METP4/16-180--------------------------------------------------------------------------------
W6RXI5_9CLOT/18-181--------------------------------------------------------------------------------
E8ND31_MICTS/47-196--------------------------------------------------------------------------------
A1AP29_PELPD/17-185--------------------------------------------------------------------------------
G8PS80_PSEUV/5-164--------------------------------------------------------------------------------
C5C2T3_BEUC1/32-194--------------------------------------------------------------------------------
G9NLT9_HYPAI/30-192--------------------------------------------------------------------------------
J5JAK5_BEAB2/35-197--------------------------------------------------------------------------------
A6WBN4_KINRD/58-214--------------------------------------------------------------------------------
C8VG40_EMENI/27-192--------------------------------------------------------------------------------
F4L6A7_HALH1/6-175--------------------------------------------------------------------------------
E3J2T3_FRASU/21-178--------------------------------------------------------------------------------
COAE_MYCTU/210-395--------------------------------------------------------------------------------
C0QYF8_BRAHW/3-170--------------------------------------------------------------------------------
Q6CG34_YARLI/3-172--------------------------------------------------------------------------------
C2X2A2_BACCE/3-163--------------------------------------------------------------------------------
I2B7X5_SHIBC/41-199--------------------------------------------------------------------------------
R6QU09_9FIRM/17-181--------------------------------------------------------------------------------
A1SCK2_NOCSJ/16-200--------------------------------------------------------------------------------
G8LV75_CLOCD/29-188--------------------------------------------------------------------------------
C1ABX5_GEMAT/4-164--------------------------------------------------------------------------------
F8L5H4_SIMNZ/6-169--------------------------------------------------------------------------------
A1TAF0_MYCVP/210-390--------------------------------------------------------------------------------
E5ADM9_LEPMJ/589-747--------------------------------------------------------------------------------
W0E5J7_9FIRM/3-163--------------------------------------------------------------------------------
D6D4R0_9BACE/19-178--------------------------------------------------------------------------------
G7MD75_9CLOT/6-165--------------------------------------------------------------------------------
D3E8X8_GEOS4/3-165--------------------------------------------------------------------------------
E1QDH8_DESB2/16-184--------------------------------------------------------------------------------
L0J6E6_MYCSM/3-164--------------------------------------------------------------------------------
R6R8F5_9FIRM/2-160--------------------------------------------------------------------------------
L0DYV6_THIND/8-167--------------------------------------------------------------------------------
F8D8W2_HALXS/8-171--------------------------------------------------------------------------------
E3FRK9_STIAD/45-209--------------------------------------------------------------------------------
R6CUV5_9CLOT/17-184--------------------------------------------------------------------------------
R5RQF7_9FIRM/7-166--------------------------------------------------------------------------------
Q5ZWJ7_LEGPH/174-340--------------------------------------------------------------------------------
L0IZF9_MYCSM/209-374--------------------------------------------------------------------------------
B2HQZ8_MYCMM/210-396--------------------------------------------------------------------------------
G9N260_HYPVG/30-192--------------------------------------------------------------------------------
A4FFQ9_SACEN/32-191--------------------------------------------------------------------------------
J7L574_NOCAA/29-191--------------------------------------------------------------------------------
R7A6W2_9FIRM/28-187--------------------------------------------------------------------------------
R4SP20_AMYOR/28-187--------------------------------------------------------------------------------
E9SZZ4_RHOHA/222-405--------------------------------------------------------------------------------
K9VQD2_9CYAN/4-164--------------------------------------------------------------------------------
R5LK04_9MOLU/7-167--------------------------------------------------------------------------------
Q0CCF9_ASPTN/28-183--------------------------------------------------------------------------------
D3FCW0_CONWI/18-181--------------------------------------------------------------------------------
Q81PZ3_BACAN/4-164--------------------------------------------------------------------------------
A6WEQ7_KINRD/4-189--------------------------------------------------------------------------------
I5AW69_EUBCE/66-227--------------------------------------------------------------------------------
B9JCE0_AGRRK/17-178--------------------------------------------------------------------------------
A6T980_KLEP7/3-163--------------------------------------------------------------------------------
G3JP53_CORMM/36-199--------------------------------------------------------------------------------
T0JR78_COLGC/30-193--------------------------------------------------------------------------------
Q12KI9_SHEDO/3-162--------------------------------------------------------------------------------
S3E6I7_GLAL2/3-173--------------------------------------------------------------------------------
R6IMI3_9CLOT/8-178--------------------------------------------------------------------------------
M1MIC4_9CLOT/5-169--------------------------------------------------------------------------------
D5ELY3_CORAD/2-162--------------------------------------------------------------------------------
F4FGK1_VERMA/211-377--------------------------------------------------------------------------------
B9E8H7_MACCJ/3-152--------------------------------------------------------------------------------
G8NQJ1_GRAMM/17-177--------------------------------------------------------------------------------

PF04607

Q8F1P4_LEPIN/241-352--------------------------------------------------------------------------------
Q7NBS7_MYCGA/247-359--------------------------------------------------------------------------------
Q83GJ6_TROWT/256-367--------------------------------------------------------------------------------
YWAC_BACSU/57-179--------------------------------------------------------------------------------
Q8DU97_STRMU/42-162--------------------------------------------------------------------------------
Q7NGY9_GLOVI/272-383--------------------------------------------------------------------------------
Q8H5X7_ORYSJ/326-435--------------------------------------------------------------------------------
Q7VM28_HAEDU/245-356--------------------------------------------------------------------------------
Q9X388_BACAN/65-209--------------------------------------------------------------------------------
Q8EBQ4_SHEON/250-361--------------------------------------------------------------------------------
Q7MAV7_PORGI/253-368--------------------------------------------------------------------------------
Q8LSZ7_CHLRE/410-527--------------------------------------------------------------------------------
Q7NRS8_CHRVO/260-371--------------------------------------------------------------------------------
Q8XKG7_CLOPE/50-185--------------------------------------------------------------------------------
Q8A9W5_BACTN/249-366--------------------------------------------------------------------------------
Q8XJZ8_CLOPE/66-208--------------------------------------------------------------------------------
Q8DLB2_THEEB/256-367--------------------------------------------------------------------------------
Q9KBP0_BACHD/57-179--------------------------------------------------------------------------------
Q88BE4_PSESM/235-346--------------------------------------------------------------------------------
Q7U332_HAEDU/235-346--------------------------------------------------------------------------------
Q9K903_BACHD/43-163--------------------------------------------------------------------------------
Q89K51_BRADU/270-381--------------------------------------------------------------------------------
Q830U9_ENTFA/54-174--------------------------------------------------------------------------------
SPOT_SYNY3/267-378--------------------------------------------------------------------------------
Q8FPL1_COREF/265-376--------------------------------------------------------------------------------
Q97DY0_CLOAB/61-183--------------------------------------------------------------------------------
Q9CIJ5_LACLA/36-155--------------------------------------------------------------------------------
Q8EJU8_SHEON/235-346--------------------------------------------------------------------------------
Q8DUK1_STRMU/46-172--------------------------------------------------------------------------------
Q9RTX1_DEIRA/64-194--------------------------------------------------------------------------------
Q8DZK6_STRA5/44-164--------------------------------------------------------------------------------
O25466_HELPY/265-376--------------------------------------------------------------------------------
Q820X2_COXBU/235-346--------------------------------------------------------------------------------
YJBM_BACSU/45-164--------------------------------------------------------------------------------
Q9CH66_LACLA/57-179--------------------------------------------------------------------------------
Q8P5T8_XANCP/255-366--------------------------------------------------------------------------------
Q7U362_BORPE/282-393--------------------------------------------------------------------------------
Q83BW2_COXBU/241-352--------------------------------------------------------------------------------
Q9A812_CAUCR/255-366--------------------------------------------------------------------------------
Q8XJ23_CLOPE/233-344--------------------------------------------------------------------------------
Q885Y7_PSESM/259-370--------------------------------------------------------------------------------
Q9WZI8_THEMA/289-400--------------------------------------------------------------------------------
Q8RAL8_CALS4/234-345--------------------------------------------------------------------------------
Q7U324_HELHP/252-362--------------------------------------------------------------------------------
Q97LC0_CLOAB/45-165--------------------------------------------------------------------------------
SPOT_AQUAE/237-348--------------------------------------------------------------------------------
Q7MAV5_PORGI/262-377--------------------------------------------------------------------------------
SPOT_BORBU/252-364--------------------------------------------------------------------------------
Q818C3_BACCR/50-172--------------------------------------------------------------------------------
Q8KC80_CHLTE/244-357--------------------------------------------------------------------------------
RELA_HAEIN/253-364--------------------------------------------------------------------------------
Q8XXG1_RALSO/249-360--------------------------------------------------------------------------------
Q7TTS4_SYNPX/282-392--------------------------------------------------------------------------------
Q92D54_LISMO/43-163--------------------------------------------------------------------------------
Q8FNX4_COREF/61-188--------------------------------------------------------------------------------
Q81GK0_BACCR/48-168--------------------------------------------------------------------------------
Q9PQK8_UREPA/246-355--------------------------------------------------------------------------------
Q7D045_AGRFC/236-347--------------------------------------------------------------------------------
Q889A5_PSESM/52-191--------------------------------------------------------------------------------
Q7MBD5_CHRVO/250-361--------------------------------------------------------------------------------
Q7MUI3_PORGI/30-160--------------------------------------------------------------------------------
Q8CXQ4_MYCPE/252-362--------------------------------------------------------------------------------
Q8A0M3_BACTN/251-368--------------------------------------------------------------------------------
CRSH_ARATH/309-434--------------------------------------------------------------------------------
Q898M4_CLOTE/66-201--------------------------------------------------------------------------------
Q8DYZ3_STRA5/45-171--------------------------------------------------------------------------------
Q8NR76_CORGL/66-188--------------------------------------------------------------------------------
Q8G4H5_BIFLO/112-234--------------------------------------------------------------------------------
RELA_MYCLE/290-401--------------------------------------------------------------------------------
Q8Y8U1_LISMO/51-173--------------------------------------------------------------------------------
Q8RF04_FUSNN/66-209--------------------------------------------------------------------------------
Q8XZ30_RALSO/254-365--------------------------------------------------------------------------------
Q8P6N1_XANCP/244-355--------------------------------------------------------------------------------
Q8ERT0_OCEIH/42-162--------------------------------------------------------------------------------
Q7VTF3_BORPE/258-369--------------------------------------------------------------------------------
Q7MAH7_WOLSU/253-363--------------------------------------------------------------------------------
B0TF84_HELMI/237-347--------------------------------------------------------------------------------
B5I035_9ACTN/197-306--------------------------------------------------------------------------------
C4YWN1_9RICK/24-132--------------------------------------------------------------------------------
D3FSJ4_BACPE/58-179--------------------------------------------------------------------------------
I1QPB8_ORYGL/428-537--------------------------------------------------------------------------------
M1A0E5_SOLTU/182-305--------------------------------------------------------------------------------
M1B3M7_SOLTU/437-545--------------------------------------------------------------------------------
SPOT_ECOLI/235-345--------------------------------------------------------------------------------
Q1D7G8_MYXXD/252-362--------------------------------------------------------------------------------
Q2FXU1_STAA8/240-350--------------------------------------------------------------------------------
Q2G204_STAA8/43-162--------------------------------------------------------------------------------
Q2G2L7_STAA8/77-198--------------------------------------------------------------------------------
RSH_BRUA2/235-344--------------------------------------------------------------------------------
CRSH1_ORYSJ/316-438--------------------------------------------------------------------------------
Q8DPU2_STRR6/44-163--------------------------------------------------------------------------------
Q8DXB2_STRA5/240-348--------------------------------------------------------------------------------
Q8R5V7_FUSNN/234-344--------------------------------------------------------------------------------
Q9A0A1_STRP1/53-178--------------------------------------------------------------------------------
R4UJ80_9MOLU/240-350--------------------------------------------------------------------------------

PF14792

DPOLB_RAT/149-262----------------------------------------R-----IP------REE-------------------M---
DPOLB_DANRE/148-263----------------------------------------R-----IP------RSE-------------------M---
A7SJ46_NEMVE/149-263----------------------------------------R-----IP------REE-------------------M---
C3YJ28_BRAFL/322-432----------------------------------------R-----MP------REE-------------------A---
C7YGY5_NECH7/618-739----------------------------------------R-----IP------RRE-------------------V---
F0ZLU7_DICPU/181-297----------------------------------------R-----VP------RKE-------------------I---
A7SK52_NEMVE/213-322----------------------------------------R-----MP------REE-------------------A---
A2QQG4_ASPNC/509-626----------------------------------------R-----IP------RSE-------------------V---
A9V5M0_MONBE/167-298----------------------------------------R-----IP------RAE-------------------V---
D7G2F8_ECTSI/183-296----------------------------------------R-----MP------RSE-------------------A---
B7QKW0_IXOSC/150-261----------------------------------------R-----IP------REE-------------------V---
E9EVQ2_METRA/556-677----------------------------------------R-----IP------RRE-------------------V---
D2A436_TRICA/901-1007----------------------------------------K-----IP------RNE-------------------I---
E3QD37_COLGM/619-740----------------------------------------R-----IP------RSE-------------------V---
Q5KBS5_CRYNJ/504-616----------------------------------------R-----IP------REE-------------------C---
B6HVS0_PENCW/522-633----------------------------------------R-----IP------RKE-------------------V---
A7EMR3_SCLS1/618-744----------------------------------------R-----IP------RAE-------------------I---
E4ZMZ8_LEPMJ/596-715----------------------------------------R-----IP------RAE-------------------V---
C5FJW6_ARTOC/469-580----------------------------------------R-----IP------REE-------------------V---
B7QK41_IXOSC/277-387----------------------------------------K-----MP------REE-------------------A---
B2AY49_PODAN/639-751----------------------------------------R-----IP------RSE-------------------V---
C9SJH6_VERA1/548-691----------------------------------------R-----IP------RRE-------------------V---
D8SG82_SELML/125-237----------------------------------------R-----IP------RDE-------------------V---
E3RX41_PYRTT/579-692----------------------------------------R-----IP------RAE-------------------V---
Q2HFI0_CHAGB/649-794----------------------------------------R-----IP------RAE-------------------V---
C1E884_MICSR/525-667----------------------------------------R-----IP------RDE-------------------V---
A9TCX5_PHYPA/342-457----------------------------------------K-----IP------RHE-------------------I---
C5Z7H1_SORBI/359-473----------------------------------------R-----IP------RHE-------------------V---
B9HVB4_POPTR/315-429----------------------------------------R-----IP------RHE-------------------V---
Q0UN18_PHANO/574-687----------------------------------------R-----IP------RSE-------------------V---
A4S364_OSTLU/149-268----------------------------------------R-----IP------REE-------------------V---
D8R616_SELML/125-233----------------------------------------R-----IP------RDE-------------------V---
A0BDW1_PARTE/419-531----------------------------------------R-----IP------RDE-------------------A---
B8JIE9_DANRE/378-488----------------------------------------R-----MP------RSE-------------------A---
C5GK07_AJEDR/525-637----------------------------------------R-----IP------RAE-------------------V---
F2U5R6_SALR5/160-281----------------------------------------R-----IP------RDE-------------------V---
F7CJ14_CALJA/78-188----------------------------------------R-----MP------REE-------------------A---
Q245F6_TETTS/717-832----------------------------------------R-----MP------REE-------------------A---
Q4QI79_LEIMA/354-499----------------------------------------R-----IP------HEE-------------------G---

PF01909

CID16_SCHPO/908-1034----------------------------------------------------------------------------I---
CID1_SCHPO/69-169----------------------------------------------------------------------------L---
O26508_METTH/6-97----------------------------------------------------------------------------L---
O26564_METTH/21-113----------------------------------------------------------------------------M---
CCA_METTH/29-141----------------------------------------------------------------------------L---
O27980_ARCFU/6-90----------------------------------------------------------------------------I---
CCA_ARCFU/28-133----------------------------------------------------------------------------E---
O28300_ARCFU/48-135----------------------------------------------------------------------------R---
O28312_ARCFU/101-191----------------------------------------------------------------------------V---
O28500_ARCFU/441-531----------------------------------------------------------------------------I---
O28587_ARCFU/7-100----------------------------------------------------------------------------L---
O28660_ARCFU/27-113----------------------------------------------------------------------------I---
O29641_ARCFU/5-90----------------------------------------------------------------------------K---
O29943_ARCFU/5-101----------------------------------------------------------------------------L---
O30239_ARCFU/8-91----------------------------------------------------------------------------L---
PAP_CANAL/68-160----------------------------------------------------------------------------S---
O44768_CAEEL/71-163----------------------------------------------------------------------------C---
O66796_AQUAE/86-173----------------------------------------------------------------------------R---
CID11_SCHPO/72-179----------------------------------------------------------------------------V---
PAPS2_ARATH/82-179----------------------------------------------------------------------------L---
O97205_LEIMA/1069-1163----------------------------------------------------------------------------L---
TDT_HUMAN/311-403----------------------------------------------------------------------------V---
TDT_MOUSE/312-404----------------------------------------------------------------------------S---
PAPOA_BOVIN/82-175----------------------------------------------------------------------------S---
PAP_YEAST/69-161----------------------------------------------------------------------------K---
OAS2_HUMAN/373-475----------------------------------------------------------------------------I---
Y073_HAEIN/14-110----------------------------------------------------------------------------L---
TRF5_YEAST/201-326----------------------------------------------------------------------------I---
PAP2_YEAST/204-318----------------------------------------------------------------------------I---
GLND_RHIME/87-183----------------------------------------------------------------------------L---
P72997_SYNY3/7-99----------------------------------------------------------------------------P---
P73498_SYNY3/14-107----------------------------------------------------------------------------D---
P73970_SYNY3/10-96----------------------------------------------------------------------------L---
OAS1A_RAT/38-140----------------------------------------------------------------------------L---
Q09995_CAEEL/75-168----------------------------------------------------------------------------I---
PAP_SCHPO/68-161----------------------------------------------------------------------------A---
Y128_METJA/11-98----------------------------------------------------------------------------L---
Y141_METJA/7-99----------------------------------------------------------------------------I---
Y435_METJA/7-92----------------------------------------------------------------------------K---
Y604_METJA/7-100----------------------------------------------------------------------------I---
Y1086_METJA/124-219----------------------------------------------------------------------------C---
CCA_METJA/35-147----------------------------------------------------------------------------I---
Y1217_METJA/11-98----------------------------------------------------------------------------L---
Y1305_METJA/10-110----------------------------------------------------------------------------L---
Y1379_METJA/11-100----------------------------------------------------------------------------L---
TUT4_HUMAN/976-1065----------------------------------------------------------------------------L---
Q9RTF8_DEIRA/9-95----------------------------------------------------------------------------H---
Q9RWI9_DEIRA/14-98----------------------------------------------------------------------------I---
Q9RXQ9_DEIRA/18-105----------------------------------------------------------------------------L---
Q9U2P3_CAEEL/73-166----------------------------------------------------------------------------A---
CID14_SCHPO/266-381----------------------------------------------------------------------------V---
PAPA_CANAL/68-161----------------------------------------------------------------------------K---
Q9VC07_DROME/53-140----------------------------------------------------------------------------V---
Q9WZ83_THEMA/22-113----------------------------------------------------------------------------L---
Q9X096_THEMA/7-103----------------------------------------------------------------------------L---
Q9X2Z5_BACAN/31-119----------------------------------------------------------------------------V---
Q9X304_BACAN/10-108----------------------------------------------------------------------------M---
GLND_CORGL/12-98----------------------------------------------------------------------------E---
GLND_VIBF1/55-151----------------------------------------------------------------------------L---
OAS3_HUMAN/780-872----------------------------------------------------------------------------I---
CCA_AERPE/39-163----------------------------------------------------------------------------V---
Q9YCI7_AERPE/22-112----------------------------------------------------------------------------A---
Q9YFN6_AERPE/17-110----------------------------------------------------------------------------R---
Q3Y244_ENTFC/6-114----------------------------------------------------------------------------I---
Q5HNP5_STAEQ/17-112----------------------------------------------------------------------------.---
PAPD7_HUMAN/245-352----------------------------------------------------------------------------V---
CCA_SULSO/25-127----------------------------------------------------------------------------.---
CCA_THEAC/29-134----------------------------------------------------------------------------I---

PF07528

O62349_CAEEL/113-354HVGSFVTDTTTH---------------SSDKSDVVVQLSTL-----PS------YET-------------------V---
Q7PYL7_ANOGA/111-351QVGSFKKGTMMA---------------GSNVADIVIILKSL-----PT------RDC-------------------A---
ILF3_MOUSE/94-342RVGLVAKGLLLK---------------GDLDLELVLLCKEK-----PT------TAL-------------------L---
ILF2_DROME/105-345QVGSFKKGTILT---------------GNNVADVVVILKTL-----PT------KEA-------------------V---

PF12633

K0C9C6_CYCSP/30-225DLKVVKQRFLNL---------------HKLKMQRAIDAVTP-----RQ------KIF-------------------L---
Q7MYN2_PHOLL/4-200YIETLKQRLDAI---------------NQLRLERASTAMSA-----EF------KQV-------------------Y---
C9R2R0_AGGAD/4-204DLNKARKRVDYL---------------DKLRIQRALSDTPE-----SF------QQV-------------------F---
M1WST2_DESPC/651-841.....EERMLTL---------------NRARLARALAGLER-----EK------QVY-------------------L---
F6AGP1_PSEF1/20-216.LTQLRARFMRI---------------NHGRQQRAMQALSP-----RQ------QRV-------------------L---
F4HFE0_GALAU/3-201NLDVAKKKVEQL---------------DKLRLERALAGAPN-----EF------QYV-------------------L---
B3PH57_CELJU/19-216QLTLLRRRFLSL---------------NEQRVARTLTNLSE-----RQ------QQF-------------------M---
G4T2L3_META2/23-218DLLAILQRFKNL---------------HLLQQKRIQSFLQP-----RQ------RVF-------------------L---
K4KKJ3_SIMAS/20-214.TAQIRARFHAL---------------NQSRLALAQMSLSE-----RQ------CDA-------------------L---
B8F5L0_HAEPS/22-213QLSYIKHRVDML---------------DQFRIHNTLRNHSE-----AF------QSV-------------------F---
B0UWZ7_HISS2/4-207DLQQAKKQVEFV---------------DQLRLERALSSTSV-----EF------QRV-------------------L---
Q8E9H1_SHEON/9-202......DIAERL---------------NQVRIARALALLSP-----LQ------KHL-------------------F---
C5BLM3_TERTT/19-214NLTKIRKRFLAI---------------NQDRLTRMRDALTV-----RQ------QLV-------------------L---
J7SL77_MORMO/4-201YIETLKQRLDAI---------------NQLRSERATIGMSR-----AF------KDV-------------------Y---
I0DV26_PROSM/4-199YIETLKQRLDAI---------------NQLRLDRATASMDE-----TF------CKV-------------------Y---
A3Q9P3_SHELP/3-203EQEHFIATAERL---------------NKVRLARALAMLTP-----LQ------RHL-------------------M---
M5DMW4_9GAMM/16-206....WRDAFLAL---------------NQERLDATRSQMTK-----RQ------QAV-------------------I---
E6WHF8_PANSA/15-211YIETLKQRLDAI---------------NQLRVDRALAAMGP-----AF------QHV-------------------Y---
F7YQ90_VIBA7/4-199YTKTLIQRLDNL---------------NQQRTERALALMDL-----QS------QRV-------------------F---
E6VWA6_DESAO/664-855....REQRIQGF---------------NRKRLVRAMGRLDR-----DK------QAY-------------------L---
Q9HTS8_PSEAE/21-217..GQLRQRFLAV---------------NAGRLQRARQALSS-----RQ------ERV-------------------L---
A6VL92_ACTSZ/4-203DLEFARKQVADL---------------EKFRLFRALSGTTD-----EF------RYV-------------------F---
Q2SQ66_HAHCH/20-215.LKTLCQRFITL---------------VEHRLQRTRLALTP-----RQ------QVV-------------------L---
A3N160_ACTP2/35-224......SRVDAL---------------DHFRTQRALAANSP-----QF------QHV-------------------F---
E4PK78_MARAH/20-216TLRRLRDRFLLV---------------NQQRWNRAHSALSY-----RQ------QMV-------------------L---
W8VBQ3_YEREN/4-200YIETLKQRLDAI---------------NQLRVDRALAAMGP-----AF------QRV-------------------Y---
B4F1X4_PROMH/4-202YIETLKQRLDAI---------------NQLRLERAFASMSD-----VF------KQV-------------------Y---
Q9KVL9_VIBCH/4-199YTQTLIHRLDKL---------------NRQRIERALALMDL-----QS------QRV-------------------F---
Q6LLN1_PHOPR/4-203YIQMLKNRLDGH---------------NQLRIERARAAMNV-----QS------EQV-------------------F---
D4ZCR6_SHEVD/7-207EQNHIIETADRL---------------NRVRQARALALLSP-----LK------RDL-------------------L---
Q7VND7_HAEDU/2-191......QRVDAL---------------NDFRIERALAANNP-----QF------QHV-------------------F---
A4VGX1_PSEU5/20-216.LATLRTRFLAV---------------NAARLERALAAMST-----RQ------QQV-------------------L---
F9ZY47_METMM/21-216DLHAITQRFKHF---------------NQSRLQRMREFLQP-----RQ------YEF-------------------L---
M4R7B7_BIBTR/21-222RLEWAKKRIDAL---------------ENHRIYNILKNSDE-----SF------KQV-------------------F---
CYAA_PASMU/4-205DLFSAQKKVEYL---------------DKLRIERALSGSSG-----EF------QHV-------------------F---
Q88B03_PSESM/20-216.LSQLRNRFLSL---------------NDGRYARALEGMST-----RQ------QSV-------------------L---
Q65VX6_MANSM/4-207DLQFAKKQVDDL---------------HRLRVERVLQGSTA-----DF------QHV-------------------F---
Q2NQF3_SODGM/4-200YIETLKQRLDAI---------------NQLRVDRALAAMGP-----DF------QHV-------------------Y---
A1TXX4_MARHV/20-216TLRRLRDRFLLV---------------NQQRWQRACSALTY-----RQ------QMV-------------------L---
CYAA_HAEIN/4-209NLAQAKQWVSAL---------------DQRRFERALQGSGD-----AF------QHV-------------------L---
M9X3J4_MANHA/29-225KLNSTKARIDQL---------------NAYRIERAINANNH-----HF------MHV-------------------F---
E1VFT5_9GAMM/19-214QLKTLKGRFLAV---------------NAERLRRTLEGLSP-----KR------QQF-------------------L---
M4X4Y6_PSEDE/20-216.LAQLRQRFLKV---------------NAGRLRRASEALSS-----RQ------QLV-------------------L---
C6BYH9_DESAD/680-878DIEHCHACFAEN---------------NSRRLDWAQSKLDS-----KS------RKL-------------------L---
I5AZY9_9DELT/15-214KLTRMKAAFSNY---------------NVVRMREALRYLSG-----PK------LEL-------------------F---
Q088L2_SHEFN/10-203.....KDLAEKL---------------NGIRLARVLNVLPE-----SQ------LHL-------------------F---
X2H648_9GAMM/4-197YINNIKKQLKDL---------------ALLKHERALNAMSE-----EF------QHV-------------------F---
A1SR20_PSYIN/12-237EIKRLRDKADEL---------------TRLRIQSAELLMNA-----DT------LTV-------------------F---
Q87KJ0_VIBPA/4-199YTYTIIQRLDNL---------------NQQRIDRALALMDS-----QS------QQV-------------------F---
H8GI61_METAL/21-218DLQAIADRFRKF---------------HHFKRESIRHVLTP-----SQ------RQF-------------------L---
Q21EM4_SACD2/20-215NLTLLRKRFLSI---------------NTDRLERMRSALNS-----HQ------QLC-------------------L---
A4XNY1_PSEMY/20-216.LTQLRARFLKI---------------NQGRLQRTMLGLSS-----RQ------QLV-------------------L---
D6Z233_DESAT/8-206......ARYHLY---------------NEERIAKSVLLNPH-----KS------NII-------------------F---
C5BBD1_EDWI9/4-201YIETLKQRLDAI---------------NQLRVERALSAMGP-----AF------QQV-------------------Y---
B7VMD8_VIBTL/4-199YTQTLIQRLDNL---------------NQQRIDRALALMNV-----QG------QRV-------------------F---
Q88CF9_PSEPK/20-216.LATLRARFLHL---------------NQGRLQRAKEGLST-----RQ------QQV-------------------L---
C4LDV3_TOLAT/4-196QFELLVARCDAI---------------NQIKMERALEAMNE-----AG------RRM-------------------L---
M4U351_9GAMM/4-197EIKRLRDKADQF---------------NRLRIQSAQVLMTE-----NE------YNV-------------------F---
E0SKN1_DICD3/4-200YIETLKQRLDAI---------------NQLRVDRALEAMKP-----AF------QQV-------------------Y---
D5C200_NITHN/12-205..KDIRQRFFAL---------------NRHRLGRVRESLRP-----RQ------RVF-------------------L---
A0KFH7_AERHH/4-200KLDTLVARYDEL---------------NRLKTQRALGLMSR-----YG------QQV-------------------F---

PF10127

YCGL_BACSU/1-249----------------------------------------------MK------QRI-------------------I---
A8MHZ8_ALKOO/1-249----------------------------------------------MK------SVI-------------------M---
Q0ATC2_MARMM/14-264----------------------------------------------MH------DTI-------------------L---
Q5YSM9_NOCFA/7-254----------------------------------------------MS------VHG-------------------S---
A3QAH3_SHELP/6-255----------------------------------------------IK------KEI-------------------L---
Q8Y2V7_RALSO/25-271----------------------------------------------IR------ARV-------------------L---
Q97IY9_CLOAB/10-256----------------------------------------------IE------ELV-------------------N---
A6LZ95_CLOB8/1-237----------------------------------------------MN------KVT-------------------K---
A8F9S9_BACP2/1-249----------------------------------------------MR------ERI-------------------K---
Q2RSZ8_RHORT/22-270----------------------------------------------LG------PAA-------------------A---
Q8SCS5_BPDPK/11-264----------------------------------------------MR------VTI-------------------N---
A9B3Q0_HERA2/60-291----------------------------------------------LR------KQF-------------------N---
A7MPB9_CROS8/11-258----------------------------------------------MR------ERV-------------------R---
Q9S235_STRCO/1-245----------------------------------------------MI------DAL-------------------D---
Q65NN4_BACLD/1-249----------------------------------------------MK------QRI-------------------E---
Q7ULC4_RHOBA/63-303----------------------------------------------IH------HDQ-------------------L---
A9BRG4_DELAS/16-262----------------------------------------------MR------ATV-------------------L---
Q7NZ84_CHRVO/14-259----------------------------------------------VR------RRV-------------------M---
Q24TP5_DESHY/3-250----------------------------------------------VK------ERI-------------------I---
Q7ULC3_RHOBA/4-250----------------------------------------------AR------IID-------------------Y---
Q099H0_STIAD/9-253----------------------------------------------HQ------TRV-------------------S---
Q7MZH9_PHOLL/11-258----------------------------------------------MK------QHI-------------------C---
Q0BVF7_GRABC/14-264----------------------------------------------IR------SVI-------------------Q---
A6LZ96_CLOB8/1-249----------------------------------------------MD------KVI-------------------Q---
Q2SQI3_HAHCH/1-246----------------------------------------------ME------KRI-------------------Q---
B4EM27_BURCJ/21-266----------------------------------------------.R------ARV-------------------M---
Q814A4_BACCR/1-249----------------------------------------------MR------EKI-------------------E---
Q853S4_BPMBZ/16-276----------------------------------------------.H------EPV-------------------Q---
Q9HVK0_PSEAE/13-260----------------------------------------------MR------ERV-------------------L---

PF10620

D3FW19_BACPE/3-199RVHDLVELKDVE......................GFLSKET-----FP------DWV-------------------YSVL
B4EEI1_BURCJ/9-215RRHTLVTLTAAG.WGAAFARDPALAGDP............L-----VR------AWA-------------------E...
F2F9N8_SOLSS/4-194TVHDLVFLKSMD......................QIDYFGQ-----YP------DWM-------------------NEDE
R5PTN8_9BURK/4-199RPHDLLFLTGKA......................SLRDSL.-----.A------PLI-------------------DGFW
Q20XM6_RHOPB/11-212RPHDLLWIDEPR......................TLISDSS-----TP------AWV-------------------FAAL
D5DB12_BACMD/5-199.AHDLLQLKEEA......................KLISYTP-----IP------DWV-------------------EHSL
G8NWE2_GRAMM/10-208QVHDLLLLSSGR......................VHPACMA-----EP------PWV-------------------QTAM
Q6FBG5_ACIAD/8-200RPHDLLWGMTCE......................MLPEDA.-----.P------HWV-------------------KDAV
Q478I8_DECAR/2-209RRHDLVYLQRDA....LFSTPCAETGDPYWQA........A-----.G------DWI-------------------A...
G8M515_9BURK/7-206RPHDLVRLAPGA........................PPFAD-----AP------GWV-------------------AAAL
Q13P70_BURXL/22-223RPHDLLRLQ.........................RLQTFDA-----EP------AWV-------------------REAF
B0UJ86_METS4/6-208RRHDLLDVEPQA.WAGVLAGRPDIEGVP............H-----VA------EWA-------------------Q...
E0SJB7_DICD3/5-200RPHDLLWLTSRE......................ALEGID.-----.A------PWV-------------------DSQW
B1Y603_LEPCP/24-240RRHQLVRLSPAG.WQTVLAQTHAESARPC............-----LA------HWA-------------------A...
B6JE84_OLICO/7-212ERHAFVYCAPER.............LSDGAIRTAHSQDIAV-----IE------SWI-------------------R...
I0DQT6_PROSM/4-200NPHDFVWISSLD......................DLPVES.-----LP------EWV-------------------ISQW
MDCG_BRADU/13-217GRHDLVFVSPAG.WRAMLDARDDLAADS............L-----LA------RWP-------------------K...
D5AVP5_RHOCB/5-220.RHSLAHVSPAS..RPGILAAVLDALPEQMRD..PGTRKLV-----RD------AMS-------------------K...
Q2RUR7_RHORT/4-220RRHTLAHIDPIA..RARLLPALIEALPAAMRG..PDIEARI-----EH------VLI-------------------S...
D3HKK0_LEGLN/3-206QRHHLIYLQPGT............EFFLVSCHEENRLIKEH-----VS------AWF-------------------A...
A0R6Q2_MYCS2/5-197RPHDLLRIADVA......................RLSGDA.-----.P------SWV-------------------AAAL
I3U924_ADVKW/2-208RRHDLAYLYSNA.EYQLLSP....VQSPTAQA........A-----LQ------RWL-------------------H...
A4G557_HERAR/3-213YRHNRVWLSANG.W.....QAACARLPAAHAK........E-----LM------RWA-------------------E...
H5WND7_9BURK/5-214HRHQLAHLSAAG.WQAILAMPWDDEASAC............-----LA------HWA-------------------A...
W0PCX9_9BURK/2-210RRHDLAYLYPTA.DYRLLST....SPDAAAHH........A-----LQ------RWL-------------------H...
A8AQP5_CITK8/6-200RPHDLIWLNARS......................ALEGVT.-----.E------SWV-------------------DDVW
D8IXS4_HERSS/5-221PRHHLLWLTEAA.WTRLQTQSQDSREQAV............-----LA------RWR-------------------Q...
Q4FSL5_PSYA2/2-211HRHDLVYLQPEEAFTMLNASLPLAVIQAVD...........-----..------NMI-------------------M...
G0ABH8_COLFT/3-212ARHSLVWLSADG.WQRAA.QTAAAGNRAA............-----LE------RWQ-------------------S...
C5AE29_BURGB/13-235VRHRVVRLAPAA.W.AALAEPLVERLALPA.ADA...A..V-----IR------AWA-------------------A...
C5CZJ3_VARPS/8-216HRHQLAWLTRSG.WAAVLGRPWDVQARDC............-----LA------HWA-------------------L...
Q21XD0_RHOFT/5-210ARNQLVWLDAQA.WAQMQAHPWDDEAQH............I-----LA------HWR-------------------S...
A1WLX1_VEREI/8-240WRHRRVWLAPAL.............RAQDMRAGTGAGAVQA-----FI------ARA-------------------Q...
Q89UY6_BRADU/6-207ARHTMVKASAAG.WAAVMSRHPELASEP............I-----ID------GWA-------------------R...
C5APL6_METEA/6-211RRHDLLDVEPGA.WAAAVIARADLAEVP............H-----VA------AWV-------------------N...
F6AEK3_PSEF1/6-203RPHDLLWGLLPT......................QLPQEA.-----.P------AWA-------------------RAAL
MDCG_PSEAE/8-202EPHDLLLGMAPA......................HLPENA.-----.P------AWV-------------------CAAL
A4VRY6_PSEU5/6-198RPHDLLWGMRPE......................QLPADA.-----.P------AWA-------------------VAVL
D7A7S9_STAND/7-217ARHDLLRVTPEG.WRATLTVT.......EGLERLSDEPRRL-----VE------GWC-------------------E...
B2JLU1_BURP8/24-227RAHDILRVR.........................KLEPFDA-----EP------AWV-------------------RDAF
MDCG_XANCP/3-204GRHALVWLRADA.................PSQALTPGAQPR-----LQ------AWF-------------------A...
I2BDH6_SHIBC/7-201RAHDLLWLDSNT......................PPQGIT.-----.D------PWV-------------------AEYW
A9BUU4_DELAS/12-224HRHQLVDLGPQA.WADLLERPRDAQAREI............-----LT------HWR-------------------D...
H0Q3G4_9RHOO/2-205RRHDLVWLDPAF...............PLADFGVTEDHRAE-----LG------DWI-------------------A...
G2IWN4_PSEUL/8-208RPHDLLWLADPA......................ALCTDTP-----LP------DWA-------------------GADW
MDCG_KLEP7/6-200RPHDLVWLNHAS......................ALEDIA.-----.E------PWV-------------------AQQW
H2IQE3_RAHAC/5-202RAHDFVWIRDRS......................ALESDDV-----LP------EWV-------------------NTGW
S6AL15_PSERE/6-197RPHDLLWGMTPD......................QLPGEA.-----.P------DWA-------------------RQAL
A1VKU0_POLNA/11-212RPHDLLWPLAAS......................SLVFSGP-----PP------PWA-------------------TPDW
MDCG_PSESM/9-203LPHDLLWGMPLS......................ALPDDA.-----.P------QWA-------------------VDTL
H8MH16_CORCM/7-204VRHDWVYLGDH..WAEALRSPLIPDVLV............H-----VT------AWR-------------------A...
B8EMG7_METSB/15-229RRHALLQVCPEG...FAIALAGFAQAESPAGAPVKIPP..I-----VT------EWA-------------------A...
E6WJH1_PANSA/6-195RPHDLLWLRHDR......................ALVGIT.-----.E------AWV-------------------AELW
B1M799_METRJ/6-209RRHDLVRADPAA.WAAWRVGRPDLSAVP............H-----LE------HWA-------------------A...
MDCG_AZOVD/9-206QPHDLLWGMSTD......................RLDAAA.-----.P------TWA-------------------AEVL
W0LLU0_9ENTR/3-217HRHDLLQFSPQA..AQQIFLLWQAAQPHDWLSSLPDWQ...-----.R------SFN-------------------A...
A5VEB4_SPHWW/8-205RRHDLVHLRSGA.................RIEGVAAAPEVL-----LA------DWV-------------------A...
B2UKC7_RALPJ/7-206RAHDLLWVSETP......................VATDDAP-----LP------DWA-------------------ITAC
Q21AG0_RHOPB/4-220LRHTMVEFSVEE..RLRSAETVCGGLLAPFRQ..PALQEQV-----RR------AFA-------------------A...
A2SDW3_METPP/11-216WRHRRVWLAPDL.............GPADLAGLGDPTDAQA-----VV------DWA-------------------Q...
A1T0S3_PSYIN/7-202QPHDLLWVKDIV......................IHQEN..-----.P------NWY-------------------ANHI
B2FSQ2_STRMK/6-203ARHTLAWLSADADWRADVTA.................HEPR-----LA------AWF-------------------A...
B8IJN7_METNO/6-210RRHDLLDVDPGA.WAAMLAQRPDLDGVP............H-----VA------DWA-------------------R...

PF04439

R7KZ10_9FIRM/1-274......MYELIIGTARADERIRAVYMNGS.......RTDKN-----AP------KVI-------------------F---
W6S1S8_9CLOT/1-279MRSEKEMYELILSIANNDKRIHAVYMNGS.......RVNKN-----IK------SDI-------------------F---
L0EDK7_THECK/1-279MRSERDMMELIVGFAKADERVRAVILNGS.......RANPD-----AP------RDC-------------------F---
R7M6A2_9CLOT/3-279MRTEKQIYDTILNFAKADDRIRVVTLEGS.......RTNIN-----II------PDD-------------------F---
F0RJQ6_DEIPM/17-291...ETVLLRRVRAFAEADPRVRAAVLSGS.......RVNAA-----IR------PDP-------------------F---
C9A7Q4_ENTCA/1-276MREEAELHQLILSVGQRV.GARAIGLSGS.......RTDPQ-----AP------KDF-------------------L---
R5BA48_9CLOT/1-282MRSERQIMDTILSVVKSSDNIRAAYMNGS.......RTNPN-----VE------KDE-------------------L---
A8AXL5_STRGC/1-268MKTETEMFDVILQTAKAL.QVYAVAMSGS.......RSNPN-----AT------KDE-------------------F---
J7SKW9_MORMO/1-275MESIEQIINNIISFALLDPRIDAVIITGS.......VARQN-----QA------.DR-------------------F---
C0ZBY2_BREBN/3-281LRTEQEMMNMLIDFARKDDRIRLVTLEGS.......RTNKN-----IP------ADP-------------------F---
F8KV03_PARAV/7-263TK........IVEWAKQEQTVKAVILQGS.......HATNQ-----A.------.DR-------------------Y---
R6MWH0_9CLOT/1-270MRSQEEMLAIILKKAKQEEHIRAALLQGS.......RVSKE-----AK------PDC-------------------F---
D1API7_SEBTE/1-279MRNEKEMLDLILRTAVNDPEIRAVYMNGS.......RTNPN-----VK------KDI-------------------F---
Q81EL0_BACCR/1-279MRTEKEMLDLIINTAIEDERIRAVIMNGS.......RVNPN-----VK------RDC-------------------F---
E8N0I5_ANATU/1-276MRTEQEMMDLILTFARNDERVRAVILNGS.......RANPN-----AP------RDF-------------------F---
T0U4V5_9ENTE/1-276MRNEAEMLAVILRVGQKI.GVQAIAISGS.......RREPN-----AI------SDR-------------------F---
F5WV16_ERYRF/1-277MRTETEIMTLILEQAKLSQHIRIVAMNGS.......RVNKE-----IE------KDS-------------------M---
Q7N6T3_PHOLL/8-279.......LEKILTFAHNDPRIDTVIQTGS.......RARNA-----RV------.DK-------------------F---
D6DFM9_CLOSC/1-277MRSEKEVYDIVLNFAKTDKRIRMVTLEGS.......RTNTN-----IP------PDD-------------------F---
C6VZK2_DYAFD/8-288.RTASDMTELILEVARKDHRILAVLQDGS.......RSNPN-----VT------PDI-------------------F---
F4C3Y1_SPHS2/10-290.RSESEMMELILRVAAKDTKILGVLQDGS.......RSNPN-----VS------KDI-------------------F---
Q9KFZ4_BACHD/1-282MRTEQEMMDVILTIAKKEERIRAVYMNGS.......RTNSN-----VP------KDL-------------------F---
D3HMA9_LEGLN/5-280.RDEKTMLNLIVQAAKNDKRIRAVIMNGS.......RASPS-----AK------KDI-------------------F---
C3AKL1_BACMY/1-279MRSEKEMMGLILNAAREDERIRAVIMNGS.......RVNPN-----VK------RDC-------------------F---
G4L4M5_TETHN/1-277MRSTTEMTDLILETAQKLPEVKAVAMSGS.......RANKS-----IP------KDN-------------------F---
A5N4U0_CLOK5/1-276MRSEKEMMDLIIAVANNDVRIRAAYLEGS.......RANPN-----VP------KDI-------------------F---
F3ZWD0_MAHA5/1-282MRSEKEMMELILGVAESDEHVRAVYMNGS.......RANPN-----IT------KDA-------------------Y---
Q830C7_ENTFA/1-279MRTEEEMFQLIMDVAKQEEHIRAVGMVGS.......RTNVK-----AP------KDS-------------------F---
E1R322_SPISS/4-281.RTEKEILDLIYNFVEADNRIRVVIMNGS.......RVNPN-----IQ------KDI-------------------F---
D3EE58_GEOS4/1-279MRSEQEMMDLVLGYAARDERVRAVTLEGS.......RTNPN-----VP------KDI-------------------F---
F5YA41_TREAZ/1-278MRSEREMMALILGVAQKDERIRAVWMNGS.......RTNTN-----AP------KDD-------------------F---
K0J1M0_AMPXN/1-279MRTEKEMYDLVLNFAKNDQRVRAVGLNGS.......RTNPN-----AP------RDI-------------------F---
D9SUI2_CLOC7/1-279MRTEQEMFDLILNTAKEDERIRAVYINGS.......RTNPN-----AI------KDI-------------------F---
A8MEJ4_ALKOO/1-277MRTEQEIMNLMLDIAKQDERIRIMILEGS.......RTNVN-----IP------KDE-------------------F---
A6TTG7_ALKMQ/1-278MRTEKEMMDRILNTAKEDERIRAVVMNGS.......RVGNP-----SS------KDC-------------------F---
Q5WJQ6_BACSK/1-279MRSEQEMMTLFLDFAKNDERIRLVTLEGS.......RTNKA-----IT------PDK-------------------F---
E3EGQ4_PAEPS/1-279MRSEPEMMNMLVKFAMNDKRIRLVTMEGS.......RTNFN-----VP------PDS-------------------F---
G7M0J2_9CLOT/1-279MRTEQEMFNLILSAAENDERIRAVVMNGS.......RTNRN-----AI------KDI-------------------F---
I0JN00_HALH3/1-279MRSEEEMMELILSVAETEPHIRGVIMNGS.......RVNPN-----VT------PDL-------------------F---
C3AW64_BACMY/1-282MRNEQEMMDLIINIAKEDGRIRAVYMNGS.......RTNPN-----VP------KDI-------------------F---
Q5ZTL0_LEGPH/5-281.RDEQTMLTLIIKIANDDERIKIVIMNGS.......RASPS-----AK------KDI-------------------F---
Q5WBU9_BACSK/1-278MRTYNEMINLLLGVAKSDERIRAVCMNGS.......RTNRN-----AR------KDP-------------------F---
H1ZC54_MYROD/8-281.......QNQVLDLASNDTRIRAVLLNGS.......RANPN-----VM------PDV-------------------Y---
Q65P34_BACLD/1-285MRTEQEIIDLVLKVAREDSRVRAVGMNGSRTNPNVPRTNPN-----VP------KDP-------------------F---
R7EXP0_9FIRM/1-276MRSEKEMLDLIIRTAREDERIIAAYLEGS.......RVDPN-----AQ------KDI-------------------F---
D9SN58_CLOC7/1-281MRNTQEMMDLILNIAKEDARIRAVYLSGS.......RVDPD-----AT------QDK-------------------Y---
E3EJ73_PAEPS/1-278MRSEQEMLHTILQFAQEDERVRAVIMNGS.......RANPH-----AP------RDI-------------------F---
H6NNB4_9BACL/1-279MRSEREMMDTILSFANEEEGIRAVIMNGS.......RVNPK-----AR------RDP-------------------F---
R6VSM5_9FIRM/1-276MRTEDEIMKLLINTAAQDDRIRAAYLEGS.......RVNPD-----VP------RDM-------------------F---
Q3Y246_ENTFC/1-277MRSEKEMMDLVLSLAEQDERIRIVTLEGS.......RANIN-----IP------KDE-------------------F---
J9R2N9_RIEAN/1-283MKVREEKLRTIIEWSEKNEDVRVLLLTSS.......LVNPL-----AL------VDE-------------------F---
C6XTS4_PEDHD/4-284.RSEQKMMKLILDVATDHPEVRAVLLNGS.......RANPN-----VA------TDI-------------------F---
Q24XY2_DESHY/1-282MRSEKEMMEIILSTAKKDERIRAVYMNGS.......RTNPN-----VP------KDI-------------------Y---
K8E427_CARML/1-279MRSEEEMYHLILQKAQLDERIRGVLLNGS.......RANKH-----VK------PDR-------------------L---
E0RXK3_BUTPB/1-281MKTYDEMYDLIIKTATEDDRIRAATMEGS.......AVTPG-----AV------RDG-------------------F---
R5RFU0_9FIRM/1-279MRSEKEVFTLFDNIAKTDDRIRVMTLEGS.......RVNPN-----VK------PDQ-------------------W---
AADK_BACSU/1-279MRSEQEMMDIFLDFALNDERIRLVTLEGS.......RTNRN-----IP------PDN-------------------F---
I0DXB6_PROSM/4-277...PASLINKIISVSLLDPRIDAVILTGS.......RGREQ-----QI------.DH-------------------Y---
R5A566_9CLOT/1-278MRTEQEMYQLILEYAWKDPKIRGVILNGS.......RANPT-----AK------LDR-------------------F---

PF03296

Q9EN10_AMEPV/129-284...DNPILNEILKQYVYKQKLKNVTVNND......KKKIIDPDDEKLA------ESI-------------------K---
PAP1_CPRVZ/123-270YAAHEDYVEAMLRSY.......RVTDGAG..PPKGRNKVSD.....LV------GYV-------------------I---
PAP1_DPV83/122-269TSSMQKIANDALNSM.......NIATISD..KVMGRHNVSS.....LV------CNV-------------------N---
PAP1_MCV1/122-269YCSMERLAEEVLWSY.......NVAFRSG..KVMGRHCVSN.....LV------VHV-------------------N---
Q6TVV2_ORFSA/120-268.TRARALASRALDSY.......AVLPPPEEAAPMARHKHSD.....LV------EVV-------------------K---
PAP1_VAR67/131-279VTSMEELARDMLNSM.......NVAVIDK.AKVMGRHNVSS.....LV------KNV-------------------N---
PAP1_FOWPN/124-271YSSMEKIADDILDSY.......NVVEPSK..EVKGRHKVSD.....LV------GHV-------------------Y---

PF01743

PCNB_ECOLI/62-193--------------------------------------------------------------------------------
O66728_AQUAE/454-580--------------------------------------------------------------------------------
Q93795_CAEEL/38-162--------------------------------------------------------------------------------
CCA_BACSU/22-142--------------------------------------------------------------------------------
O83294_TREPA/24-145--------------------------------------------------------------------------------
O84710_CHLTR/23-143--------------------------------------------------------------------------------
O67911_AQUAE/37-172--------------------------------------------------------------------------------
O51649_BORBU/24-145--------------------------------------------------------------------------------
O83605_TREPA/50-165--------------------------------------------------------------------------------
PCNB_HAEIN/50-181--------------------------------------------------------------------------------
O25357_HELPY/22-146--------------------------------------------------------------------------------
P74081_SYNY3/512-663--------------------------------------------------------------------------------
CCA1_YEAST/63-205--------------------------------------------------------------------------------
I1NH95_SOYBN/99-237--------------------------------------------------------------------------------
Q88DX1_PSEPK/56-188--------------------------------------------------------------------------------
Q94K06_ARATH/110-247--------------------------------------------------------------------------------
Q9CCY1_MYCLE/41-168--------------------------------------------------------------------------------

PF06042

C3AL46_BACMY/24-186--------------------------------------------------------------------------------
Q2S808_HAHCH/20-179--------------------------------------------------------------------------------
G8PQI6_PSEUV/58-222--------------------------------------------------------------------------------
Q47ZE1_COLP3/38-196--------------------------------------------------------------------------------
T0TPF3_9STRE/22-184--------------------------------------------------------------------------------
C7ZKJ8_NECH7/30-194--------------------------------------------------------------------------------
A6VYX8_MARMS/22-179--------------------------------------------------------------------------------
B2IE49_BEII9/22-182--------------------------------------------------------------------------------
A4VG22_PSEU5/22-182--------------------------------------------------------------------------------
C2WZT1_BACCE/24-186--------------------------------------------------------------------------------
A6WX10_OCHA4/47-208--------------------------------------------------------------------------------
G3J5G4_CORMM/36-202--------------------------------------------------------------------------------
Q5WAS6_BACSK/23-185--------------------------------------------------------------------------------
K9QIT0_9NOSO/21-177--------------------------------------------------------------------------------
A0KID9_AERHH/44-203--------------------------------------------------------------------------------
Q7NQC6_CHRVO/26-191--------------------------------------------------------------------------------
Q0WCS8_YERPE/22-199--------------------------------------------------------------------------------
Q084X9_SHEFN/37-198--------------------------------------------------------------------------------
K8E4K8_CARML/22-184--------------------------------------------------------------------------------
N0ATJ8_9BACI/22-184--------------------------------------------------------------------------------
K9WRX7_9NOST/22-176--------------------------------------------------------------------------------
T0TA19_9STRE/18-179--------------------------------------------------------------------------------
Q8E2A6_STRA5/19-180--------------------------------------------------------------------------------
A7HQY2_PARL1/21-184--------------------------------------------------------------------------------
Q0ATF8_MARMM/35-199--------------------------------------------------------------------------------
R9VI11_9ENTR/29-181--------------------------------------------------------------------------------
C6D3F5_PAESJ/25-186--------------------------------------------------------------------------------
E6TYF2_BACCJ/23-185--------------------------------------------------------------------------------
B5I7I9_9ACTN/30-193--------------------------------------------------------------------------------
Q9A3I2_CAUCR/24-192--------------------------------------------------------------------------------
R4L9D2_9ACTN/23-182--------------------------------------------------------------------------------
E6X9J4_CELAD/24-180--------------------------------------------------------------------------------
Q6LIY1_PHOPR/48-206--------------------------------------------------------------------------------
R7F266_9BACI/28-194--------------------------------------------------------------------------------
W8UHS0_YEREN/24-184--------------------------------------------------------------------------------
Q12L07_SHEDO/33-198--------------------------------------------------------------------------------
X4ZH19_9BACL/21-179--------------------------------------------------------------------------------
E1V6J0_HALED/24-181--------------------------------------------------------------------------------
D4ZAN8_SHEVD/35-191--------------------------------------------------------------------------------
Q7MJH5_VIBVY/23-178--------------------------------------------------------------------------------
Q8EGD2_SHEON/29-193--------------------------------------------------------------------------------
I1RDV7_GIBZE/30-194--------------------------------------------------------------------------------
Q03U83_LACBA/22-184--------------------------------------------------------------------------------
C0ZRT4_RHOE4/21-184--------------------------------------------------------------------------------
I3TT60_TISMK/24-184--------------------------------------------------------------------------------
Q98CQ2_RHILO/58-222--------------------------------------------------------------------------------
A4Z2D9_BRASO/21-184--------------------------------------------------------------------------------
M4XBK0_PSEDE/30-180--------------------------------------------------------------------------------
B2J7L9_NOSP7/21-177--------------------------------------------------------------------------------
C4L4W2_EXISA/22-184--------------------------------------------------------------------------------
C9A9L8_ENTCA/21-183--------------------------------------------------------------------------------
C9SMQ7_VERA1/31-195--------------------------------------------------------------------------------
I0JHP3_HALH3/24-186--------------------------------------------------------------------------------
G2SQN4_LACRR/23-176--------------------------------------------------------------------------------
G4R9P5_PELHB/34-198--------------------------------------------------------------------------------
D9QML6_BRESC/23-187--------------------------------------------------------------------------------
Q8CZ82_STRR6/25-187--------------------------------------------------------------------------------
H2IZW8_RAHAC/23-181--------------------------------------------------------------------------------
K9PHD3_9CYAN/22-177--------------------------------------------------------------------------------
S8BA31_DACHA/30-194--------------------------------------------------------------------------------
D3E7U6_GEOS4/21-179--------------------------------------------------------------------------------
A1S5C1_SHEAM/40-192--------------------------------------------------------------------------------
E3EIW9_PAEPS/24-182--------------------------------------------------------------------------------
B9JA85_AGRRK/24-187--------------------------------------------------------------------------------
Q89V81_BRADU/22-184--------------------------------------------------------------------------------
C9A5U1_ENTCA/30-192--------------------------------------------------------------------------------
Q8DVZ2_STRMU/21-183--------------------------------------------------------------------------------
U5L946_9BACI/24-185--------------------------------------------------------------------------------
R8BBT8_TOGMI/30-194--------------------------------------------------------------------------------
F0LZI9_VIBFN/22-180--------------------------------------------------------------------------------
Q9CGK8_LACLA/22-182--------------------------------------------------------------------------------
Q8YZI8_NOSS1/21-177--------------------------------------------------------------------------------
H8L6T1_FRAAD/26-186--------------------------------------------------------------------------------
B4RAU1_PHEZH/22-186--------------------------------------------------------------------------------
U4KG05_9VIBR/26-182--------------------------------------------------------------------------------
N4VT77_COLOR/30-193--------------------------------------------------------------------------------
Q5M5D3_STRT2/19-183--------------------------------------------------------------------------------
A9KPI8_CLOPH/31-195--------------------------------------------------------------------------------
A0ZEL1_NODSP/6-161--------------------------------------------------------------------------------
Q6F6M2_ACIAD/63-218--------------------------------------------------------------------------------
A3CK23_STRSV/22-184--------------------------------------------------------------------------------
T0LHD4_COLGC/33-197--------------------------------------------------------------------------------
B7VSV6_VIBTL/5-162--------------------------------------------------------------------------------
F3ZCS6_9ACTN/62-226--------------------------------------------------------------------------------
K9ZZZ5_DEIPD/21-185--------------------------------------------------------------------------------
Q9KMH4_VIBCH/42-199--------------------------------------------------------------------------------
F9UNI3_LACPL/22-183--------------------------------------------------------------------------------
F7YRG9_VIBA7/44-201--------------------------------------------------------------------------------
D0J385_COMT2/22-181--------------------------------------------------------------------------------
G8PQI7_PSEUV/50-212--------------------------------------------------------------------------------
V4KBT1_9ACTN/35-199--------------------------------------------------------------------------------
K9W6P1_9CYAN/21-184--------------------------------------------------------------------------------
C5CXQ6_VARPS/13-176--------------------------------------------------------------------------------
G8S5F2_ACTS5/30-189--------------------------------------------------------------------------------
K9RM73_9CYAN/21-177--------------------------------------------------------------------------------
B9JP57_AGRRK/25-185--------------------------------------------------------------------------------
B9DTD2_STRU0/21-182--------------------------------------------------------------------------------
F5Z4Y3_ALTSS/31-192--------------------------------------------------------------------------------
K0I121_9BURK/29-196--------------------------------------------------------------------------------
W0L9G9_9ENTR/22-179--------------------------------------------------------------------------------
A4VSF2_STRSY/43-201--------------------------------------------------------------------------------
A8GHE5_SERP5/22-179--------------------------------------------------------------------------------
E9ELM3_METRA/30-196--------------------------------------------------------------------------------
A8AUH1_STRGC/23-185--------------------------------------------------------------------------------
R7F5W6_9BACI/28-194--------------------------------------------------------------------------------

PF07984

L5LWP1_MYODS/17-336LSWDQVSRLHEVLNEVVPVHGR.G.NFPTLELTLKDIVQTVRSRLEEA......GIQ...................V---
A1Z745_DROME/52-381LSFEQVSKLHDVMDEKVAIHGR.G.NFPTLEVKLKDLVNLVRRKLEAEVNAGGAGVL...................V---
T1FNH1_HELRO/24-358LNYDQINRLDQIIGSTFDVHGHSGLGYPNLSIKAKELIVAVRDKLVES......GFH...................L---
T1J6X5_STRMM/39-359LSYEQVRRLDTVMEEVVPIHGR.G.NFPTLEIKLKDLVHVVRSKLESD......SVS...................V---
G3Q3S6_GASAC/31-351LNVEQVEVLHQVLSEAVPIHGR.G.NFPTLELRPRDIIIAVRARLQQQ......GIA...................V---
H2Z3D3_CIOSA/19-351..YKGVARLTELMEADVPIHGV.G.NFPDLQISPSELIQMVCDRLECS......GVK...................V---
H9GHA4_ANOCA/13-332LTWEQLQILDQVLTEVIPIHGR.G.NFPTLEVKPKDIIRVVKEQLIKK......QIV...................I---
B3RY60_TRIAD/11-330LDYDQVSRLDEILTQVISIDGV.G.NFPSLEVRPYQFVNLILKKLAIH......GIH...................L---
E4X262_OIKDI/463-783.KFGEIKKLQKILDKSHEIHGK.G.NFPTITVEPTKLIKDIHARLGEA......GIS...................V---
G4M0E2_SCHMA/159-490LSYERVTRLHYVLSKTIPIHSRYP.GFPTIMVKLHDLLRAVRGNLKSA......GIP...................I---
W5NMQ1_LEPOC/15-334LTWEQVRLLDEVMTEAVPVHGR.G.NFPTLEVRLKDIVQMVRSRLEEK......GIR...................V---
A7T168_NEMVE/10-329LTYEQVHRLDNVLNQVVQVHGR.G.NFPTLDVHLRELINVVSSGLKDE......NLR...................I---
T1K5N9_TETUR/11-330LSYEQVTRLDTVMDEVVPIHGR.G.NFPTLEMKLKDLVSVVRGKLEEE......NVT...................L---
I1FWF4_AMPQE/47-375LTFEQVQRLSQIVSDPIAINAKEG.NFPTLAISPAQLIKAVKKRLDSK......DID...................V---
B3RUB7_TRIAD/6-351LNYGQVGKLVELLETCVEIHGY.G.NLPTLQIPLKELLRKVRNNLRKD......NVN...................V---
K1PBY4_CRAGI/10-333LCYEQVDRLNKVMEDVIPIHGR.G.NFPTLDVKLKDLVQVVRDKLKAE......GVC...................V---
F7AS71_MONDO/19-338LGWDQIKILDQVLSEDVPIHGR.G.NFPTLEVKTKDIILVIQEELQKK......EIV...................I---
H2LZV4_ORYLA/17-337LSIEQIQALDRILTEVIPIHGR.G.NFPTLQVRVKDIIRVVKDRLVER......DIM...................V---
F7E7M3_XENTR/18-337LSWPQVRRLDAILCESVPIHGR.G.NFPTLSCRPRDLVQVVRSRLEQK......GIL...................V---
H3E7R5_PRIPA/59-392L...QMERLQQLLNENIEIDGA.G.NFPEIILPLRHFVVALKRQLVSA......GLS...................P---
J9JYZ0_ACYPI/99-447LSYEQVARLNDVMDETVSIHGR.G.NFPTLEVRLRDLVAMVRDRLRAQAAPEDDDVAFPAERSTPPSPDADDTCFQV---
E9HG11_DAPPU/7-330LSYEQVSRVHDVMNETVSIHGR.G.NFPTLELRLRDLVTLVRAKLEAD......GVA...................V---
H9JEQ9_BOMMO/53-380LSYEQVRRLNDVMDEVVAIHGR.G.NFPTLHVRLRELVAGVRARLELAQAAGGAGVS...................V---
FA46B_HUMAN/52-372LSWPQVKRLDALLSEPIPIHGR.G.NFPTLSVQPRQIVQVVRSTLEEQ......GLH...................V---
G3VWF6_SARHA/61-380LSWEQVQRLDDILSETIPIHGR.G.NFPTLEMQPRQIVKVVRSRLEEK......RIG...................V---
Q86NJ5_CAEEL/50-400LAKGQMKRLRAVLEERVEIHGR.G.NFPTISTKLINLIRCLRQHMGSV......QVE...................A---
F1S1S5_PIG/9-328LTWDQVMTLDQVLNEVIPIHGR.G.NFPTLEVKPKDIIHVVKDQLIEQ......GII...................V---
E9IG33_SOLIN/73-399LSFEQVRRLNDVMNEVVSIHGR.G.NFPTLEVRLRDLVTVVRSKLETDPSNGGAGMR...................V---
W4YCY4_STRPU/13-330LSYPQVVRLDEVLTTPVAVHGR.G.NFPTLDVTLLDLVENVREKLVGS......NID...................V---
C3YH94_BRAFL/153-472LDYEQVRKLDQVLNDVVPIHGR.G.NFPTLEICLKSLVQVVRKRLEEE......GIP...................L---
H3D951_TETNG/18-337LCWDQVRRLDSILAESVPIHGR.G.NFPTLSVQPRQIVQVVRARLEER......GVA...................V---
E1FUA8_LOALO/18-327LNPAQVERLRSVLNEQVEIHGR.G.NFPTISVRLHDLIVCVRDSLRAA......GIG...................P---

PF12281

A8I451_AZOC5/134-340--------------------------------------------------------------------------------
B9JC00_AGRRK/105-319--------------------------------------------------------------------------------
A1BBC9_PARDP/103-312--------------------------------------------------------------------------------
Q126S1_POLSJ/108-319--------------------------------------------------------------------------------
Q5P6X2_AROAE/109-317--------------------------------------------------------------------------------
Q89MC1_BRADU/114-315--------------------------------------------------------------------------------
A9CH87_AGRFC/104-319--------------------------------------------------------------------------------
Q98P17_RHILO/173-382--------------------------------------------------------------------------------
Q8KKU1_RHIEC/104-319--------------------------------------------------------------------------------
N0AYX3_9RHIZ/127-330--------------------------------------------------------------------------------
B6IPR2_RHOCS/108-321--------------------------------------------------------------------------------
V5SE53_9RHIZ/102-312--------------------------------------------------------------------------------
Q9A9N3_CAUCR/103-311--------------------------------------------------------------------------------
A8LU12_DINSH/105-313--------------------------------------------------------------------------------
D6ZZH4_STAND/103-312--------------------------------------------------------------------------------
Q3IVG2_RHOS4/104-312--------------------------------------------------------------------------------
W6S626_9RHIZ/127-341--------------------------------------------------------------------------------
M4S0H4_9SPHN/98-303--------------------------------------------------------------------------------
Q3IV36_RHOS4/114-326--------------------------------------------------------------------------------
B8IY04_METNO/103-315--------------------------------------------------------------------------------
D5CPE9_SIDLE/109-318--------------------------------------------------------------------------------
B3E5Q2_GEOLS/108-317--------------------------------------------------------------------------------
A9BZ70_DELAS/2-210--------------------------------------------------------------------------------
Q12C53_POLSJ/118-324--------------------------------------------------------------------------------
Q0C240_HYPNA/104-317--------------------------------------------------------------------------------
C3KPJ9_RHISN/33-247--------------------------------------------------------------------------------
B4RE82_PHEZH/98-305--------------------------------------------------------------------------------
Q0C284_HYPNA/109-317--------------------------------------------------------------------------------
A4SVJ5_POLSQ/110-320--------------------------------------------------------------------------------
A1AK69_PELPD/13-213--------------------------------------------------------------------------------
Q930T5_RHIME/105-319--------------------------------------------------------------------------------
F2IVW1_POLGS/104-311--------------------------------------------------------------------------------
A6WWH8_OCHA4/115-328--------------------------------------------------------------------------------
C3KKL2_RHISN/104-319--------------------------------------------------------------------------------
A2SPA0_METPP/110-321--------------------------------------------------------------------------------

PF02410

E1VGT7_9GAMM/19-115--------------------------------------------------------------------------------
Q72BL7_DESVH/18-114--------------------------------------------------------------------------------
E3PRI2_CLOSD/8-104--------------------------------------------------------------------------------
E3I0D8_RHOVT/51-147--------------------------------------------------------------------------------
F8KUA6_HELBC/7-101--------------------------------------------------------------------------------
C6D5V2_PAESJ/10-106--------------------------------------------------------------------------------
G4QH00_GLANF/8-104--------------------------------------------------------------------------------
K0T8E5_THAOC/404-526--------------------------------------------------------------------------------
O86327_MYCTU/12-108--------------------------------------------------------------------------------
C7NE56_LEPBD/13-105--------------------------------------------------------------------------------
K9TU63_9CYAN/35-131--------------------------------------------------------------------------------
R7F4J7_9BACT/11-109--------------------------------------------------------------------------------
B9HIN9_POPTR/50-151--------------------------------------------------------------------------------
X5DAH5_9BACT/12-110--------------------------------------------------------------------------------
H2WNK0_CAEJA/65-168--------------------------------------------------------------------------------
Q04FE5_OENOB/8-104--------------------------------------------------------------------------------
B2GDA7_LACF3/8-104--------------------------------------------------------------------------------
R7JA64_9PORP/9-107--------------------------------------------------------------------------------
D7CWT0_TRURR/6-101--------------------------------------------------------------------------------
H2IXB4_RAHAC/8-104--------------------------------------------------------------------------------
B1ZVV9_OPITP/13-109--------------------------------------------------------------------------------
R6TBA4_9FIRM/11-107--------------------------------------------------------------------------------
B8E1S0_DICTD/12-107--------------------------------------------------------------------------------
R5A3E4_9CLOT/8-104--------------------------------------------------------------------------------
E8NE71_MICTS/12-108--------------------------------------------------------------------------------
B9DNI5_STACT/8-104--------------------------------------------------------------------------------
A9WK69_CHLAA/4-100--------------------------------------------------------------------------------
R5HDA8_9FIRM/9-105--------------------------------------------------------------------------------
C7LYC9_ACIFD/51-146--------------------------------------------------------------------------------
K4L4Y3_9FIRM/9-105--------------------------------------------------------------------------------
Q4FP42_PELUB/9-105--------------------------------------------------------------------------------
R6ESE1_9FIRM/22-118--------------------------------------------------------------------------------
A7I1F9_CAMHC/190-283--------------------------------------------------------------------------------
K9ZZD3_DEIPD/20-115--------------------------------------------------------------------------------
G0QND0_ICHMG/58-162--------------------------------------------------------------------------------
D1CCZ4_THET1/16-112--------------------------------------------------------------------------------
C7RQU7_ACCPU/8-104--------------------------------------------------------------------------------
B9GK05_POPTR/129-223--------------------------------------------------------------------------------
Q5SHF3_THET8/12-107--------------------------------------------------------------------------------
K4KHM4_SIMAS/37-132--------------------------------------------------------------------------------
R6CD09_9FIRM/15-111--------------------------------------------------------------------------------
A0ZLR5_NODSP/38-134--------------------------------------------------------------------------------
R5Q2J4_9BACT/9-107--------------------------------------------------------------------------------
A0A068XU24_ECHMU/101-202--------------------------------------------------------------------------------
D4ZSA1_ARTPN/39-134--------------------------------------------------------------------------------
G1NDG8_MELGA/5-104--------------------------------------------------------------------------------
R6QB74_9FIRM/8-103--------------------------------------------------------------------------------
F9UNR7_LACPL/8-104--------------------------------------------------------------------------------
A1SHP8_NOCSJ/12-108--------------------------------------------------------------------------------
J9W1F9_LACBU/8-104--------------------------------------------------------------------------------
Q47JQ2_DECAR/8-104--------------------------------------------------------------------------------
B2V9I4_SULSY/8-105--------------------------------------------------------------------------------
E3GLQ0_EUBLK/11-107--------------------------------------------------------------------------------
A3N2P9_ACTP2/7-103--------------------------------------------------------------------------------
A0LSX7_ACIC1/13-109--------------------------------------------------------------------------------
E0TFT9_PARBH/42-138--------------------------------------------------------------------------------
F4GJF5_SPHCD/10-107--------------------------------------------------------------------------------
D6Z191_DESAT/20-116--------------------------------------------------------------------------------
R6RRV9_9BACE/9-107--------------------------------------------------------------------------------
G0A0U8_METMM/8-104--------------------------------------------------------------------------------
C5D4V8_GEOSW/8-104--------------------------------------------------------------------------------
E6JZX0_PARDN/12-109--------------------------------------------------------------------------------
S6AAN5_9PROT/8-104--------------------------------------------------------------------------------
R7BRJ0_9ACTN/15-110--------------------------------------------------------------------------------
B4U9M4_HYDS0/5-102--------------------------------------------------------------------------------
D4J8G6_9FIRM/9-105--------------------------------------------------------------------------------
R6EX89_9BACT/9-107--------------------------------------------------------------------------------
A4VTA2_STRSY/8-104--------------------------------------------------------------------------------
T2DLB5_ALTMD/8-104--------------------------------------------------------------------------------
K9UU95_9CYAN/43-134--------------------------------------------------------------------------------
X2H6J8_9GAMM/8-103--------------------------------------------------------------------------------
F8F078_TRECH/16-112--------------------------------------------------------------------------------
G8JWM0_ERECY/86-219--------------------------------------------------------------------------------
Q73LW7_TREDE/15-110--------------------------------------------------------------------------------
R5BYH5_9FIRM/9-105--------------------------------------------------------------------------------
H6NIK1_9BACL/9-105--------------------------------------------------------------------------------
F0SVG5_SYNGF/9-105--------------------------------------------------------------------------------
R7R2A4_9FIRM/8-104--------------------------------------------------------------------------------
R7LB71_9BACT/9-107--------------------------------------------------------------------------------
E4TYH5_SULKY/6-98--------------------------------------------------------------------------------
I3WID0_BIFBI/12-110--------------------------------------------------------------------------------
G1KP02_ANOCA/11-110--------------------------------------------------------------------------------
R5RDD8_9PROT/19-114--------------------------------------------------------------------------------
F8EN32_RUNSL/16-114--------------------------------------------------------------------------------
R5SGY3_9GAMM/13-109--------------------------------------------------------------------------------
D9QBW4_CORP2/12-108--------------------------------------------------------------------------------
R5LGW6_9FIRM/6-103--------------------------------------------------------------------------------
C0R0F4_BRAHW/47-143--------------------------------------------------------------------------------
W1QI88_OGAPD/62-199--------------------------------------------------------------------------------
F9YTI3_CAPCC/14-112--------------------------------------------------------------------------------
R5YP83_9PROT/10-105--------------------------------------------------------------------------------
F9D1M0_PREDD/9-107--------------------------------------------------------------------------------
S2JP82_MUCC1/153-260--------------------------------------------------------------------------------
YM62_CAEEL/65-167--------------------------------------------------------------------------------
B5EEI2_GEOBB/16-109--------------------------------------------------------------------------------
B8I1C2_CLOCE/8-104--------------------------------------------------------------------------------
R6K4L0_9BACE/9-107--------------------------------------------------------------------------------
E6W3S5_DESIS/8-105--------------------------------------------------------------------------------
K7IQU4_NASVI/90-189--------------------------------------------------------------------------------
B7G5J9_PHATC/2-97--------------------------------------------------------------------------------
B7FPM4_PHATC/162-271--------------------------------------------------------------------------------
K9YCI5_HALP7/25-122--------------------------------------------------------------------------------
Q11XG7_CYTH3/15-113--------------------------------------------------------------------------------
A0A088A1M0_APIME/113-212--------------------------------------------------------------------------------
R5TZZ5_9FIRM/10-106--------------------------------------------------------------------------------
V4J0M6_9DELT/18-114--------------------------------------------------------------------------------
R7HB19_9FIRM/11-107--------------------------------------------------------------------------------
Q4U8K5_THEAN/211-313--------------------------------------------------------------------------------
D5X4P2_THIK1/8-104--------------------------------------------------------------------------------
F5XNG3_MICPN/12-108--------------------------------------------------------------------------------
Q6D7M0_PECAS/9-104--------------------------------------------------------------------------------
G2KW74_LACSM/8-104--------------------------------------------------------------------------------
I1XI99_METNJ/9-104--------------------------------------------------------------------------------
F4HAS9_GALAU/3-99--------------------------------------------------------------------------------
B8DJS5_DESVM/19-114--------------------------------------------------------------------------------
Q747Q6_GEOSL/15-109--------------------------------------------------------------------------------
W0RI79_9BACT/14-110--------------------------------------------------------------------------------
D6GRY3_FILAD/5-101--------------------------------------------------------------------------------
K9SPG4_9CYAN/36-131--------------------------------------------------------------------------------
A0LPG4_SYNFM/32-126--------------------------------------------------------------------------------
L0GSY4_9GAMM/8-104--------------------------------------------------------------------------------
R6GQD4_9FIRM/22-115--------------------------------------------------------------------------------
C7MPQ9_SACVD/12-108--------------------------------------------------------------------------------
S5SWN0_9CORY/13-108--------------------------------------------------------------------------------
F4PVH6_DICFS/525-623--------------------------------------------------------------------------------
W0JK56_DESAE/2-93--------------------------------------------------------------------------------
M4VFB7_9DELT/227-324--------------------------------------------------------------------------------
G8BW66_TETPH/84-227--------------------------------------------------------------------------------
B3ER25_AMOA5/16-114--------------------------------------------------------------------------------
Q3Z9G1_DEHM1/8-104--------------------------------------------------------------------------------
E6TW12_BACCJ/8-104--------------------------------------------------------------------------------
W5N0T0_LEPOC/99-198--------------------------------------------------------------------------------
D6XWC7_BACIE/8-104--------------------------------------------------------------------------------
H6RLG7_BLASD/13-108--------------------------------------------------------------------------------
ATP25_ZYGRC/85-217--------------------------------------------------------------------------------
Q3IZI6_RHOS4/3-95--------------------------------------------------------------------------------
C5CB00_MICLC/12-109--------------------------------------------------------------------------------
T1IN47_STRMM/146-245--------------------------------------------------------------------------------
W8F8R6_9BACT/15-113--------------------------------------------------------------------------------
Q1QXB2_CHRSD/8-104--------------------------------------------------------------------------------
Q7URC6_RHOBA/74-171--------------------------------------------------------------------------------
D3PKV4_MEIRD/12-108--------------------------------------------------------------------------------
Q5FRT0_GLUOX/51-147--------------------------------------------------------------------------------
H2LUV3_ORYLA/97-196--------------------------------------------------------------------------------
E3HA88_ILYPC/6-102--------------------------------------------------------------------------------
R5G8H7_9PORP/20-117--------------------------------------------------------------------------------
R5RHQ5_9FIRM/9-105--------------------------------------------------------------------------------
R5XAQ7_9FIRM/8-103--------------------------------------------------------------------------------
K7SIQ4_PROA4/13-108--------------------------------------------------------------------------------
D4H0Y6_DENA2/8-104--------------------------------------------------------------------------------
D2RNC7_ACIFV/8-104--------------------------------------------------------------------------------
R6IQY9_9CLOT/8-103--------------------------------------------------------------------------------
M3HMI8_CANMX/81-220--------------------------------------------------------------------------------
C7M7C0_CAPOD/12-111--------------------------------------------------------------------------------
R6GWL1_9FIRM/10-105--------------------------------------------------------------------------------
R6NCD6_9FIRM/5-101--------------------------------------------------------------------------------
R6A3V4_9ACTN/43-140--------------------------------------------------------------------------------
R6DIG1_9BACE/9-107--------------------------------------------------------------------------------
D3UIX0_HELM1/7-101--------------------------------------------------------------------------------
R5N925_9BACT/9-107--------------------------------------------------------------------------------
D6WL03_TRICA/57-156--------------------------------------------------------------------------------
A9V8V9_MONBE/155-258--------------------------------------------------------------------------------
R7KSJ6_9BURK/8-104--------------------------------------------------------------------------------
F9ZTY5_ACICS/9-105--------------------------------------------------------------------------------
G2LE33_CHLTF/32-127--------------------------------------------------------------------------------
Q8DY34_STRA5/8-104--------------------------------------------------------------------------------
K4IPF9_PSYTT/13-111--------------------------------------------------------------------------------
W0F3W7_9SPHI/26-124--------------------------------------------------------------------------------
G8AIT6_AZOBR/37-132--------------------------------------------------------------------------------
R6DUN9_9FIRM/8-103--------------------------------------------------------------------------------
R5AKW9_9CLOT/10-106--------------------------------------------------------------------------------
B5Y803_COPPD/2-97--------------------------------------------------------------------------------
A6QCD7_SULNB/8-101--------------------------------------------------------------------------------
D4K7J1_9FIRM/12-108--------------------------------------------------------------------------------
B6YRM7_AZOPC/12-110--------------------------------------------------------------------------------
R5QWA2_9FIRM/5-101--------------------------------------------------------------------------------
F2F3K1_SOLSS/7-103--------------------------------------------------------------------------------
E4NB25_KITSK/12-109--------------------------------------------------------------------------------
Q6A9H4_PROAC/12-108--------------------------------------------------------------------------------
Q21FD1_SACD2/8-104--------------------------------------------------------------------------------
W0EAU7_9FIRM/8-104--------------------------------------------------------------------------------
E1WYV6_HALMS/7-98--------------------------------------------------------------------------------
F0V8J6_NEOCL/449-551--------------------------------------------------------------------------------
E4TJ98_CALNY/7-103--------------------------------------------------------------------------------
D7WC86_9CORY/13-108--------------------------------------------------------------------------------
E4U6Z9_OCEP5/12-107--------------------------------------------------------------------------------
Q8NN58_CORGL/12-108--------------------------------------------------------------------------------
R7B4U9_9ACTN/13-109--------------------------------------------------------------------------------
E1ZH82_CHLVA/239-341--------------------------------------------------------------------------------
U3GY66_9CORY/12-108--------------------------------------------------------------------------------
R7IT94_9FIRM/11-107--------------------------------------------------------------------------------
D8S2B1_SELML/13-114--------------------------------------------------------------------------------
K4E5A1_TRYCR/232-326--------------------------------------------------------------------------------
F6CQD9_DESK7/10-106--------------------------------------------------------------------------------
R6KF46_9FIRM/11-107--------------------------------------------------------------------------------
I0HW02_RUBGI/8-104--------------------------------------------------------------------------------
Q8YPM4_NOSS1/37-133--------------------------------------------------------------------------------
C1EE68_MICSR/526-636--------------------------------------------------------------------------------
C5KAT1_PERM5/235-334--------------------------------------------------------------------------------
H6L6C8_SAPGL/21-119--------------------------------------------------------------------------------
G4T293_META2/8-104--------------------------------------------------------------------------------
I3UBD3_ADVKW/8-104--------------------------------------------------------------------------------
H2FY28_OCESG/8-104--------------------------------------------------------------------------------
R7CUD2_9BACE/6-104--------------------------------------------------------------------------------
J9JUC8_ACYPI/125-224--------------------------------------------------------------------------------
C0ZB11_BREBN/10-106--------------------------------------------------------------------------------
K0KVP5_WICCF/177-309--------------------------------------------------------------------------------
S6EFN2_ZYGB2/82-213--------------------------------------------------------------------------------
S9W0T4_SCHCR/94-219--------------------------------------------------------------------------------
D4JS04_9FIRM/8-104--------------------------------------------------------------------------------
G8TML0_NIAKG/49-147--------------------------------------------------------------------------------
I0K9S3_9BACT/50-148--------------------------------------------------------------------------------
A0A068NYM9_9BACT/8-103--------------------------------------------------------------------------------
Q2GCL3_NEOSM/17-109--------------------------------------------------------------------------------
Q5E6V1_VIBF1/12-106--------------------------------------------------------------------------------
D0J0H1_COMT2/20-116--------------------------------------------------------------------------------
C8WIS8_EGGLE/17-112--------------------------------------------------------------------------------
Q606I9_METCA/10-106--------------------------------------------------------------------------------
B4RD60_PHEZH/47-142--------------------------------------------------------------------------------
Q2JQ53_SYNJB/16-111--------------------------------------------------------------------------------
A6Q542_NITSB/8-101--------------------------------------------------------------------------------
G0VLT2_MEGEL/20-116--------------------------------------------------------------------------------
G8Y063_PICSO/101-239--------------------------------------------------------------------------------
Q7VRA9_BLOFL/4-100--------------------------------------------------------------------------------
H1XSE2_9BACT/8-104--------------------------------------------------------------------------------
Q47MW6_THEFY/12-109--------------------------------------------------------------------------------
F2KV42_PREDF/9-107--------------------------------------------------------------------------------
A1AVZ7_RUTMC/8-104--------------------------------------------------------------------------------
R5NMF0_9FIRM/8-104--------------------------------------------------------------------------------
E4RIQ7_HALHG/12-107--------------------------------------------------------------------------------
R5Z3M1_9FIRM/5-102--------------------------------------------------------------------------------
E8N386_ANATU/2-95--------------------------------------------------------------------------------
E3D0R6_9BACT/33-122--------------------------------------------------------------------------------
Q92BM7_LISMO/9-104--------------------------------------------------------------------------------
S6CGZ3_9GAMM/8-104--------------------------------------------------------------------------------
Q9A1F0_STRP1/16-112--------------------------------------------------------------------------------
A5G904_GEOUR/16-109--------------------------------------------------------------------------------
B3RRW9_TRIAD/91-190--------------------------------------------------------------------------------
F6EQY0_AMYSD/13-108--------------------------------------------------------------------------------
R6ALX9_9CLOT/27-123--------------------------------------------------------------------------------
E1G5L4_LOALO/54-150--------------------------------------------------------------------------------
Q5P2U1_AROAE/8-104--------------------------------------------------------------------------------
R5WH81_9DELT/389-485--------------------------------------------------------------------------------
R6SBY2_9FIRM/9-105--------------------------------------------------------------------------------
U6B5K9_9RHIZ/20-117--------------------------------------------------------------------------------
D1BM92_VEIPT/13-109--------------------------------------------------------------------------------
B8IEM3_METNO/6-98--------------------------------------------------------------------------------
A1SU09_PSYIN/8-104--------------------------------------------------------------------------------
K8GKE5_9CYAN/32-128--------------------------------------------------------------------------------
Q2N6F3_ERYLH/12-107--------------------------------------------------------------------------------
A3QH51_SHELP/14-110--------------------------------------------------------------------------------
C4Z098_EUBE2/9-105--------------------------------------------------------------------------------
D3EQN9_ATETH/15-112--------------------------------------------------------------------------------
E6U7Y1_ETHHY/22-118--------------------------------------------------------------------------------
G0GDI3_SPITZ/12-109--------------------------------------------------------------------------------
K9Q2R2_9CYAN/18-114--------------------------------------------------------------------------------
E0W225_PEDHC/107-206--------------------------------------------------------------------------------
I0I1R8_CALAS/2-97--------------------------------------------------------------------------------
E0RUY2_BUTPB/13-108--------------------------------------------------------------------------------
D5UTC0_TSUPD/14-108--------------------------------------------------------------------------------
D4M5X8_9FIRM/9-105--------------------------------------------------------------------------------
B1H031_UNCTG/11-107--------------------------------------------------------------------------------
A6LNB0_THEM4/5-101--------------------------------------------------------------------------------
G2SP30_LACRR/8-104--------------------------------------------------------------------------------
Q3IJ97_PSEHT/8-104--------------------------------------------------------------------------------
R5EE57_9GAMM/8-104--------------------------------------------------------------------------------
R6DH31_9CLOT/8-104--------------------------------------------------------------------------------
Q12QY1_SHEDO/9-104--------------------------------------------------------------------------------
IOJAP_ZYMMO/21-117--------------------------------------------------------------------------------
Q0VN47_ALCBS/9-105--------------------------------------------------------------------------------
Q8DJK1_THEEB/29-125--------------------------------------------------------------------------------
G0IXL6_CYCMS/8-106--------------------------------------------------------------------------------
E6WZ07_NITSE/8-101--------------------------------------------------------------------------------
W4YD31_STRPU/344-443--------------------------------------------------------------------------------
D7BBA8_MEISD/14-107--------------------------------------------------------------------------------
X2H7X0_9NEIS/15-110--------------------------------------------------------------------------------
G6D1G9_DANPL/107-206--------------------------------------------------------------------------------
Q2G298_STAA8/8-104--------------------------------------------------------------------------------
H8KN20_SOLCM/15-113--------------------------------------------------------------------------------
F6AEU5_PSEF1/13-109--------------------------------------------------------------------------------
A8Y3I6_CAEBR/59-161--------------------------------------------------------------------------------
L0KBB8_HALHC/16-107--------------------------------------------------------------------------------
F8E7X1_FLESM/8-104--------------------------------------------------------------------------------
Q3A1E2_PELCD/9-105--------------------------------------------------------------------------------
D5EEJ0_AMICL/14-107--------------------------------------------------------------------------------
K9XKK1_9CHRO/37-133--------------------------------------------------------------------------------
O51725_BORBU/11-108--------------------------------------------------------------------------------
B0SRU3_LEPBP/13-113--------------------------------------------------------------------------------
J7QF24_METSZ/35-131--------------------------------------------------------------------------------
R6BA50_9CLOT/8-104--------------------------------------------------------------------------------
D3SLN3_THEAH/7-102--------------------------------------------------------------------------------
Q2GLC3_ANAPZ/10-104--------------------------------------------------------------------------------
F2N7T7_CORGP/47-144--------------------------------------------------------------------------------
Q7VJ93_HELHP/11-105--------------------------------------------------------------------------------
A8LKJ3_DINSH/8-103--------------------------------------------------------------------------------
U5QDK7_9CYAN/13-109--------------------------------------------------------------------------------
R5CBV8_9BACE/9-107--------------------------------------------------------------------------------
U3K4T0_FICAL/9-108--------------------------------------------------------------------------------
D2VAH7_NAEGR/112-210--------------------------------------------------------------------------------
B3EK36_CHLPB/27-123--------------------------------------------------------------------------------
D8LM97_ECTSI/43-138--------------------------------------------------------------------------------
K9WGD2_9CYAN/28-124--------------------------------------------------------------------------------
F2NRK4_TRES6/11-108--------------------------------------------------------------------------------
G4Q705_ACIIR/8-105--------------------------------------------------------------------------------
C5BNN1_TERTT/7-103--------------------------------------------------------------------------------
J9Z794_LEPFM/48-141--------------------------------------------------------------------------------
R7KVA5_9FIRM/8-104--------------------------------------------------------------------------------
F2JQX0_CELLD/10-106--------------------------------------------------------------------------------
A3LQS7_PICST/33-171--------------------------------------------------------------------------------
R6GPR7_9CLOT/8-100--------------------------------------------------------------------------------
C7R7J9_KANKD/8-104--------------------------------------------------------------------------------
Q0ABM8_ALKEH/14-109--------------------------------------------------------------------------------
R7GK75_9CLOT/203-298--------------------------------------------------------------------------------
W0J190_9BACT/16-112--------------------------------------------------------------------------------
R7HV95_9CLOT/13-109--------------------------------------------------------------------------------
T2GFT8_DESGI/18-114--------------------------------------------------------------------------------
R6UIY6_9FIRM/6-102--------------------------------------------------------------------------------
K9RW58_SYNP3/23-119--------------------------------------------------------------------------------
R6VTB1_9FIRM/16-113--------------------------------------------------------------------------------
N0B789_9RHIZ/47-143--------------------------------------------------------------------------------
W0DX52_9GAMM/8-104--------------------------------------------------------------------------------
Q24SP4_DESHY/10-104--------------------------------------------------------------------------------
U6GU24_EIMAC/436-549--------------------------------------------------------------------------------
T0VFU6_9STRE/8-104--------------------------------------------------------------------------------
G8BC02_CANPC/81-218--------------------------------------------------------------------------------
A9KMF1_CLOPH/10-106--------------------------------------------------------------------------------
B8IY74_DESDA/31-127--------------------------------------------------------------------------------
F2I3K1_PELSM/11-107--------------------------------------------------------------------------------
R6S9M8_9FIRM/7-102--------------------------------------------------------------------------------
G8PDQ2_PEDCP/8-104--------------------------------------------------------------------------------
A0LCY9_MAGMM/19-115--------------------------------------------------------------------------------
R7XYP9_9ACTN/12-108--------------------------------------------------------------------------------
C6BY18_DESAD/18-114--------------------------------------------------------------------------------
A5WCA7_PSYWF/21-117--------------------------------------------------------------------------------
R6ZB75_9CLOT/9-105--------------------------------------------------------------------------------
X2GYY9_9BACI/7-103--------------------------------------------------------------------------------
A0A068X2K5_HYMMI/99-199--------------------------------------------------------------------------------
Q5M321_STRT2/8-104--------------------------------------------------------------------------------
K9W317_9CYAN/28-124--------------------------------------------------------------------------------
C9RAT7_AMMDK/8-104--------------------------------------------------------------------------------
Q31RX3_SYNE7/23-118--------------------------------------------------------------------------------
E2ABW0_CAMFO/117-216--------------------------------------------------------------------------------
B7ZSU4_XENTR/104-203--------------------------------------------------------------------------------
E6S731_INTC7/12-108--------------------------------------------------------------------------------
J9RNQ7_9ACTN/12-108--------------------------------------------------------------------------------
Q74ID2_LACJO/14-110--------------------------------------------------------------------------------
R5PG49_9CLOT/8-104--------------------------------------------------------------------------------
C3M9Y3_RHISN/41-137--------------------------------------------------------------------------------
K9RB59_9CYAN/38-135--------------------------------------------------------------------------------
Q4Y4A2_PLACH/249-351--------------------------------------------------------------------------------
R5SL59_9FIRM/6-102--------------------------------------------------------------------------------
A9NGN0_ACHLI/5-95--------------------------------------------------------------------------------
I3YSI4_AEQSU/13-111--------------------------------------------------------------------------------
R5VE54_9BACE/9-107--------------------------------------------------------------------------------
F7QH28_9BRAD/22-118--------------------------------------------------------------------------------
D3PE18_DEFDS/5-102--------------------------------------------------------------------------------
Q3J7T3_NITOC/8-104--------------------------------------------------------------------------------
R5K9K4_9CLOT/9-105--------------------------------------------------------------------------------
O67309_AQUAE/5-101--------------------------------------------------------------------------------
E2C2S6_HARSA/121-220--------------------------------------------------------------------------------
ATP25_LACTC/125-266--------------------------------------------------------------------------------
Q3ANY6_CHLCH/23-120--------------------------------------------------------------------------------
R7JTP2_9FIRM/9-105--------------------------------------------------------------------------------
D9R139_CLOSW/9-105--------------------------------------------------------------------------------
E3F1H1_KETVY/62-158--------------------------------------------------------------------------------
I2H8T5_TETBL/114-252--------------------------------------------------------------------------------
C4LJT9_CORK4/12-108--------------------------------------------------------------------------------
B7JXB1_CYAP8/32-128--------------------------------------------------------------------------------
B0RDF7_CLAMS/12-108--------------------------------------------------------------------------------
X5DNJ2_9CORY/13-108--------------------------------------------------------------------------------
B2IKW2_BEII9/21-117--------------------------------------------------------------------------------
Q9CJS0_PASMU/6-102--------------------------------------------------------------------------------
E2SB72_9ACTN/12-108--------------------------------------------------------------------------------
Q10VW4_TRIEI/29-126--------------------------------------------------------------------------------
A6WDM3_KINRD/18-114--------------------------------------------------------------------------------
I4A2C0_ORNRL/11-109--------------------------------------------------------------------------------
I2EQ24_EMTOG/14-112--------------------------------------------------------------------------------
S5XVR4_PARAH/2-98--------------------------------------------------------------------------------
E1SSX4_FERBD/9-104--------------------------------------------------------------------------------
D5AKK2_RHOCB/55-151--------------------------------------------------------------------------------
F0SS65_RUBBR/56-150--------------------------------------------------------------------------------
R5X7F3_9CLOT/8-104--------------------------------------------------------------------------------
E1R019_OLSUV/10-107--------------------------------------------------------------------------------
D5SVA3_PLAL2/30-124--------------------------------------------------------------------------------
R6GP78_9FIRM/10-106--------------------------------------------------------------------------------
R6XQE4_9FIRM/9-105--------------------------------------------------------------------------------
B7KCB2_CYAP7/31-128--------------------------------------------------------------------------------
B9E6Y1_MACCJ/11-107--------------------------------------------------------------------------------
R5GKV6_9FIRM/8-104--------------------------------------------------------------------------------
A0RQT7_CAMFF/6-99--------------------------------------------------------------------------------
A8F8G2_PSELT/2-95--------------------------------------------------------------------------------
Q9WXZ4_THEMA/6-102--------------------------------------------------------------------------------
R6QEW5_9FIRM/9-105--------------------------------------------------------------------------------
F8C4U4_THEGP/8-104--------------------------------------------------------------------------------
I4DAU1_DESAJ/9-106--------------------------------------------------------------------------------
F4EZF2_SELS3/10-107--------------------------------------------------------------------------------
R6EX51_9BACT/10-108--------------------------------------------------------------------------------
C7Q898_CATAD/13-108--------------------------------------------------------------------------------
Q31IE2_THICR/10-105--------------------------------------------------------------------------------
B0C3C4_ACAM1/29-124--------------------------------------------------------------------------------
R5GV36_9BACT/9-107--------------------------------------------------------------------------------
Q2RV08_RHORT/3-98--------------------------------------------------------------------------------
I0DX27_PROSM/8-104--------------------------------------------------------------------------------
R5FJ79_9ACTN/20-115--------------------------------------------------------------------------------
F7V655_CLOSS/202-298--------------------------------------------------------------------------------
IOJAM_ARATH/49-148--------------------------------------------------------------------------------
E1R6B7_SPISS/8-103--------------------------------------------------------------------------------
D1AUY8_STRM9/6-98--------------------------------------------------------------------------------
W5W1D7_9PSEU/13-108--------------------------------------------------------------------------------
F2JXD4_MARM1/8-105--------------------------------------------------------------------------------
R5Q0E4_9PROT/67-162--------------------------------------------------------------------------------
A1BJS1_CHLPD/26-122--------------------------------------------------------------------------------
F9Z618_ODOSD/9-107--------------------------------------------------------------------------------
B5YGK3_THEYD/10-104--------------------------------------------------------------------------------
D6ZGB4_MOBCV/15-108--------------------------------------------------------------------------------
Q2SA29_HAHCH/8-104--------------------------------------------------------------------------------
C7R5L6_JONDD/13-108--------------------------------------------------------------------------------
R5YKL7_9FIRM/8-104--------------------------------------------------------------------------------
C1FH80_MICSR/4-102--------------------------------------------------------------------------------
C4XU12_DESMR/17-113--------------------------------------------------------------------------------
ATP25_CANAL/82-221--------------------------------------------------------------------------------
R7F936_9CLOT/7-103--------------------------------------------------------------------------------
Q1H3S4_METFK/10-105--------------------------------------------------------------------------------
E4TS81_MARTH/27-125--------------------------------------------------------------------------------
C5X4I8_SORBI/118-211--------------------------------------------------------------------------------
B1XIK5_SYNP2/18-114--------------------------------------------------------------------------------
Q8RBA1_CALS4/10-105--------------------------------------------------------------------------------
Q87RQ3_VIBPA/9-104--------------------------------------------------------------------------------
E8R1R1_ISOPI/52-148--------------------------------------------------------------------------------
Q3AF31_CARHZ/10-106--------------------------------------------------------------------------------
A3I392_9BACT/8-106--------------------------------------------------------------------------------
Q7VC47_PROMA/8-105--------------------------------------------------------------------------------
R5HDA5_9FIRM/9-104--------------------------------------------------------------------------------
F2IFG0_FLUTR/25-123--------------------------------------------------------------------------------
Q8F6E4_LEPIN/16-115--------------------------------------------------------------------------------
C3YER5_BRAFL/19-118--------------------------------------------------------------------------------
E4WVJ5_OIKDI/92-192--------------------------------------------------------------------------------
R5IZX4_9FIRM/10-105--------------------------------------------------------------------------------
I6X5U0_PROPF/12-109--------------------------------------------------------------------------------
I0IB03_PHYMF/45-140--------------------------------------------------------------------------------
A1AV34_PELPD/21-115--------------------------------------------------------------------------------
B6ITL0_RHOCS/33-127--------------------------------------------------------------------------------
E8WVY3_GRATM/12-108--------------------------------------------------------------------------------
A4G2M3_HERAR/8-104--------------------------------------------------------------------------------
R5SG81_9BACE/7-105--------------------------------------------------------------------------------
V5WI46_9SPIO/20-117--------------------------------------------------------------------------------
D7GCX0_PROFC/12-108--------------------------------------------------------------------------------
D5EVB2_PRER2/6-104--------------------------------------------------------------------------------
F8ADL0_THEID/24-120--------------------------------------------------------------------------------
Q9CIX8_LACLA/8-105--------------------------------------------------------------------------------
Q4FV91_PSYA2/15-111--------------------------------------------------------------------------------
A7HJX7_FERNB/2-95--------------------------------------------------------------------------------
G8XAX0_FLACA/13-111--------------------------------------------------------------------------------
R5MJL8_9FIRM/8-103--------------------------------------------------------------------------------
Q3B6P4_PELLD/26-122--------------------------------------------------------------------------------
A0CFH5_PARTE/123-260--------------------------------------------------------------------------------
D3SCP4_THISK/8-104--------------------------------------------------------------------------------
R6PRZ7_9FIRM/13-109--------------------------------------------------------------------------------
K9VMY5_9CYAN/30-127--------------------------------------------------------------------------------
D4KXG1_9FIRM/8-104--------------------------------------------------------------------------------
R5L7P0_9SPIR/27-124--------------------------------------------------------------------------------
ATP25_DEBHA/109-247--------------------------------------------------------------------------------
R5SKZ4_9CLOT/9-105--------------------------------------------------------------------------------
E1VB18_HALED/20-116--------------------------------------------------------------------------------
B2A6C1_NATTJ/9-106--------------------------------------------------------------------------------
I3TPX1_TISMK/24-120--------------------------------------------------------------------------------
A1WYZ2_HALHL/9-105--------------------------------------------------------------------------------
R7I4F9_9BURK/8-104--------------------------------------------------------------------------------
Q6LN95_PHOPR/8-104--------------------------------------------------------------------------------
C8WQ80_ALIAD/10-106--------------------------------------------------------------------------------
R7N5Q1_9FIRM/15-110--------------------------------------------------------------------------------
R6LSF0_9CLOT/9-105--------------------------------------------------------------------------------
I1ITD6_BRADI/41-146--------------------------------------------------------------------------------
D1AZJ0_SULD5/185-278--------------------------------------------------------------------------------
M0TAY3_MUSAM/51-152--------------------------------------------------------------------------------
D8PC97_9BACT/12-107--------------------------------------------------------------------------------
A6TQK2_ALKMQ/10-106--------------------------------------------------------------------------------
I3MWU9_SPETR/40-139--------------------------------------------------------------------------------
A4SWG8_POLSQ/8-104--------------------------------------------------------------------------------
Q7MS87_WOLSU/155-248--------------------------------------------------------------------------------
D7CP02_SYNLT/8-104--------------------------------------------------------------------------------
R6ERE3_9FIRM/11-104--------------------------------------------------------------------------------
C6XL35_HIRBI/12-108--------------------------------------------------------------------------------
I1BWL4_RHIO9/123-222--------------------------------------------------------------------------------
G1X0K2_ARTOA/334-462--------------------------------------------------------------------------------
K9SQI6_9SYNE/18-112--------------------------------------------------------------------------------
B2KD55_ELUMP/10-104--------------------------------------------------------------------------------
I0AM81_IGNAJ/8-104--------------------------------------------------------------------------------
ATP25_VANPO/109-251--------------------------------------------------------------------------------
M1C016_SOLTU/116-211--------------------------------------------------------------------------------
R5QB53_9BURK/8-104--------------------------------------------------------------------------------
L0ES52_LIBCB/10-105--------------------------------------------------------------------------------
Q1QQT5_NITHX/14-110--------------------------------------------------------------------------------
B1VGL5_CORU7/24-120--------------------------------------------------------------------------------
R7MR88_9FIRM/8-104--------------------------------------------------------------------------------
ATP25_CANGA/122-262--------------------------------------------------------------------------------
R7NQG0_9FIRM/8-104--------------------------------------------------------------------------------
R7K4Z6_9CLOT/10-105--------------------------------------------------------------------------------
G8UKS2_TANFA/9-107--------------------------------------------------------------------------------
B8ENA7_METSB/40-135--------------------------------------------------------------------------------
F6GD04_LACS5/13-111--------------------------------------------------------------------------------
R6HRJ9_9PROT/15-110--------------------------------------------------------------------------------
D1BA22_THEAS/33-122--------------------------------------------------------------------------------
C7PFY2_CHIPD/25-123--------------------------------------------------------------------------------
Q0BRE4_GRABC/97-192--------------------------------------------------------------------------------
R5IBC6_9PORP/9-107--------------------------------------------------------------------------------
H2AMA4_KAZAF/78-205--------------------------------------------------------------------------------
A7IH11_XANP2/41-137--------------------------------------------------------------------------------
H6LK21_ACEWD/11-107--------------------------------------------------------------------------------
E4T8D0_PALPW/9-107--------------------------------------------------------------------------------
D9S2B0_THEOJ/12-106--------------------------------------------------------------------------------
R6PP02_9FIRM/8-104--------------------------------------------------------------------------------
R6UG98_9CLOT/8-104--------------------------------------------------------------------------------
V5SFF4_9RHIZ/29-125--------------------------------------------------------------------------------
D7B3J7_NOCDD/12-109--------------------------------------------------------------------------------
F6IFE3_9SPHN/10-106--------------------------------------------------------------------------------
R5EVV3_9FIRM/10-105--------------------------------------------------------------------------------
K9YL55_CYASC/31-127--------------------------------------------------------------------------------
H3GI95_PHYRM/159-258--------------------------------------------------------------------------------
F7BHS5_ORNAN/46-145--------------------------------------------------------------------------------
C1A7N4_GEMAT/16-110--------------------------------------------------------------------------------
F4NTG8_BATDJ/276-378--------------------------------------------------------------------------------
F8KZF8_PARAV/10-105--------------------------------------------------------------------------------
D0MDZ8_RHOM4/26-123--------------------------------------------------------------------------------
D9QV64_ACEAZ/9-106--------------------------------------------------------------------------------
ATP25_SCHPO/93-216--------------------------------------------------------------------------------
E6X7D5_CELAD/13-111--------------------------------------------------------------------------------
A8EWM1_ARCB4/6-99--------------------------------------------------------------------------------
W0EUD9_9PORP/8-106--------------------------------------------------------------------------------
Q9HX22_PSEAE/8-104--------------------------------------------------------------------------------
B3E3Q9_GEOLS/19-113--------------------------------------------------------------------------------
C1F5X5_ACIC5/12-108--------------------------------------------------------------------------------
F0JEE6_DESDE/18-114--------------------------------------------------------------------------------
K0B0C3_CLOA9/6-102--------------------------------------------------------------------------------
D3FXJ1_BACPE/8-104--------------------------------------------------------------------------------
F2J6T6_POLGS/21-117--------------------------------------------------------------------------------
R7ESF0_9FIRM/20-117--------------------------------------------------------------------------------
B9KGM7_ANAMF/15-109--------------------------------------------------------------------------------
R5E2B8_9FIRM/11-107--------------------------------------------------------------------------------
Q98EZ9_RHILO/18-114--------------------------------------------------------------------------------
G8PNV7_PSEUV/27-123--------------------------------------------------------------------------------
R5CEC3_9FIRM/12-108--------------------------------------------------------------------------------
N0B340_9BACI/8-104--------------------------------------------------------------------------------
E8SIE5_STAPH/9-104--------------------------------------------------------------------------------
D8LLX7_ECTSI/95-196--------------------------------------------------------------------------------
R6R4Z7_9CLOT/8-104--------------------------------------------------------------------------------
Q2YC52_NITMU/8-104--------------------------------------------------------------------------------
Q2IMF9_ANADE/3-97--------------------------------------------------------------------------------
R7G449_9PROT/8-104--------------------------------------------------------------------------------
F4LVY7_TEPAE/11-106--------------------------------------------------------------------------------
A6L1N1_BACV8/9-107--------------------------------------------------------------------------------
R5RZ49_9FIRM/10-105--------------------------------------------------------------------------------
R7C9H6_9CLOT/10-106--------------------------------------------------------------------------------
Q5WHH8_BACSK/6-102--------------------------------------------------------------------------------
Q6AJX9_DESPS/18-114--------------------------------------------------------------------------------
I4AHE2_FLELS/14-112--------------------------------------------------------------------------------
R7BM01_9FIRM/8-104--------------------------------------------------------------------------------
L0G1E7_ECHVK/8-106--------------------------------------------------------------------------------
W5KWU5_ASTMX/92-191--------------------------------------------------------------------------------
I7F098_PHAIB/14-110--------------------------------------------------------------------------------
I0JP65_HALH3/8-104--------------------------------------------------------------------------------
W1PUX9_AMBTC/52-153--------------------------------------------------------------------------------
R7AP40_9CLOT/8-104--------------------------------------------------------------------------------
D3F9N1_CONWI/13-110--------------------------------------------------------------------------------
Q46LB2_PROMT/8-105--------------------------------------------------------------------------------
R6PCX2_9CLOT/9-105--------------------------------------------------------------------------------
ATP25_KLULA/73-205--------------------------------------------------------------------------------
G8LV07_CLOCD/8-104--------------------------------------------------------------------------------
C8WAH7_ATOPD/10-107--------------------------------------------------------------------------------
R6XRX2_9FIRM/7-99--------------------------------------------------------------------------------
B8FMU2_DESAA/13-106--------------------------------------------------------------------------------
R6VXF1_9BACT/3-101--------------------------------------------------------------------------------
E1QJM4_DESB2/22-118--------------------------------------------------------------------------------
A5UYA6_ROSS1/19-115--------------------------------------------------------------------------------
E3MG32_CAERE/60-163--------------------------------------------------------------------------------
R7FMH5_9CLOT/6-100--------------------------------------------------------------------------------
H2J515_MARPK/14-110--------------------------------------------------------------------------------
E6SKC0_THEM7/9-104--------------------------------------------------------------------------------
B3PKN0_CELJU/18-114--------------------------------------------------------------------------------
A4S573_OSTLU/206-310--------------------------------------------------------------------------------
C6W7P7_DYAFD/16-114--------------------------------------------------------------------------------
R6I0A5_9FIRM/9-105--------------------------------------------------------------------------------
E8T3G4_THEA1/8-104--------------------------------------------------------------------------------
Q03VE9_LEUMM/13-109--------------------------------------------------------------------------------
Q310U3_DESAG/19-115--------------------------------------------------------------------------------
R6W6Y8_9BACT/9-107--------------------------------------------------------------------------------
Q30PQ1_SULDN/6-98--------------------------------------------------------------------------------
R5CLL0_9BACT/9-107--------------------------------------------------------------------------------
F0NZC4_WEEVC/12-110--------------------------------------------------------------------------------
K9S5F4_9CYAN/37-134--------------------------------------------------------------------------------
C9R6R0_AGGAD/5-101--------------------------------------------------------------------------------
R5HU75_9FIRM/12-108--------------------------------------------------------------------------------
R5Q081_9FIRM/19-115--------------------------------------------------------------------------------
R5FP90_9FIRM/5-101--------------------------------------------------------------------------------
A3DEU1_CLOTH/8-104--------------------------------------------------------------------------------
Q1G9B8_LACDA/8-104--------------------------------------------------------------------------------
A4VR05_PSEU5/8-104--------------------------------------------------------------------------------
H8MPB9_CORCM/74-172--------------------------------------------------------------------------------
Q0AKW8_MARMM/39-134--------------------------------------------------------------------------------
U5T5I4_9GAMM/14-109--------------------------------------------------------------------------------
F0S0T6_DESTD/8-104--------------------------------------------------------------------------------
O25960_HELPY/6-100--------------------------------------------------------------------------------
M9R1R3_9RHOB/46-142--------------------------------------------------------------------------------
F5YJG7_TREPZ/15-111--------------------------------------------------------------------------------
R6DEK3_9CLOT/9-105--------------------------------------------------------------------------------
Q65H38_BACLD/8-104--------------------------------------------------------------------------------
R7FAW8_9FIRM/8-105--------------------------------------------------------------------------------
F3Z458_DESAF/57-153--------------------------------------------------------------------------------
D3PVY5_STANL/13-109--------------------------------------------------------------------------------
I2F216_9BACT/14-110--------------------------------------------------------------------------------
Q2RKZ2_MOOTA/8-104--------------------------------------------------------------------------------
S5RPA2_9PROT/9-104--------------------------------------------------------------------------------
R5PUQ2_9BACT/9-107--------------------------------------------------------------------------------
H1YG85_9SPHI/15-113--------------------------------------------------------------------------------
R6G428_9FIRM/10-105--------------------------------------------------------------------------------
D7BPC9_ARCHD/13-109--------------------------------------------------------------------------------
K9P3M8_CYAGP/9-105--------------------------------------------------------------------------------
B0JP67_MICAN/22-119--------------------------------------------------------------------------------
Q03RL2_LACBA/8-104--------------------------------------------------------------------------------
H0UKA1_9BACT/11-106--------------------------------------------------------------------------------
K4LK74_THEPS/10-105--------------------------------------------------------------------------------
D6ZEV6_SEGRD/12-108--------------------------------------------------------------------------------
K9Z2B7_CYAAP/30-126--------------------------------------------------------------------------------
D4KFF0_9FIRM/10-106--------------------------------------------------------------------------------
R6C1U9_9CLOT/11-107--------------------------------------------------------------------------------
E9FU74_DAPPU/58-157--------------------------------------------------------------------------------
C7MN28_CRYCD/14-110--------------------------------------------------------------------------------
M5E773_9GAMM/8-104--------------------------------------------------------------------------------
F6ZF75_MONDO/81-180--------------------------------------------------------------------------------
R5K116_9CLOT/8-104--------------------------------------------------------------------------------
O84774_CHLTR/10-106--------------------------------------------------------------------------------
D2PUU4_KRIFD/12-109--------------------------------------------------------------------------------
R5B5K2_9FIRM/9-105--------------------------------------------------------------------------------
D6YRN1_WADCW/10-106--------------------------------------------------------------------------------
K0J7A3_AMPXN/8-104--------------------------------------------------------------------------------
Q0P8K9_CAMJE/6-99--------------------------------------------------------------------------------
R5DCD6_9FIRM/9-105--------------------------------------------------------------------------------
R7CNP0_9FIRM/6-102--------------------------------------------------------------------------------
D1AAX1_THECD/12-109--------------------------------------------------------------------------------
B7Q172_IXOSC/85-184--------------------------------------------------------------------------------
B8C8G7_THAPS/1-100--------------------------------------------------------------------------------
A5EVS4_DICNV/8-104--------------------------------------------------------------------------------
Q7CW98_AGRFC/55-151--------------------------------------------------------------------------------
A7MK38_CROS8/88-183--------------------------------------------------------------------------------
F4CD17_SPHS2/15-113--------------------------------------------------------------------------------
J9R497_RIEAN/12-110--------------------------------------------------------------------------------
K9UMC3_9CHRO/24-120--------------------------------------------------------------------------------
Q7V1P0_PROMP/9-105--------------------------------------------------------------------------------
R5ALT6_9BACT/11-109--------------------------------------------------------------------------------
R5QK94_9FIRM/9-105--------------------------------------------------------------------------------
Q38VU1_LACSS/8-104--------------------------------------------------------------------------------
H9UK90_SPIAZ/16-113--------------------------------------------------------------------------------
G2TNI2_BACCO/8-104--------------------------------------------------------------------------------
Q6MBT6_PARUW/10-106--------------------------------------------------------------------------------
R6A7V5_9CLOT/34-124--------------------------------------------------------------------------------
L0DJT1_SINAD/58-154--------------------------------------------------------------------------------
B2FPR3_STRMK/26-122--------------------------------------------------------------------------------
A7HT63_PARL1/61-157--------------------------------------------------------------------------------
F9VG82_LACGL/8-105--------------------------------------------------------------------------------
Q2YLI9_BRUA2/7-102--------------------------------------------------------------------------------
B0VG47_CLOAI/9-104--------------------------------------------------------------------------------
C6XXK3_PEDHD/15-113--------------------------------------------------------------------------------
D9SD71_GALCS/10-105--------------------------------------------------------------------------------
B0UVQ4_HISS2/5-101--------------------------------------------------------------------------------
Q8XXC1_RALSO/8-104--------------------------------------------------------------------------------
U5N9D4_9BURK/23-119--------------------------------------------------------------------------------
B2GGE5_KOCRD/13-109--------------------------------------------------------------------------------
R5B495_9CLOT/22-117--------------------------------------------------------------------------------
B1YKR7_EXIS2/8-104--------------------------------------------------------------------------------
R6Z4U4_9FIRM/8-104--------------------------------------------------------------------------------
R7FU76_9FIRM/9-105--------------------------------------------------------------------------------
Q2RZI5_SALRD/27-124--------------------------------------------------------------------------------
G2J1W2_PSEUL/8-104--------------------------------------------------------------------------------
B7J9S2_ACIF2/10-105--------------------------------------------------------------------------------
R5WGL8_9BACT/6-104--------------------------------------------------------------------------------
G2IMP8_9SPHN/35-130--------------------------------------------------------------------------------
Q087K6_SHEFN/8-104--------------------------------------------------------------------------------
IOJAP_SYNY3/32-129--------------------------------------------------------------------------------
M4AHS6_XIPMA/111-210--------------------------------------------------------------------------------
G8ZLS5_TORDC/62-203--------------------------------------------------------------------------------
Q6F840_ACIAD/13-109--------------------------------------------------------------------------------
A4HIE4_LEIBR/27-122--------------------------------------------------------------------------------
C9RLC6_FIBSS/18-111--------------------------------------------------------------------------------
F5Y7D3_TREAZ/5-100--------------------------------------------------------------------------------
A9ITN4_BORPD/8-104--------------------------------------------------------------------------------
R7LCG4_9BACT/75-171--------------------------------------------------------------------------------
B9KZU5_THERP/16-113--------------------------------------------------------------------------------
R6BS45_9BACT/9-107--------------------------------------------------------------------------------
Q22U76_TETTS/206-310--------------------------------------------------------------------------------
Q7V7C5_PROMM/12-109--------------------------------------------------------------------------------
A6LD24_PARD8/9-107--------------------------------------------------------------------------------
V4JHI0_9GAMM/9-105--------------------------------------------------------------------------------
R9YKS2_9PROT/5-99--------------------------------------------------------------------------------
B0TBV4_HELMI/10-106--------------------------------------------------------------------------------
R7PRI7_9FIRM/6-102--------------------------------------------------------------------------------
R6TPV4_9STAP/7-99--------------------------------------------------------------------------------
R5AYU7_9BACE/9-107--------------------------------------------------------------------------------
C5CEP8_KOSOT/6-102--------------------------------------------------------------------------------
G4UJS9_NEUT9/132-292--------------------------------------------------------------------------------
G0N093_CAEBE/60-162--------------------------------------------------------------------------------
A4J7H3_DESRM/10-106--------------------------------------------------------------------------------
G8QZC8_OWEHD/15-113--------------------------------------------------------------------------------
E8UCD5_TAYEM/8-104--------------------------------------------------------------------------------
R7BSA0_9FIRM/8-104--------------------------------------------------------------------------------
R7QW75_9FIRM/9-105--------------------------------------------------------------------------------
B1WTU4_CYAA5/32-128--------------------------------------------------------------------------------
F0QZ30_BACSH/9-107--------------------------------------------------------------------------------
R5VK80_9CLOT/10-106--------------------------------------------------------------------------------
I7HEH2_9HELI/17-111--------------------------------------------------------------------------------
A1A1R8_BIFAA/12-110--------------------------------------------------------------------------------
ATP25_ASHGO/88-221--------------------------------------------------------------------------------
F4KXS4_HALH1/20-117--------------------------------------------------------------------------------
A5D414_PELTS/10-106--------------------------------------------------------------------------------
R6NC63_9CLOT/8-104--------------------------------------------------------------------------------
Q83DY7_COXBU/8-104--------------------------------------------------------------------------------
W0BD95_9GAMM/9-105--------------------------------------------------------------------------------
Q6MGS6_BDEBA/227-324--------------------------------------------------------------------------------
D3E4X0_GEOS4/10-106--------------------------------------------------------------------------------
A6VM71_ACTSZ/7-103--------------------------------------------------------------------------------
R7A8R3_9FIRM/5-102--------------------------------------------------------------------------------
F8L9P7_SIMNZ/11-106--------------------------------------------------------------------------------
I4B2F1_TURPD/18-115--------------------------------------------------------------------------------
C7N5Z8_SLAHD/15-111--------------------------------------------------------------------------------
C5C3Y0_BEUC1/13-108--------------------------------------------------------------------------------
C7LNN2_DESBD/6-102--------------------------------------------------------------------------------
R4LD67_9ACTN/13-110--------------------------------------------------------------------------------
C7MDI1_BRAFD/13-109--------------------------------------------------------------------------------
R6ZYM4_9FIRM/13-107--------------------------------------------------------------------------------
R4FM08_RHOPR/97-195--------------------------------------------------------------------------------
G0HCC1_CORVD/13-109--------------------------------------------------------------------------------
Q1IVS3_KORVE/11-108--------------------------------------------------------------------------------
W5XR92_9CORY/12-108--------------------------------------------------------------------------------
C4LCB5_TOLAT/8-104--------------------------------------------------------------------------------
I0GK03_CALEA/17-113--------------------------------------------------------------------------------
R6SD79_9CLOT/3-99--------------------------------------------------------------------------------
E7AAH6_HELFC/7-101--------------------------------------------------------------------------------
C8X2A5_DESRD/21-115--------------------------------------------------------------------------------
Q5ZVR3_LEGPH/9-105--------------------------------------------------------------------------------
F4LQI7_TREBD/10-107--------------------------------------------------------------------------------
D4J3C3_BUTFI/8-104--------------------------------------------------------------------------------
K9TF10_9CYAN/32-128--------------------------------------------------------------------------------
Q3SG63_THIDA/8-104--------------------------------------------------------------------------------
R7IGE6_9FIRM/8-104--------------------------------------------------------------------------------
Q82C74_STRAW/12-109--------------------------------------------------------------------------------
K9XVN0_STAC7/31-127--------------------------------------------------------------------------------
K4J0M5_BIFAP/12-109--------------------------------------------------------------------------------
D3DJ79_HYDTT/6-102--------------------------------------------------------------------------------
R7KD51_9FIRM/8-105--------------------------------------------------------------------------------
A1R781_ARTAT/12-108--------------------------------------------------------------------------------
R7B0J5_9BACE/11-107--------------------------------------------------------------------------------
F4A061_MAHA5/12-106--------------------------------------------------------------------------------
G4VJP1_SCHMA/94-193--------------------------------------------------------------------------------
R5QVM6_9FIRM/5-101--------------------------------------------------------------------------------
Q65RG9_MANSM/5-101--------------------------------------------------------------------------------
W5WX18_9CORY/12-108--------------------------------------------------------------------------------
Q5NFW4_FRATT/8-104--------------------------------------------------------------------------------
Q0AWK2_SYNWW/9-105--------------------------------------------------------------------------------
Q54B26_DICDI/464-559--------------------------------------------------------------------------------
B0WVG4_CULQU/121-219--------------------------------------------------------------------------------
R5NV97_9PORP/9-107--------------------------------------------------------------------------------
Q1GDM8_RUEST/15-111--------------------------------------------------------------------------------
D2QKI7_SPILD/17-114--------------------------------------------------------------------------------
B8F687_HAEPS/7-103--------------------------------------------------------------------------------
D8QQ28_SELML/79-179--------------------------------------------------------------------------------
Q9PBG4_XYLFA/35-131--------------------------------------------------------------------------------
D8UJ79_VOLCA/508-659--------------------------------------------------------------------------------
A9BGV5_PETMO/11-107--------------------------------------------------------------------------------
X5HL15_9RICK/7-99--------------------------------------------------------------------------------
I3ZBA9_TERRK/11-108--------------------------------------------------------------------------------
C8XF22_NAKMY/12-108--------------------------------------------------------------------------------
E4RQ84_LEAB4/12-110--------------------------------------------------------------------------------
U9U9V9_RHIID/51-151--------------------------------------------------------------------------------
R6XJJ4_9BACT/7-104--------------------------------------------------------------------------------
K4RIG6_HELHE/4-97--------------------------------------------------------------------------------
F4B2T6_DOKS4/13-111--------------------------------------------------------------------------------
R4KQ58_9FIRM/11-107--------------------------------------------------------------------------------
Q0SH66_RHOJR/12-108--------------------------------------------------------------------------------
R5QJ41_9FIRM/12-107--------------------------------------------------------------------------------
W8KVW8_HALHR/8-104--------------------------------------------------------------------------------
E6VZ32_DESAO/19-113--------------------------------------------------------------------------------
K6YTN0_9ALTE/9-104--------------------------------------------------------------------------------
W8UBA1_YEREN/8-104--------------------------------------------------------------------------------
R6AXF5_9BACT/9-107--------------------------------------------------------------------------------
I0IKW0_LEPFC/44-136--------------------------------------------------------------------------------
R5FVB9_9FIRM/8-104--------------------------------------------------------------------------------
D6S4W0_9LACO/8-104--------------------------------------------------------------------------------
R5U623_9FIRM/9-105--------------------------------------------------------------------------------
F8GJZ3_NITSI/8-104--------------------------------------------------------------------------------
A4XKG8_CALS8/6-98--------------------------------------------------------------------------------
R7G8T5_9FIRM/5-101--------------------------------------------------------------------------------
F4GWP5_PUSST/8-104--------------------------------------------------------------------------------
R6QDZ5_9CLOT/11-108--------------------------------------------------------------------------------
R5ELM4_9CLOT/8-104--------------------------------------------------------------------------------
G7VA32_THELD/10-105--------------------------------------------------------------------------------
E3DMY5_HALPG/12-107--------------------------------------------------------------------------------
A8MHK3_ALKOO/10-106--------------------------------------------------------------------------------
D5V5P9_ARCNC/5-98--------------------------------------------------------------------------------
R5YMX1_9FIRM/8-104--------------------------------------------------------------------------------
R7HM20_9BACT/8-106--------------------------------------------------------------------------------
G8QXT8_SPHPG/10-107--------------------------------------------------------------------------------
V5XFV4_MYCNE/12-108--------------------------------------------------------------------------------
D2NSW1_ROTMD/33-130--------------------------------------------------------------------------------
V8NPE7_OPHHA/602-701--------------------------------------------------------------------------------
C1MLU7_MICPC/83-177--------------------------------------------------------------------------------
M1P9Z1_DESSD/18-114--------------------------------------------------------------------------------
Q9A2X4_CAUCR/7-102--------------------------------------------------------------------------------
B8HKL6_CYAP4/30-126--------------------------------------------------------------------------------
R5VBQ6_9FIRM/7-103--------------------------------------------------------------------------------
ATP25_CLAL4/96-228--------------------------------------------------------------------------------
F8I0U6_WEIKK/11-107--------------------------------------------------------------------------------
C4KCZ9_THASP/8-104--------------------------------------------------------------------------------
ATP25_PICGU/88-224--------------------------------------------------------------------------------
D4LCT4_RUMC1/8-104--------------------------------------------------------------------------------
A8L0S1_FRASN/13-108--------------------------------------------------------------------------------
D4IQ57_9BACT/6-104--------------------------------------------------------------------------------
R7K5C7_9FIRM/10-106--------------------------------------------------------------------------------
B1I5R8_DESAP/10-106--------------------------------------------------------------------------------
E9J4J3_SOLIN/121-220--------------------------------------------------------------------------------
R7P8V8_9BACT/9-107--------------------------------------------------------------------------------
R7GL65_9FIRM/5-101--------------------------------------------------------------------------------
F2I5U3_AERUA/11-107--------------------------------------------------------------------------------
I3VX60_THESW/11-106--------------------------------------------------------------------------------
F0ZWV5_DICPU/383-477--------------------------------------------------------------------------------
J7R6P1_KAZNA/88-227--------------------------------------------------------------------------------
B2UMY0_AKKM8/11-108--------------------------------------------------------------------------------
R6XNW3_9FIRM/6-102--------------------------------------------------------------------------------
I5AQV5_EUBCE/9-105--------------------------------------------------------------------------------
IOJAP_TREPA/8-104--------------------------------------------------------------------------------
I3Z0Q1_BELBD/8-106--------------------------------------------------------------------------------
R7FYP6_9FIRM/22-118--------------------------------------------------------------------------------
ATP25_CANTT/82-221--------------------------------------------------------------------------------
K9T830_9CYAN/33-130--------------------------------------------------------------------------------
G4RH05_PELHB/25-121--------------------------------------------------------------------------------
F7XVP2_MIDMI/9-104--------------------------------------------------------------------------------
Q2LSS9_SYNAS/2-96--------------------------------------------------------------------------------
Q182L0_PEPD6/8-104--------------------------------------------------------------------------------
X4Z9U4_9BACL/10-106--------------------------------------------------------------------------------
I6YYA6_MELRP/8-104--------------------------------------------------------------------------------
K4BYI4_SOLLC/54-155--------------------------------------------------------------------------------
F2UAC2_SALR5/139-239--------------------------------------------------------------------------------
R5FER8_9BACT/9-107--------------------------------------------------------------------------------
J9YZQ7_9PROT/15-111--------------------------------------------------------------------------------
I4BW42_ANAMD/16-108--------------------------------------------------------------------------------
D5V9T6_MORCR/11-107--------------------------------------------------------------------------------
Q03GA3_PEDPA/8-104--------------------------------------------------------------------------------
D5EJ39_CORAD/18-113--------------------------------------------------------------------------------
G4KSV6_OSCVS/9-104--------------------------------------------------------------------------------
Q818D4_BACCR/9-104--------------------------------------------------------------------------------
R6FXQ7_9FIRM/8-104--------------------------------------------------------------------------------
U1NRB0_ASCSU/227-325--------------------------------------------------------------------------------
Q484R0_COLP3/9-104--------------------------------------------------------------------------------
M5A2E2_9ACTN/14-110--------------------------------------------------------------------------------
L7VK85_9FLAO/10-105--------------------------------------------------------------------------------
F2NNL5_MARHT/12-107--------------------------------------------------------------------------------
E1Z8J3_CHLVA/4-97--------------------------------------------------------------------------------
G0WF35_NAUDC/65-189--------------------------------------------------------------------------------
R5KVH1_9FIRM/8-104--------------------------------------------------------------------------------
A9WUT6_RENSM/16-112--------------------------------------------------------------------------------
I1YT23_PREI7/9-107--------------------------------------------------------------------------------
R7JD55_9FUSO/13-109--------------------------------------------------------------------------------
G9WG40_9LACT/8-104--------------------------------------------------------------------------------
C7NH29_KYTSD/12-108--------------------------------------------------------------------------------
R6CH16_9FIRM/8-104--------------------------------------------------------------------------------
C6X352_FLAB3/12-110--------------------------------------------------------------------------------
A4RXN6_OSTLU/16-109--------------------------------------------------------------------------------
C7RHK0_ANAPD/5-100--------------------------------------------------------------------------------
V9TWB7_9PROT/2-96--------------------------------------------------------------------------------
B9DTM8_STRU0/8-104--------------------------------------------------------------------------------
Q6AFX5_LEIXX/14-108--------------------------------------------------------------------------------
R6QUB8_9FIRM/8-104--------------------------------------------------------------------------------
B5YNF2_THAPS/450-581--------------------------------------------------------------------------------
D3AY29_POLPA/476-574--------------------------------------------------------------------------------
I4WTH1_9GAMM/17-113--------------------------------------------------------------------------------
F5WTA4_ERYRF/6-102--------------------------------------------------------------------------------
Q1MPK9_LAWIP/52-145--------------------------------------------------------------------------------
Q5LX03_RUEPO/22-118--------------------------------------------------------------------------------
A9TEA2_PHYPA/63-157--------------------------------------------------------------------------------
D3ICT2_9BACT/9-107--------------------------------------------------------------------------------
R6I9I1_9FIRM/8-103--------------------------------------------------------------------------------
C3PHZ3_CORA7/12-108--------------------------------------------------------------------------------
D3HSE6_LEGLN/9-105--------------------------------------------------------------------------------
E6UF33_RUMA7/11-107--------------------------------------------------------------------------------
R6WPM6_9CLOT/8-105--------------------------------------------------------------------------------
K3X3T5_PYTUL/107-206--------------------------------------------------------------------------------
D8K1D9_DEHLB/11-108--------------------------------------------------------------------------------
R7DMR6_9FIRM/7-103--------------------------------------------------------------------------------
E1VWM4_ARTAR/12-109--------------------------------------------------------------------------------
D5MJ59_9BACT/30-126--------------------------------------------------------------------------------
C5ZXG7_9HELI/10-104--------------------------------------------------------------------------------
B3DVR4_METI4/4-101--------------------------------------------------------------------------------
K0C587_CYCSP/7-103--------------------------------------------------------------------------------
H1ZA70_MYROD/13-111--------------------------------------------------------------------------------
C7JCS4_ACEP3/42-138--------------------------------------------------------------------------------
Q1GVM4_SPHAL/25-120--------------------------------------------------------------------------------
R5IE32_9BACT/5-103--------------------------------------------------------------------------------
G0S6Z3_CHATD/120-279--------------------------------------------------------------------------------
B4KZ09_DROMO/104-203--------------------------------------------------------------------------------
F3ZSP8_9BACE/11-109--------------------------------------------------------------------------------
B3QSE4_CHLT3/45-141--------------------------------------------------------------------------------
R5C106_9FIRM/15-109--------------------------------------------------------------------------------
R6T077_9CLOT/36-132--------------------------------------------------------------------------------
R6NVN6_9FIRM/10-106--------------------------------------------------------------------------------
H8GJL3_METAL/8-104--------------------------------------------------------------------------------
W8T6F3_EUBAC/10-106--------------------------------------------------------------------------------
Q82XC6_NITEU/9-105--------------------------------------------------------------------------------
A1S8T2_SHEAM/8-104--------------------------------------------------------------------------------
B4EV09_PROMH/8-104--------------------------------------------------------------------------------
M1E8G8_9FIRM/12-107--------------------------------------------------------------------------------
A0KN92_AERHH/9-104--------------------------------------------------------------------------------
A8ZRY5_DESOH/13-106--------------------------------------------------------------------------------
I6S4I9_ENTHA/2-94--------------------------------------------------------------------------------
F4WK15_ACREC/124-223--------------------------------------------------------------------------------
B8CXR9_HALOH/15-110--------------------------------------------------------------------------------
D0L1I9_HALNC/40-138--------------------------------------------------------------------------------
V6F0E1_9PROT/8-103--------------------------------------------------------------------------------
D4MZP3_9FIRM/9-105--------------------------------------------------------------------------------
W8RZP4_9RHOB/25-121--------------------------------------------------------------------------------
R6NDQ1_9FIRM/8-104--------------------------------------------------------------------------------
B9L8C0_NAUPA/5-98--------------------------------------------------------------------------------
F7YU42_9THEM/9-105--------------------------------------------------------------------------------
B8GV08_THISH/8-104--------------------------------------------------------------------------------
E7F2E7_DANRE/83-181--------------------------------------------------------------------------------
A9T8N1_PHYPA/162-263--------------------------------------------------------------------------------
G3AI15_SPAPN/101-235--------------------------------------------------------------------------------
X4QTP2_9ACTO/14-109--------------------------------------------------------------------------------
C8W5N8_DESAS/10-106--------------------------------------------------------------------------------
D0LK39_HALO1/35-131--------------------------------------------------------------------------------
R6DLX5_9FIRM/12-104--------------------------------------------------------------------------------
S0ET20_CHTCT/14-110--------------------------------------------------------------------------------
Q5FIX7_LACAC/8-104--------------------------------------------------------------------------------
ATP25_PHANO/99-265--------------------------------------------------------------------------------
Q038B3_LACC3/9-105--------------------------------------------------------------------------------
R6NHF7_9CLOT/9-105--------------------------------------------------------------------------------
R5YA62_9BACE/9-107--------------------------------------------------------------------------------
R6M0U4_9FIRM/9-105--------------------------------------------------------------------------------
Q9KTF0_VIBCH/10-104--------------------------------------------------------------------------------
D5XBC0_THEPJ/11-106--------------------------------------------------------------------------------
ATP25_PICPG/78-215--------------------------------------------------------------------------------
G3B8J3_CANTC/85-222--------------------------------------------------------------------------------
I0GTD8_SELRL/8-104--------------------------------------------------------------------------------
F6DLB0_DESRL/10-106--------------------------------------------------------------------------------
R7BVC4_9BURK/20-116--------------------------------------------------------------------------------
Q2GHB7_EHRCR/18-112--------------------------------------------------------------------------------
R7J059_9BACT/9-107--------------------------------------------------------------------------------
IOJAP_HAEIN/5-101--------------------------------------------------------------------------------
Q67SC2_SYMTH/5-99--------------------------------------------------------------------------------
R5ECA2_9BURK/8-104--------------------------------------------------------------------------------
R7MJL0_9CLOT/12-108--------------------------------------------------------------------------------
H3AY78_LATCH/158-257--------------------------------------------------------------------------------
G3VZZ7_SARHA/11-110--------------------------------------------------------------------------------
Q08NZ3_STIAD/68-165--------------------------------------------------------------------------------
R6ETJ2_9FIRM/10-106--------------------------------------------------------------------------------
Q1DCX4_MYXXD/14-112--------------------------------------------------------------------------------
D1AKP5_SEBTE/6-98--------------------------------------------------------------------------------
M1WNH7_DESPC/18-113--------------------------------------------------------------------------------
F6FPQ7_ISOV2/13-108--------------------------------------------------------------------------------
F2LXZ8_HIPMA/3-95--------------------------------------------------------------------------------
Q8KG28_CHLTE/44-140--------------------------------------------------------------------------------
A2U334_9FLAO/13-111--------------------------------------------------------------------------------
L0DYT0_THIND/8-104--------------------------------------------------------------------------------
Q87VV8_PSESM/8-104--------------------------------------------------------------------------------
A5GSM6_SYNR3/8-104--------------------------------------------------------------------------------
R6A9P5_9FIRM/6-102--------------------------------------------------------------------------------
Q5QYE0_IDILO/8-104--------------------------------------------------------------------------------
E3DAG2_GARV3/12-110--------------------------------------------------------------------------------
D3R1R0_MAGIU/8-105--------------------------------------------------------------------------------
L7W7C8_NONDD/13-111--------------------------------------------------------------------------------
Q8EPV3_OCEIH/8-104--------------------------------------------------------------------------------
B8DU79_BIFA0/12-110--------------------------------------------------------------------------------
E3IV14_FRASU/13-108--------------------------------------------------------------------------------
Q5HNV5_STAEQ/8-104--------------------------------------------------------------------------------
ATP25_YEAST/105-246--------------------------------------------------------------------------------
D2R8D5_PIRSD/24-119--------------------------------------------------------------------------------
I4CCS0_DESTA/15-111--------------------------------------------------------------------------------
D5WXL5_KYRT2/10-106--------------------------------------------------------------------------------
E8REX9_DESPD/18-114--------------------------------------------------------------------------------
Q21WP9_RHOFT/19-115--------------------------------------------------------------------------------
R6TTM2_9FIRM/13-109--------------------------------------------------------------------------------
L7VM09_CLOSH/8-104--------------------------------------------------------------------------------
F0S9I9_PSESL/16-113--------------------------------------------------------------------------------
Q1AVU5_RUBXD/25-121--------------------------------------------------------------------------------

PF03445

Q74E96_GEOSL/70-216--------------------------------------------------------------------------------
Q3SMK2_THIDA/311-451--------------------------------------------------------------------------------
A5FH19_FLAJ1/315-456--------------------------------------------------------------------------------
Q21RX0_RHOFT/287-419--------------------------------------------------------------------------------
Q2IEC2_ANADE/287-421--------------------------------------------------------------------------------
Q72EX4_DESVH/364-509--------------------------------------------------------------------------------
B9M647_GEODF/87-225--------------------------------------------------------------------------------
Q5KZZ8_GEOKA/30-169--------------------------------------------------------------------------------
Q0A740_ALKEH/45-190--------------------------------------------------------------------------------
Q0A741_ALKEH/289-440--------------------------------------------------------------------------------
Q2SC90_HAHCH/335-475--------------------------------------------------------------------------------
B3E878_GEOLS/160-298--------------------------------------------------------------------------------
Q0A6Y9_ALKEH/155-300--------------------------------------------------------------------------------
A6VT54_MARMS/299-436--------------------------------------------------------------------------------
Q5QUI2_IDILO/291-428--------------------------------------------------------------------------------
Q1QZ78_CHRSD/292-424--------------------------------------------------------------------------------
A7II29_XANP2/249-381--------------------------------------------------------------------------------
Q4FUP8_PSYA2/335-467--------------------------------------------------------------------------------
Q315G6_DESAG/341-482--------------------------------------------------------------------------------
B3EBD1_GEOLS/155-293--------------------------------------------------------------------------------
Q0A6Z3_ALKEH/338-481--------------------------------------------------------------------------------
A7HH07_ANADF/294-428--------------------------------------------------------------------------------
Q89MS6_BRADU/287-419--------------------------------------------------------------------------------
Q8NQY4_CORGL/299-437--------------------------------------------------------------------------------
A9C1C5_DELAS/300-433--------------------------------------------------------------------------------
Q3AAI0_CARHZ/302-445--------------------------------------------------------------------------------
Q0AAW3_ALKEH/298-443--------------------------------------------------------------------------------
Q6AK79_DESPS/536-676--------------------------------------------------------------------------------
O29291_ARCFU/289-422--------------------------------------------------------------------------------
Q6LLZ3_PHOPR/291-423--------------------------------------------------------------------------------
A7HF43_ANADF/290-424--------------------------------------------------------------------------------
Q5WB02_BACSK/16-152--------------------------------------------------------------------------------
A0KJY8_AERHH/290-422--------------------------------------------------------------------------------
A6W3F4_MARMS/295-433--------------------------------------------------------------------------------
O67874_AQUAE/297-438--------------------------------------------------------------------------------
Q0A6Z6_ALKEH/50-188--------------------------------------------------------------------------------
Q0AAE6_ALKEH/308-446--------------------------------------------------------------------------------
A7HH08_ANADF/291-424--------------------------------------------------------------------------------
A0QUE9_MYCS2/19-146--------------------------------------------------------------------------------
A0L6G8_MAGMM/300-438--------------------------------------------------------------------------------
A4SW93_POLSQ/291-424--------------------------------------------------------------------------------
Q0VMJ3_ALCBS/291-422--------------------------------------------------------------------------------
A5UUU0_ROSS1/301-438--------------------------------------------------------------------------------
Q2RWQ7_RHORT/287-419--------------------------------------------------------------------------------
Q5E0M6_VIBF1/300-437--------------------------------------------------------------------------------
Q30QK1_SULDN/290-422--------------------------------------------------------------------------------
A1VJH4_POLNA/291-424--------------------------------------------------------------------------------
A0M2M4_GRAFK/316-457--------------------------------------------------------------------------------
A1WYA2_HALHL/306-457--------------------------------------------------------------------------------
A1TZ30_MARHV/318-457--------------------------------------------------------------------------------
A5GB63_GEOUR/87-228--------------------------------------------------------------------------------
A1STJ2_PSYIN/318-456--------------------------------------------------------------------------------
A7HBY5_ANADF/161-300--------------------------------------------------------------------------------
Q47FJ9_DECAR/33-173--------------------------------------------------------------------------------
Q2IP15_ANADE/291-425--------------------------------------------------------------------------------
A7HHL2_ANADF/317-456--------------------------------------------------------------------------------
Q47FJ8_DECAR/323-463--------------------------------------------------------------------------------
Q1GL32_RUEST/285-422--------------------------------------------------------------------------------
Q8KDK9_CHLTE/323-469--------------------------------------------------------------------------------
Q9K6I7_BACHD/316-461--------------------------------------------------------------------------------
Q5P177_AROAE/314-454--------------------------------------------------------------------------------
Q31GK9_THICR/297-430--------------------------------------------------------------------------------
A7HH09_ANADF/26-158--------------------------------------------------------------------------------
Q7NTV8_CHRVO/285-417--------------------------------------------------------------------------------
Q124J8_POLSJ/165-305--------------------------------------------------------------------------------
A7HF42_ANADF/295-425--------------------------------------------------------------------------------
Q7MSB7_WOLSU/294-426--------------------------------------------------------------------------------
B0UVN5_HISS2/302-436--------------------------------------------------------------------------------
B6IWA9_RHOCS/320-456--------------------------------------------------------------------------------
Q5SK35_THET8/277-408--------------------------------------------------------------------------------
Q72EX3_DESVH/178-317--------------------------------------------------------------------------------
Q7MCI2_VIBVY/302-436--------------------------------------------------------------------------------
Q88QY0_PSEPK/323-461--------------------------------------------------------------------------------
Q8EDA6_SHEON/299-436--------------------------------------------------------------------------------
Q9HZ07_PSEAE/290-420--------------------------------------------------------------------------------

PF03710

GLNE_RHILO/579-826---------------------------------R....PHVFDGLLDPALLTELPDRV----------------------
GLNE_CORGL/627-871---------------------------------T....PDFMKQLGDA..ASGPKLLA----------------------
GLNE_VIBCH/33-281---------------------------------D....DPLCQVLPSL..LAKPSREQ----------------------
GLNE_HAEIN/589-842---------------------------------Y....PILLDELLNTEALRHPLPFT----------------------
GLNE_PASMU/587-841---------------------------------H....PILLDELLDRNALLNPPPYD----------------------
GLNE_ECOLI/552-806---------------------------------Y....PLLLDELLDPNTLYQPTATD----------------------
GLNE_CAUCR/70-317---------------------------------DGKRLPRIL........GGDPGETL----------------------
GLNE_PSEAE/47-298---------------------------------D....SAMLLELAERGELENPHAPG----------------------
GLNE_ECOLI/29-277---------------------------------H....PEWLTELESQ..PPQADEWQ----------------------
GLNE_PASMU/46-295---------------------------------Q....PHFLHQCWQQ..CPRLQDCE----------------------
GLNE_CAUCR/589-828---------------------------------R....PTALDALLDPTFFGPIETPA----------------------
GLNE_VIBCH/556-810---------------------------------Y....PILLDELIDPQHLYNPIPLE----------------------
GLNE_HAEIN/46-299---------------------------------Y....PHLVKQWWEK..SPCFADCT----------------------
GLNE_RHILO/58-307---------------------------------R....PRILDALFDQPVEARLEAIT----------------------
M9X424_MANHA/24-271---------------------------------Q....PDLLAEWLAK..FPTPDDCC----------------------
GLNE_MYCTU/589-828---------------------------------A....PRVIQQYEDG..PAGPKLLE----------------------
Q5F608_NEIG1/520-754---------------------------------Y....PILLDELISAQLLDTAFDWQ----------------------
GLNE_PSEAE/576-830---------------------------------F....PILLDELLNEGRLFRPPQAA----------------------

PF09139

F4Q0F6_DICFS/78-418IDMVFA-VDNAN-DWHKE...............NLERNWSHYSF.LAYG..G....PK----------------------
C5G7N5_AJEDR/130-496IDFIFG-VSYSQ-HWHAL...............NLNQHRDHYSG.LGSL..G....SY----------------------
H6BQ12_EXODN/141-510IDFIFG-VSYTQ-HWHSL...............NLQEHRDHYSA.VGSL..G....SY----------------------
A8NRM0_COPC7/89-410LDFMFA-VTHPA-HFHSI...............NMHQFPSHYPL.HARMF.G....SS----------------------
G1XLW6_ARTOA/133-472VDLIFG-VTYTQ-HWHSL...............NLTEHRDHYSF.LGKM..G....SG----------------------
E9J9M0_SOLIN/10-328LDLIFV-VRNAN-KWHAE...............NLTRNPKHYAKPLRFL..G....PK----------------------
G4N333_MAGO7/122-492IDFIFG-VSHTQ-HWHSL...............NMRQNRHHYSA.VASL..G....SG----------------------
D8M4A9_BLAHO/3-344LDVIIG-VRDPI-EWHRV...............NMQLNPEHYSF.FRHL..G....SS----------------------
S3BZ14_OPHP1/165-542IDFIFG-VTFTQ-HWHSL...............NLHQHRDHYSA.LGSL..G....SG----------------------
U1HUS9_ENDPU/150-521IDFIFG-VSYSQ-HWHSL...............NLQEHRDHYSA.VGSL..G....SY----------------------
C1E0D3_MICSR/10-340VDFVFA-VDDPR-AWHRR...............NMAMNPSHYAP.HLRAL.G....GG----------------------
L0P740_PNEJ8/104-428IDFIFG-VSQAQ-QWHSL...............NLFHNNNHYSF.LKYF..G....SY----------------------
C9S6T4_VERA1/142-510IDLIFG-VTHTQ-HWHSL...............NMRQHPEHYSS.LAKF..G....SG----------------------
B4NJ58_DROWI/5-342IDLVFC-VRDAL-GFHAE...............NMHRHPSHYSA.LRHL..G....PR----------------------
E9F7E1_METRA/91-463IDFIFG-VSHTQ-HWHSI...............NIRQHRDHYSG.IASL..G....SG----------------------
A5E243_LODEL/82-429MDFIFV-VKNSA-SFHKE...............NLLQNANHYSS.KS.........LM----------------------
W1Q7W0_OGAPD/134-519VDMIYA-VSYPD-HWHSL...............NIAQNPDHYSS.LRHL..G....SS----------------------
B6K4K1_SCHJY/52-376LDFIFG-VKDPY-QWHSV...............NVKQNPKHYSF.LKYF..G....SR----------------------
H0Z110_TAEGU/13-327LDFVFA-VDDVV-TWHMM...............NLLKNRSHYSF.LKFF..G....PK----------------------
M3B232_PSEFD/164-542IDFIFG-VSHTQ-HWHSL...............NLMQHPKHYSA.LRYIPNS....SA----------------------
E0VMJ8_PEDHC/16-330IDFIFA-VKNSE-KWHSS...............NLQLNPSHYSA.LSFL..G....SK----------------------
B0WG01_CULQU/11-332IDLIYT-VDNAH-RWHVS...............NLERNPDHYSG.LGRF..G....GN----------------------
D6WLK1_TRICA/13-336IDLIYC-VDNPS-AWHEA...............NMKENFSHYSG.LKYF..G....HN----------------------
K3ZJ60_SETIT/15-326VDYILG-VADPL-HWHSE...............NLKRNPAHYSR.WMGCL.G....AS----------------------
E9CXS5_COCPS/124-488IDFIFG-VSYSQ-HWHSL...............NLNQHRDHYSA.IGSL..G....SY----------------------
A0ECV7_PARTE/9-316IDLIIA-VDNVE-EWHMQ...............NIQINSTHYSG.LSYYL.G....SR----------------------
B9GN14_POPTR/9-326VDYIIG-VSDPK-QWHSK...............NMELNEDHYAS.WMVPLGG....AK----------------------
S8AI20_PENO1/118-482IDFIFG-VSYSQ-HWHDL...............NLNQHRDHYSG.LGSM..G....SY----------------------
W5N967_LEPOC/13-328LDFVFA-VDDPV-SWHTM...............NLMKNHKHYSF.LRYL..G....PR----------------------
Q0UPI9_PHANO/59-415IDFVLT-PRFSE-HFHSL...............NLRSHRDHYSF.LGSL..G....SG----------------------
A7S007_NEMVE/10-319IDFVFV-VDNPY-DWHSK...............NLSRFPHHYSF.MANL..G....VN----------------------
K9G9U1_PEND2/123-487IDFIFG-VSYSQ-HWHAI...............NLNQNRDHYSA.LGSL..G....SY----------------------
TAM41_DICDI/68-424IDLIFA-VENST-KWHSL...............NLVNNQSHYSF.LGLM..G....AH----------------------
I1K386_SOYBN/6-319TDYILG-VSDPK-QWHSE...............NLKLNKHHYAS.WMVHLGG....ES----------------------
M7PAY1_PNEMU/94-420IDFIFG-VSHAQ-HWHSL...............NLLYNRDHYSF.LKHF..G....SY----------------------
S8FW20_FOMPI/63-368LDFMFA-VTHAD-HWHSI...............NMNQFPGHYPL.HAR..........----------------------
C5MHG3_CANTT/128-440LDFIFV-VENTT-QFHKE...............NVHQNPKHYSS.KS.........LS----------------------
Q2H207_CHAGB/144-517IDFIFG-VSHTQ-HWHSL...............NMKQHRDHYSR.LASL..G....SG----------------------
A8Q506_MALGO/15-385IDMVIA-VKDPI-HWHAA...............NMLRNKSHYPW.WTRWC.G....LW----------------------
T1JUS5_TETUR/9-355VDLVVV-VDDSL-EFHRN...............NLRNNAQHYSL.LRHL..G....PK----------------------
G1KJZ6_ANOCA/15-329LDFVFA-VDNSV-TWHTT...............NLSKNRNHYSF.LKYF..G....PK----------------------
K2RZS9_MACPH/50-418IDFIFG-VTYSQ-HWHSL...............NLAQHRDHYSF.LGSF..G....SW----------------------
M2UHY6_COCH5/80-448IDFILT-PRFSQ-HFHSL...............NLREHRDHYSF.LGSL..G....SA----------------------
C4QXR2_PICPG/110-482MDMIYA-VSYPD-HWHAL...............NLHQFPEHYSF.LRIG..G....SG----------------------
G3APF1_SPAPN/81-416LDFIHI-VPDSH-EFHRV...............NLQQNRSHYSF.KS.........LS----------------------
C7Z478_NECH7/122-494IDFIFG-VTHTQ-HWHSI...............NMKQHRDHYSG.IASL..G....SG----------------------
F1R4V6_DANRE/13-328LDFVFA-VDDPV-TWHTM...............NLIENRKHYSF.LRFL..G....PK----------------------
Q6CC57_YARLI/155-503VDLIFG-VKYPN-HWHSL...............NLKQNPHHYSG.LKYL..G....SD----------------------
K7IVD4_NASVI/11-329LDLIFV-VRNPY-QWHAE...............NMNKNPEHYAQPLRFL..G....HK----------------------
J9K2F7_ACYPI/5-309VDLIFV-VNNTH-DFHQE...............NLTINPDHYSS.IRYL..G....AS----------------------
TAM41_DROME/5-338VDLVFC-VRDAR-GFHAE...............NLHRHPDHYSA.LRHL..G....PN----------------------
M7TNP0_EUTLA/89-460IDFIFG-VQHTQ-HFHSL...............NLRQHRDHYSG.LGSL..G....SA----------------------
U4L0D7_PYROM/82-426IDLIFG-VTYTQ-HWHSI...............NLKQHRDHYSF.LGSF..G....SR----------------------
W1PVI6_AMBTC/11-327VDYILG-VSDPM-QWHSQ...............NLEKNRHHYGS.FLAYL.G....SR----------------------
S2J8V7_MUCC1/67-383VDFIFG-VSHPG-HWHDL...............NMQQNPHHYSG.IRAL..G....SG----------------------
E1FWI9_LOALO/14-325VDFIIA-TSDSN-QFHKQ...............NLKMNPMHYSS.LRFL..G....YQ----------------------
R7Z3U1_CONA1/137-506IDFIFG-VTYTQ-HWHSL...............NLTQHRDHYSF.LGSL..G....SG----------------------
R9AIR3_WALI9/86-407VDFIVA-TTHPY-HWHSI...............NIQQNPTHYPF.LAKIL.G....SK----------------------
G8B9Z5_CANPC/74-380LDFIFL-VNDTA-KFHHE...............NVKQNPSHYST.KS.........LT----------------------
Q9SN75_ARATH/9-326VDYILG-VSDPI-KWHSA...............NLKMNSDHYAS.WMVHLGG....AR----------------------
G8YHN8_PICSO/69-420IDLIHL-VRNAQ-SFHEG...............NLHQYPEHYSG.IKYFG.G....SH----------------------
B4K948_DROMO/5-334IDLVFC-VRDTQ-GFHAE...............NIHRHSSHYSA.LCHL..G....AN----------------------
S9W8F4_SCHCR/52-374VDFIFQ-VDNPV-RWHEL...............NIQQNPSHYSF.LKYL..G....PK----------------------
N1J4Q0_BLUG1/111-475IDFIFG-VSHTQ-HWHSL...............NLAQHRDHYSA.LGSL..G....SG----------------------
J3PFP4_GAGT3/124-495IDFIFG-VSHTQ-HWHSL...............NIRQNRHHYSG.LASL..G....SG----------------------
J4HVB6_FIBRA/89-403LDFIFA-VTHPA-HWHSI...............NLNQFPGHYPL.HARLL.G....SS----------------------
A3LVC5_PICST/51-374IDFINI-VEDNQ-TFHKQ...............NLVKNRSHYSI.KS.........AG----------------------
Q6BKV0_DEBHA/67-411IDMIHM-VDKPA-DFHEQ...............NLEQFSGHYSG.IRMF..G....PA----------------------
A7EQJ2_SCLS1/136-507IDFIFG-VSYSQ-HWHSL...............NLNQHRDHYSA.LGSL..G....SG----------------------
F1L2S9_ASCSU/10-321VDFIIA-SSNSH-TFHEE...............NLDRNPSHYSM.IRRL..G....AR----------------------
G3JTW8_CORMM/137-509IDFIFG-VSHTQ-HWHSL...............NIKQHRKHYSG.VASL..G....SG----------------------
V5G174_BYSSN/130-494IDFIFG-VSYSQ-HWHSL...............NLHQHRDHYSA.LGSM..G....SY----------------------
F4PEP7_BATDJ/67-400VDFIFG-VVHSE-HWHSL...............NIKQNPHHYSS.IAGL..G....SG----------------------
Q5AGE7_CANAL/141-463LDFMFL-VKDCG-KFHQE...............NLKQNRDHYSI.KS.........LR----------------------
G3XQA7_ASPNA/29-371IDFILG-VPCAE-EWHGL...............NLQQNPHHYGA.LGKL..G....KR----------------------
B6QBB5_PENMQ/135-501IDFIFG-VSHTQ-HWHSL...............NLQEHRDHYSA.LGAL..G....SG----------------------
F2DNW5_HORVD/11-326VDYILG-VADPL-HWHSE...............NMARNPTHYSS.WMARR.G....PE----------------------
I7M213_TETTS/17-335IDLIFG-VQDAD-EWHRM...............NLIKNPSHYSG.LGYYL.G....SS----------------------
M9MEW7_PSEA3/116-467VDFIMA-VTHPQ-HWHSL...............NMAQHPKHYSM.FSRLL.G....GL----------------------
R8BP23_TOGMI/11-384IDFIFG-VTFTQ-HWHSL...............NLNQHRDHYSW.LGSL..G....SG----------------------
M2M255_BAUCO/36-426IDFIFG-VSHTQ-HWHSL...............NLMEHPDHYSF.LRHLPYS....SA----------------------
T1F6T9_HELRO/4-318LDLILV-TDNPH-KWHKM...............NLKMNRKHYSF.LKLL..G....PK----------------------
F4REF8_MELLP/113-453LDFVFA-VSHPS-HWHSI...............NLQQNPKHYSL.PLRWL.G....SA----------------------
M5E4Z7_MALS4/64-428IDMVIA-VEEPA-HWHVM...............NMHANPHHYPW.WARLF.G....GW----------------------
U5H5E0_USTV1/137-472LDFVFA-VSHPS-HWHAI...............NMAQNPHHYSL.PMRLL.G....SD----------------------
G3B682_CANTC/65-370IDLVHV-VDSTS-AFHRQ...............NLNKYPHHYSA.LKYL..G....VR----------------------
H3FZA6_PRIPA/8-319VDLVLC-TKDPQ-AFHAD...............NLQQNPSHYSF.LRML..G....PA----------------------
H2S0L1_TAKRU/13-328LDFVIA-VDDPV-TWHTM...............NLLQNRKHYSI.LKLL..G....PT----------------------
D8PZS1_SCHCM/93-412LDFLFA-VTHAD-HFHSI...............NMNQFPSHYPL.SARVL.G....SD----------------------
D7T9Q8_VITVI/9-326VDYILG-VSDPM-QWHSQ...............NLKMNRDHYAS.SMVYLGG....AK----------------------
G0T2B5_RHOG2/147-502LDFIFA-VSHPS-HWHAI...............NMQQHPEHYSL.PMRLM.G....SN----------------------
B7PKK9_IXOSC/7-319LDVIFA-VDDPL-AWHRE...............NLKRNWRHYSF.LRYG..G....PH----------------------
F9WXS4_ZYMTI/148-520IDFIFG-VSHTQ-HWHSL...............NLAQNPHHYSG.LRFMPNS....SA----------------------
B9SQ77_RICCO/9-325VDFILG-VSDPR-QWHSE...............NLKLNRDHYAS.WMVHLGG....AK----------------------
M0S210_MUSAM/10-320VDYILG-VADPI-QWHSEASASFLDDLLSESAMNLT....................YM----------------------
E9R3D7_ASPFU/128-493IDFIFG-VSYTQ-HWHAL...............NLSQHRDHYSA.LGST..G....SY----------------------
I4Y9B7_WALSC/21-342VDFIIA-VTHPH-HWHSI...............NIQQNPSHYPL.GAKLF.G....NK----------------------
D3B0C8_POLPA/348-663IDLVFA-VENSE-QWHKE...............NIKQNFDHYSF.LAYF..G....ES----------------------
A5DAD6_PICGU/58-371IDMIHV-VDDAC-NFHTT...............NLRQFGNHYSG.LKYLG.G....AP----------------------
TAM41_CAEBR/4-316VDFVVV-TKDAQ-EFHKA...............NIAKNPQHYSL.LRLL..G....PK----------------------
H3AQ57_LATCH/13-328LDFVFV-VDDPV-TWHTM...............NIMKNRKHYSF.LKFF..G....PK----------------------
G4U2Y1_PIRID/94-414LDFIFA-VSHPE-HWHSI...............NLAQNPSHYAL.HARLL.G....SD----------------------
H2Y1H7_CIOIN/13-342LDLIFV-VRDPR-SWHSE...............NMRMNKLHYWYPMRYL..G....PN----------------------
Q5KAN9_CRYNJ/49-385TDLLIS-TPDAE-AFHKI...............NLEQNPRHYPV.YARWM.G....GK----------------------
E9HGG3_DAPPU/25-340VDLILV-VDDAE-TFHRL...............NLERNSKHYSS.MKYL..G....PH----------------------
Q7PQL6_ANOGA/11-332IDLIYV-VDNAH-RWHTA...............NLDQNFEHYSS.MRLL..G....GG----------------------
F1MZC5_BOVIN/13-327LDFVFT-VDDPV-AWHSK...............NLKRNWNHYSF.LKVL..G....PR----------------------
B7GA00_PHATC/17-343IDVIMV-VDDAF-SFHQT...............NILLNPAHYAL.PFWTR.FRKSMPE----------------------
B4JF38_DROGR/5-334IDLIFC-VRDTL-GFHAE...............NIHRHEAHYSS.LRYL..G....AN----------------------
Q16J98_AEDAE/11-332IDLIYT-VDNAH-RWHAS...............NLERNPDHYSG.LKYL..G....SN----------------------
E3K171_PUCGT/48-392LDFIFA-VTHPS-HWHSI...............NLHHHPHHYSL.PARLL.G....SP----------------------
D5GF34_TUBMM/84-434IDLIFG-VTYTQ-HWHSL...............NLAQHRDHYSF.LGGM..G....SA----------------------
G9MXT6_HYPVG/81-452IDFIFG-VTHTE-HWHSI...............NMKQHRDHYSG.VASL..G....SG----------------------
U9TGF8_RHIID/101-418IDFIFA-VGHTQ-HWHSL...............NINQNRKHYSY.LGTL..G....SG----------------------
L8FTT4_PSED2/132-505IDFIFG-VSYTE-HWHSL...............NLNQHRDHYSG.LGSL..G....SG----------------------
A0A0C4EL14_PUCT1/30-349LDFIFA-VSHPS-HWHSI...............NLRHNPSHYSL.PARIL.G....SP----------------------
TAM41_SCHPO/61-385IDFIFQ-VEDPV-KWHKI...............NLQQNPSHYSF.VKNF..G....PG----------------------
R4XIF8_TAPDE/76-410VDYIFG-VSYAQ-HFHSL...............NLHHHPDHYSF.LRRL..G....SG----------------------
G7E6I3_MIXOS/149-482LDFVFA-VSHPS-HWHDI...............NLRQNKHHYSW.TARAL.G....SG----------------------
B8N4Y6_ASPFN/11-362IDFIFG-ISHAH-TWHTI...............NLQQHPHHYPP.LLRSL.G....PR----------------------
K5VSI5_PHACS/87-407LDFMFA-VTHAS-HWHDL...............NMHQFPGHYPL.YARAL.G....SE----------------------
T0K1A0_COLGC/136-508IDFIFG-VTHTQ-HWHSL...............NMRQHRDHYSG.LASF..G....SG----------------------
D7FQS1_ECTSI/13-328LDLVLA-VEDSE-AWHKA...............NLKRNRDHYSG.LARLF.G....AG----------------------
K5VXR0_AGABU/90-409LDFMFA-VTHPA-HFHYI...............NMQQYPAHYPM.HARML.G....SS----------------------
F2PR85_TRIEC/162-525IDFIFG-VSHSQ-HWHSL...............NLNQHRNHYSS.LGSM..G....SY----------------------
F7BSM1_MONDO/13-327LDFVFS-VDDPV-TWHSK...............NLQKNRNHYSC.LRLF..G....PN----------------------
C1MRC2_MICPC/9-342VDYVLA-VDAPD-EWHAA...............NMAANPSHYAA.HLRLL.G....AR----------------------
C3ZAA9_BRAFL/5-319VDFIFA-VDNAE-AWHKE...............NMRRNRKHYSF.LSSL..X....PE----------------------
G4V8Y8_SCHMA/10-360IDLVII-VRNPV-EWHLK...............NISENPNHYNF.VVRNY.AQKYQSS----------------------
V2X315_MONRO/94-415LDFMFA-VTHPD-HFHSI...............NMHQHASHYPL.HSRIF.G....SD----------------------
M5BIJ2_THACB/103-424LDFLFA-VTHAD-HFHSI...............NMQQNPKHYAL.VPRLL.G....SD----------------------
W5JMS0_ANODA/11-332IDLIYT-VDNPT-RWHTA...............NLDLNFDHYSG.MRLL..G....GN----------------------
M2RN09_CERS8/89-398LDFMFA-VTHAD-HWHSI...............NMQQHPGHYPL.HARI.........----------------------
E5SKP7_TRISP/223-538IDFVVV-VDKPL-EWHKE...............NLKLNSSHYSM.LRYI..G....AE----------------------

PF09970

A2BMQ9_HYPBU/4-185LSWLFR-KLQEH-GIKGVVIGSTV--IE--------------------LALR----RK-----SFED--D----------
Q9YEU3_AERPE/3-181VASSLR-VLLDR-GFRFTIIGGTV--VE--------------------YALG----SR-----DLGD--D----------
Q0W0P2_METAR/6-201YREAAS-VLEAN-GI.PYVVGGGI--AV--------------------MSFG----RL-----RDTK--D----------
A3DMD4_STAMF/4-178LAVVLG-KLSSY-GVKFVVIGDTV--VQ--------------------LALR----IK-----LFTG--D----------
B8D508_DESK1/4-179LAGIMK-TLQDE-GVKAVVIGDTV--VQ--------------------LALG----RK-----RLEG--D----------
A8AAR7_IGNH4/4-184LIYVMK-KLQEA-GLDAVIIGGTS--VE--------------------LEAR----NK-----KFSG--D----------
Q8ZWK5_PYRAE/12-191LRKVAK-SLNEK-GVEFVLIGSAV--LP--------------------FVYN----ID-----YDPR--D----------
A4YD77_METS5/3-181IGEILS-QIKEK-M.DFVIIGDTV--VD--------------------LSLG----RK-----GTES--D----------
A8MBZ4_CALMQ/6-188LLRVGG-VLGGR-GVGFVVVGSLI--LP--------------------LAYG----VD-----WVVH--D----------

PF08843

P96356_MYCTU/44-279T..LTD-DTGAP-LL..LVKGGSS..LE-------------------.LRRG..IPDS-----RTSK--D----------
A4QBB6_CORGB/41-280R...IF-ANDPN-SW..VLKGGTA..L.-------------------.IWRD...TTA-----RSTR--D----------
A4TG06_MYCGI/45-278R...VF-NANEP-PW..VVAGGIG..ML-------------------IRVPG.....A-----RATR--D----------
Q3L9Z1_RHOE4/41-273R...VF-SSPDS-RW..ILTGGGG..ML-------------------VRIPG.....A-----RHSQ--D----------
Q0RZM2_RHOJR/41-272R...VF-DADPD-GW..ILKGGIG..MM-------------------.VRLP....QA-----RYSK--D----------
A1BD69_CHLPD/21-282E...VA-DGLAI-HF..FVVGAFARDLN-------------------.FEHIHHIPAP-----RVTE--D----------
A1VQW1_POLNA/3-254A...VA-APMGI-AI..VITGAFARDLH-------------------.LLYGYGIDMQ-----RKTE--D----------
Q8XT48_RALSO/19-276R...VA-RQANL-RY..LVVGATARDIL-------------------.MYHLHGFPLN-----RASP--D----------
B1YQB6_BURA4/27-287T...TC-VQLDT-AF..VVAGATARDIL-------------------.MWHVHGIRPV-----RATR--D----------
Q63YV1_BURPS/19-278H...AC-AQLGA-KF..VLAGATARDIL-------------------.MWHLHDIRAP-----VATR--D----------
Q82BM7_STRAW/85-332A..IAD-SAWVD-AL..VLRGSVL..MS-------------------.AWFG...DAA-----REPG--D----------
A4X8Y5_SALTO/290-509T..IAA-TTWSQ-QL..VLRGSVT..MA-------------------.AWVG...DDA-----REPG--D----------
A5FTN4_ACICJ/24-250S.IFVK-STERE-I...ALKGGFA..MR-------------------.ALFG....SA-----RHTK--D----------
A5CLY9_CLAM3/43-277R...VF-ADDEP-MF..VLKGGTG..ML-------------------ARMPR.....S-----RSTL--D----------
B4SCH8_PELPB/39-286G....L-HIQGL-QL..AFGGGTS..LA-------------------..KAG...LIK-----RFSE--D----------
Q5X025_LEGPL/35-302K.....-.IENE-YFRLVFCGGTC..LA-------------------.KAHK...VVQ-----RMSE--D----------
A0A0C9P991_LEGPN/35-300G.....-.ISND-YFELVFQGGTS..LS-------------------.KGYG...VIS-----RLSE--D----------
Q3ICX9_PSEHT/18-286E....L-SFDTH-LL..VFSGGTA..LT-------------------KSGIK....TH-----RMSE--D----------
Q7MZL3_PHOLL/34-307P....L-AFDTH-KL..VFAGGTA..LA-------------------.KAGI...SLD-----RMSE--D----------
B3EES9_CHLL2/39-305D....I-DVDGI-QL..IFCGGTC..LS-------------------.KAHG...LIG-----RMSE--D----------
A1W687_ACISJ/40-308A....L-QPEGV-QL..VFCGGTS..LS-------------------.KAYG...LIE-----RMSE--D----------
B1HK77_BURPE/40-306T....L-AHEHV-TL..VFCGGTN..LS-------------------.KAHG...IIE-----RMSE--D----------
A6DS96_9BACT/37-309I..FSN-ETLAE-YT..VFKGGTS..LS-------------------.KCFD...LID-----RFSE--D----------
Q64WK6_BACFR/36-314D..ISM-SEYAD-KT..YFKGGTS..LS-------------------.KAYG...LIE-----RFSE--D----------
Q7MW16_PORGI/42-316A..LSK-SSYSQ-QI..VFKGGTS..LS-------------------.KAYL...LID-----RFSE--D----------
A4VC40_BACUN/48-319A.....-GDKDN-RA..IFKGGTS..LT-------------------.KAYG...IGA-----RFSE--D----------
A4TFZ6_MYCGI/38-313T...IA-ASHRD-EI..VFKGGTS..LQ-------------------.KLR....IIK-----RFSE--D----------
Q8EAV5_SHEON/44-326D.IAPK-LTARS-QIPFVFKGGTS..LS-------------------.KCHK...LIN-----RMSE--D----------
E0TEK2_PARBH/39-305...WGL-QQLDY-KF..ELKGGTS..LS-------------------.KGYG...LID-----RFSE--D----------
A0A016HWW3_BACFG/41-334H.....-TSVSE-YL..LFKGGTS..LS-------------------.KGWD...IIN-----RFSE--D----------
A3J913_9ALTE/48-337D...EN-LLGAH-ST..AFKGGTA..LS-------------------.KCWK...VIE-----RFSE--D----------
A6THM9_KLEP7/48-339D.....-EGFLH-PYTVAFKGGTS..LS-------------------.KCWN...VIE-----RFSE--D----------
A9KUC3_SHEB9/48-338D...ER-LLGDC-SV..AFKGGTA..LS-------------------.KCWG...AIE-----RFSE--D----------
Q82T38_NITEU/42-327V.....-SPLSA-DL..TFKGGTS..LS-------------------.KVYK...LID-----RFSE--D----------
Q0BSX7_GRABC/42-325G.....-SALGE-HL..VFKGGTS..LS-------------------.KAYQ...VIR-----RFSE--D----------
Q8KW71_9RHOB/44-328G.....-SDLGE-HL..VFKGGTS..LS-------------------.KVYR...AID-----RFSE--D----------
Q7D419_AGRFC/45-352N...RR-KDDAI-GL..YFKGGTS..LS-------------------.KAYG...LIK-----RFSE--D----------
A5ETQ0_BRASB/46-335H...RL-PADRP-RL..LFKGGTS..LS-------------------.KAYG...LIN-----RFSE--D----------
Q47DL1_DECAR/45-335N...GL-ATGGP-RL..LFKGGTS..LS-------------------.KAFG...LIS-----RFSE--D----------
A1TXM9_MARHV/49-331S.....-MPGAH-PM..AFKGGTS..LS-------------------.KVYD...VID-----RFSE--D----------
Q5WTN4_LEGPL/43-334S....N-EDLSP-HV..IFKGGTS..LS-------------------.KCYN...IIE-----RFSE--D----------
A0LER7_SYNFM/41-321G....L-QNWGQ-HL..AFKGGTS..LS-------------------.KGWQ...LIS-----RFSE--D----------
A3ZP42_9PLAN/42-324E.....-SEFAS-DL..VFKGGTS..LS-------------------.KVFG...VIE-----RFSE--D----------
Q2SRA8_MYCCT/41-317N....Q-SKWSM-SF..TFKGGTS..LS-------------------.KCFK...LIE-----RFSE--D----------
Q6MDY6_PARUW/41-327S....L-QKLKP-HL..TFKGGTS..LS-------------------.KVYG...LID-----RFSE--D----------
B0T9L0_CAUSK/43-328D....P-ARSTG-SM..IFKGGTS..LS-------------------.KAYD...LIQ-----RFSE--D----------
Q212U2_RHOPB/41-335A...LQ-GEEFA-SL..VFKGGTS..LS-------------------.KAYG...AIR-----RFSE--D----------
Q3A7V2_PELCD/41-315A....H-PPLAH-VL..MFKGGTS..LS-------------------.KVFG...LIE-----RFSE--D----------
A2SRV5_METLZ/41-321H....D-CPWKN-TL..TFKGGTS..LS-------------------.KAYG...LID-----RFSE--D----------
Q70K67_9ACTN/39-270R..LFR-SPDAE-QW..ILTGGSA..LQ-------------------.FRAP...TQA-----RPTT--D----------
A0A066RWX3_MYCTX/36-282Q...TV-QFGDN-RL..VFKGGTS..LR-------------------KCRLG...NVG-----RFST--D----------
Q0AYA4_SYNWW/12-213RLVECD-ILTDR-GF..YLAGGTA..LA-------------------.IQLG.....H-----RISV--D----------
A4AL11_9ACTN/32-263R..LVE-SPYAD-SF..VLKGGVL..LA-------------------..GYG....LR-----RPTR--D----------
V7MI27_MYCAV/21-255R...LQ-AAEPG-LW..VLKGGMA..LE-------------------.VRLS...DAA-----RVTK--D----------
Q2IEN8_ANADE/40-269R...LV-RVLGD-AA..TLKGGLV..LE-------------------.LRLE....RA-----RTTR--D----------
A6P1W9_9FIRM/34-254R..LEK-SQYAE-NL..VLKGGLF..IY-------------------.SITD...FDS-----RVTV--D----------
A7B855_RUMGN/34-254K..LSK-SGCED-TL..ILKGGLF..IY-------------------.TLTN...FES-----RATI--D----------
B4SEI7_PELPB/39-257R..LSI-SSFAD-RF..ILKGALL..LR-------------------.VWHA...PLA-----RPTM--D----------
A8ZZS0_DESOH/39-259R..LAQ-SRHAN-RF..ILKGALM..LR-------------------.IWQA...PET-----RSTM--D----------
Q5KV23_GEOKA/37-258R..LSI-SNYRD-KF..VLKGGLF..LF-------------------.SLTQ...FKS-----RPTK--D----------
A6LIS3_PARD8/36-258R..VSV-SQYKD-NF..LLKGGSL..LY-------------------.AMNG...LEA-----RPTV--D----------
Q64Q44_BACFR/39-261R..LSI-SRFYD-HF..FLKGGAL..LY-------------------.AHER...FLA-----RPTL--D----------
A7LUN8_BACO1/37-259R..ISQ-THYRE-NF..YLKGGAL..MY-------------------.AYER...FAA-----RPTL--D----------
A6DSE9_9BACT/33-256R..LGL-SEHKN-RI..TLKGAML..FI-------------------.LWSD...KSF-----RPTK--D----------
Q0F353_9PROT/38-260R..LSV-SRYRD-EF..VLKGAML..FS-------------------.YWSG...DAF-----RATK--D----------
A0LJY5_SYNFM/39-260R..IGR-SEWRS-RF..LLKGAML..YT-------------------.LWFD...ASY-----RPTR--D----------
Q5GY13_XANOR/41-262R..LSV-SEQQG-QF..LLKGALL..FD-------------------.IWFD...IPH-----RPTH--D----------
A3Z4Q5_9SYNE/35-255R..IGI-SEYCD-RF..LLKGAML..FA-------------------.LWYD...MPH-----RPTR--D----------
A1VW15_POLNA/35-256R..LSQ-SAHAD-RF..VLKGALL..FT-------------------.LWYD...MAH-----RPTR--D----------
A1W4H8_ACISJ/35-256R..VST-SPHAD-RF..LLKGALL..FA-------------------.LWYD...TPH-----RPTR--D----------
A6UKN5_SINMW/38-258R..LSR-SPHAG-RF..VLKGAML..MM-------------------.SWFD...DPH-----RGTR--D----------
Q1M7T1_RHIL3/81-300R..LSL-SEHRD-RF..ILKGAML..FV-------------------.TWVA...DPF-----RPTR--D----------
Q3Y113_ENTFC/32-252R..IVE-SPYHD-DF..VLKGGFL..IG-------------------.SKYG...LEN-----RSTV--D----------
Q8E4P3_STRA3/32-253K..LSQ-SSYSD-HY..IFKGGFL..LS-------------------.NVIG...VES-----RSTV--D----------
Q6MU66_MYCMS/32-253K..IVK-SKNKQ-NF..VIKGGFL..LS-------------------.NMMS...LNE-----RTTQ--D----------
Q932V7_MYCBV/32-254R..ISK-SNERD-NF..VFKGGFL..LS-------------------.NIMG...LDK-----RATM--D----------
Q6MDV8_PARUW/32-251R..LSR-STYTQ-QF..IFKGGFL..LA-------------------.YLME....IG-----RETT--D----------
Q6M9M4_PARUW/38-258R..LAR-SKYRD-QF..VLKGGIL..LS-------------------..RYL...EIG-----RETT--D----------
Q48616_9LACT/30-263R..LSA-SQYKE-KF..VLKGGFL..IG-------------------.VTYN...LSQ-----RTTK--D----------
A5ZR43_9FIRM/34-257R..ISL-SEYKN-QF..ILKGGML..VA-------------------.AMVG...LDA-----RATM--D----------
A6NXL8_9FIRM/29-249R..LAA-SAYKE-KF..VLKGGML..VA-------------------.AIVG...LDN-----RATM--D----------
Q5QWW7_IDILO/14-223N.FNSH-YLTEH-AI..LFGGGTR..IA-------------------.LELS....EY-----RESV--D----------
G5JBQ4_CROWT/13-234S.FNPT-ILQES-YA..YFGGGTL..LA-------------------.LLFD....EY-----RQSN--D----------
A3JKF1_9ALTE/13-197A.MNPE-LLKDL-QC..FFCGGTA..IA-------------------.LQLN....DF-----RKSV--D----------
A2SDV7_METPP/12-231A.LDAD-VLVAN-DC..LFGGGTA..MA-------------------.LRYG....EY-----RESV--D----------
A1VJ73_POLNA/12-232A.LNAP-LLREN-LC..LFGGGTA..IA-------------------.LRYG....EY-----RESV--D----------
Q2KB15_RHIEC/41-246L.MRAD-FFLAN-KC..WFAGGTA..IV-------------------.MNLD....EY-----RLSL--D----------
A7FCE4_YERP3/14-242S.IDAN-FIEDA-EC..YFAGGTA..IV-------------------.MLLD....EY-----RESI--D----------
A4Z034_BRASO/13-212D.LKQQ-GLPAP-EW..VLGGGTA....-------------------.LMLH...ANH-----RLSR--D----------
A4XFS5_CALS8/11-198C....A-KIPEE-EW..TFGGGTA..LS-------------------.LYFH.....H-----RESK--D----------
Q120Y5_POLSJ/21-211D.YLAT-VVDHP-TW..SFGGGTV....-------------------.LMLR...INH-----RHSK--D----------
Q21T10_RHOFT/21-211H..LER-QTSHP-LW..TFGGGTV..LM-------------------.LRIG.....H-----RQSK--D----------
A1WFU2_VEREI/21-211H..LEE-ATIEP-QW..TFGGGTV..LM-------------------.LRFD.....H-----RFSK--D----------
A0A0A5LPY8_BURCE/21-212E.IRKH-GTSSP-FW..TFGGGTV..LM-------------------.LRHG.....H-----RVSK--D----------
Q7WXF2_CUPNH/19-210E.VRKH-GGIEP-FW..TFGGGTV..LM-------------------.LRYR.....H-----RFSR--D----------
A0RUS7_CENSY/6-237YISTDE-VLKDV-QF..AFRGGTT..LS-------------------KVYFG...SRQ-----RISE--E----------
Q0W4I1_METAR/29-258Q....L-RPLFP-DA..IFKGGTA..LN-------------------.RVYLAKNGVS-----RFSE--D----------
O58109_PYRHO/28-258Q...LW-EIFGR-KV..ILKGGTA..LN-------------------.RVYLSKLNAS-----RFSE--D----------
B3E891_GEOLS/35-303H....L-AESDL-NF..VFKGGTS..LL-------------------.LHVP...VIR-----RLSI--D----------
A3XKF9_LEEBM/37-314H....L-KVSGL-DF..VFKGGTS..LV-------------------.LLLK...EGN-----RFSI--D----------
A7M3Q0_BACO1/35-306M....L-VKAGC-PL..VFKGGTA..LM-------------------.LILG..KSAH-----RLSI--D----------
Q8G4C8_BIFLO/40-283A..MMR-EGFFS-SL..VFQGGTS..LR-------------------.LCHG....SP-----RYSE--D----------
A6W084_MARMS/31-273V..MVK-QGVMQ-SL..TFIGGTS..LR-------------------.LCHN....SS-----RLSE--D----------
Q1NX48_9DELT/33-274L..LND-AGLLA-GL..TFIGGTC..LR-------------------.ACYG....AE-----RLSE--D----------
A3JJK0_9ALTE/33-275E..LSH-ADLLK-KL..TFIGGTC..LR-------------------.ACYG....SS-----RLSE--D----------
A1WLS4_VEREI/34-292A..LDD-AGLLK-HL..VFQGGTS..LR-------------------.LCRG....SD-----RFSE--D----------
Q7N0F8_PHOLL/35-281C..LDT-NGLLD-QL..TFQGGTS..LR-------------------.LCHG....AP-----RFSE--D----------
Q7N990_PHOLL/35-281C..LSK-DGLLK-EI..TFQGGTS..LR-------------------.LCYG....SN-----RFSE--D----------
Q1RR56_STRAM/9-205D.ILDL-G.SPY-PL..VLTGGYA..VQ-------------------..AHG...LVE-----RFSR--D----------
Q93P81_9BACT/17-212A.....-.EVFK-TF..RLVGGTA..LS-------------------.LQVG.....H-----RKSV--D----------
Q11WD0_CYTH3/17-213A.....-.DEFK-DF..RLVGGTA..LS-------------------.LHIG.....H-----RMSI--D----------
A6E7P3_9SPHI/16-212E.....-.PIFK-HF..RLVGGTA..LS-------------------.LQFG.....H-----RISV--D----------
A7HFJ3_ANADF/43-305Q.....-.HFGD-AL..LLKGGTL..LS-------------------.KVDL...GFF-----RMSE--D----------
Q2JEV0_FRASC/11-201G.....-LPESA-GF..AVAGGAA..L.-------------------.IVRD...LVD-----RETR--D----------
A0A0C9PEK8_LEGPN/30-299D.FTSF-PQFKD-KF..ALKGGTA..LN-------------------.LFFF...NLP-----RLSV--D----------
Q2LU48_SYNAS/35-302A.IRSH-PFLKD-KL..VLKGGTA..LN-------------------.LFIF...AVP-----RLSV--D----------
Q1LN31_RALME/10-279Q.VAPL-VFVDD-TF..ALKGGTA..IN-------------------.LFVR...DMP-----RLSV--D----------
Q8P655_XANCP/10-280D.IAPA-VFAND-IF..AMKGGTA..IN-------------------.LFVQ...DMP-----RLSV--D----------
A4JU43_BURVG/10-285G.IAPI-IFDTP-LF..AMKGGTA..LN-------------------.LFVQ...AMP-----RLSV--D----------
Q58AR5_RALME/10-285D.IAPP-VFDTD-KF..AMKGGTA..IN-------------------.LFLQ...DLP-----RLSV--D----------
A1VVH0_POLNA/10-280A.IAPA-IFETP-LF..ALKGGTA..LN-------------------.LFVQ...DLP-----RLSV--D----------
A0YF78_9GAMM/10-274D.VLPE-VSKEA-CF..AMHGGTA..IN-------------------.LFVR...DMP-----RLSV--D----------
Q3ARB4_CHLCH/11-282Q.ILPL-VAKEK-VF..ALKGGTA..IN-------------------.LFVR...DMP-----RLSV--D----------
M4TXV3_9XANT/17-288E.ILPV-LAQEP-RF..ALKGGTA..IN-------------------.LFEH...DLP-----RLSV--D----------
A3W959_9RHOB/11-281R.VLPY-VAKEE-IF..ALKGGTA..IN-------------------.LFYR...DLP-----RLSV--D----------
E0TGY4_PARBH/11-280D.ILPA-VAAEE-DF..ALKGGTA..IN-------------------.LFYR...DLP-----RLSV--D----------
Q7ND98_GLOVI/12-283S.LLPQ-VAKQE-CF..ALKGGTA..LN-------------------.LFVR...DMP-----RLSV--D----------
A6F2Q0_9ALTE/14-284Q.LVPF-VAKHQ-CF..ALKGGTA..IN-------------------.LFIR...NFP-----RLSV--D----------
A6X803_OCHA4/12-281R.LIPI-VARET-CF..SLKGGTA..IN-------------------.LFIR...NLP-----RLSV--D----------
A3UHI0_9RHOB/12-283R.TIPF-VAQEQ-CF..ALKGGTA..IN-------------------.LFVR...DLP-----RLSV--D----------
Q11AE5_CHESB/12-283Q.VLPF-VADEK-EF..ALKGGTA..IN-------------------.LFIR...NMP-----RLSV--D----------
Q2LU07_SYNAS/47-285S.....-...GC-KLPPVFRGGTC..LS-------------------.KIHA...DFY-----RLSE--D----------
A1TBN2_MYCVP/31-246R.....-.EFGD-RI..HFIGGTA..LA-------------------.RTHL...QDG-----RLSE--D----------
A1U7W6_MARHV/12-228AICEII-HDEGK-PL..VLKGGTA..LL-------------------.LGYD....LQ-----RFSE--D----------
A7NJN2_ROSCS/29-227A..LQR-AGAMI-PL..AFHGGTA..LR-------------------.FLYA....SA-----RYSE--D----------
A5D0Y6_PELTS/89-288I..FSR-VNKHG-DF..YFTGGTA..LA-------------------.VCY....LRH-----RESD--D----------
Q07LJ4_RHOP5/30-260A.IFSD-PFLRG-EL..RFRGGTA..LN-------------------KLHFP...TPL-----RYSE--D----------
A3WUQ2_9BRAD/30-251N.LFED-AFLRD-EL..RFRGGTA..LN-------------------KLHFP...KPL-----RYSE--D----------
Q5X0F2_LEGPL/30-282E.IFSN-PFLAS-EL..AFRGGTA..LH-------------------KLFFH...PAA-----RYSE--D----------
A0M137_GRAFK/30-253E.IFSD-DFLRE-NL..AFRGGTA..LH-------------------KLYLD...PAP-----RYSE--D----------
A7LVH9_BACO1/30-253A.IFSD-DFLAS-KL..AFRGGTA..LH-------------------KLYLS...PQP-----RYSE--D----------
D5T6J5_LEGP2/30-253E.LFND-PLISE-SI..AFRGGTA..LY-------------------KLFVD...KPA-----RYSE--D----------
Q3SW13_NITWN/30-253E.IFSH-PVLSQ-AL..AFRGGTA..LY-------------------KLYLK...PAA-----RYSE--D----------
A1BFK9_CHLPD/30-252E.IFSN-SFLAE-SL..AFRGGTA..LF-------------------.KLHM...PPV-----RYSE--D----------
B9M297_GEODF/30-250E.LYSH-PLLAE-NL..AFRGGTA..LF-------------------.KLHL...PPA-----RYSE--D----------
O54654_HALSA/29-256G..IFT-SDFGE-NL..MFKGGTA..LS-------------------KLYFP...QSW-----RFSE--D----------
Q82TQ8_NITEU/35-265G..LAG-HPLRD-VL..AFKGGTA..LR-------------------.RCWF...VDY-----RFSE--D----------
Q3B1Q4_PELLD/29-234G.LASQ-EEVAD-SW..VFKGGTC..LK-------------------.KCLF...ETY-----RFSE--D----------
A8ZVR5_DESOH/29-286G.IFNH-PAIGK-SW..AFKGGTC..LK-------------------.KCYF...ETY-----RFSE--D----------
A6GZS9_FLAPJ/29-275A.IFNE-PELKE-TL..IFKGGTC..LK-------------------.KCWF...EEY-----RFSE--D----------
Q1Q4B8_9BACT/29-269G.LYNR-SLFKE-CF..RFKGGTC..LR-------------------KLYFK....HF-----RFSE--D----------
A1BFT1_CHLPD/31-275G..LWR-AGFFQ-VA..AFQGGTC..LR-------------------.ILHG....LP-----RFSE--D----------
Q0YUP4_9CHLB/31-275A..LWR-AGFFE-KA..AFQGGTS..LR-------------------.ILHG....LP-----RFSE--D----------
Q74DE8_GEOSL/31-281G..LWR-SKFFE-HA..AFYGGTA..LR-------------------.ILYG....LD-----RFSE--N----------
Q1NX65_9DELT/31-281G..LWR-GKFFE-HA..AFYGGTA..LR-------------------.IMHG....LD-----RFSE--D----------
A6VTK2_MARMS/28-267G..LYR-GGFFQ-KA..AFYGGTC..LR-------------------.IFHG....LP-----RFSE--D----------
A6LDX6_PARD8/32-268G..LYA-GGFFE-SA..AFYGGTC..LR-------------------.IFHG....LQ-----RFSE--D----------
A0RWG6_CENSY/28-254V..MVD-FPKID-KM..VFKGGTS..LK-------------------.KAYF...EDF-----RYSE--D----------
A0RWG1_CENSY/28-244I..IAD-FPGID-KI..VFKGGTS..VK-------------------KMFFR....DF-----RYSE--D----------
A7LH05_9HELI/21-239A..IVK-NLADT-PM..VLKGGTA..LY-------------------.LGYG....LN-----RFSE--D----------
Q649Z3_9ARCH/29-245S....I-YASTN-DL..AFKGGTC..LW-------------------.FFHG....LN-----RFSE--D----------
Q6L332_PICTO/28-244E...IY-NEFND-EL..IFKGGTS..LK-------------------.YFYN....LN-----RFSE--D----------
Q3F100_BACTI/38-319A.LLSS-DIFVD-KT..VLTGGSV..LN-------------------.LVYN...VHN-----RVSV--D----------
A0A063UM99_BORBO/15-280A.ILSD-DKLFE-NL..VLKGGNA..ID-------------------.LIHQ...ITA-----RASV--D----------
Q138J1_RHOPS/18-217S...LE-PAGDL-NF..VLYGGTA..VA-------------------.LHLG.....H-----RISI--D----------
A4JFW1_BURVG/16-258D...LA-PVKDL-GF..TLYGGTA..IA-------------------.LRRG.....H-----RTSV--D----------
Q8KW54_9RHOB/74-323T.LAMT-RPYCQ-QV..FLKGGIL..MG-------------------.VVYG....SP-----RQTG--D----------
A6GR58_9BURK/30-277A.IGSS-APLRT-QM..VMKGGML..MA-------------------.IRYN....ST-----RFTR--D----------
Q7N7R6_PHOLL/25-274A.IASN-EYLKP-KM..IMKGGIL..LG-------------------.LRYQ....SS-----RFTE--D----------
Q3JF57_NITOC/25-272A.IAGT-PSLQT-AM..IMKGGVL..LA-------------------.LSYR....SP-----RYTS--D----------
A1X5X8_ECOLX/40-289S.ISIE-ESLNE-MM..VMKGGTL..LG-------------------.VKHG....SD-----RYTK--D----------

PF14907

D4IJI6_9BACT/30-280WREIYD-LSSVQ-GVLAQAWDGMQ.LLP................E..A...M...RPP...R.ALRL--Q----------
D6D2Z8_9BACE/32-294WWDVYR-MAVRQ-TVTGIVCRGLH.HLP................E..A...L...LPG...D.ALMI--R----------
E3EIB5_PAEPS/42-310WSRLLR-LIEHH-RVVPTVYLQLK.TLN................H..P...F...IPA.....ELLR--N----------
E6SSN3_BACT6/27-274WQTLYR-MAQAQ-ALLAIAFDGVS.LLP................D..E...L...RPP...R.PLYL--Q----------
A6L7U2_BACV8/35-288WQACYR-LACTQ-GVMALAWDGIQ.TLP................A..C...L...QPP...K.ALKL--N----------
D5EUU1_PRER2/28-271WRWLYQ-MAVRQ-SLVGVCYQGVC.QLS................G..K...Q...QLP...V.DIAM--Q----------
F2KYQ1_PREDF/45-298WDALYD-FGYKQ-AILGVFFHGIK.RLS................Q..S..EH...RPG...R.QQVL--K----------
A1AK32_PELPD/41-295WRDFLS-LAAEQ-RVRPLLWHRLR.EKG................L..E...Q...AVP...V.EIVD--E----------
D0MHT5_RHOM4/36-289WERLYR-LMLRH-GVVALAYRNLL.QAA................P..D...A...VPE.....PWRI--R----------
C8VWU0_DESAS/27-271WEKLYQ-LSIWH-GISNMAWYGIM.QLD................T..E...H...RPP...Q.NILM--K----------
C8W2H3_DESAS/29-273WEKLYK-FAAWH-GVSNMACYGLN.RLT................C..D...N...QPP...Q.DILE--K----------
F0SY73_SYNGF/27-282QSELLN-LAMEQ-KVSAYLYTLVG.KKF................D..V...G...LLD...E.KIKE--E----------
B0CEE6_ACAM1/41-296WHTLVR-LANVH-GVQTLLYQSVK.SIG................K..E...Q...IPA.....IVLK--D----------
E6X194_NITSE/55-325IQNLLE-LSSRH-GVLPLVYKNLK.AIEKSIQTSSSQNDTPPTQN...........PKSKIR.NLLI--E----------
A5G508_GEOUR/51-304WGAFTA-LVNRH-EVSALVYAALR.KHA................D..N...R...FPN.....NVRE--K----------
B8I678_CLOCE/34-315WSEAIY-QMITH-RTLPMFRYNLK.KFN................L..Y...D...SME...K.ELQR--L----------
B8HPX3_CYAP4/33-304WKTLIQ-TSIAQ-GVMPILYESLK.TIE................Q..K...Y...VPR.....SVMV--Q----------
A6QAF7_SULNB/69-323LHTLIS-LANQH-GILPLIYKTLS.SLN................A..E...L...LTL...N.TFLS--E----------
C8W5K5_DESAS/42-296WQFFAH-LAVHH-RVYPIVYKTLS.QLN................N..P...V...VPG.....NVLC--L----------
A0LED8_SYNFM/43-296WDALLR-LAEAH-KILPILHAVLK.ESH................W..R...E...VPE.....SVLE--T----------
C8W092_DESAS/36-289WDLFLH-LAVYH-RLFPLAYKTLC.SLN................N..P...A...VPA.....EVIN--A----------
B3U4I7_9BACT/63-313WELVWK-LSRTH-GVAPLVYRNLV.TIC................P..A...A...LPS.....SIHE--S----------
B8HL63_CYAP4/37-290WPYLEA-IALRH-QVFPLFYRRLE.SLG................L..E...H...LPP.....AVAQ--S----------
C6CW48_PAESJ/39-291WPLFLR-FAVYH-ETYPILYPLLV.QLN................A..K..QQ...WTP...D.FVMA--R----------
E3GKM5_EUBLK/27-271WDVVYR-EARRH-SVAGMADYGLE.KLA................E..E...E...QPP...Q.LVRQ--S----------
Q5V4C2_HALMA/33-294WDRVVA-LARYH-GIVQLLYEGLE.AMARE............SGD..E...F...TVP...A.AVLT--R----------
B0CA05_ACAM1/43-304WHHFLR-LTKFH-KVIPPVYQCLK.QHT................H..K...N...IPD.....YLLA--S----------
E4NR20_HALBP/45-311ADEVLT-AAHHL-GVGPLVASHLT.DAD...........................VPA.....AFES--R----------
D0MJ16_RHOM4/27-280PAEVAR-LAVQQ-GVGPLLYRALK.AAS................P..A...K...VPE.....VLLA--A----------
D5C0P8_NITHN/38-283WDKLLY-YAQVH-ALTPLVHEVIA.SQY................Q......S...VVP...I.NILK--A----------
E4T3H3_PALPW/32-289WDYLTK-TIIDR-GIAPLLFKKLP.ALK................N..S...S...LIP...D.AVQA--K----------
B8HYI9_CYAP4/46-308WTYVLN-QANDH-GLMPLLYRQLV.SLT................H..A..NH...FVS...T.LVKT--K----------
Q2S9G8_HAHCH/40-294WECFLQ-QLRWH-RVTPLVWRNLS.AAG.......................E...SVP...G.GVRK--K----------
E0RZJ9_BUTPB/57-297IGELIN-YAAKG-HIYYPIASSLI.KLD................I..D...E...KHA...E.IMRN--D----------
F2NH29_DESAR/30-285WPDFLR-WVDRH-RVAPLVYENLR.RYG................G..N...G...VPG.....AVRN--A----------
E6UIV6_RUMA7/27-267IERLYQ-LAKYH-TVRAAVNIALK.SAG...................................VVDN--K----------
B3DZF9_METI4/33-292WELFYN-LCFVH-GLWGFVLDNLN.GRF...........................PYP...G.EIKK--K----------
F2JWV8_MARM1/27-283VSLLAR-TCAQH-RIGPLLSESIK.KAN.......................L...SVP...D.TLSD--Y----------
D9SE91_GALCS/39-298ADALIW-LAIRH-RIEPLLYHNLK.QHA................V..G...V...FSS.....EILD--K----------
D1CIV7_THET1/37-287WPRLLA-IAHSQ-DVVPVLPYSPL.WSA................V..R...A...CAP...P.EVLS--N----------
D2QFF6_SPILD/34-281WHRVYT-LAVRH-RLTPFLYRSLY.QIP...........................AIP...E.SFIR--T----------
D4LAD3_RUMC1/30-273LRPMLS-LAQQH-TLGAMTCMSFE.HAG................L..L...E...RLS...P.EDAA--A----------
D4L7W6_9FIRM/34-277WQSIKM-LANYC-SVESLVANAVL.SLD................K..K...Y...VSL.....EVYE--K----------
Q7N4C9_PHOLL/37-311WDRFLS-VVNRQ-KIVGIVYKSLS.EMK................L..L...H...LVP...Y.RVAS--A----------
E6UK59_RUMA7/32-272LSQLYE-VAQTH-SLTAITAYAID.SSN...........................IID...E.....--R----------
E8X100_GRATM/35-290WRAFLA-AAHSH-RLSPLALCGLQ.SAA................L..S...A...VPD...F.V.FR--E----------
D1YWY8_METPS/61-314WYELFS-ALKPH-GILPLLYWQIL.HIP................Q..E...S...RPA...K.ELVD--E----------
A9AY74_HERA2/29-280WKVLAH-LADYH-EVEGLLWSVLR.HQA............................LP...A.TLAE--H----------
E8UZW2_TERSS/40-293WSRLLR-IAHRN-RVKGLVFSSLS.THG.......................D...LVP...L.VVLE--E----------
Q5ZRD2_LEGPH/18-272APEILK-TAQRM-RLTNSVYTILR.EHY.......................G...IPA.....SQLA--N----------
Q2W7B9_MAGSA/35-286WSQVVA-GATSH-HVVPLVADLAL.RPG................A..A...A...MPA.....AVRN--D----------
Q47DA0_DECAR/28-284WDDTLR-LARQA-RLLGLLGHRLC.EQK................DIWA...Q...IPP.....PVQG--H----------
A5VF23_SPHWW/48-301WDELIG-MAARG-RLLVQVQHGLL.VSG................I..A...A...PPK...VGAAVK--A----------
C7RTZ8_ACCPU/29-287WELLLR-VARRV-RLLGRLESELS.RLG................L..L...G...SIP...T.RAAA--H----------
A9NH68_ACHLI/22-261ELELTK-IIFEN-GLVGLLFETID.KSS................F..........KTP...K..YHQ--M----------
E4NA58_KITSK/44-325WGAFTD-AAARH-KLLPLVGRHVH.RHR................L..D...R...KGP...G.TFPY--P----------
Q220U3_RHOFT/22-279WDLLIR-QARRT-KLLARLAHTLE.RAG................L..L...K...TVP...M.APRL--H----------
C8VW96_DESAS/31-295PECLTN-RLNEL-QVIALFYDAVS.SEK................V..P...L...ELP...S.ETLK--A----------
Q1IJX8_KORVE/41-297DEVAWQ-VAKQH-ELEGNLGHRLI.DIL................G..E...Q...VP.........L--R----------
Q0ACH9_ALKEH/23-281WDALLR-VARVA-SLEARLHALLQ.ERD................L..F...D...RVP...A.RPRR--H----------
Q2G399_NOVAD/40-294WSDLAA-LAEDK-RAAPLVRRSIA.IAG................I..Q...P...IVP...A.SALQ--E----------
Q82U71_NITEU/28-285WELLLR-LARRA-QLSGYLAAKLE.KDG................L..L...D...SIP...A.RASN--L----------
E8X2I6_GRATM/22-260WEQAFE-LAEAE-QVLPSFVSTLR.RSG................L..P...L...SPS......IEK--R----------
Q2N714_ERYLH/28-286WQRIDI-IAAQH-RLSPHLHGRLE.RGE................L..D...C...AVP...P.DTRA--G----------
A1K446_AZOSB/28-282WTALLA-AARAA-NLLGTLAARLT.DAG................I..D...L...PPA...P...AR--H----------
Q3SG05_THIDA/23-278WDTLVR-QARAA-GLLARLAHRLR.EHG................M..A...N...SLP...G.VVRW--H----------
A0L573_MAGMM/21-281QEPLLR-MLRVE-GLLAHVGARLQ.ASP................H..W...Q...NMP...E.DLQG--V----------
A1SY03_PSYIN/35-284FDRLQT-LIIQH-RTHPCIYNNIR.QHF................I..E...Q...VPS...K..LLF--Y----------
A5VCA1_SPHWW/21-272WTSLLA-IARAE-RLDGSLAYRLA.DMP...........................LPA.....PVAR--A----------
Q1GTD6_SPHAL/21-273WDRVIT-VARAE-AMLGTLAHRLD.ETP...........................LPS.....TVAA--L----------
C6W7P4_DYAFD/31-292PQKYLA-LAKWH-QIRPLAFEHAA.EKS................L..D...L.....P...A.PVLR--S----------
A2U3F5_9FLAO/33-287WDDIVK-LSTAH-YVFPALFCNLK.KAN................F..L...A...YLP...E.DLVA--Y----------
Q2RPP9_RHORT/33-290WDRLIP-LARHA-GVLGRLGYLID.AAG................L..T...P...ALP...A.APAR--H----------
Q98C81_RHILO/47-300AAAVAD-IARLN-KVATFVLKVLS.RAP................V..G...E...RPA.....ELFQ--W----------
D3SEY4_THISK/21-280WAPLLA-AARES-ALPGTLWHLAD.DAG................L..A...D...GLP...E.PVAS--Q----------
D4Z532_SPHJU/20-266WNALVA-MARAE-RLIGTLALRIG.DRP...........................VPA.....AVRP--I----------
Q5P7H0_AROAE/23-275WEHVLR-LARMT-GLHGRLAAS...NDG................N..S...D...LPE.....PVRR--H----------
D9R9Y8_CLOSW/28-270WEKMYR-LADYH-NVAHAVYYGIM.GLE.......................E...NIP...Q.AIRQ--R----------
C8X6N8_NAKMY/33-276IDEFVD-AARLH-RIAPLAYVATR.GLD.......................D...VVA...G.RVRE--D----------
E8WZ57_GRATM/42-294WKSNLK-WLDTS-GLALYLLGHLQ.ELG................V..G...E...VLP...T.KIVL--R----------
A1WX94_HALHL/26-285WTGILA-VGREN-LLLGALWHRAV.SCG................V..E...G...QLP...E.WVAG--H----------
C4ZNM3_THASP/23-275WDRVLR-LARMT-GLHGRLAAANA.DNP...........................TVS...E.RVRR--H----------
B9JQN6_AGRRK/37-306FAQLFA-AIRIH-RVAGLVQQLIK.AQQ................D..NSTFQQKNTHL...D.SFLT--A----------
Q15WK0_PSEA6/24-278WEFLIR-IAREA-SVLPRVAYALD.SVI...................E...L...VPE...Y..AQT--H----------
E3FNY0_STIAD/23-272WEDFVD-WAIAQ-GLAPLAAYNLEYRLG................G..A...D...APE.....WARD--R----------
A7HIS8_ANADF/20-254PALLAD-VLEAH-GLAPLASYQLE.TTR................L..G...A...AVP...Q.ALRE--R----------
Q1DDG5_MYXXD/51-300WEEYVD-WAIMQ-GLAPLAAYNLE.YRL................G..A...G...NAP...E.WARD--K----------
C2X1P1_BACCE/40-289WELFLE-QAVHH-RVYPVIYQKLK.QVD................E..E...I...IPS.....NIVQ--S----------
C3AT78_BACMY/45-292WNKFLK-LALHH-RMYAFIYPKMK.SID................K..Q...L...VPS.....NVVQ--V----------
D4KWT4_9FIRM/552-802WESILS-IADRH-RVLPLLYDVLE.NIL................P..E...D...GA.......DWK--R----------
D4MW73_9FIRM/28-281WEKIYD-ISQKQ-QLAPMIYQQIF.SNE................S..F...Q...NSD...P.GFQQ--F----------
F2G8P1_ALTMD/26-277LSELFV-FLRAA-NLLSIFAHKIK.RKN................M..V...D...RLP...E.SIQW--H----------
I1YWC5_PREI7/27-278FSALQN-IANMQ-TVNGLVYSSLI.NNN................V..K...L...PQQ...E.ALV.--.----------
I3YL41_ALIFI/31-278WSRVYG-QAAQQ-GVLAVAWESVR.RLS................P..D...L...QPG...R.GLRL--Q----------
I3YQI9_ALIFI/33-278WDDIFR-MAADQ-GVCAVIGDGME.RLP................E..K...L...RPP...R.DIRL--R----------
Q8KKS5_RHIEC/2-289....VW-RAEHN-RTVPLLENHLR.RLD................L..L...T...LLP...T.EAAH--Y----------
Q8XN73_CLOPE/29-276WNEIMC-EANAH-EISALIYSSIY.GIK................S..L...E...GLS...K.EELN--Q----------
R5QD91_9FIRM/30-263IERVIK-CARVH-GVLPFLQECPV.FME.................................E.PYRE--K----------
R5QEH8_9FIRM/29-271WGKFYR-ICKFH-KIQSMVCPGIQ.KLP................K..E...Q...QPP...E.EILK--K----------
R5XE76_9CLOT/30-276LVYIYK-MSEIH-HVVPMIYNAAY.NED................F..F...K...ECD...A.NFQA--M----------
R6KK05_9BACE/28-278WEEIYQ-LARTQ-ALLAITFDGVL.SLP................A..E...L...RPP...R.PLYL--Q----------
R6QP25_9CLOT/29-271WEKLYR-ICKFH-KIEAVVAHGID.KIS................G..K...E...QIP...Q.EVRK--K----------
R7JPI5_9BACT/51-294WTRLFT-LAAQH-GVTALLFDTIL.RLP................E..Q...Q...QPS...R.ALKI--R----------

PF10706

A6TJ11_KLEP7/73-246IHKILA-AADER-NLPLWIGGGWA--ID--------------------ARLG---RVT-----RKHD--D----------
Q8YL66_NOSS1/1-174IHQLFA-ASDKI-NLPLWLQGGWA--ID--------------------AKLH---RIT-----REHE--D----------

PF04991

Q753A8_ASHGO/506-745--------TNSS-NLVTWVAHGSM--YA-------------------WMYDG---LAF-----PWDG--D----------
A5DCG8_PICGU/263-461--------AREA-GIDTWLAHGSA--LG-------------------WYWNR---SNL-----PWDN--D----------
A6LC14_PARD8/39-262--------CRKH-DISYWMCSGTL--LG-------------------AVRHK---GFI-----PWDD--D----------
Q87Q28_VIBPA/24-242--------CERH-DLEYSLAGGTL--LG-------------------AIRHK---GYI-----PWDD--D----------
Q03SH4_LACBA/23-245--------CHQL-GLPYFLMGGSL--LG-------------------AIRHQ---GFI-----PWDD--D----------
A7TLM6_VANPO/513-754--------TKAN-GIISWLSHGTL--YG-------------------YFHNG---ATF-----PWDN--D----------
A6M2A9_CLOB8/33-257--------CDKH-NIRYFLDAGTL--IG-------------------AVRHK---GFI-----PWDD--D----------
YJ31_YEAST/469-720--------VKAN-GLISWLSHGTL--YG-------------------YLYDG---LKF-----PWDV--D----------
Q03GP1_PEDPA/22-243--------CDKH-DIKYMLIGGTL--LG-------------------AIRHG---GFI-----PWDD--D----------
A8AZQ7_STRGC/28-259--------CKEH-GLISYMVAGTL--IG-------------------SLRHG---GYI-----PWDD--D----------
A6LBV7_PARD8/43-251--------AKEN-NIPYWIDGGSL--IG-------------------IVRHK---GFI-----PWDD--D----------
A5UNE2_METS3/36-262--------CEEN-DIEYFADSGTL--IG-------------------AIRHN---GFI-----PWDD--D----------
A5UND9_METS3/81-296--------CKKH-DIDYWLEGGTL--IG-------------------AVRHG---GFI-----PWDD--D----------
Q6FSB7_CANGA/473-717--------TKAN-GLITWLSHGTL--FS-------------------HLYNG---LTF-----PWDD--D----------
Q832Q2_ENTFA/24-252--------CRSN-NLHYTLFYGTL--IG-------------------VERHK---GFI-----PWDD--D----------
A5UNH1_METS3/30-252--------CEEN-NIEYFIYGGSA--LG-------------------AVRHG---GFI-----PWDD--D----------
MNN4_YEAST/490-746--------TKAN-GIISWLSHGTL--YG-------------------YLYNG---MAF-----PWDN--D----------
A7TID6_VANPO/522-767--------TKAN-GIISWLAHGTV--YG-------------------YLYDG---LSF-----PWDN--D----------
A6LD13_PARD8/44-278--------CEKE-GLTLMLSGGSC--LG-------------------AVRHK---GFI-----PWDD--D----------
Q6FRE8_CANGA/512-760--------AIAN-GLVSWLSHGTL--YG-------------------YMYNG---MTF-----PWDN--D----------
A6LI11_PARD8/44-274--------CSKY-GLCFMLGGGSV--LG-------------------AVRHK---GFI-----PWDD--D----------
Q2NIC1_METST/35-244--------CQKY-ELKYWLDYGTL--LG-------------------AIRHG---GFI-----PWDD--D----------
A6L4H8_BACV8/26-253--------CKRH-DLTYYVYGGTL--LG-------------------AIRHQ---GFI-----PWDD--D----------
Q9CIZ2_LACLA/24-251--------CREN-GIEYTLAGGSL--IG-------------------AIRHG---GYI-----PWDD--D----------
Q832P6_ENTFA/27-250--------CEEH-NLTCYFCGGGC--IG-------------------AIRSQ---GFI-----PWDD--D----------
Q6CV94_KLULA/470-711--------VKAN-GLISWLAHGTM--YG-------------------WMYNG---RTF-----PWDN--D----------
B0URY8_HISS2/24-243--------CAKN-DIQYSLGGGTL--IG-------------------AVRHK---GFI-----PWDD--D----------
D6CZV8_9BACE/24-240--------CKEH-NLRYYIMAGTM--LG-------------------AVRHK---GFI-----PWDD--D----------
G0VHC4_NAUCC/584-836--------TRAN-GLISWLGHGTL--YG-------------------YLYNG---HSF-----PWDN--D----------
LICD_HAEIN/24-243--------CERY-KISYSLGGGTL--IG-------------------AIRHK---GFI-----PWDD--D----------
Q1G8I9_LACDA/45-275--------CQKY-DIPWYLSGGSL--LG-------------------AVRHQ---GYI-----PWDD--D----------
Q6CV92_KLULA/338-579--------..SN-DLTAWLAHGTL--YG-------------------WLYNG---LAF-----TWDG--D----------
Q8CWR1_STRR6/24-245--------CKKH-DIPYFLSYGTM--LG-------------------AIRHK---GMI-----PWDD--D----------
Q8DPD7_STRR6/25-246--------CKEH-DLLCYLCGGGA--IG-------------------ALRNK---GFI-----PWDD--D----------
Q8DPI0_STRR6/24-243--------CKKH-NINYIINYGTL--IG-------------------AVRHE---GFI-----PWDD--D----------
Q8DYQ6_STRA5/24-249--------ARDN-KIEYSLGGGSL--LG-------------------AMRHK---GFI-----PWDD--D----------
Q8R630_FUSNN/25-234--------CNEN-KIRYWLDSGTL--LG-------------------AVRHG---GFI-----PWDD--D----------
R5K6F7_9CLOT/25-248--------CEKH-GLRYYLCGGTL--LG-------------------AVRHQ---DFI-----PWDD--D----------
R5U2Q7_9BACE/28-256--------CRKH-DIPYFVIGGTA--IG-------------------ALYDR---AIL-----PWDD--D----------
R6N240_9CLOT/23-251--------CDEE-QIRYYLSSGTL--LG-------------------AVRHQ---GFI-----PWDD--D----------
R6N4Y5_9CLOT/26-257--------CEKH-SLEYFAVDGTL--LG-------------------AVRHG---GFI-----PWDD--D----------
R6X1W1_9PORP/32-241--------CRKH-GIRYWLSSGTL--LG-------------------AVRHG---GFI-----PWDD--D----------
R7EDL2_9BACE/24-240--------CKEH-GLRYYIMAGTM--LG-------------------AVRHK---GFI-----PWDD--D----------
R7EEU8_9BACE/31-244--------CTKY-DIPYWLDGGTL--LG-------------------AIRHG---GFI-----PWDD--D----------
R7EJM5_9BACE/32-245--------CRKH-KLSYWLDGGTL--LG-------------------AMRHG---GFI-----PWDD--D----------

PF04229

Q7UQR9_RHOBA/21-182--PIRL-MHHDA.RWKQEFEQTRS---------------------------------------SLLQ--S..........
F4FG59_VERMA/4-164--AVEI-VDYQP.AWGVDFTELGS---------------------------------------ALRI--A..........
H6L1E0_SAPGL/5-166--TIEV-CPYRE.DWPQAFAKEKA---------------------------------------AILS--V..........
E4N0U3_KITSK/9-181--.VLV-LPYDP.DWPARAADLAA---------------------------------------ELRA--A..........
D1BEG0_SANKS/7-190--PARL-ARYDD.TWPVRAAEVLA---------------------------------------DIQL--R..........
T0T7N8_9STRE/5-167--DVVV-ISYQE.SWKDDFEQISK---------------------------------------ELQE--A..........
F0R0L2_BACSH/21-180--KIIL-HEYDP.QWKLLFQHEKA---------------------------------------RIEN--A..........
R6RXV9_9CLOT/9-171--TVKL-IPHQE.EWDQNAKEMIG---------------------------------------ILFE--L..........
C7M6I7_CAPOD/21-178--PINL-TQHNP.LWKEWYEEERS---------------------------------------FLLK--Q..........
K9PW19_9CYAN/3-165--KVEV-VAHNL.SWKKEFEQESR---------------------------------------YLVK--A..........
F8I524_SULAT/19-179--RVHV-EPYNP.LWAVRFQDEAA---------------------------------------QIQK--A..........
D9S0W3_THEOJ/3-164--KVVV-TDYNP.MWPAMFEAEAA---------------------------------------KIKE--I..........
R6D2S7_9CLOT/3-163--.VIV-TAYNP.NWPALYEQEAQ---------------------------------------AIRQ--I..........
C1A083_RHOE4/211-392--.PEL-APADP.SWPAQAERIIG---------------------------------------RLSL--A..........
E1VYF6_ARTAR/165-333--.IEI-AEPSP.HWVPDFLALHA---------------------------------------CLAQ--A..........
W6R4W1_9RHIZ/3-163--PVRV-VDYDP.KWPDLFEAARA---------------------------------------ELLD--L..........
W5TQQ6_9NOCA/29-187--PVEI-VAYDP.NWPQRFETQAA---------------------------------------RIRT--A..........
B2TLP2_CLOBB/5-165--HVIV-EDYNP.KWKESFESIKD---------------------------------------ELLA--V..........
B9JDR1_AGRRK/3-162--PIRL-VDYDP.AWPALFQSRSA---------------------------------------AIAT--L..........
I0H1C1_ACTM4/212-377--NLRI-VPFDP.EWPARADRLIA---------------------------------------RIRH--G..........
F9UMA6_LACPL/43-192--PIQL-TAYQS.DWQKQATEYQT---------------------------------------LLRQ--Q..........
Y3154_VIBCH/37-187--...A-DEYQA.SCENLYRKYEL---------------------------------------EIAA--L..........
Q81YH7_BACAN/4-173--RITI-EEYNI.KWESEFNKLQT---------------------------------------LIND--V..........
E6S9I6_INTC7/214-387--..AV-VAPRS.DWGERGARLVA---------------------------------------RVAH--A..........
D5DGR0_BACMD/3-175--..KI-VQYET.KWSLLYQMEKE---------------------------------------ALLN--T..........
W5TJ52_9NOCA/212-391--AIEV-TDHDP.AWAQQAQRLIA---------------------------------------RLWL--A..........
K9XBR5_9CHRO/3-167--EIII-VEYDP.HWSQQFEAEAT---------------------------------------TIWQ--V..........
E3GIN1_EUBLK/3-163--PIIL-KKHNP.NYKDWYEEEKQ---------------------------------------RIIR--H..........
K0KAS1_SACES/227-393--PLNV-LPYDP.TWPEQAARVGA---------------------------------------RISL--A..........
A8AWN1_STRGC/18-179--PIFL-REHQL.EWKDWYEEERL---------------------------------------RLLS--F..........
I3R2F8_HALMT/25-186--TVEL-VPYDP.QWRDEYEREVE---------------------------------------RLHS--R..........
D4J128_BUTFI/5-166--HVVV-LPYNE.KWKQDFTTIKE---------------------------------------ELSA--A..........
A4FKT9_SACEN/207-379--SPVL-VEPDP.EWPRTARRLLA---------------------------------------RVER--A..........
B6QAD6_PENMQ/29-191--PITI-IEYDI.IWPEQFSIVHQ---------------------------------------RIQQ--A..........
D1AHI7_SEBTE/18-178--PIIL-KDYNP.EYRNWFGAEKQ---------------------------------------NILN--H..........
R4KDL8_CLOPA/5-164--HVVV-EDYNP.NWKYEFEKIEA---------------------------------------ELRT--V..........
A5G319_ACICJ/3-168--HVEM-AEYDP.AWPGMFETEAR---------------------------------------LLKR--V..........
H6N9P1_9BACL/2-161--KVRL-SEYSE.NWTRLFQEEAD---------------------------------------FLMT--I..........
Q2K5X8_RHIEC/4-163--PVEL-VSYDR.EWPEAFQRIRA---------------------------------------NLLA--L..........
Q8DTG8_STRMU/18-179--PIFL-VEHKE.EWEDWYEEEKE---------------------------------------RLLH--L..........
C4KZG2_EXISA/3-162--KVEV-VKYNP.EWNQKFEEEAS---------------------------------------KLSR--L..........
E4NR36_HALBP/5-165--PITI-AEYNP.EWPDIFERERQ---------------------------------------RLAS--V..........
I7EVS4_PHAIB/4-164--...V-VAPDP.TWPAQAQAEAG---------------------------------------RWSD--S..........
K0NHL1_DESTT/8-169--TVRV-VDHNS.GWADLAAQACR---------------------------------------RVLE--V..........
K0JPZ1_SACES/83-263--PPVL-HDHDP.DLPVVARRLLD---------------------------------------RLRT--G..........
H6NPI6_9BACL/17-180--PVTL-APPDP.QWPAQGENLRQ---------------------------------------ELAS--L..........
Q88IL4_PSEPK/6-162--..KI-TPYDP.TWPARFLTDKP---------------------------------------LIAS--A..........
Q65HR6_BACLD/152-312--KVKV-VSYKE.EWKGEFFKEKK---------------------------------------QLEA--L..........
D8MSB8_ERWBE/3-163--IVVV-APYDQ.QWPVQYQAERA---------------------------------------RLEA--V..........
R5WT49_9BACT/2-163--NIRV-VPYNP.EWPAAYEHEAA---------------------------------------TIAR--I..........
R5MRQ0_9BACE/17-180--PILL-TEHQE.NWKDLYIQEEE---------------------------------------QLRT--F..........
L0IAX8_HALRX/8-169--TVEL-VTHRE.CWRGTFEAEAN---------------------------------------RLQD--I..........
Q55AI9_DICDI/5-191--SVTV-VEHDP.RWKELFLEEEK---------------------------------------QIKE--V..........
B0C1Z8_ACAM1/3-165--TVEV-VSHNP.AWKMIFQTEAS---------------------------------------LVKE--A..........
A7MK97_CROS8/6-166--QIVL-EPYNP.AWPAQFAEEEK---------------------------------------RVRE--V..........
C8W1B5_DESAS/176-344--PIVL-REYNP.AYPRWFAEEKA---------------------------------------NLTR--L..........
Q83EE3_COXBU/18-178--IIEV-VPYDP.DWSNQFEKEAL---------------------------------------LLKL--I..........
D3FQ45_BACPE/3-163--KVQV-VPYQK.DWPDAFYRERE---------------------------------------NIQQ--I..........
B8NAT5_ASPFN/26-188--LIEI-VEPDP.TWPESFAIIAR---------------------------------------RIAD--A..........
D2PRV9_KRIFD/5-169--RITI-TEYDV.HWPALFEQQRR---------------------------------------RVEP--V..........
C5C5E0_BEUC1/9-171--PVRV-VPARA.GWAAEGSELVA---------------------------------------SLDR--A..........
M2MR17_BAUCO/24-208--ELTI-VEPDS.QWIDHFETFKA---------------------------------------RITA--AFGRRGPNNEV
K1W9P8_TRIAC/2-167--PIQV-VEYDP.AWPEYFASLSA---------------------------------------ELAT--V..........
I0H425_ACTM4/12-172--VIRI-ADHDP.AWPARFAEMGD---------------------------------------ALRR--A..........
Q81PM3_BACAN/8-166--KVFL-VPWTE.EWEFEFMKEKQ---------------------------------------FIEK--Q..........
V5FMN7_BYSSN/27-191--RLEV-VEYDP.TWPESFRVISK---------------------------------------RIRD--A..........
A5I088_CLOBH/18-180--PIIL-EEHNP.LWEEWYLEEKK---------------------------------------LIMS--I..........
R6CHS7_9CLOT/8-171--RVTL-YPHQT.EWDEQARRTME---------------------------------------QLKE--L..........
K9QG42_9NOSO/2-163--KVEV-VPHNP.NWRSQFENESK---------------------------------------QIAL--A..........
F0RLV6_DEIPM/12-172--TIEV-VPYDP.AWPAQFEAIAA---------------------------------------PIRA--K..........
YZZE_STRCO/25-180--EIGL-SDYDA.RWAETYLRHRR---------------------------------------RILD--A..........
R4TB77_AMYOR/212-382--.PKI-APYDE.TWPVQAERALA---------------------------------------RIRV--V..........
Q480R9_COLP3/9-169--VIEV-VDYDP.NWKNIFEIEKV---------------------------------------ALTQ--A..........
R7K5K1_9FIRM/2-163--KVEV-VDYRP.EWAEMYAAEAE---------------------------------------KIRA--V..........
K9XRX3_STAC7/4-167--KVEV-LPHNP.KWRDEFAKEAN---------------------------------------QINL--A..........
D2R1G3_PIRSD/2-160--NIEV-ASYDP.RWPLLFAAERD---------------------------------------LLVA--A..........
C7N2S7_SLAHD/18-179--PISL-VEHND.AWRQQYAEIAS---------------------------------------DIAE--L..........
W5W422_9PSEU/211-378--APEL-VPYDP.SWPEQAARVAA---------------------------------------RIGL--A..........
R4PVG6_9BACT/9-168--TVKL-VNYSR.DWPSDFLHEKE---------------------------------------LLQP--V..........
Y4798_PSEAE/21-183--RIEV-LPADP.AWPQHFAAEAE---------------------------------------AIRT--A..........
R5AL68_9BACT/11-171--PIVL-AAYNP.DWSEWAKEEIL---------------------------------------ELSA--L..........
Q5ZY58_LEGPH/204-370--HIDI-VAYNT.EWPLLAKAEMV---------------------------------------KLRA--S..........
U5RPT9_9CLOT/8-169--KVRL-LPHCE.EWKEEFEEVKK---------------------------------------QLKE--I..........
C8WR35_ALIAD/281-442--PVSL-TEVST.RHLLAFERERE---------------------------------------QISR--V..........
YQKA_BACSU/153-313--KVEI-ILYNE.KWAECFDEEKE---------------------------------------RLKL--V..........
B8FH40_DESAA/17-183--KIDM-APYNP.ARPEMFRQEAE---------------------------------------FLQN--R..........
I0DNI9_PROSM/44-202--KIEI-RDYDP.IWATLFIQEKA---------------------------------------RIQA--A..........
D6ZD81_SEGRD/214-391--..VL-AEPDP.TWQAQAARLIA---------------------------------------RVSV--A..........
S6AG51_PSERE/6-162--..TI-SHYDH.NWPALFSAERA---------------------------------------RIEP--G..........
G8RQ26_MYCRN/217-398--EPVL-VPSDP.SWPDQARRIAA---------------------------------------RLNT--A..........
G0G9J0_AMYMS/26-185--TVTL-ADYDP.EWPKLFEREAE---------------------------------------RIRG--A..........
H5WXT5_9PSEU/241-411--.PVL-VEPDP.SWPRQAERALA---------------------------------------RIRL--A..........
A0QU49_MYCS2/32-190--PVAI-VAPDP.RWPARYRRLAE---------------------------------------QIRA--A..........
K9RII6_9CYAN/3-167--EIEI-VKHNP.NWANMFEAEAE---------------------------------------AIRA--V..........
R7YMF0_CONA1/4-163--PVIV-EDYNP.AWPSDFEAIRA---------------------------------------QLRP--I..........
Q7MJH4_VIBVY/9-159--..HA-EEYQA.SCEQRYQKYKS---------------------------------------EIEA--L..........
K0JYW2_SACES/116-273--TVEL-VPYDD.GVVAQYEQDRA---------------------------------------VVSG--V..........
C6CZF7_PAESJ/4-164--QWRI-AVHNP.QWHDMFQETAA---------------------------------------KLRA--A..........
I4EWN3_MODMB/45-201--QISV-VDYDA.RWPTRFREIAE---------------------------------------RLRR--A..........
R6USG1_9FIRM/169-332--PIVI-RPYNE.QYTAWYDAQQL---------------------------------------HLQE--L..........
G3JC83_CORMM/22-188--TITI-VDADP.SWPCTFAQLAS---------------------------------------SIRA--A..........
R6K9E4_9BACE/11-174--PIIL-TEYQK.DWERLYKLEEQ---------------------------------------QLRA--I..........
Q5HQZ0_STAEQ/13-170--....-..SVK.QFTYEYNKVKD---------------------------------------VLFT--I..........
A3QDM7_SHELP/4-183--SIVV-IDHQM.SWHQAFKVEKA---------------------------------------QLLT--A..........
Q8TK81_METAC/20-182--IVRV-VPYDP.EWKTEFLKIKA---------------------------------------MIVD--C..........
I7BP47_NATSJ/8-170--PIEL-VPARYDAWRECFVAERD---------------------------------------RVSD--V..........
A6WAJ0_KINRD/50-209--PAVV-VDYDP.HWREDFDMLRS---------------------------------------CLHP--L..........
A0JWM9_ARTS2/214-385--..VL-APADP.TWGTQAARLAG---------------------------------------RIAA--A..........
C7YUZ2_NECH7/30-193--PLAI-VEPDP.SWPATFDLLKA---------------------------------------RIES--A..........
F8L3S4_SIMNZ/8-166--TIDL-LPYDP.SWKDQAEKEIE---------------------------------------RIHL--A..........
M2YLJ2_DOTSN/41-212--..AI-LPPDP.QWFSHFETFKA---------------------------------------RIET--A..........
Q1D1T3_MYXXD/32-190--KVAV-APYDA.GWPTRYAELAV---------------------------------------AIQG--V..........
R8BXH6_TOGMI/31-193--PIEI-VESDP.AWPATFERVAS---------------------------------------RIRD--A..........
V6K242_STRNV/29-199--QVTL-GEYDP.HWPAVYEREAA---------------------------------------LIDA--R..........
D6GQ99_FILAD/18-178--PIFL-VEHNP.LWKVWYEEERN---------------------------------------TILS--T..........
I0JMF1_HALH3/3-163--RVQV-NLYDE.TWPLRYEAERK---------------------------------------KLER--I..........
D2SB44_GEOOG/32-188--TVVV-QDPDP.EWPVRFSAVRD---------------------------------------LLEA--R..........
W8EQN2_9BACT/18-186--PVEL-VAHDA.GWKDLFEQEKQ---------------------------------------RLLA--A..........
C6WGV0_ACTMD/28-186--AVVI-APYDP.AWPARYAELAR---------------------------------------DVRA--A..........
D3EI21_GEOS4/6-165--AIHL-EPYDK.QWADRFNDEHR---------------------------------------LLIG--E..........
M3AHS4_PSEFD/34-203--KVSI-VEYNP.LWPERFLSAKS---------------------------------------RIEI--A..........
V9X9E8_9NOCA/211-393--.PVL-VPARE.EWHRQAQRLVA---------------------------------------RLAL--A..........
R5A7J0_9CLOT/21-180--TIQL-QDYNP.AWPKQYQVEEK---------------------------------------KIAD--A..........
I2EU23_EMTOG/3-172--...I-QEYRE.SWIEDFKAIKS---------------------------------------VITD--A..........
E6UAG3_RUMA7/4-166--PVVV-EQYNE.EWAADFQAIKA---------------------------------------ELNV--A..........
R5VAK1_9FIRM/4-165--HIVV-REYDP.NYPLMFEKEKK---------------------------------------SIIP--L..........
I2F809_9BACT/5-167--PVIV-AEYDS.SWPELFRREAE---------------------------------------LIYA--A..........
A0A0D2YDZ7_FUSO4/30-193--PIAI-VEPDP.KWPEHFARAKA---------------------------------------RIES--A..........
W5W1G6_9PSEU/88-244--TIHI-AEPDP.DWPARFQAERA---------------------------------------RIAA--A..........
C4ZJM8_THASP/15-182--RVEI-VPYDP.AWPGLFAEEVA---------------------------------------RLRA--A..........
Y1888_BACHD/32-191--SITL-LEYDP.RWPKLFDREAK---------------------------------------RIRS--V..........
D5UGE0_CELFN/2-161--RVFV-VPYDE.CWPSAFESVRR---------------------------------------ELVA--A..........
K0ETX6_9NOCA/211-393--ELRL-VPANP.EWAAQAQRLIA---------------------------------------RLWV--A..........
Q0ANT8_MARMM/3-164--.VDV-VDYDP.GWPARFTDERK---------------------------------------RLQR--A..........
B9M8V0_GEODF/15-182--EVAI-VPYDP.RWRDLFEEERR---------------------------------------HLLS--C..........
E9FC77_METRA/32-195--.LEI-VEPDP.TWPQQFERLKA---------------------------------------RIVD--A..........
Q5UW62_HALMA/8-169--TVEL-VPHQE.EWKHHYENEVA---------------------------------------HLKA--V..........
D7AV49_NOCDD/30-189--RVRL-SEYDP.KWPYLFRREDG---------------------------------------RVRA--A..........
W5WGD4_9PSEU/84-261--.PEL-AEWDP.SWSITAERLLN---------------------------------------RLRS--A..........
V5XFQ0_MYCNE/214-379--DAAV-VPYDA.SWPDQAQRILA---------------------------------------RLNT--A..........
G2XBV0_VERDV/31-198--PLIV-EPYNA.AWPTMYLAVAL---------------------------------------LVLD--A..........
A0A016PCG5_GIBZA/30-193--TIAI-DEPDP.SWPHHFDLAKT---------------------------------------RIET--A..........
C6WB47_ACTMD/210-381--PPKV-VDPDP.TWPAQAARIAA---------------------------------------RLRT--A..........
Q0SI30_RHOJR/210-391--.PEL-APPNS.QWPAQADRLIA---------------------------------------RVKL--V..........
A3CX26_METMJ/18-179--HVRV-VDYDP.VWPDLFRTEAR---------------------------------------RIED--I..........
D5BAN2_ZUNPS/18-185--PIHL-EDHNP.AWKTIFEKEKK---------------------------------------LILS--N..........
D1BE93_SANKS/25-181--HVDL-HDYDE.RWPVLYREHEQ---------------------------------------RIRA--A..........
J7L577_NOCAA/28-187--RIAI-VPHDP.KWPYLFRQEAD---------------------------------------RIRG--A..........
I0JT44_HALH3/47-207--TVSL-RSYHP.EWPVLFEQEQE---------------------------------------LIAE--S..........
W0BB67_9GAMM/10-170--LIEV-VPYDF.NWPLQFEQEAK---------------------------------------KIKK--A..........
Q4KFG9_PSEF5/6-162--..KI-SLYDD.HWPAAFAGEKA---------------------------------------RIAK--G..........
R5EZV1_9CLOT/22-183--PVFL-TEHRP.VWAQWYQEERE---------------------------------------RLFG--I..........
Q189F3_PEPD6/18-179--PIFL-TTHKE.CWKNWFKEEQY---------------------------------------RLTG--I..........
R5J8J7_9CLOT/11-172--.LII-MDYTE.DYKRIYDAEKE---------------------------------------ELLK--I..........
E8N7N1_MICTS/6-189--PAAI-AEHRP.EWAARAAALLV---------------------------------------DVRS--A..........
COAE_MYCPA/210-395--PVRL-VPPDP.EWPAQAQRIVN---------------------------------------RLKT--A..........
Q82TF0_NITEU/35-196--RIQL-AEYDL.RWPSMFSVAAD---------------------------------------KIRS--A..........
Q81CT5_BACCR/4-164--QIVI-KPYQK.EWVEEYIKEKE---------------------------------------KFCS--L..........
I0KB45_9BACT/5-175--PIHI-ADYSP.AWASAFDDLAA---------------------------------------VYQA--H..........
D2Q1S7_KRIFD/4-173--SITI-VRPDP.TWAAQFDKTAQ---------------------------------------TIRA--I..........
D3PXU1_STANL/211-382--TITM-ADYSP.QWPSRFERLAA---------------------------------------RLRH--V..........
B2VVX8_PYRTR/3-161--.VVV-EQYNT.EWPQQFERIKA---------------------------------------DLEG--Y..........
W6RMG9_9RHIZ/5-164--.VEL-VPYDA.SWPDHFLRIAD---------------------------------------ALKS--L..........
Q837C3_ENTFA/3-163--.VIV-TEYQP.AWVEQFEEEAQ---------------------------------------ALKQ--I..........
E8SKB4_STAPH/10-169--...T-ENQQP.FYATQYEKYQH---------------------------------------ILFD--L..........
G8SCS9_ACTS5/212-375--ELHI-VPPDP.GWPQAAERLIT---------------------------------------RIRH--Q..........
H6R024_NOCCG/201-383--ELRL-VAPDP.DWDAQAQRLIA---------------------------------------RLWV--A..........
D5DHV4_BACMD/6-164--EIQL-TPYNI.AWEKEFSKEAA---------------------------------------TLTT--I..........
D3HRN8_LEGLN/9-169--LIEV-HPYDA.NWPMHFLQEAG---------------------------------------QIKK--A..........
F0JD71_DESDE/16-183--RIRL-VPPDP.AWPRLFEEEKA---------------------------------------RLLA--C..........
H6LKW2_ACEWD/9-173--PIIL-KEHNP.KYKEWYEIEKR---------------------------------------QLLS--S..........
COAE_MYCLE/210-398--PAGL-VTSDP.IWLGQAKRIVA---------------------------------------RLKT--T..........
R9TA40_9EURY/18-177--PIRL-TEHNA.EWKDQYAEMAI---------------------------------------FLEN--K..........
R5NDU7_9BACT/18-177--PIYL-TEHQP.YWKEWYTDEES---------------------------------------FLKN--R..........
E3FUL3_STIAD/60-221--.LEV-RAYDP.SWPVLFERERQ---------------------------------------RLQK--A..........
C7QZ85_JONDD/13-170--PVEL-KEADP.LWPLVAAEWSN---------------------------------------RIQS--A..........
U5LFL0_9BACI/7-168--KVDV-QPYSR.SWADSFQEEKQ---------------------------------------LLAA--V..........
B1YEV6_EXIS2/3-163--QVIV-TPYQS.SWPDAFQQAKE---------------------------------------QLET--I..........
G9N0Q7_HYPVG/30-192--KIEI-VEPDA.SWPQSFKLLKE---------------------------------------SIAS--A..........
D0LRK4_HALO1/63-218--....-KDYDP.AWHVWFAAERQ---------------------------------------QMAS--T..........
K9UHL6_9CHRO/4-165--KVEV-VPHDR.NWQSAFADEAQ---------------------------------------QLSI--A..........
Q0U0A7_PHANO/2-162--PITV-LSYDP.AWADDLAQIKK---------------------------------------ELEA--G..........
K9X9I3_9CHRO/3-165--KVEV-VPHNP.QWQDAFVKEKQ---------------------------------------HILQ--A..........
H1ZDJ0_MYROD/6-189--....-EPYNP.KWKEQFEKIKS---------------------------------------ELAL--R..........
C6CSH6_PAESJ/2-161--EVRL-SDYKE.EWAQMFREEAE---------------------------------------YLRS--I..........
I0KC39_9BACT/4-171--PVEI-VPFDP.RWFDLFDQERK---------------------------------------LILN--T..........
A5I0C7_CLOBH/9-169--IIEV-VPHNP.RWKIGYEKEAN---------------------------------------KIYN--I..........
D1CF17_THET1/8-168--PVIV-VPYDP.EWPNLFQAFAH---------------------------------------TIRI--A..........
U5VXI8_9ACTN/209-373--ALHV-VPSDP.TWPEQAERVIA---------------------------------------RIRH--A..........
R7XXE7_9ACTN/3-160--.VEV-VAWSA.DWARDFERVAA---------------------------------------DLRT--A..........
C7N047_SACVD/214-386--PPKL-VPADP.TWPAQAARILP---------------------------------------RLRN--A..........
R4KA00_CLOPA/5-167--KVIV-VPYDS.KWNDEFEKIKF---------------------------------------YLEK--A..........
F2F973_SOLSS/9-173--EVVL-VPYEA.GWKSEFADTKK---------------------------------------KIME--H..........
E3HNB6_ACHXA/38-195--.VAV-VPYDP.DWPVRYGRLES---------------------------------------QVRE--A..........
B1MAV8_MYCA9/211-383--.PEL-MPADP.TWPVQAQRVIN---------------------------------------RLAV--A..........
R7NHU4_9MOLU/7-167--IVEL-VDYDS.NWDNEYRKEEE---------------------------------------LLRR--V..........
G0G0L6_AMYMS/196-366--.PKI-AEYDL.GWPAQAERVLA---------------------------------------RVRT--A..........
S5RIM5_9STRE/14-176--EVLL-LSYQE.SWKDDFEKIAK---------------------------------------ELKT--A..........
A8FEV1_BACP2/150-310--KVEV-IEYQT.SWPDECRRELA---------------------------------------KLKE--V..........
Q2KDV8_RHIEC/3-162--AIKV-VDYDP.SWPLLFAEISA---------------------------------------EVAT--S..........
W6R743_9RHIZ/15-174--TVSL-AEPNT.LWQQAYANEAH---------------------------------------AIRQ--A..........
R5T2X8_9FIRM/18-179--PIFL-VPHKK.EWAGWYREEKG---------------------------------------RLEV--L..........
G4L3G4_TETHN/32-191--PIKL-VDYNP.NWVDLFEREAK---------------------------------------RIKS--I..........
K9U9A9_9CYAN/3-168--NIVI-VEYDR.QWVELFEQEAI---------------------------------------YLRN--L..........
Y2534_DEIRA/32-184--..DL-ISPDPGRWAARFDRHRW---------------------------------------RIRL--A..........
A8FA86_BACP2/8-167--EVFL-VPWSA.EWGKEFEREKK---------------------------------------RIVE--V..........
R8BCT1_TOGMI/34-197--TIEI-VEPDP.SWPAAYAEVEA---------------------------------------RIRA--A..........
R5X925_9FIRM/14-176--AVAV-EAHKA.EWEAAAKKTIE---------------------------------------LLKS--I..........
GRPB_BACPE/8-173--EVIL-VTHSE.NWKRLFDKEKS---------------------------------------LLET--I..........
R6RNY7_9FIRM/13-174--.VTL-MPYQE.EWKENAESAIE---------------------------------------KLKQ--L..........
E3EIR7_PAEPS/4-166--QVVI-SEYNP.QWVAEYTRERA---------------------------------------KMIE--A..........
A5I050_CLOBH/2-163--KVQV-VEYNS.EWPNLYLEEAE---------------------------------------KIKN--I..........
H1VDI7_COLHI/31-193--.LSI-EPPDP.AWPAQFEEIRT---------------------------------------RIND--A..........
N4UZ58_COLOR/309-472--PLAI-EPPNP.DWPAHFDTLRE---------------------------------------RIAN--A..........
C8XAW5_NAKMY/211-382--.PRL-VAPRA.SWADDARRLAA---------------------------------------RISA--A..........
C8WAQ0_ATOPD/20-179--PIFL-VEHND.KWDAFYSEMEA---------------------------------------KLQY--I..........
K0K1A8_SACES/37-195--NVVI-TPYDP.EWPLRYQALAT---------------------------------------DIRA--A..........
D9SV06_CLOC7/4-168--EMLV-VPYND.EWPQIYEEEKK---------------------------------------VLSK--I..........
D7BEE1_MEISD/4-169--PIEL-LEYDP.SWPARFEAERT---------------------------------------RLLE--A.....LGGWA
Q74CV0_GEOSL/2-165--RIAI-EEYSS.AWERAFLAERK---------------------------------------RLLG--T..........
U5L973_9BACI/9-172--EVRL-ADHSP.GWKTEFQKVRK---------------------------------------NLLE--N..........
R7K4C0_9FIRM/184-345--PIEL-MPHDD.GFARLFSEEKK---------------------------------------FLLD--L..........
A1R6F2_ARTAT/218-384--....-..SKG.EWAAQAERLAE---------------------------------------RILA--V..........
Q2G068_STAA8/12-170--....-.DLTN.CFQSQYTEIES---------------------------------------LLFN--L..........
Q0RJB4_FRAAA/11-173--PVDL-VAHDP.GWAGRFAEQRD---------------------------------------RVTD--I..........
A1CSD9_ASPCL/61-222--LIEI-VDYNP.LWPAHFSGIAD---------------------------------------RIRA--A..........
F8B2Q7_FRADG/43-199--VIRI-VDYDP.AWPGRFQAERG---------------------------------------RIEA--A..........
D4M8N7_9BACT/11-171--PIFL-VRHHE.EWDDWYAEEKS---------------------------------------TLTA--L..........
R6IAQ5_9FIRM/8-176--DVRL-FEHNK.EWKIEGERTVN---------------------------------------ELRE--I..........
F0T2H2_SYNGF/9-169--.VAL-YDHEI.SWEENAALTME---------------------------------------KLQK--I..........
D3EFC9_GEOS4/5-164--.LIV-VEYNP.NWVKKFEELRD---------------------------------------FVFP--V..........
B6QP89_PENMQ/30-189--KISI-VEPNP.AWPQRFLDTKA---------------------------------------RIET--E..........
R6CC32_9CLOT/13-180--EVQI-FPYDP.QWKVEFEKIKG---------------------------------------MITR--Y..........
M2RUD6_COCSN/3-161--.VTV-DQYRE.EWPKQFEKIKA---------------------------------------ELEN--H..........
J5JV21_BEAB2/22-188--TIDI-VDPDP.SWPATFAQLAT---------------------------------------GIRA--A..........
Q4WKR7_ASPFU/23-185--PIEI-VDYDP.SWPTTFASIAQ---------------------------------------RIRS--A..........
M3BXF1_SPHMS/30-197--KVAI-VVPNP.LWSQRFLEAKS---------------------------------------RIES--A..........
F4LJZ3_TREBD/18-177--PIFL-TAHQD.CWEQWYSGEET---------------------------------------ALKK--I..........
L0KBF6_HALHC/18-182--PIIL-REHNP.EYKEWYLKEKE---------------------------------------NIEK--T..........
F0ZS88_DICPU/4-173--..EI-EPHNI.NWKNEFLKFDK---------------------------------------EIKQ--V..........
B0RAH0_CLAMS/4-161--MIRL-EEHRS.GWADAFHAEAA---------------------------------------RILA--A..........
E1RF13_METP4/16-180--PIIL-SDYNP.AWPEIYAAEKK---------------------------------------HIED--V..........
W6RXI5_9CLOT/18-181--PIIL-KEHNP.EYSSWYLEEKE---------------------------------------SLIN--I..........
E8ND31_MICTS/47-196--RA..-......GWDRAFEIVAD---------------------------------------LVRE--A..........
A1AP29_PELPD/17-185--RIEV-VPYDA.CWPLLFEEEKA---------------------------------------YLLA--M..........
G8PS80_PSEUV/5-164--KVKV-VDAQA.RWAEDFQQEQE---------------------------------------ILHD--L..........
C5C2T3_BEUC1/32-194--PITV-VDYDE.SWPAQFDRVAA---------------------------------------RVRA--A..........
G9NLT9_HYPAI/30-192--KLEI-ADPNP.LWPQSYELLKD---------------------------------------RIVS--A..........
J5JAK5_BEAB2/35-197--PLAI-EEPKP.EWPRRFAILEA---------------------------------------KIRA--A..........
A6WBN4_KINRD/58-214--ELEL-HDHDE.RWADTYRWHRA---------------------------------------RIEE--A..........
C8VG40_EMENI/27-192--RIEI-VEPDP.AWPAAFAVIEA---------------------------------------RIKA--A..........
F4L6A7_HALH1/6-175--KITI-SPYNP.EWQQSFLQLKV---------------------------------------VYTH--A..........
E3J2T3_FRASU/21-178--RIVI-AAYRP.EWVERFAFERD---------------------------------------RIVA--A..........
COAE_MYCTU/210-395--PARL-VPADP.SWPDQARRIVN---------------------------------------RLKI--A..........
C0QYF8_BRAHW/3-170--IIEI-VDYDP.NWKNLYKEEEV---------------------------------------KIKN--I..........
Q6CG34_YARLI/3-172--.IVI-CPPSP.SWPAEYETLRA---------------------------------------KIAS--V..........
C2X2A2_BACCE/3-163--RIVV-VPYEN.HWIEKFQMEAE---------------------------------------RLKS--V..........
I2B7X5_SHIBC/41-199--NINV-DRYDP.EWPRIFTREKA---------------------------------------RIIS--A..........
R6QU09_9FIRM/17-181--PIVL-CGHKE.EWKQMYENEKK---------------------------------------LLLH--S..........
A1SCK2_NOCSJ/16-200--PAAL-QAHDP.AWAPRAAGYLA---------------------------------------RARA--A..........
G8LV75_CLOCD/29-188--PITL-VEYDP.NWEELFEREAH---------------------------------------RIRS--I..........
C1ABX5_GEMAT/4-164--TVRV-VAYDA.SWPDVFEQLRA---------------------------------------MLWP--A..........
F8L5H4_SIMNZ/6-169--KIEV-VPYDP.SWPEQFEVEAG---------------------------------------LIRD--A..........
A1TAF0_MYCVP/210-390--EARL-VPSDP.SWPAQAQRILA---------------------------------------RLRT--A..........
E5ADM9_LEPMJ/589-747--.VVV-EQYDP.KWPEEFERIKS---------------------------------------DLKK--Y..........
W0E5J7_9FIRM/3-163--VVVV-NDYNY.QWPSMFKVEAD---------------------------------------KICE--V..........
D6D4R0_9BACE/19-178--PITL-TAHQD.YWADWYKEEAE---------------------------------------LLKE--R..........
G7MD75_9CLOT/6-165--.VVV-EDYNP.EWKNEFEHIKN---------------------------------------ELLT--V..........
D3E8X8_GEOS4/3-165--EVIV-TPYNP.DWKDEYNREKA---------------------------------------KIES--A..........
E1QDH8_DESB2/16-184--PVEI-VDPDP.RWPALFAREKA---------------------------------------HLLA--C..........
L0J6E6_MYCSM/3-164--.VTV-VEYDT.HWPRQFAEQRD---------------------------------------QLAH--L..........
R6R8F5_9FIRM/2-160--...V-LPYDP.AWKADFAAIRQ---------------------------------------ELAS--A..........
L0DYV6_THIND/8-167--GVTL-VGYDA.SWPTEFRREAQ---------------------------------------RLRA--ARIPGFL....
F8D8W2_HALXS/8-171--TVEL-EPYND.EWQRAFETEAE---------------------------------------RVRS--A..........
E3FRK9_STIAD/45-209--NIDV-REYDP.RWPETFEAEKH---------------------------------------RIHG--A..........
R6CUV5_9CLOT/17-184--EVRI-VPYDP.QWKAEFEKIKA---------------------------------------MIQS--Y..........
R5RQF7_9FIRM/7-166--KVEV-VPYNE.DWPRKYALEAN---------------------------------------VIRN--I..........
Q5ZWJ7_LEGPH/174-340--SVEL-VPYDS.QWPKIAEVEIK---------------------------------------KLRK--I..........
L0IZF9_MYCSM/209-374--KLEL-TPYDP.TWADDAARIIK---------------------------------------RVQM--A..........
B2HQZ8_MYCMM/210-396--PARV-VPADP.SWPEQAQRIVA---------------------------------------RLKT--T..........
G9N260_HYPVG/30-192--PIEI-VEPDP.SWPKTFELLKT---------------------------------------RIIS--A..........
A4FFQ9_SACEN/32-191--PVTL-VDYDP.RWPELFRREAD---------------------------------------RVRG--A..........
J7L574_NOCAA/29-191--PIHV-VDHDP.EWAVWFFQVAA---------------------------------------LVRS--A..........
R7A6W2_9FIRM/28-187--TIYL-SEYDP.NWPLVYKQLSK---------------------------------------EIQS--V..........
R4SP20_AMYOR/28-187--TVTL-AEYDP.EWPELFDREAK---------------------------------------RIRG--I..........
E9SZZ4_RHOHA/222-405--PPVV-RPADP.DWAAQGRRLVE---------------------------------------RLRL--V..........
K9VQD2_9CYAN/4-164--KVEV-VPHDP.NWCSAFETESK---------------------------------------LIAL--A..........
R5LK04_9MOLU/7-167--TVKL-EEYNP.KWKDMYLEEEK---------------------------------------NLKE--M..........
Q0CCF9_ASPTN/28-183--PLEI-VEYNP.EWKPRFQDISQ---------------------------------------KIQD--A..........
D3FCW0_CONWI/18-181--.VRI-LPPDR.SWAVRFEREAA---------------------------------------RLRA--A..........
Q81PZ3_BACAN/4-164--QIVI-KPYEK.EWHEEYLIEKE---------------------------------------KFIS--L..........
A6WEQ7_KINRD/4-189--PAVL-HPYDP.AWPGRAAELLA---------------------------------------AVRR--A..........
I5AW69_EUBCE/66-227--PIFL-VAHDD.RWEESFDEVEK---------------------------------------MLIG--L..........
B9JCE0_AGRRK/17-178--CVTL-AVPNA.RWQEAYALEAA---------------------------------------AIRK--A..........
A6T980_KLEP7/3-163--ILTV-VDYDE.MWPTLFENERT---------------------------------------LLQM--T..........
G3JP53_CORMM/36-199--PLAI-TEAQP.SWASRFAALEA---------------------------------------RIRA--A..........
T0JR78_COLGC/30-193--PLAI-EPPNP.AWPEHFEFLKA---------------------------------------RIIG--A..........
Q12KI9_SHEDO/3-162--.VDV-VPYRL.GWRKDFEIEKE---------------------------------------VLIK--Y..........
S3E6I7_GLAL2/3-173--QITI-LPHNP.LWLSKFEAQKK---------------------------------------ILQE--I..........
R6IMI3_9CLOT/8-178--AVAL-YPHEK.AWETEAQATMA---------------------------------------RLRQ--I..........
M1MIC4_9CLOT/5-169--NVVV-LPYDF.NWSHEFEKIKI---------------------------------------CIEK--E..........
D5ELY3_CORAD/2-162--KIEV-VPYSD.EWPEAFKKEKR---------------------------------------ALLE--L..........
F4FGK1_VERMA/211-377--RVTL-TEPDP.TWPQQYARLAA---------------------------------------RIRH--A..........
B9E8H7_MACCJ/3-152--QVMI-VPYDS.IWQHLYIGEKK---------------------------------------RVLQ--K..........
G8NQJ1_GRAMM/17-177--TVIV-VEYDP.SWPALFRFFYE---------------------------------------RLAR--T..........

PF04607

Q8F1P4_LEPIN/241-352-------------GRAKHFYSIYR---------------------------------------KMKL..K----------
Q7NBS7_MYCGA/247-359-------------SRIKSVYSTYQ---------------------------------------KLNYRHN----------
Q83GJ6_TROWT/256-367-------------GRPKEIYSIYQ---------------------------------------KMVL..R----------
YWAC_BACSU/57-179-------------SRVKSFESIVN---------------------------------------KLMR..K----------
Q8DU97_STRMU/42-162-------------GRVKPIESIKE---------------------------------------KMVL..R----------
Q7NGY9_GLOVI/272-383-------------GRPKHLWGIYQ---------------------------------------KMQR..Q----------
Q8H5X7_ORYSJ/326-435-------------GRNKSMYSIYS---------------------------------------KMAK..K----------
Q7VM28_HAEDU/245-356-------------GRPKHIYSIWK---------------------------------------KMQK..K----------
Q9X388_BACAN/65-209-------------SRVKDAGHLID---------------------------------------KIIR..K----------
Q8EBQ4_SHEON/250-361-------------GRPKHIYSIWR---------------------------------------KMKG..K----------
Q7MAV7_PORGI/253-368-------------GRTKSINSIRN---------------------------------------KLRQ..Q----------
Q8LSZ7_CHLRE/410-527-------------GRPKNLYGIFM---------------------------------------KLQKDGK----------
Q7NRS8_CHRVO/260-371-------------GRPKHIYSIWK---------------------------------------KMKK..K----------
Q8XKG7_CLOPE/50-185-------------TRVKSASSLKE---------------------------------------KIIR..H----------
Q8A9W5_BACTN/249-366-------------GRTKSIHSIWN---------------------------------------KIQK..Q----------
Q8XJZ8_CLOPE/66-208-------------SRIKNPDRLIE---------------------------------------KIIR..K----------
Q8DLB2_THEEB/256-367-------------GRPKHLYSIYQ---------------------------------------KMMR..Q----------
Q9KBP0_BACHD/57-179-------------SRVKSPESIVN---------------------------------------KIQR..R----------
Q88BE4_PSESM/235-346-------------GRQKHLYGIYK---------------------------------------KMRG..K----------
Q7U332_HAEDU/235-346-------------GREKHLYALYE---------------------------------------KMRQ..R----------
Q9K903_BACHD/43-163-------------GRVKPISSILD---------------------------------------KAIR..K----------
Q89K51_BRADU/270-381-------------GRRKKPFSIWT---------------------------------------KMER..K----------
Q830U9_ENTFA/54-174-------------GRVKPVDSILT---------------------------------------KTAI..R----------
SPOT_SYNY3/267-378-------------GRPKHLYGIYY---------------------------------------KMTS..Q----------
Q8FPL1_COREF/265-376-------------GRPKHYWSIYQ---------------------------------------KMIV..R----------
Q97DY0_CLOAB/61-183-------------DRVKDPKSIMD---------------------------------------KLER..K----------
Q9CIJ5_LACLA/36-155-------------GRVKRRESIRN---------------------------------------KAKL..R----------
Q8EJU8_SHEON/235-346-------------GREKNLYSIYN---------------------------------------KMQS..K----------
Q8DUK1_STRMU/46-172-------------ARIKTNESMIE---------------------------------------KCQR..K----------
Q9RTX1_DEIRA/64-194-------------ARLKKPASLAD---------------------------------------KLRR..K----------
Q8DZK6_STRA5/44-164-------------GRVKSVESIQE---------------------------------------KMVL..R----------
O25466_HELPY/265-376-------------TRVKRPYSIYL---------------------------------------KMQR..K----------
Q820X2_COXBU/235-346-------------GREKHLYSIYR---------------------------------------KMRN..K----------
YJBM_BACSU/45-164-------------GRVKPVASILE---------------------------------------KARR..K----------
Q9CH66_LACLA/57-179-------------HRLKSPESIAG---------------------------------------KLKK..K----------
Q8P5T8_XANCP/255-366-------------SRIKTPWSIYS---------------------------------------KMHE..E----------
Q7U362_BORPE/282-393-------------GREKTLYGVYR---------------------------------------KMTE..Q----------
Q83BW2_COXBU/241-352-------------GRAKHIYSIFR---------------------------------------KIQR..K----------
Q9A812_CAUCR/255-366-------------GREKSPYSIWR---------------------------------------KLQR..K----------
Q8XJ23_CLOPE/233-344-------------GRPKHFYSIYR---------------------------------------KMVN..K----------
Q885Y7_PSESM/259-370-------------GRAKHIYSIWR---------------------------------------KMQR..K----------
Q9WZI8_THEMA/289-400-------------GRYKHYYSIWR---------------------------------------KMKE..K----------
Q8RAL8_CALS4/234-345-------------GRPKHFYSIYK---------------------------------------KMKT..Q----------
Q7U324_HELHP/252-362-------------SRVKRYYSIFL---------------------------------------KMQR..K----------
Q97LC0_CLOAB/45-165-------------GRVKEISSILE---------------------------------------KANK..F----------
SPOT_AQUAE/237-348-------------YRSKHYYSIWE---------------------------------------KTRR..K----------
Q7MAV5_PORGI/262-377-------------ARVKSVYSIWK---------------------------------------KMEK..K----------
SPOT_BORBU/252-364-------------VRSKHFYSIFR---------------------------------------KMQT..R----------
Q818C3_BACCR/50-172-------------TRLKQPESIIK---------------------------------------KLER..K----------
Q8KC80_CHLTE/244-357-------------GRAKHLYSIYN---------------------------------------KMRM..K----------
RELA_HAEIN/253-364-------------GRPKHIYSIWR---------------------------------------KMQK..K----------
Q8XXG1_RALSO/249-360-------------GREKTLYSIYR---------------------------------------KMHD..K----------
Q7TTS4_SYNPX/282-392-------------GRPKHLFGIWS---------------------------------------KMQR..Q----------
Q92D54_LISMO/43-163-------------GRVKPVASILD---------------------------------------KANQ..K----------
Q8FNX4_COREF/61-188-------------TRLKEWSSLKA---------------------------------------KARK..R----------
Q81GK0_BACCR/48-168-------------GRVKSVASIID---------------------------------------KAEK..R----------
Q9PQK8_UREPA/246-355-------------WRLKGIYSTYK---------------------------------------KIT...S----------
Q7D045_AGRFC/236-347-------------GRQKKPYSVFR---------------------------------------KMQS..K----------
Q889A5_PSESM/52-191-------------SRIKDPGHLTE---------------------------------------KVAR..K----------
Q7MBD5_CHRVO/250-361-------------GREKNLYSIYK---------------------------------------KMQE..K----------
Q7MUI3_PORGI/30-160-------------HRTKSVMSIKN---------------------------------------KLER..K----------
Q8CXQ4_MYCPE/252-362-------------ERIKGIYSTYK---------------------------------------KIE...K----------
Q8A0M3_BACTN/251-368-------------ARVKSIYSIWN---------------------------------------KMQT..K----------
CRSH_ARATH/309-434-------------GRYKSRYSMMK---------------------------------------KLLR..D----------
Q898M4_CLOTE/66-201-------------SRVKSPKSLKE---------------------------------------KIIR..N----------
Q8DYZ3_STRA5/45-171-------------GRIKTSDSMIE---------------------------------------KCRR..K----------
Q8NR76_CORGL/66-188-------------SRLKTPESIVK---------------------------------------KVIR..K----------
Q8G4H5_BIFLO/112-234-------------RRLKSVSSIIG---------------------------------------KLER..K----------
RELA_MYCLE/290-401-------------GRPKHYWSIYQ---------------------------------------KMIV..K----------
Q8Y8U1_LISMO/51-173-------------SRVKSLESIGA---------------------------------------KLEK..K----------
Q8RF04_FUSNN/66-209-------------RRVKKPTHLIE---------------------------------------KIIR..K----------
Q8XZ30_RALSO/254-365-------------GRPKHIYSIWR---------------------------------------KMRG..K----------
Q8P6N1_XANCP/244-355-------------GRPKHIYSIWR---------------------------------------KMQK..K----------
Q8ERT0_OCEIH/42-162-------------ARVKPIPSIIE---------------------------------------KAQN..R----------
Q7VTF3_BORPE/258-369-------------GRPKHIYSIWN---------------------------------------KMRL..K----------
Q7MAH7_WOLSU/253-363-------------SRIKRHYSIYL---------------------------------------KMQR..K----------
B0TF84_HELMI/237-347-------------GRPKHFYSIYR---------------------------------------KMTS..Q----------
B5I035_9ACTN/197-306-------------GRPKHYYSVYQ---------------------------------------KMIV..R----------
C4YWN1_9RICK/24-132-------------GRIKHPISILY---------------------------------------KLYR..K----------
D3FSJ4_BACPE/58-179-------------SRLKSPESIVK---------------------------------------KLRR..K----------
I1QPB8_ORYGL/428-537-------------GRHKSLYSIHN---------------------------------------KMLK..K----------
M1A0E5_SOLTU/182-305-------------GRYKSRYSTMK---------------------------------------KLLR..D----------
M1B3M7_SOLTU/437-545-------------GRHKSLYSIYC---------------------------------------KMLK..K----------
SPOT_ECOLI/235-345-------------GREKHLYSIYC---------------------------------------KMVL..K----------
Q1D7G8_MYXXD/252-362-------------GRFKHVYSIYK---------------------------------------KIKS..Q----------
Q2FXU1_STAA8/240-350-------------GRPKHIYSIYR---------------------------------------KMMK..Q----------
Q2G204_STAA8/43-162-------------GRVKPIASIID---------------------------------------KANK..R----------
Q2G2L7_STAA8/77-198-------------RRVKEMRSLIE---------------------------------------KLNR..K----------
RSH_BRUA2/235-344-------------SRQKKPWSVFR---------------------------------------KMET..K----------
CRSH1_ORYSJ/316-438-------------GRYKSRFSTMK---------------------------------------KLVK..D----------
Q8DPU2_STRR6/44-163-------------GRVKPIESIKE---------------------------------------KMAR..R----------
Q8DXB2_STRA5/240-348-------------GRPKHIYSIYR---------------------------------------KMRD..K----------
Q8R5V7_FUSNN/234-344-------------GRFKHFYSIYK---------------------------------------KMYQ..K----------
Q9A0A1_STRP1/53-178-------------SRIKSEASMIE---------------------------------------KCQR..K----------
R4UJ80_9MOLU/240-350-------------GRSKSIYSIHR---------------------------------------KMNQ..F----------

PF14792

DPOLB_RAT/149-262--LQMQ-DIVL.-NEVKKLD---------P--------------------------------------------------
DPOLB_DANRE/148-263--QKME-ALIL.-KELDIVD---------P--------------------------------------------------
A7SJ46_NEMVE/149-263--IKLR-DIVL.-VHVKKQD---------K--------------------------------------------------
C3YJ28_BRAFL/322-432--AEIE-RTVR.-EMAESIN---------P--------------------------------------------------
C7YGY5_NECH7/618-739--EALG-TVVR.-KGAQQVD---------P--------------------------------------------------
F0ZLU7_DICPU/181-297--EVFE-KLVS.-NSLFSID---------P--------------------------------------------------
A7SK52_NEMVE/213-322--GKIG-EVVK.-AATEIID---------P--------------------------------------------------
A2QQG4_ASPNC/509-626--EAHG-EIVR.-KAVQTAD---------P--------------------------------------------------
A9V5M0_MONBE/167-298--EALR-QAVF.-AELREVD---------D--------------------------------------------------
D7G2F8_ECTSI/183-296--AEIE-AVVT.-KVAQSIC---------P--------------------------------------------------
B7QKW0_IXOSC/150-261--AQLE-ARIL.-AECRALD---------E--------------------------------------------------
E9EVQ2_METRA/556-677--EALG-AFVR.-RAAARID---------A--------------------------------------------------
D2A436_TRICA/901-1007--KQIE-NLIR.-GHL...E---------P--------------------------------------------------
E3QD37_COLGM/619-740--KLLG-AVVR.-SEAAKLD---------P--------------------------------------------------
Q5KBS5_CRYNJ/504-616--KQIY-ELIK.-LEAKTVD---------E--------------------------------------------------
B6HVS0_PENCW/522-633--EAHG-AIVR.-KAVQAVD---------R--------------------------------------------------
A7EMR3_SCLS1/618-744--EELG-THIT.-KTAQSLD---------P--------------------------------------------------
E4ZMZ8_LEPMJ/596-715--EAHA-NHVR.-SALRNIN---------P--------------------------------------------------
C5FJW6_ARTOC/469-580--EAHG-AIVR.-ETVLAVD---------S--------------------------------------------------
B7QK41_IXOSC/277-387--GEIA-DTVA.-KAALSLQ---------P--------------------------------------------------
B2AY49_PODAN/639-751--TQLA-AFVQ.-REAFLVD---------P--------------------------------------------------
C9SJH6_VERA1/548-691--EALA-AVVR.-SAAAALD---------P--------------------------------------------------
D8SG82_SELML/125-237--VDTE-KFVR.-GVVETLA---------P--------------------------------------------------
E3RX41_PYRTT/579-692--EAHG-AVVI.-AALKKID---------T--------------------------------------------------
Q2HFI0_CHAGB/649-794--GKLF-AYVQ.-REAAAID---------P--------------------------------------------------
C1E884_MICSR/525-667--EALA-GHVE.-DAVAAVC---------P--------------------------------------------------
A9TCX5_PHYPA/342-457--KEME-AIVQ.-KSGSELC---------P--------------------------------------------------
C5Z7H1_SORBI/359-473--SEME-ELLK.-DVGTDIL---------P--------------------------------------------------
B9HVB4_POPTR/315-429--QEME-LLLQ.-KTGEEIL---------P--------------------------------------------------
Q0UN18_PHANO/574-687--EAHG-AAVK.-AALAQID---------P--------------------------------------------------
A4S364_OSTLU/149-268--SHIA-TAVR.-EAANTFM---------K--------------------------------------------------
D8R616_SELML/125-233--ADTE-KFVR.-GVVETLA---------P--------------------------------------------------
A0BDW1_PARTE/419-531--TIIY-DIVK.-REIDDLS---------G--------------------------------------------------
B8JIE9_DANRE/378-488--NAIE-KTVK.-DAAHSVD---------P--------------------------------------------------
C5GK07_AJEDR/525-637--EAHG-AIVK.-KLLFTVD---------P--------------------------------------------------
F2U5R6_SALR5/160-281--DRLR-KQAF.-AIISEVD---------P--------------------------------------------------
F7CJ14_CALJA/78-188--TEIE-QTVQ.-KAAQAFN---------P--------------------------------------------------
Q245F6_TETTS/717-832--TLIV-NEVI.-KGFKELY---------P--------------------------------------------------
Q4QI79_LEIMA/354-499--RLHE-AFMKL-RMRKYLG---------K--------------------------------------------------

PF01909

CID16_SCHPO/908-1034--KKLL-KSLRK-LEG....---------.--------------------------------------------------
CID1_SCHPO/69-169--DTLR-LCLKR-ISP....---------.--------------------------------------------------
O26508_METTH/6-97--EKLA-EFFEE-KDE....---------.--------------------------------------------------
O26564_METTH/21-113--EMLR-RYFKD-KAQ....---------.--------------------------------------------------
CCA_METTH/29-141--VECL-NGLAE-EQG....---------I--------------------------------------------------
O27980_ARCFU/6-90--NEII-GEVK.-.......---------.--------------------------------------------------
CCA_ARCFU/28-133--EELR-RRLDE-L......---------.--------------------------------------------------
O28300_ARCFU/48-135--ERAK-EVMES-LLS....---------F--------------------------------------------------
O28312_ARCFU/101-191--RKIV-EFFSE-IP.....---------.--------------------------------------------------
O28500_ARCFU/441-531--PAVV-DELRR-RYS....---------.--------------------------------------------------
O28587_ARCFU/7-100--RKLR-ESRKE-LKKF...---------G--------------------------------------------------
O28660_ARCFU/27-113--KKLA-KKMLE-.......---------.--------------------------------------------------
O29641_ARCFU/5-90--EITK-KDVQ.-.......---------.--------------------------------------------------
O29943_ARCFU/5-101--LELS-RELKE-KFKD...---------E--------------------------------------------------
O30239_ARCFU/8-91--EQIR-KDLRE-FS.....---------.--------------------------------------------------
PAP_CANAL/68-160--KNMS-DSMAQ-DA.....---------.--------------------------------------------------
O44768_CAEEL/71-163--YQLK-NIISK-NNPT...---------W--------------------------------------------------
O66796_AQUAE/86-173--KYIE-DFFKR-RNK....---------.--------------------------------------------------
CID11_SCHPO/72-179--DKLR-TILST-EIKD...---------A--------------------------------------------------
PAPS2_ARATH/82-179--TRQR-GYTDQ-MVED...---------A--------------------------------------------------
O97205_LEIMA/1069-1163--CWII-EAVLR-KHLN...---------Q--------------------------------------------------
TDT_HUMAN/311-403--SVLV-KEAVW-AFL....---------P--------------------------------------------------
TDT_MOUSE/312-404--MLVK-EAVVT-FLP....---------.--------------------------------------------------
PAPOA_BOVIN/82-175--KNLP-QSVIE-NV.....---------.--------------------------------------------------
PAP_YEAST/69-161--KNMS-DGMAR-DA.....---------.--------------------------------------------------
OAS2_HUMAN/373-475--RTFL-KENCF-RQST...---------A--------------------------------------------------
Y073_HAEIN/14-110--AIVK-TILQQ-LVP....---------.--------------------------------------------------
TRF5_YEAST/201-326--DKLR-RAVKE-LWS....---------.--------------------------------------------------
PAP2_YEAST/204-318--STIR-EAVKQ-LWP....---------.--------------------------------------------------
GLND_RHIME/87-183--NQVF-DAAKA-PEA....---------S--------------------------------------------------
P72997_SYNY3/7-99--MEQI-RQFCH-KWQ....---------.--------------------------------------------------
P73498_SYNY3/14-107--PGKI-TAFCQ-QWQ....---------.--------------------------------------------------
P73970_SYNY3/10-96--SQSK-PDLQS-RFG....---------.--------------------------------------------------
OAS1A_RAT/38-140--CDFL-KERCF-RDTVHPV---------R--------------------------------------------------
Q09995_CAEEL/75-168--SRIP-KDQMF-NA.....---------.--------------------------------------------------
PAP_SCHPO/68-161--KHMN-EKMAN-EA.....---------.--------------------------------------------------
Y128_METJA/11-98--RKHK-KILKE-KYK....---------.--------------------------------------------------
Y141_METJA/7-99--KEFK-KDIST-ILKD...---------K--------------------------------------------------
Y435_METJA/7-92--RKII-PILLK-HG.....---------.--------------------------------------------------
Y604_METJA/7-100--KEFV-NALKS-KYRG...---------R--------------------------------------------------
Y1086_METJA/124-219--RKLA-LILED-YGV....---------P--------------------------------------------------
CCA_METJA/35-147--DKIW-EIVRE-NSY....---------P--------------------------------------------------
Y1217_METJA/11-98--RKHK-KILKE-KYK....---------.--------------------------------------------------
Y1305_METJA/10-110--DEFL-QKCKQ-KFGD...---------D--------------------------------------------------
Y1379_METJA/11-100--RKHK-KILKD-KYK....---------.--------------------------------------------------
TUT4_HUMAN/976-1065--IGLE-KFIQK-EYD....---------E--------------------------------------------------
Q9RTF8_DEIRA/9-95--RQAI-DALAR-RHG....---------.--------------------------------------------------
Q9RWI9_DEIRA/14-98--AAHA-DELRQ-LG.....---------.--------------------------------------------------
Q9RXQ9_DEIRA/18-105--REGA-GEWRT-LG.....---------.--------------------------------------------------
Q9U2P3_CAEEL/73-166--MKIP-NGEGV-NA.....---------.--------------------------------------------------
CID14_SCHPO/266-381--SRIN-QAVLQ-KWP....---------.--------------------------------------------------
PAPA_CANAL/68-161--KNIS-EGMAR-DV.....---------.--------------------------------------------------
Q9VC07_DROME/53-140--RRIE-DVVLS-IWP....---------.--------------------------------------------------
Q9WZ83_THEMA/22-113--GIIR-NSLPQ-LLKK..L---------P--------------------------------------------------
Q9X096_THEMA/7-103--SEFK-KRVSE-KFG....---------.--------------------------------------------------
Q9X2Z5_BACAN/31-119--QKIR-ETVSS-.......---------.--------------------------------------------------
Q9X304_BACAN/10-108--MLYS-SRLNE-MFPN...---------Q--------------------------------------------------
GLND_CORGL/12-98--KEVL-ALLGS-LVLP...---------A--------------------------------------------------
GLND_VIBF1/55-151--SRLW-QFFKF-DDI....---------A--------------------------------------------------
OAS3_HUMAN/780-872--CSFL-KENCF-RNSP..I---------K--------------------------------------------------
CCA_AERPE/39-163--ARAL-EECED-LRLS..I---------P--------------------------------------------------
Q9YCI7_AERPE/22-112--SKLL-ERLG.-.......---------.--------------------------------------------------
Q9YFN6_AERPE/17-110--RKAL-EIVRA-LSRT..V---------H--------------------------------------------------
Q3Y244_ENTFC/6-114--KSVA-EKLSS-LSY....---------.--------------------------------------------------
Q5HNP5_STAEQ/17-112--...L-KIVKD-LFGS...---------S--------------------------------------------------
PAPD7_HUMAN/245-352--KRIE-TVVKD-LWP....---------.--------------------------------------------------
CCA_SULSO/25-127--....-EIIRE-RLN....---------.--------------------------------------------------
CCA_THEAC/29-134--RKIN-SICRS-RGL....---------.--------------------------------------------------

PF07528

O62349_CAEEL/113-354--AELG-RKVVE-NMKIADP---------K.........ETGEP.-----------------------------------
Q7PYL7_ANOGA/111-351--EALG-KKVEE-DLEKSMK---------T..EVVPTA.EALSL.-----------------------------------
ILF3_MOUSE/94-342--DKVA-DNLAI-QLTTVTE---------DKYEILQSVDDAAIVI-----------------------------------
ILF2_DROME/105-345--DALA-KKVEA-DLKASMK---------T.........EVLTKG-----------------------------------

PF12633

K0C9C6_CYCSP/30-225--ELLP-LLFHV-NHPVLPG---------YVSSET.PAGIADYSP.DKLSIDKAKKLGKGFVYSKRAKRA..........
Q7MYN2_PHOLL/4-200--SLLP-VLLHY-HHSMMPG---------YINGNV.PYGVCFFVH.DEAQKSYLNDLENKLDHFIEQPAN..........
C9R2R0_AGGAD/4-204--RLIP-LLLHF-NHPDLPG---------YIA.DA.PCGIVHFVA.NKFQQNYLKHNYAPDSVKNILKSHRTF.......
M1WST2_DESPC/651-841--RLLP-YLLDT-TVFEKKF---------SLRGVP.SCEVWGYTP.CLTSLELSKQFFPTHKHSQTK.............
F6AGP1_PSEF1/20-216--TLLP-LLFHV-NHPLLPG---------YVSAQT.PAGLAHFEP.SAELLAEAQRLTRSFAYKPARAPAP.........
F4HFE0_GALAU/3-201--NLVC-VLLHH-NIPELPG---------YVE.DA.PFGIVNFCF.NRYQENYLSSTLSNLERYSLNHHNT.........
B3PH57_CELJU/19-216--QLLP-LLFHV-NHPMLPG---------YISGAT.PAGVYAYQP.DKDSLRLARILARSFTYTRDLVETT.........
G4T2L3_META2/23-218--ELLP-LLFHQ-NVPLLPG---------FISSET.PAGILDYSP.TRQVLLHAAQFSRSYQYKTRALAN..........
K4KKJ3_SIMAS/20-214--RLLP-LLLHI-NHPRLPG---------FCGTAV.PSGISQFDP.DPHQLQLARKITPGFRYGGTRNRS..........
B8F5L0_HAEPS/22-213--SLLP-ALLHY-NIPSLPA---------YVE.NA.PKGIFNFNL.SATQKAHLSTYFPLPEDT................
B0UWZ7_HISS2/4-207--QLLT-LLLHI-NHPLMGG---------YLP.NA.PHGIARFQL.SKYQQEFLTTHLPQGDFEQLSTHLAALQHL....
Q8E9H1_SHEON/9-202--RLIP-FLIQQ-NSVQYPG---------FVDPNT.PCGIYGYKA.GSLEAQACDVFKLPFIATEV..............
C5BLM3_TERTT/19-214--DAIP-LLFHT-NHPMMPG---------FESRDT.PAGVCHFKI.TKGAVQLGRGIARSFTASQDAVHE..........
J7SL77_MORMO/4-201--SLLP-VLLHH-HHPDMPG---------YVPGNV.PHGVCFWAS.DDYQSHWLAEFSRQHGECLPCNAG..........
I0DV26_PROSM/4-199--SLLP-VLFHY-HHPMIPG---------YIEGNV.PYGVCFFTP.DNDQKLWLSQFGKYLPNAEKAN............
A3Q9P3_SHELP/3-203--QLIP-VLFHY-HRSDFPG---------YNGPMT.PSGVFEYFP.SDDALEACRTLGLSEPQVIHQ.............
M5DMW4_9GAMM/16-206--DVLA-VLLHV-NHPRLPG---------FVTADT.PCGVRGFTP.SIAQRSALHTLARGVQLPRDPAHR..........
E6WHF8_PANSA/15-211--SLLP-TLLHY-HHPLMPG---------YLEGNV.PHGISFYTP.DENQQQLLQDLAGKQPLHLSTGAK..........
F7YQ90_VIBA7/4-199--HFIP-ALLHF-NHPIIPG---------YYDAKV.PYGVYGFEP.NDIQRQLVEDTELTLGQPLPTA............
E6VWA6_DESAO/664-855--RMLP-HLLET-DVFETRF---------TLEGVP.PCEVWGYTP.TLSAMELTRQFFPKIRPSGTR.............
Q9HTS8_PSEAE/21-217--RLLP-LLFHI-NHPLLPG---------YLSAST.PAGLSGFEA.DDEVLAEAQRLARSFVYKPRRQEPAQ........
A6VL92_ACTSZ/4-203--QLIA-LLLHA-NHPNLPG---------FVA.DA.PTGIADFKL.TDYQRHYLHEILAQSSDIQFPQIFDR........
Q2SQ66_HAHCH/20-215--ELLP-LLFHV-NHPLLPG---------YVSRTT.PHRLVNYEP.DKNVVAQAQRLSRSFNYREPARHH..........
A3N160_ACTP2/35-224--SLLP-LLIHT-NLPELPA---------YIK.NA.PSGIAAFEL.SEYQANYLSELSLSHLAIRNSA............
E4PK78_MARAH/20-216--EILP-LVFHL-NHPALPG---------YLDSDC.PYGLSNYQP.SPATINAARRLARTFSLKDEGKRK..........
W8VBQ3_YEREN/4-200--SLLP-TLLHC-HHPLMPG---------YLDGNV.PHGICLFTP.NETQQDYLSEVEAKWGQPLQQSVG..........
B4F1X4_PROMH/4-202--GLIP-VLLHY-HHPQLPG---------YIQGNV.PHGTCFFEP.DDVQRQWVNKLTNASCDEPMNGYTS.........
Q9KVL9_VIBCH/4-199--HLIP-ALFQF-NHPLIPG---------YFSADT.PFGIHLFEA.NPIQQQFIDDAQLTLGEPLTPA............
Q6LLN1_PHOPR/4-203--DLLS-ILLHY-NHPAVPG---------YLEQKV.PFGIANFAV.SAFQQQFIDDCGLGAQSLIPTTQIDD........
D4ZCR6_SHEVD/7-207--RLIP-VLLHY-HRAEYPG---------YNGPMT.PSGIFEYGP.SEQVLAACDTLGLIKPQVSQV.............
Q7VND7_HAEDU/2-191--SLLP-LLLHT-NCPELPV---------YVK.NA.PSGIAQFEL.SAYQQAYLANLMVSDDVVEAFS............
A4VGX1_PSEU5/20-216--KLLP-LLFHV-NHPILPG---------YISATT.PAGLANFEP.DAEQLAEAQRLSRSFAYKPVRGKAP.........
F9ZY47_METMM/21-216--QLLP-LLFHQ-NHPLLPG---------FVSLET.PAGIPDYLP.GKQTVDTAKQFSKGFTYKRKALRN..........
M4R7B7_BIBTR/21-222--CLLP-LLLQY-NHPLLPA---------YVE.NS.PKGISHFTL.TTIQQEYLLRILGSAEFSKVISDHSFFS......
CYAA_PASMU/4-205--QLLT-LLLHI-NHPNLPG---------YVA.DA.PVGIADFVI.SPYQKQYLLTTVPSLEANQSLLPSFSYR......
Q88B03_PSESM/20-216--TLLP-LFFHV-NHPLLPG---------YVSGST.PAGVSHYEP.DTLALAEAQRLTRSFSYKARHGNPP.........
Q65VX6_MANSM/4-207--QLIA-LLLHL-NHPALPG---------YVT.DA.PAGVAHFKL.SDYQKNFLAQQFPTGFDFVRLEQESNAHQQ....
Q2NQF3_SODGM/4-200--SLLP-TLLHF-HHPMLPG---------YLDGTV.PHGICFYSP.DETQRAWLDDIGRQAGAAVAAPDS..........
A1TXX4_MARHV/20-216--ELLP-LVFHR-NHPALPG---------YLDGNC.PDGFSGYTP.GQEVLDAARRYARSFHYRDKGTRK..........
CYAA_HAEIN/4-209--AIVP-LLLHL-NHPQLPG---------YVI.HA.PSGIASFLA.SDYQKKWLTNEYGIHYADHKPSTLKSAVNFHE..
M9X3J4_MANHA/29-225--SLIP-LLIHL-NHPVLPA---------YVE.NA.PQGIWHFQL.SDYQKQFLVSYRFDEAISADHLG...........
E1VFT5_9GAMM/19-214--HALP-LLLHV-NHASLPG---------YITPKT.PVGVRHFVP.EKHHLLAARNIARAFTYNGSKLNE..........
M4X4Y6_PSEDE/20-216--RLLP-LLLDV-NHPLLPG---------YVSAAT.PAGLSGFVP.DDELLAEAQRLTRSFSYKPRRGNPA.........
C6BYH9_DESAD/680-878--KIIP-ALLHT-NVFEIKS---------GLDPQTMSSRVCNYAL.SPQVIKLLDEFFPDIKYEISKE............
I5AZY9_9DELT/15-214--IKIP-FLIHI-NHPQFEG---------YVPEAPEACGIYNFKN.SGFYKALLDMEEVPGDILETKTDI..........
Q088L2_SHEFN/10-203--HLIP-FLIHH-NQINVPG---------IIDPDT.PCGIHGFTL.SDAIVSACDALSLSIPEMIQP.............
X2H648_9GAMM/4-197--SFLP-ALFHF-HDPKLPG---------YLNEDM.PKGIACYEI.SETISTQLKNDFNFIAPLTT..............
A1SR20_PSYIN/12-237--RTFP-LLLHY-NHPSLPG---------YTKGDT.PTGIHQFNV.NKKQKKQLAELFPYQEEPQKKAQATNLITKPTDL
Q87KJ0_VIBPA/4-199--HLIP-ALLNY-NHPVIPG---------YYDADV.PFGVHGLEL.NPIQQQFIDDIQLAIGQPLKTA............
H8GI61_METAL/21-218--DTLP-LVLDI-NDPALPG---------FVSPAT.PAGIYGYRP.GKRALEAARQIGSDFNYRPQKHDN..........
Q21EM4_SACD2/20-215--DALP-LLFHT-NHPMMPG---------FVSRST.PARLCNFKP.DKDILQLGRRVARSFTLGYDPSLE..........
A4XNY1_PSEMY/20-216--KLLP-LLLHV-NHPLLPG---------YVSAAT.PAGLSGFEP.DDEVLAEVQRLTRSFVYKPRRGQGS.........
D6Z233_DESAT/8-206--AAVP-YLLHV-NHPDLPG---------YLNEPAAPCGICNYNPATAFSFELFHRFFPGQSVPRGEEKMLPG.......
C5BBD1_EDWI9/4-201--TLLP-TLLHF-HHPLMPG---------YLEGNV.PHGICFFTP.DEPQQNYLLHLEQRAPGSLPPVTGS.........
B7VMD8_VIBTL/4-199--NLIP-ALLHF-NHPMMPG---------YYDQQV.PFGIRSFTL.NEFQKQFVSDTELTLGGKLTEA............
Q88CF9_PSEPK/20-216--SLLP-LLFHV-NHPLLPG---------YVSGST.PAGVSAYEP.SAELVADAQRLARSFTYKAQHGNPP.........
C4LDV3_TOLAT/4-196--SMLP-VLLHY-HHPHLPG