Sequence alignment for CL0263

PF05315

J9R1X7_RIEAN/2-219-------------------------------------------------------------------------------T
Q7VHB6_HELHP/4-221-------------------------------------------------------------------------------S
F4HDL7_GALAU/5-226-------------------------------------------------------------------------------T

PF03165

O15968_DROME/217-326--------------------------------------------------------------------------------
NFIA_MOUSE/91-195--------------------------------------------------------------------------------
Q9NH63_SCHMA/29-129--------------------------------------------------------------------------------
B4IKX2_DROSE/29-129--------------------------------------------------------------------------------
Q8T8C9_HALRO/30-148--------------------------------------------------------------------------------
Q09631_CAEEL/112-215--------------------------------------------------------------------------------
SMAD2_RAT/41-171--------------------------------------------------------------------------------
O57475_XENLA/39-131--------------------------------------------------------------------------------
SMA3_CAEEL/28-134--------------------------------------------------------------------------------
SMAD6_CHICK/106-204--------------------------------------------------------------------------------
O17532_CAEEL/145-246--------------------------------------------------------------------------------
SMAD6_MOUSE/173-271--------------------------------------------------------------------------------
Q21733_CAEEL/36-132--------------------------------------------------------------------------------
Q9YHB1_XENLA/59-158--------------------------------------------------------------------------------
SMA2_CAEEL/26-129--------------------------------------------------------------------------------
SMA4_CAEEL/168-268--------------------------------------------------------------------------------
SMAD9_HUMAN/34-135--------------------------------------------------------------------------------
SMAD4_PIG/36-137--------------------------------------------------------------------------------
SMAD7_HUMAN/92-202--------------------------------------------------------------------------------

PF14279

C1EJZ2_BACC3/4-72--------------------------------------------------------------------------------
A1SZ92_PSYIN/4-75--------------------------------------------------------------------------------
D2ZR44_METSM/3-73--------------------------------------------------------------------------------
C6CI95_DICZE/4-73--------------------------------------------------------------------------------
Q636Z7_BACCZ/5-73--------------------------------------------------------------------------------
B2JC00_NOSP7/3-73--------------------------------------------------------------------------------
C2W902_BACCE/4-67--------------------------------------------------------------------------------
B5SI46_RALSL/7-76--------------------------------------------------------------------------------
Q73LN7_TREDE/4-73--------------------------------------------------------------------------------
B6VX81_9BACE/8-77--------------------------------------------------------------------------------
C3XCW2_OXAFO/4-84--------------------------------------------------------------------------------
A7C0Y7_9GAMM/4-72--------------------------------------------------------------------------------
A4J8Y0_DESRM/4-73--------------------------------------------------------------------------------
B1XMH2_SYNP2/4-84--------------------------------------------------------------------------------
A0A026XQU1_ECOLX/4-74--------------------------------------------------------------------------------

PF13391

Q3ZJ53_PSEAK/128-185--------------------------------------------------------------------------------
Q3ZJ54_PSEAK/137-183--------------------------------------------------------------------------------
B0D1S8_LACBS/452-520--------------------------------------------------------------------------------
D3DZU5_METRM/268-314--------------------------------------------------------------------------------
A1ZMP4_9BACT/24-72--------------------------------------------------------------------------------
A0JZY1_ARTS2/483-533--------------------------------------------------------------------------------
B6QT68_PENMQ/172-253--------------------------------------------------------------------------------
C6H8C1_AJECH/170-261--------------------------------------------------------------------------------
C0SHG6_PARBP/129-219--------------------------------------------------------------------------------
C0NVL4_AJECG/128-219--------------------------------------------------------------------------------
A1CN99_ASPCL/176-240--------------------------------------------------------------------------------
B2WD78_PYRTR/182-246--------------------------------------------------------------------------------
C0SG59_PARBP/145-228--------------------------------------------------------------------------------
Q7SBL2_NEUCR/148-212--------------------------------------------------------------------------------
B8HI49_ARTCA/207-262--------------------------------------------------------------------------------
C5QBZ5_STAEP/274-329--------------------------------------------------------------------------------
D0MUB8_PHYIT/175-238--------------------------------------------------------------------------------
A8ILS7_CHLRE/241-301--------------------------------------------------------------------------------
A1ZEN4_9BACT/211-269--------------------------------------------------------------------------------
B3R3B4_CUPTR/129-182--------------------------------------------------------------------------------
C5A9D8_BURGB/190-242--------------------------------------------------------------------------------
Q58AC3_RALME/314-368--------------------------------------------------------------------------------
Q97AT3_THEVO/116-167--------------------------------------------------------------------------------
Q2H3K5_CHAGB/194-260--------------------------------------------------------------------------------
Q1Z8V3_PHOPR/45-99--------------------------------------------------------------------------------
C9RJH3_FIBSS/236-289--------------------------------------------------------------------------------
A6WRD3_SHEB8/155-207--------------------------------------------------------------------------------
Q1LAG0_RALME/217-269--------------------------------------------------------------------------------
Q8EUF0_MYCPE/252-316--------------------------------------------------------------------------------
Q0HZ27_SHESR/183-234--------------------------------------------------------------------------------
A8RAR8_9FIRM/242-295--------------------------------------------------------------------------------
C1A2C0_RHOE4/177-236--------------------------------------------------------------------------------
D1QVC2_9BACT/149-200--------------------------------------------------------------------------------
B4RPU5_NEIG2/270-321--------------------------------------------------------------------------------
A9M531_9VIBR/136-187--------------------------------------------------------------------------------
A0YQ47_LYNSP/170-221--------------------------------------------------------------------------------
C6SD53_NEIME/264-320--------------------------------------------------------------------------------
A5UCN4_HAEIE/226-278--------------------------------------------------------------------------------
B0P0S7_9CLOT/157-209--------------------------------------------------------------------------------
Q8XKY3_CLOPE/181-233--------------------------------------------------------------------------------
C4Z3W1_EUBE2/283-335--------------------------------------------------------------------------------
Q6KH34_MYCMO/262-326--------------------------------------------------------------------------------
B5JL75_9BACT/10-62--------------------------------------------------------------------------------
D2MUA6_CAMJU/249-300--------------------------------------------------------------------------------
A9M540_9VIBR/208-261--------------------------------------------------------------------------------
C5TPE4_NEIFL/171-223--------------------------------------------------------------------------------
B5ND07_SALET/226-278--------------------------------------------------------------------------------
A0A017QNN2_SALET/161-214--------------------------------------------------------------------------------
C7JF14_ACEP3/216-269--------------------------------------------------------------------------------
B6ESV9_ALISL/277-329--------------------------------------------------------------------------------
A7HHG5_ANADF/218-270--------------------------------------------------------------------------------
A3WLG5_9GAMM/162-214--------------------------------------------------------------------------------
Q2NS53_SODGM/141-193--------------------------------------------------------------------------------
Q11XS6_CYTH3/195-247--------------------------------------------------------------------------------
A6LR77_CLOB8/228-280--------------------------------------------------------------------------------
D5SYQ3_PLAL2/147-198--------------------------------------------------------------------------------
A3SEH6_9RHOB/147-198--------------------------------------------------------------------------------
A3IFP0_9BACI/201-253--------------------------------------------------------------------------------
B3E6K1_GEOLS/248-298--------------------------------------------------------------------------------
Q0YRR0_9CHLB/151-202--------------------------------------------------------------------------------
D4L965_9FIRM/137-189--------------------------------------------------------------------------------
D1NWA4_9BIFI/170-222--------------------------------------------------------------------------------
A9VZD9_METEP/165-217--------------------------------------------------------------------------------
A0A008B479_STAAU/218-269--------------------------------------------------------------------------------
C7TDF7_LACRG/286-337--------------------------------------------------------------------------------
C7RPH5_ACCPU/152-203--------------------------------------------------------------------------------
D2QD13_SPILD/151-202--------------------------------------------------------------------------------
A4G160_HERAR/158-209--------------------------------------------------------------------------------
A3XG80_LEEBM/154-205--------------------------------------------------------------------------------
C6H7Y4_AJECH/166-242--------------------------------------------------------------------------------
C5G0R2_ARTOC/156-239--------------------------------------------------------------------------------
D4DG81_TRIVH/144-227--------------------------------------------------------------------------------
D4AWU5_ARTBC/72-157--------------------------------------------------------------------------------
D4AWT1_ARTBC/153-252--------------------------------------------------------------------------------
C6HSV2_AJECH/189-299--------------------------------------------------------------------------------
C4JTW4_UNCRE/156-261--------------------------------------------------------------------------------
C5FX47_ARTOC/172-283--------------------------------------------------------------------------------
C5GIN7_AJEDR/149-259--------------------------------------------------------------------------------
C5FYU3_ARTOC/192-299--------------------------------------------------------------------------------
C5PG06_COCP7/175-290--------------------------------------------------------------------------------
A1DHZ4_NEOFI/144-238--------------------------------------------------------------------------------
C6HH53_AJECH/147-240--------------------------------------------------------------------------------
C6HB07_AJECH/162-258--------------------------------------------------------------------------------
B6H206_PENCW/172-270--------------------------------------------------------------------------------
B6HJB7_PENCW/110-203--------------------------------------------------------------------------------
C5FNT1_ARTOC/164-228--------------------------------------------------------------------------------
D4D4G1_TRIVH/160-225--------------------------------------------------------------------------------
D4AWT5_ARTBC/163-226--------------------------------------------------------------------------------
B0CQV9_LACBS/112-197--------------------------------------------------------------------------------
B1VR35_STRGG/22-91--------------------------------------------------------------------------------
B0CUP6_LACBS/82-165--------------------------------------------------------------------------------
C4JQB0_UNCRE/171-234--------------------------------------------------------------------------------
C4JDN9_UNCRE/60-122--------------------------------------------------------------------------------
B6HCX9_PENCW/194-295--------------------------------------------------------------------------------
A2QGH8_ASPNC/178-274--------------------------------------------------------------------------------
A2QG51_ASPNC/197-280--------------------------------------------------------------------------------
B8P2J0_POSPM/349-413--------------------------------------------------------------------------------
B8P2H7_POSPM/369-433--------------------------------------------------------------------------------
B8PJ67_POSPM/96-161--------------------------------------------------------------------------------
B8P061_POSPM/98-163--------------------------------------------------------------------------------
B2WQ71_PYRTR/178-242--------------------------------------------------------------------------------
C7ZJS1_NECH7/14-80--------------------------------------------------------------------------------
C7ZR37_NECH7/151-217--------------------------------------------------------------------------------
Q0CEY0_ASPTN/158-237--------------------------------------------------------------------------------
C7ZM78_NECH7/156-223--------------------------------------------------------------------------------
B6H0Z1_PENCW/209-303--------------------------------------------------------------------------------
B0DGI4_LACBS/197-310--------------------------------------------------------------------------------
B0DGX0_LACBS/22-98--------------------------------------------------------------------------------
B5JTG3_9GAMM/205-258--------------------------------------------------------------------------------
C0NM18_AJECG/69-132--------------------------------------------------------------------------------
C0NFG2_AJECG/145-208--------------------------------------------------------------------------------
B0CU30_LACBS/126-203--------------------------------------------------------------------------------
A1C9L4_ASPCL/21-95--------------------------------------------------------------------------------
C5FQP7_ARTOC/116-187--------------------------------------------------------------------------------
A1CHP5_ASPCL/119-193--------------------------------------------------------------------------------
C1ME87_9ENTR/110-159--------------------------------------------------------------------------------
D4D3B7_TRIVH/114-186--------------------------------------------------------------------------------
C5FLW1_ARTOC/116-189--------------------------------------------------------------------------------
C5FGM1_ARTOC/115-187--------------------------------------------------------------------------------
A0A031MZ15_ECOLX/108-157--------------------------------------------------------------------------------
L3VWH1_ECOLX/324-373--------------------------------------------------------------------------------
B2VKG6_ERWT9/66-115--------------------------------------------------------------------------------
E4NRW0_HALBP/214-265--------------------------------------------------------------------------------
Q18I98_HALWD/210-261--------------------------------------------------------------------------------
E4NSD1_HALBP/243-294--------------------------------------------------------------------------------
C7ZR46_NECH7/227-313--------------------------------------------------------------------------------
C7ZLG5_NECH7/248-329--------------------------------------------------------------------------------
B8G8J9_CHLAD/36-82--------------------------------------------------------------------------------
A0A034USF7_ERWAM/216-274--------------------------------------------------------------------------------
E7FSP2_9LACO/263-324--------------------------------------------------------------------------------
D0FXK4_ERWPE/274-335--------------------------------------------------------------------------------
F3RA44_LISMN/276-338--------------------------------------------------------------------------------
B9MGY9_ACIET/216-265--------------------------------------------------------------------------------
B8F0E2_THASP/225-279--------------------------------------------------------------------------------
A9B5H7_HERA2/140-196--------------------------------------------------------------------------------
D7VSZ6_9SPHI/197-252--------------------------------------------------------------------------------
Q82H00_STRAW/418-471--------------------------------------------------------------------------------
D4GVR6_HALVD/183-239--------------------------------------------------------------------------------
C6WB78_ACTMD/145-200--------------------------------------------------------------------------------
D9TEC7_MICAI/400-455--------------------------------------------------------------------------------
Q9RU61_DEIRA/197-252--------------------------------------------------------------------------------
Q82CY5_STRAW/72-128--------------------------------------------------------------------------------
Q2S547_SALRD/185-241--------------------------------------------------------------------------------
A6TQ34_ALKMQ/175-229--------------------------------------------------------------------------------
C1HR67_9ESCH/182-236--------------------------------------------------------------------------------
C5C731_MICLC/57-112--------------------------------------------------------------------------------
D2RPV1_HALTV/388-442--------------------------------------------------------------------------------
D6SU17_9DELT/210-264--------------------------------------------------------------------------------
Q2S548_SALRD/164-218--------------------------------------------------------------------------------
A9AVZ1_HERA2/214-268--------------------------------------------------------------------------------
C5FYU4_ARTOC/144-210--------------------------------------------------------------------------------
Q89W12_BRADU/199-250--------------------------------------------------------------------------------
Q1DFJ6_MYXXD/230-280--------------------------------------------------------------------------------
B1MFU6_MYCA9/186-236--------------------------------------------------------------------------------
C2IA18_VIBCL/139-188--------------------------------------------------------------------------------
B6H8R8_PENCW/114-188--------------------------------------------------------------------------------
C6HTE9_AJECH/70-135--------------------------------------------------------------------------------
C5P1V7_COCP7/116-194--------------------------------------------------------------------------------
C6H7P6_AJECH/116-190--------------------------------------------------------------------------------
C6HCT2_AJECH/118-196--------------------------------------------------------------------------------
E3J488_FRASU/374-423--------------------------------------------------------------------------------
Q0TBE0_ECOL5/325-374--------------------------------------------------------------------------------
A4JVB2_BURVG/309-359--------------------------------------------------------------------------------
C5PCJ2_COCP7/131-211--------------------------------------------------------------------------------
B6GYF4_PENCW/145-225--------------------------------------------------------------------------------
D4LVH2_9FIRM/326-375--------------------------------------------------------------------------------
Q8YML8_NOSS1/205-259--------------------------------------------------------------------------------
A3X6R6_9RHOB/193-247--------------------------------------------------------------------------------
D0KA46_PECWW/207-263--------------------------------------------------------------------------------
A4WEB7_ENT38/177-224--------------------------------------------------------------------------------
C6DI05_PECCP/215-264--------------------------------------------------------------------------------
A1WU45_HALHL/154-210--------------------------------------------------------------------------------
D5URV1_TSUPD/190-239--------------------------------------------------------------------------------
C2H6L1_ENTFL/305-363--------------------------------------------------------------------------------
D2NQL0_ROTMD/260-309--------------------------------------------------------------------------------
C6WN85_ACTMD/211-260--------------------------------------------------------------------------------
Q5KQA0_CRYNJ/196-257--------------------------------------------------------------------------------
D0FXE6_ERWPE/297-346--------------------------------------------------------------------------------
C1MEC3_9ENTR/183-232--------------------------------------------------------------------------------
B5XX93_KLEP3/359-407--------------------------------------------------------------------------------
Q82H23_STRAW/235-284--------------------------------------------------------------------------------
D5UBZ3_CELFN/122-171--------------------------------------------------------------------------------
A6UKM8_SINMW/8-59--------------------------------------------------------------------------------
D2B5N9_STRRD/214-263--------------------------------------------------------------------------------
B2FKB8_STRMK/193-242--------------------------------------------------------------------------------
C5CHS9_KOSOT/197-246--------------------------------------------------------------------------------
A7ZNC8_ECO24/319-367--------------------------------------------------------------------------------
A4NNK4_HAEIF/325-374--------------------------------------------------------------------------------
A4E9S5_9ACTN/247-296--------------------------------------------------------------------------------
M7P179_KLEPN/397-443--------------------------------------------------------------------------------
B4UFQ3_ANASK/203-252--------------------------------------------------------------------------------
A4V6X0_PSEFS/373-422--------------------------------------------------------------------------------
C8S3P5_9RHOB/198-247--------------------------------------------------------------------------------
E8YPK5_9BURK/129-178--------------------------------------------------------------------------------
D1P2G2_9ENTR/241-290--------------------------------------------------------------------------------
B1XPM9_SYNP2/314-363--------------------------------------------------------------------------------
B0RXA4_XANCB/309-358--------------------------------------------------------------------------------

PF13930

D0LUR7_HALO1/91-222--------------------------------------------------------------------------------
B0UVC7_HISS2/2603-2730--------------------------------------------------------------------------------
YEEF_BACSU/525-655--------------------------------------------------------------------------------
A8FDL6_BACP2/98-224--------------------------------------------------------------------------------
Q7N913_PHOLL/198-325--------------------------------------------------------------------------------
A8FDL4_BACP2/498-628--------------------------------------------------------------------------------
Q9K6M4_BACHD/424-550--------------------------------------------------------------------------------
Q5WJ65_BACSK/469-594--------------------------------------------------------------------------------
Q21NY0_SACD2/315-455--------------------------------------------------------------------------------
C0R0R8_BRAHW/45-173--------------------------------------------------------------------------------
D2QLJ8_SPILD/282-421--------------------------------------------------------------------------------
D6S5M6_9LACO/124-258--------------------------------------------------------------------------------
B0RGD0_CLAMS/624-751--------------------------------------------------------------------------------
Q74IV6_LACJO/120-254--------------------------------------------------------------------------------
Q1G8G9_LACDA/127-261--------------------------------------------------------------------------------
Q03WR4_LEUMM/85-232--------------------------------------------------------------------------------
C2X0R6_BACCE/409-538--------------------------------------------------------------------------------
Q5FK46_LACAC/120-251--------------------------------------------------------------------------------
Q835Q6_ENTFA/75-202--------------------------------------------------------------------------------
R5U617_9FIRM/67-203--------------------------------------------------------------------------------
T0UB90_9ENTE/93-224--------------------------------------------------------------------------------

PF06147

A7MHN7_CROS8/117-334--------------------------------------------------------------------------------
A3MZM0_ACTP2/134-333--------------------------------------------------------------------------------
Q7ME22_VIBVY/140-345--------------------------------------------------------------------------------
M9X5K0_PASHA/139-336--------------------------------------------------------------------------------

PF01223

Q95TI9_DROME/65-324--------------------------------------------------------------------------------
E7S4P9_STRAG/86-283--------------------------------------------------------------------------------
Q7NPI0_GLOVI/39-265--------------------------------------------------------------------------------
Q8A1U5_BACTN/46-275--------------------------------------------------------------------------------
Q8KGT7_RHILI/434-688--------------------------------------------------------------------------------
Q7QK21_ANOGA/167-356--------------------------------------------------------------------------------
Q8I9M9_PARCM/131-389--------------------------------------------------------------------------------
Q26707_9TRYP/117-408--------------------------------------------------------------------------------
Q8IPZ0_DROME/71-300--------------------------------------------------------------------------------
Q7QH21_ANOGA/177-440--------------------------------------------------------------------------------
NUCA_NOSS1/42-263--------------------------------------------------------------------------------
Q9VGU3_DROME/132-362--------------------------------------------------------------------------------
Q8YKN2_NOSS1/41-276--------------------------------------------------------------------------------
Q6TRY8_CULQU/109-345--------------------------------------------------------------------------------
Q9VU22_DROME/1089-1351--------------------------------------------------------------------------------
Q7NI85_GLOVI/113-335--------------------------------------------------------------------------------
Q8RE47_FUSNN/335-559--------------------------------------------------------------------------------
Q9ZJL1_HELPJ/54-273--------------------------------------------------------------------------------
A9QSL0_LACLK/41-258--------------------------------------------------------------------------------
NUC1_CUNEE/3-231--------------------------------------------------------------------------------
A0A031RVU6_SERMA/25-246--------------------------------------------------------------------------------
NUCG_MOUSE/57-282--------------------------------------------------------------------------------
Q9AAQ2_CAUCR/422-665--------------------------------------------------------------------------------
Q9VVV1_DROME/147-406--------------------------------------------------------------------------------
PNU1_SCHPO/59-291--------------------------------------------------------------------------------
Q7PZ31_ANOGA/114-367--------------------------------------------------------------------------------
C6IP62_9BACE/145-363--------------------------------------------------------------------------------
Q7PVB8_ANOGA/98-351--------------------------------------------------------------------------------
A0A029S9H5_STRPY/60-262--------------------------------------------------------------------------------
Q9VAU2_DROME/106-358--------------------------------------------------------------------------------
A0A029S6E3_STRPY/70-270--------------------------------------------------------------------------------
Q8RLY2_SALET/51-274--------------------------------------------------------------------------------
NUC1_YEAST/55-290--------------------------------------------------------------------------------
E9DD73_COCPS/73-305--------------------------------------------------------------------------------
Q8DFB3_VIBVU/21-232--------------------------------------------------------------------------------
O33735_STRPY/73-293--------------------------------------------------------------------------------
Q9I417_PSEAE/377-604--------------------------------------------------------------------------------
Q7Q2Q3_ANOGA/93-346--------------------------------------------------------------------------------
O73911_CHICK/38-276--------------------------------------------------------------------------------
Q8K6B9_STRP3/69-287--------------------------------------------------------------------------------
Q7RY75_NEUCR/71-303--------------------------------------------------------------------------------
B0RUP9_XANCB/8-230--------------------------------------------------------------------------------
A5M2Y5_STREE/74-272--------------------------------------------------------------------------------
Q8Y1E6_RALSO/63-274--------------------------------------------------------------------------------
Q8PFE6_XANAC/65-274--------------------------------------------------------------------------------
Q9VAU3_DROME/102-344--------------------------------------------------------------------------------
Q8TKR8_METAC/401-625--------------------------------------------------------------------------------
EXOG_MOUSE/58-287--------------------------------------------------------------------------------
Q9VU24_DROME/166-420--------------------------------------------------------------------------------
C0X3R4_ENTFL/87-279--------------------------------------------------------------------------------
M9N460_ASHG1/44-272--------------------------------------------------------------------------------
F3IR03_PSESL/68-291--------------------------------------------------------------------------------
C6IET4_9BACE/64-276--------------------------------------------------------------------------------
NUC1_SYNRA/71-306--------------------------------------------------------------------------------
Q9U5L8_PENJP/126-384--------------------------------------------------------------------------------
NUCG_CAEEL/65-293--------------------------------------------------------------------------------
Q7USW1_RHOBA/592-846--------------------------------------------------------------------------------
Y4FB_RHISN/398-641--------------------------------------------------------------------------------

PF14414

D0W6H7_NEILA/149-191--------------------------------------------------------------------------------
B1J8X4_PSEPW/63-111--------------------------------------------------------------------------------
B3PHU6_CELJU/392-431--------------------------------------------------------------------------------
D3L0R9_9BACT/153-195--------------------------------------------------------------------------------
B5GPR2_STRC2/109-151--------------------------------------------------------------------------------
Q1QCA3_PSYCK/161-203--------------------------------------------------------------------------------
E5C6Z5_9BACE/106-153--------------------------------------------------------------------------------
A5Z4R4_9FIRM/339-381--------------------------------------------------------------------------------
A0A011WJ18_BACTI/19-61--------------------------------------------------------------------------------
B8I221_CLOCE/239-288--------------------------------------------------------------------------------
A3IE28_9BACI/350-392--------------------------------------------------------------------------------
B3Z4D8_BACCE/173-215--------------------------------------------------------------------------------
E1S5U4_HELP9/196-239--------------------------------------------------------------------------------
D4DXP2_SEROD/85-134--------------------------------------------------------------------------------
B2Q7F2_PROST/252-300--------------------------------------------------------------------------------
B4EP57_BURCJ/1370-1412--------------------------------------------------------------------------------
C2UG56_BACCE/26-68--------------------------------------------------------------------------------
Q3IK23_PSEHT/156-198--------------------------------------------------------------------------------
H2GD98_CORD2/1209-1251--------------------------------------------------------------------------------
B6BJ56_SULGG/129-173--------------------------------------------------------------------------------
C9PRI4_9PAST/124-168--------------------------------------------------------------------------------
D0W666_NEILA/32-76--------------------------------------------------------------------------------
B7HC27_BACC4/136-177--------------------------------------------------------------------------------
A6CCT8_9PLAN/400-442--------------------------------------------------------------------------------
A9AVI8_HERA2/3027-3069--------------------------------------------------------------------------------
A5Z4R0_9FIRM/19-65--------------------------------------------------------------------------------
A8RX43_CLOBW/197-243--------------------------------------------------------------------------------
Q7MZK5_PHOLL/1371-1416--------------------------------------------------------------------------------
A4JB11_BURVG/1495-1544--------------------------------------------------------------------------------
C2LFQ4_PROMI/165-214--------------------------------------------------------------------------------
C6MAI9_NEISI/47-95--------------------------------------------------------------------------------
A3KB10_9RHOB/227-274--------------------------------------------------------------------------------
A0A011SXZ9_VIBPH/1318-1364--------------------------------------------------------------------------------
D2YA40_VIBMI/1355-1403--------------------------------------------------------------------------------

PF14410

B9M483_GEODF/74-140--------------------------------------------------------------------------------
B2JXD4_BURP8/2948-3016--------------------------------------------------------------------------------
A4LGH9_BURPE/147-215--------------------------------------------------------------------------------
B9LCH9_CHLSY/270-334--------------------------------------------------------------------------------
C2RQE1_BACCE/43-125--------------------------------------------------------------------------------
C8NB27_9GAMM/65-134--------------------------------------------------------------------------------
A7JRY2_PASHA/3122-3192--------------------------------------------------------------------------------
E2P5A9_PASHA/3105-3174--------------------------------------------------------------------------------
F1WWY7_MORCA/195-265--------------------------------------------------------------------------------
F1WTR8_MORCA/82-151--------------------------------------------------------------------------------
D3A0M0_NEIMU/642-712--------------------------------------------------------------------------------
D6ZD49_SEGRD/415-489--------------------------------------------------------------------------------
D6ZB38_SEGRD/420-491--------------------------------------------------------------------------------
B8I219_CLOCE/1270-1339--------------------------------------------------------------------------------
E4NNI9_HALBP/322-399--------------------------------------------------------------------------------
E4NLC7_HALBP/333-403--------------------------------------------------------------------------------
D4YN65_9MICO/242-321--------------------------------------------------------------------------------
D7JC47_9BACT/1-57--------------------------------------------------------------------------------
Q48JD7_PSE14/299-370--------------------------------------------------------------------------------
D4FSV7_STROR/39-110--------------------------------------------------------------------------------
A5Z849_9FIRM/221-292--------------------------------------------------------------------------------
M1UI10_BACIU/451-522--------------------------------------------------------------------------------
Q0BGH2_BURCM/476-547--------------------------------------------------------------------------------
Q7W1H8_BORPA/221-292--------------------------------------------------------------------------------
A9I1F1_BORPD/290-361--------------------------------------------------------------------------------
C4ZDS7_EUBR3/27-110--------------------------------------------------------------------------------
C5BZG6_BEUC1/289-366--------------------------------------------------------------------------------
Q63EY8_BACCZ/261-339--------------------------------------------------------------------------------
A0A023MBG2_LACPN/545-622--------------------------------------------------------------------------------
A9VI39_BACWK/230-307--------------------------------------------------------------------------------
D4FSW1_STROR/66-143--------------------------------------------------------------------------------
C2R1N3_BACCE/87-164--------------------------------------------------------------------------------
E4NKW7_HALBP/189-266--------------------------------------------------------------------------------
Q97IK0_CLOAB/300-377--------------------------------------------------------------------------------
F2H4N8_BACTU/235-311--------------------------------------------------------------------------------
C2ZCH4_BACCE/166-242--------------------------------------------------------------------------------
B0KTG5_PSEPG/321-389--------------------------------------------------------------------------------
D8NE31_RALSL/1447-1516--------------------------------------------------------------------------------
D3A8Q2_NEISU/281-354--------------------------------------------------------------------------------
D2ZY29_NEIMU/317-390--------------------------------------------------------------------------------
D1QWB6_9BACT/59-130--------------------------------------------------------------------------------
D2ZY17_NEIMU/1290-1360--------------------------------------------------------------------------------
D7NAI5_9BACT/60-127--------------------------------------------------------------------------------
B4E5I3_BURCJ/270-339--------------------------------------------------------------------------------
C3G567_BACTU/455-525--------------------------------------------------------------------------------
B3Z4D6_BACCE/80-150--------------------------------------------------------------------------------
C3BVM6_9BACI/30-100--------------------------------------------------------------------------------
C2X0R2_BACCE/45-115--------------------------------------------------------------------------------
C2LJS8_PROMI/56-126--------------------------------------------------------------------------------
D0KGF8_PECWW/1348-1417--------------------------------------------------------------------------------
D7HX78_PSESS/176-245--------------------------------------------------------------------------------

PF05766

A4G7D7_HERAR/8-194-------------------------------------------------------------------------------N
Q4KA59_PSEF5/8-195-------------------------------------------------------------------------------T
Q8ZMY3_SALTY/1-203-------------------------------------------------------------------------------M
B0USX4_HISS2/3-190-------------------------------------------------------------------------------.
M9WYN9_PASHA/4-187-------------------------------------------------------------------------------.
NING_LAMBD/2-198-------------------------------------------------------------------------------M
Q7CID4_YERPE/3-199-------------------------------------------------------------------------------.

PF16784

Q03RB7_LACBA/20-217---------------------------------------------------------------------------SDVD.
Q2FUP5_STAA8/21-220---------------------------------------------------------------------------.GVEL

PF13392

C7QT14_CYAP0/194-244--------------------------------------------------------------------------------
A0A026EEZ3_ECO57/59-105--------------------------------------------------------------------------------
C3QU81_9BACE/58-104--------------------------------------------------------------------------------
A7K8I5_9PHYC/225-274--------------------------------------------------------------------------------
A7ITH3_PBCVM/254-303--------------------------------------------------------------------------------
A7J8G9_PBCVF/235-284--------------------------------------------------------------------------------
A7J6P1_PBCVF/231-280--------------------------------------------------------------------------------
A7IWP5_PBCVN/225-274--------------------------------------------------------------------------------
A7RBV7_PBCVA/231-280--------------------------------------------------------------------------------
A7K8W0_9PHYC/231-280--------------------------------------------------------------------------------
A7IWX1_PBCVN/283-332--------------------------------------------------------------------------------
A7IW93_PBCVN/277-326--------------------------------------------------------------------------------
A7RCQ9_PBCVA/277-326--------------------------------------------------------------------------------
A7IVT6_PBCVN/276-325--------------------------------------------------------------------------------
A7RBJ5_PBCVA/282-331--------------------------------------------------------------------------------
A7IW48_PBCVN/71-118--------------------------------------------------------------------------------
Q56C21_9CAUD/55-98--------------------------------------------------------------------------------
Q56BD9_9CAUD/58-104--------------------------------------------------------------------------------
Q4TZV2_9CAUD/72-115--------------------------------------------------------------------------------
B1ZU98_OPITP/143-188--------------------------------------------------------------------------------
B9EBP9_MACCJ/89-134--------------------------------------------------------------------------------
C4GFQ4_9NEIS/59-100--------------------------------------------------------------------------------
C8P900_9LACO/34-80--------------------------------------------------------------------------------
D0DHI8_9LACO/69-115--------------------------------------------------------------------------------
D4FMY2_STAEP/121-166--------------------------------------------------------------------------------
Q6V7S9_9CAUD/61-107--------------------------------------------------------------------------------
A2I7W9_9CAUD/55-100--------------------------------------------------------------------------------
C7N6R6_SLAHD/162-208--------------------------------------------------------------------------------
A4NIF9_HAEIF/148-193--------------------------------------------------------------------------------
A0JQK4_LACS1/121-166--------------------------------------------------------------------------------
Q8DFY6_VIBVU/126-171--------------------------------------------------------------------------------
C4ZC58_EUBR3/189-234--------------------------------------------------------------------------------
C6IF55_9BACE/173-218--------------------------------------------------------------------------------
B1JD21_PSEPW/105-150--------------------------------------------------------------------------------
Q87Y63_PSESM/75-120--------------------------------------------------------------------------------
A1RL04_SHESW/183-228--------------------------------------------------------------------------------
B6XKN8_9ENTR/115-160--------------------------------------------------------------------------------
C5F4D1_LACPA/110-155--------------------------------------------------------------------------------
A0A031ABV7_PSEAI/156-201--------------------------------------------------------------------------------
A3WSR8_9BRAD/121-165--------------------------------------------------------------------------------
B2FM68_STRMK/151-200--------------------------------------------------------------------------------
A4JMG5_BURVG/144-193--------------------------------------------------------------------------------
Q15Y23_PSEA6/178-223--------------------------------------------------------------------------------
A0A021B9T1_STAAU/98-143--------------------------------------------------------------------------------
A6F4T8_9ALTE/122-168--------------------------------------------------------------------------------
A4WTA3_RHOS5/127-172--------------------------------------------------------------------------------
Q0FIB1_PELBH/128-173--------------------------------------------------------------------------------
A5LQ22_STREE/161-206--------------------------------------------------------------------------------
A1EAC5_9CAUD/175-220--------------------------------------------------------------------------------
C5UU10_CLOBO/128-173--------------------------------------------------------------------------------
Q73NJ9_TREDE/117-162--------------------------------------------------------------------------------
C8Q074_9GAMM/121-166--------------------------------------------------------------------------------
D0S8T8_ACIJO/121-166--------------------------------------------------------------------------------
C6E6S5_GEOSM/133-178--------------------------------------------------------------------------------
A9C3M0_DELAS/190-235--------------------------------------------------------------------------------
D4CX94_9FUSO/117-162--------------------------------------------------------------------------------
Q7P8C3_FUSNV/72-117--------------------------------------------------------------------------------
C7XPL9_FUSNV/61-106--------------------------------------------------------------------------------
D4CX93_9FUSO/115-161--------------------------------------------------------------------------------
B2TP02_CLOBB/128-173--------------------------------------------------------------------------------
C6CX53_PAESJ/104-150--------------------------------------------------------------------------------
A6TRD3_ALKMQ/182-227--------------------------------------------------------------------------------
C3DU79_BACTS/116-161--------------------------------------------------------------------------------
E6U5S1_ETHHY/116-161--------------------------------------------------------------------------------
C3JGM1_RHOER/317-363--------------------------------------------------------------------------------
Y53_BPT3/45-90--------------------------------------------------------------------------------
B3VD54_9CAUD/38-83--------------------------------------------------------------------------------
Q3YJY2_BPK1F/38-83--------------------------------------------------------------------------------
B5LJM0_9CAUD/57-102--------------------------------------------------------------------------------
A6W8V6_KINRD/41-87--------------------------------------------------------------------------------
C5E9V7_BIFLI/27-72--------------------------------------------------------------------------------
Q856N8_BPMCO/89-135--------------------------------------------------------------------------------
A0MZB2_BPN4/61-106--------------------------------------------------------------------------------
B9K2P8_AGRVS/53-100--------------------------------------------------------------------------------
A6UA36_SINMW/51-98--------------------------------------------------------------------------------
C8ZKQ5_9CAUD/63-108--------------------------------------------------------------------------------
C4NT45_9CAUD/52-97--------------------------------------------------------------------------------
A1UH45_MYCSK/70-115--------------------------------------------------------------------------------
D0U234_9CAUD/40-85--------------------------------------------------------------------------------
Q6X9Q0_9CAUD/46-92--------------------------------------------------------------------------------
B4YQH7_9CAUD/40-85--------------------------------------------------------------------------------
Q39FD2_BURS3/42-87--------------------------------------------------------------------------------
B2HPG6_MYCMM/67-112--------------------------------------------------------------------------------
A0A058WBB0_BORBO/39-84--------------------------------------------------------------------------------
Q8XUJ5_RALSO/52-97--------------------------------------------------------------------------------
Q8XUF6_RALSO/69-114--------------------------------------------------------------------------------
A6T071_JANMA/40-85--------------------------------------------------------------------------------
Q5G8U2_9CAUD/66-111--------------------------------------------------------------------------------
I6Q9W6_9CAUD/45-90--------------------------------------------------------------------------------
C6BBU5_RALP1/42-87--------------------------------------------------------------------------------
D1L332_9CAUD/27-75--------------------------------------------------------------------------------
B5ZXT2_RHILW/47-92--------------------------------------------------------------------------------
B7UG64_ECO27/45-90--------------------------------------------------------------------------------
B3VD64_9CAUD/26-71--------------------------------------------------------------------------------
C6BBU3_RALP1/28-76--------------------------------------------------------------------------------
Q6WYF0_BPT7/42-82--------------------------------------------------------------------------------
A9XL65_BPT7/26-71--------------------------------------------------------------------------------
Q55C13_DICDI/44-90--------------------------------------------------------------------------------
C8T858_KLEPR/128-173--------------------------------------------------------------------------------
A7IWJ9_PBCVN/166-211--------------------------------------------------------------------------------
A7IW40_PBCVN/137-186--------------------------------------------------------------------------------
A7IW08_PBCVN/127-176--------------------------------------------------------------------------------
A7IXP3_PBCVN/63-109--------------------------------------------------------------------------------
A7IV02_PBCVM/62-108--------------------------------------------------------------------------------
A7IW74_PBCVN/69-115--------------------------------------------------------------------------------
A7IWU9_PBCVN/61-106--------------------------------------------------------------------------------
A7IWP5_PBCVN/60-106--------------------------------------------------------------------------------
A7RBV7_PBCVA/60-106--------------------------------------------------------------------------------
A7RBZ3_PBCVA/103-150--------------------------------------------------------------------------------
A7IXC3_PBCVN/104-151--------------------------------------------------------------------------------
A7IWX1_PBCVN/103-150--------------------------------------------------------------------------------
A7KA42_9PHYC/77-123--------------------------------------------------------------------------------
A7K9V2_9PHYC/78-124--------------------------------------------------------------------------------
A7K8I5_9PHYC/59-105--------------------------------------------------------------------------------
D3SUH7_NATMM/146-192--------------------------------------------------------------------------------
A7IW48_PBCVN/260-306--------------------------------------------------------------------------------
B8INW1_METNO/63-109--------------------------------------------------------------------------------
C3KA00_PSEFS/68-113--------------------------------------------------------------------------------
A0A009UX44_ACIBA/66-111--------------------------------------------------------------------------------
C4ML45_9CAUD/99-146--------------------------------------------------------------------------------
A5HL46_9CAUD/98-145--------------------------------------------------------------------------------
A3XJC2_LEEBM/63-108--------------------------------------------------------------------------------
B0N8L2_9FIRM/61-106--------------------------------------------------------------------------------
Q2IFG5_ANADE/52-97--------------------------------------------------------------------------------
C7XUT9_9LACO/28-73--------------------------------------------------------------------------------
C3KZN2_CLOB6/39-84--------------------------------------------------------------------------------
Q6V7S8_9CAUD/139-185--------------------------------------------------------------------------------
A9I8T5_BORPD/76-129--------------------------------------------------------------------------------
A6TVB1_ALKMQ/97-143--------------------------------------------------------------------------------
D4BUG2_PRORE/155-201--------------------------------------------------------------------------------
B5LPN5_9CAUD/94-140--------------------------------------------------------------------------------
C5B0P1_METEA/139-185--------------------------------------------------------------------------------
Q633W4_BACCZ/111-157--------------------------------------------------------------------------------
C5H7P3_9CAUD/62-105--------------------------------------------------------------------------------
Q6QGN6_BPT5/53-96--------------------------------------------------------------------------------
C0ZXU5_RHOE4/92-138--------------------------------------------------------------------------------
C3KZN5_CLOB6/115-155--------------------------------------------------------------------------------
Q6XQA1_BPT1/50-95--------------------------------------------------------------------------------
Q6KG62_BPFO1/53-98--------------------------------------------------------------------------------
Q3J217_RHOS4/61-107--------------------------------------------------------------------------------
Q9T140_9CAUD/59-104--------------------------------------------------------------------------------
D1L2U2_9CAUD/88-133--------------------------------------------------------------------------------
Q6XQF0_BPT1/57-102--------------------------------------------------------------------------------
Q6XQ94_BPT1/46-91--------------------------------------------------------------------------------
B1GS34_9CAUD/33-78--------------------------------------------------------------------------------
A5PJ37_9CAUD/57-102--------------------------------------------------------------------------------
A5PJ23_9CAUD/113-158--------------------------------------------------------------------------------
B0FIJ3_BPE32/42-86--------------------------------------------------------------------------------
C4NTD4_9CAUD/53-96--------------------------------------------------------------------------------
D2K055_9CAUD/58-102--------------------------------------------------------------------------------
B3VD46_9CAUD/50-96--------------------------------------------------------------------------------
D2EBT0_9CAUD/53-98--------------------------------------------------------------------------------
Q5IGW5_9CAUD/59-103--------------------------------------------------------------------------------
C5B0T1_METEA/50-94--------------------------------------------------------------------------------
A4JMK1_BURVG/52-94--------------------------------------------------------------------------------
B9BHP6_9BURK/57-100--------------------------------------------------------------------------------
A0A024ZD01_ECOLX/68-112--------------------------------------------------------------------------------
B2ZYK2_9CAUD/71-116--------------------------------------------------------------------------------
Q1QRF2_NITHX/41-86--------------------------------------------------------------------------------
A8HNZ9_9CAUD/53-96--------------------------------------------------------------------------------
C9XY04_CROTZ/62-105--------------------------------------------------------------------------------
B4EME9_BURCJ/77-121--------------------------------------------------------------------------------
C4S5Y1_YERBE/57-101--------------------------------------------------------------------------------
Q66LV6_BPT5/53-98--------------------------------------------------------------------------------
B8QTY8_9CAUD/49-93--------------------------------------------------------------------------------
A0A024SZF9_PSEAI/58-101--------------------------------------------------------------------------------
A4JMK3_BURVG/70-113--------------------------------------------------------------------------------
D0KHU7_PECWW/69-114--------------------------------------------------------------------------------
D8JQ74_HYPDA/54-98--------------------------------------------------------------------------------
C5AFV3_BURGB/73-117--------------------------------------------------------------------------------
A9BW22_DELAS/55-99--------------------------------------------------------------------------------
C4ML49_9CAUD/55-99--------------------------------------------------------------------------------
D1P077_9ENTR/54-97--------------------------------------------------------------------------------
A9C0F7_DELAS/72-116--------------------------------------------------------------------------------
Q4TZV0_9CAUD/53-96--------------------------------------------------------------------------------
A3EZR8_9CAUD/55-99--------------------------------------------------------------------------------
K4TKR8_BORBO/58-102--------------------------------------------------------------------------------
C5A7Y6_BURGB/56-100--------------------------------------------------------------------------------
B7ULS6_ECO27/31-76--------------------------------------------------------------------------------
C4ML56_9CAUD/95-139--------------------------------------------------------------------------------
D8JQ53_HYPDA/58-102--------------------------------------------------------------------------------
Q7Y5F9_9CAUD/57-101--------------------------------------------------------------------------------
A5H1J6_9CAUD/80-124--------------------------------------------------------------------------------
A5H1L2_9CAUD/57-101--------------------------------------------------------------------------------
A8B107_9CAUD/57-101--------------------------------------------------------------------------------
Q2NPG0_9CAUD/57-101--------------------------------------------------------------------------------
A5H1K2_9CAUD/48-92--------------------------------------------------------------------------------
Q7Y5L4_9CAUD/73-117--------------------------------------------------------------------------------
Q7Y5G7_9CAUD/59-103--------------------------------------------------------------------------------
Q2NPD3_9CAUD/62-106--------------------------------------------------------------------------------
Q4TZV1_9CAUD/74-117--------------------------------------------------------------------------------
C4MYH3_9CAUD/75-118--------------------------------------------------------------------------------
C4MYS3_9CAUD/74-117--------------------------------------------------------------------------------
Q1QKU3_NITHX/67-111--------------------------------------------------------------------------------
A9DEP0_9CAUD/52-97--------------------------------------------------------------------------------
A0A028EKB2_ECO57/58-102--------------------------------------------------------------------------------
A2WAD2_9BURK/68-112--------------------------------------------------------------------------------
B7UG37_ECO27/66-110--------------------------------------------------------------------------------
A1JR30_YERE8/67-111--------------------------------------------------------------------------------
C3AR86_BACMY/82-128--------------------------------------------------------------------------------
C2JXG4_LACRH/90-135--------------------------------------------------------------------------------
B9UDM8_9CAUD/63-109--------------------------------------------------------------------------------
D4CXF1_9FUSO/31-77--------------------------------------------------------------------------------
A6L5T7_BACV8/63-109--------------------------------------------------------------------------------
C8T854_KLEPR/51-91--------------------------------------------------------------------------------
A7IV02_PBCVM/236-282--------------------------------------------------------------------------------
A2I7Y0_9CAUD/50-95--------------------------------------------------------------------------------
C7XUW2_9LACO/54-99--------------------------------------------------------------------------------
F4E585_BACAM/52-97--------------------------------------------------------------------------------
C0ZXW0_RHOE4/69-114--------------------------------------------------------------------------------
D3V337_XENBS/84-129--------------------------------------------------------------------------------
D2J8C8_STAAU/58-103--------------------------------------------------------------------------------
D4CXE9_9FUSO/59-104--------------------------------------------------------------------------------
Q84408_PBCV1/343-397--------------------------------------------------------------------------------
A7IWJ9_PBCVN/358-412--------------------------------------------------------------------------------
A7IW40_PBCVN/332-386--------------------------------------------------------------------------------
A7IW08_PBCVN/321-375--------------------------------------------------------------------------------
Q8QNG0_ESV1K/274-319--------------------------------------------------------------------------------
O80123_9CAUD/49-92--------------------------------------------------------------------------------
C7T1V9_9CAUD/47-90--------------------------------------------------------------------------------
O80140_9CAUD/47-90--------------------------------------------------------------------------------
Q09WS3_9CAUD/48-91--------------------------------------------------------------------------------
C7T218_9CAUD/56-99--------------------------------------------------------------------------------
Q09WT2_9CAUD/48-91--------------------------------------------------------------------------------
Q09YD3_9CAUD/47-90--------------------------------------------------------------------------------

PF07510

Q5Z0T6_NOCFA/102-248--------------------------------------------------------------------------------
A1R7C6_ARTAT/113-252--------------------------------------------------------------------------------
Q0RYV1_RHOSR/93-233--------------------------------------------------------------------------------
Q0S639_RHOSR/133-273--------------------------------------------------------------------------------
Q0S647_RHOSR/106-246--------------------------------------------------------------------------------
Q8FM54_COREF/109-249--------------------------------------------------------------------------------
Q6A6U8_PROAC/86-225--------------------------------------------------------------------------------
A0LV32_ACIC1/126-265--------------------------------------------------------------------------------
Q82HG5_STRAW/78-214--------------------------------------------------------------------------------
A0JTH8_ARTS2/211-350--------------------------------------------------------------------------------
A0JWX0_ARTS2/105-245--------------------------------------------------------------------------------
A1A395_BIFAA/100-238--------------------------------------------------------------------------------
Q8G7L0_BIFLO/75-214--------------------------------------------------------------------------------
Q2J4M2_FRASC/98-236--------------------------------------------------------------------------------
Q6NHN8_CORDI/105-245--------------------------------------------------------------------------------
A1T721_MYCVP/87-228--------------------------------------------------------------------------------
Q0SGG1_RHOSR/90-229--------------------------------------------------------------------------------
Q5Z121_NOCFA/118-257--------------------------------------------------------------------------------
A7ICR1_XANP2/481-654--------------------------------------------------------------------------------
Q2GBR5_NOVAD/473-622--------------------------------------------------------------------------------
Q88BH3_PSESM/500-658--------------------------------------------------------------------------------
A1U086_MARAV/478-634--------------------------------------------------------------------------------
Q5NWK7_AROAE/455-614--------------------------------------------------------------------------------
A6TCP9_KLEP7/451-620--------------------------------------------------------------------------------
Q886C3_PSESM/451-620--------------------------------------------------------------------------------
A1SFN4_NOCSJ/451-594--------------------------------------------------------------------------------
Q8NSE2_CORGL/410-552--------------------------------------------------------------------------------
B3EQQ5_CHLPB/412-553--------------------------------------------------------------------------------
Q036N1_LACC3/426-567--------------------------------------------------------------------------------
Q2FKU3_METHJ/422-570--------------------------------------------------------------------------------
A0RWN2_CENSY/426-563--------------------------------------------------------------------------------
A0ZGR7_NODSP/401-537--------------------------------------------------------------------------------
A4J1V4_DESRM/398-534--------------------------------------------------------------------------------
A9AZI5_HERA2/396-532--------------------------------------------------------------------------------
Q2J8U4_FRASC/408-551--------------------------------------------------------------------------------
O25346_HELPY/413-546--------------------------------------------------------------------------------
Q5LGD9_BACFN/443-600--------------------------------------------------------------------------------
Q7VHA6_HELHP/428-575--------------------------------------------------------------------------------
A7UG49_FIBSS/466-641--------------------------------------------------------------------------------
Q11AI8_CHESB/234-376--------------------------------------------------------------------------------
Q8YLY7_NOSS1/189-334--------------------------------------------------------------------------------
A0RVA9_CENSY/414-554--------------------------------------------------------------------------------
Q2SGD6_HAHCH/412-558--------------------------------------------------------------------------------
Q9XAG9_STRCO/398-541--------------------------------------------------------------------------------
A9AVQ7_HERA2/439-587--------------------------------------------------------------------------------
Q3ATS7_CHLCH/421-558--------------------------------------------------------------------------------
A5V079_ROSS1/420-557--------------------------------------------------------------------------------
A1AQQ9_PELPD/425-562--------------------------------------------------------------------------------
A6VMJ2_ACTSZ/423-561--------------------------------------------------------------------------------
Q3AS66_CHLCH/431-567--------------------------------------------------------------------------------
Q7NME9_GLOVI/421-559--------------------------------------------------------------------------------
A9AVB5_HERA2/420-558--------------------------------------------------------------------------------
A6Q5M5_NITSB/432-580--------------------------------------------------------------------------------
Q8YA53_LISMO/416-546--------------------------------------------------------------------------------
A4J5I9_DESRM/420-565--------------------------------------------------------------------------------
Q8YPL5_NOSS1/423-586--------------------------------------------------------------------------------
Q6F1G1_MESFL/672-827--------------------------------------------------------------------------------
A5IYB8_MYCAP/428-578--------------------------------------------------------------------------------
Q5YR97_NOCFA/406-548--------------------------------------------------------------------------------
Q4JVU8_CORJK/414-556--------------------------------------------------------------------------------
Q1DEQ6_MYXXD/411-552--------------------------------------------------------------------------------
Q6D0Y9_PECAS/408-551--------------------------------------------------------------------------------
Q6ZEH4_SYNY3/425-566--------------------------------------------------------------------------------
Q5KUQ7_GEOKA/389-532--------------------------------------------------------------------------------
A6GW01_FLAPJ/386-529--------------------------------------------------------------------------------
A4G9X6_HERAR/400-542--------------------------------------------------------------------------------
Q0C3X8_HYPNA/403-545--------------------------------------------------------------------------------
Q6LTS8_PHOPR/529-671--------------------------------------------------------------------------------
Q11QY5_CYTH3/502-639--------------------------------------------------------------------------------
A0M4J9_GRAFK/551-704--------------------------------------------------------------------------------
Q0AUV6_SYNWW/448-590--------------------------------------------------------------------------------
Q4FRY4_PSYA2/530-667--------------------------------------------------------------------------------
Q9PPW3_UREPA/769-912--------------------------------------------------------------------------------
Q6AIF5_DESPS/418-563--------------------------------------------------------------------------------
O24986_HELPY/247-392--------------------------------------------------------------------------------
A1A1T1_BIFAA/469-640--------------------------------------------------------------------------------
Q5LEB6_BACFN/377-525--------------------------------------------------------------------------------
A5FWM6_ACICJ/377-525--------------------------------------------------------------------------------
Q3JCQ9_NITOC/323-466--------------------------------------------------------------------------------
A9WEH8_CHLAA/424-558--------------------------------------------------------------------------------
B0RGW4_CLAMS/92-228--------------------------------------------------------------------------------
Q8XIG5_CLOPE/441-575--------------------------------------------------------------------------------
Q9KR77_VIBCH/513-654--------------------------------------------------------------------------------
R5T7Y2_9CLOT/410-545--------------------------------------------------------------------------------

PF14412

A5W3P0_PSEP1/1280-1394--------------------------------------------------------------------------------
A7MQ50_CROS8/1402-1512--------------------------------------------------------------------------------
Q1VCI2_VIBAL/107-222--------------------------------------------------------------------------------
Q82R58_STRAW/2257-2362--------------------------------------------------------------------------------
A6G3J9_9DELT/2292-2397--------------------------------------------------------------------------------
B2RK38_PORG3/122-225--------------------------------------------------------------------------------
A9AT71_BURM1/1292-1398--------------------------------------------------------------------------------
C2LKS1_PROMI/54-162--------------------------------------------------------------------------------
D6HTD3_ECOLX/139-248--------------------------------------------------------------------------------
A9EDX2_9FLAO/535-640--------------------------------------------------------------------------------
D0LTA7_HALO1/752-883--------------------------------------------------------------------------------
D0LKQ6_HALO1/810-934--------------------------------------------------------------------------------
D0LLJ7_HALO1/620-748--------------------------------------------------------------------------------
A6CDX3_9PLAN/332-450--------------------------------------------------------------------------------
E1KPW8_9BACT/935-1042--------------------------------------------------------------------------------
F0K581_CLOAE/200-308--------------------------------------------------------------------------------
A9VT18_BACWK/373-481--------------------------------------------------------------------------------
B1K7M0_BURCC/1371-1487--------------------------------------------------------------------------------
A7MQ44_CROS8/1218-1330--------------------------------------------------------------------------------
B1JMY6_YERPY/61-165--------------------------------------------------------------------------------
E2MFF7_PSEUB/30-137--------------------------------------------------------------------------------
Q8XQT2_RALSO/1406-1511--------------------------------------------------------------------------------
Q2SPA9_HAHCH/25-137--------------------------------------------------------------------------------
Q4HD84_CAMCO/120-223--------------------------------------------------------------------------------
D1QPX2_9BACT/380-481--------------------------------------------------------------------------------
C2VMF9_BACCE/142-242--------------------------------------------------------------------------------
Q64SC9_BACFR/1339-1449--------------------------------------------------------------------------------
Q1DCW1_MYXXD/334-445--------------------------------------------------------------------------------
Q093F6_STIAD/232-335--------------------------------------------------------------------------------
Q1D4C5_MYXXD/315-427--------------------------------------------------------------------------------
Q1DCY3_MYXXD/316-427--------------------------------------------------------------------------------
A6CA84_9PLAN/166-276--------------------------------------------------------------------------------
D3IMS2_9BACT/89-191--------------------------------------------------------------------------------
H6NWL7_SALTI/1235-1336--------------------------------------------------------------------------------
D1YPM0_9FIRM/58-154--------------------------------------------------------------------------------
Q1BS61_BURCA/453-565--------------------------------------------------------------------------------
B7VTR6_VIBSL/37-155--------------------------------------------------------------------------------
B2PYR7_PROST/296-406--------------------------------------------------------------------------------
D1PUV1_9BACT/145-267--------------------------------------------------------------------------------
A0A009XFQ0_ACIBA/1498-1612--------------------------------------------------------------------------------
A7VXS4_9CLOT/154-265--------------------------------------------------------------------------------
C5BUJ2_TERTT/116-229--------------------------------------------------------------------------------
E7J463_ECOLX/145-254--------------------------------------------------------------------------------
D8P630_RALSL/1305-1421--------------------------------------------------------------------------------
Q6HKE9_BACHK/425-537--------------------------------------------------------------------------------
D0BQG1_FUSNU/310-426--------------------------------------------------------------------------------
A6DG18_9BACT/297-411--------------------------------------------------------------------------------

PF02945

Q854H7_BPMOM/21-116--------------------------------------------------------------------------------
Q854C9_BPMOM/61-142--------------------------------------------------------------------------------
Q853W7_BPMOM/109-202--------------------------------------------------------------------------------
Q9MBZ1_9CAUD/47-128--------------------------------------------------------------------------------
Q82YG4_STRAW/252-319--------------------------------------------------------------------------------
Q857G3_BPMB2/60-141--------------------------------------------------------------------------------
Q82R65_STRAW/149-228--------------------------------------------------------------------------------
A0A023ZVT8_9CAUD/1-97--------------------------------------------------------------------------------
Q99PZ8_STRCO/154-212--------------------------------------------------------------------------------
Q82RY9_STRAW/40-138--------------------------------------------------------------------------------
G8I606_9CAUD/49-130--------------------------------------------------------------------------------
Q856T3_BPMCO/46-138--------------------------------------------------------------------------------
O87597_STRCO/77-153--------------------------------------------------------------------------------
Q849E0_STRVN/152-236--------------------------------------------------------------------------------
VG59_BPMD2/49-130--------------------------------------------------------------------------------
Q9ZL26_HELPJ/99-187--------------------------------------------------------------------------------

PF04231

S6BR35_PSERE/26-233TFEQAKVELRQKVYYD.............RNTSEAGDLYCGCDWK...WVGRSGGRVDFAS...................
H8XQY1_FLAIG/31-274TGYTLKTNLRKIIDNQNDGIPSEHISTDQGYS.GLYTTYLTSDKD..FYYENDGSLLDMYTENPTGAE...CFFTYGT..
Q7MB43_PHOLL/29-237TFEQAKVELRKRIYHD.............QFKSGEGTFYCGCDWQ...WTGKSGGRAILSS...................
C6X0Y1_FLAB3/33-266TGYTLKTKLKEIVTNG.........HQDNGYN.GLWNAYKVGDLD..KFYENDNTILDIYSEKPLSADA..YNYTPGA..
G2Z0P2_FLABF/31-278TGYTLKTQLFNTINNNTNSA.....SSSANYG.GLWTLYTENAFRD.LYYENDNSLLDVYSEKPTGPDS..YSYTGTS..
E1WX28_BACMS/37-265..YEFKSKLSSLLAKT.........HKGLSYS.ALLKAYKKTDKD..TTYDVDNSVMDMYSERPGGKDP..YRYIHSQ..
A6GXH6_FLAPJ/30-267TGYTLKTQLFNKIKAH..........TAISYSPGLWNLYYTSDVR......PDGKVWDIYSD.........CIFVFGTFA
A5FAQ0_FLAJ1/31-260TGYTLKTQLYNIIKDH..........TNNGYA.GLYTTYLTSDVD..NFYENDGTILDMYSENPSGTDP..YNYTTGT..
G8X893_FLACA/31-259SGYTLKTQLYNIIKDH..........TDKGYA.GLWTTYQTSDRD..KEYENDNSIIDVYSENPTGVDP..YVYQYGT..
F6GF23_LACS5/34-268.GYALKTELKNIITSG.........HSDQGYG.GLWTAYQTTDIDNTNQYDNDGFILDIYSEDPDNPEPTYLNFTYSS..
Q87FN9_VIBPA/294-530TGYALKTALFNIINNH..........SSRGYS.AIWTLVKDADLD..NYYEKDGSILDMYSEKPAGNDA..VSFTKVT..
M4U6V7_9GAMM/209-446TSFSLKTALYNIIKNH..........QVRTYS.DVWSFISANSRD..IYYDKDHSILDMYSENPSSSDS..YYFDP.E..
D4ZCB1_SHEVD/20-225.FSQAK.RLAKKLYSN...............ELPSTSFYCGCDIK....IQGKKWGPDLES...................
H8XRD7_FLAIG/30-246TGNNLKNQLATLITTT...H.....TNQISYTPGVWNALQSGDLN....PSNSSQVLLIYGFND.......VDAIYKNDR

PF01844

Q9RZ22_DEIRA/734-776--------------------------------------------------------------------------------
Q830G1_ENTFA/64-111--------------------------------------------------------------------------------
Q81XW6_BACAN/141-196--------------------------------------------------------------------------------
Q8XLC6_CLOPE/63-111--------------------------------------------------------------------------------
Q81CU3_BACCR/27-71--------------------------------------------------------------------------------
Q8NLR2_CORGL/374-419--------------------------------------------------------------------------------
Q8YL60_NOSS1/22-69--------------------------------------------------------------------------------
Q8DWJ8_STRMU/50-100--------------------------------------------------------------------------------
Q8CM00_THEEB/505-551--------------------------------------------------------------------------------
Q8YUD3_NOSS1/22-69--------------------------------------------------------------------------------
Q9RRS6_DEIRA/105-147--------------------------------------------------------------------------------
Q8DXJ3_STRA5/40-90--------------------------------------------------------------------------------
Q87Y88_PSESM/40-88--------------------------------------------------------------------------------
P73905_SYNY3/19-66--------------------------------------------------------------------------------
Q81D03_BACCR/65-112--------------------------------------------------------------------------------
Q88ML0_PSEPK/67-115--------------------------------------------------------------------------------
Q97HW0_CLOAB/32-80--------------------------------------------------------------------------------
Q8YKL7_NOSS1/198-241--------------------------------------------------------------------------------
MCRA_ECOLI/207-258--------------------------------------------------------------------------------
Q8YZ58_NOSS1/25-70--------------------------------------------------------------------------------
Q9KMM4_VIBCH/22-66--------------------------------------------------------------------------------
Q8XYS8_RALSO/66-114--------------------------------------------------------------------------------
Q81X85_BACAN/42-92--------------------------------------------------------------------------------
P73673_SYNY3/22-69--------------------------------------------------------------------------------
Q82YG2_STRAW/26-70--------------------------------------------------------------------------------
Q9A694_CAUCR/96-138--------------------------------------------------------------------------------
Q8DLJ5_THEEB/79-122--------------------------------------------------------------------------------
YOQL_BACSU/136-189--------------------------------------------------------------------------------
P72833_SYNY3/79-122--------------------------------------------------------------------------------
Q8YJW6_NOSS1/99-141--------------------------------------------------------------------------------
Q892G5_CLOTE/70-118--------------------------------------------------------------------------------
Q9RZ97_DEIRA/536-578--------------------------------------------------------------------------------
Q8KEG3_CHLTE/87-130--------------------------------------------------------------------------------
Q9X2X8_BACAN/514-560--------------------------------------------------------------------------------
Q8F8A1_LEPIN/40-85--------------------------------------------------------------------------------
ANRX_NOSS1/24-67--------------------------------------------------------------------------------
Q81W86_BACAN/46-96--------------------------------------------------------------------------------
Q81Z15_BACAN/30-77--------------------------------------------------------------------------------
Q8YJX0_NOSS1/534-580--------------------------------------------------------------------------------
Q984I3_RHILO/259-314--------------------------------------------------------------------------------
C1DQC3_AZOVD/456-501--------------------------------------------------------------------------------
Q2FYC4_STAA8/41-88--------------------------------------------------------------------------------
Q32JG4_SHIDS/27-75--------------------------------------------------------------------------------
Q99YZ8_STRP1/30-83--------------------------------------------------------------------------------
Q9CFR4_LACLA/90-137--------------------------------------------------------------------------------
Q9PC69_XYLFA/109-154--------------------------------------------------------------------------------

PF16786

H8L2H7_FRAAD/10-118ATAVQRDRIVMVKE.LG---------------------------------------------------------------
M4NHG8_9GAMM/46-153PTAEESERMLLVKR.LG---------------------------------------------------------------
REF_BPP1/80-182PTAEERRIANALGA.LP---------------------------------------------------------------
Q2L2X9_BORA1/6-99PTAEQKRFWDMLARNIG---------------------------------------------------------------

PF05551

O46338_9EUKA/115-245E-------------------------------------------------------------------------------
A3QSY4_9LECA/123-253G-------------------------------------------------------------------------------
Q7Z9J1_9PEZI/146-281A-------------------------------------------------------------------------------
Q966Z7_9EUKA/22-136G-------------------------------------------------------------------------------
A7ISR6_9EUKA/122-252E-------------------------------------------------------------------------------
A7F286_SCLS1/133-280S-------------------------------------------------------------------------------
A7BJ62_NAEGR/88-207E-------------------------------------------------------------------------------
Q8TGE3_9FUNG/33-165N-------------------------------------------------------------------------------
Q8X1S1_BEABA/120-236I-------------------------------------------------------------------------------
Q2TSV0_PORUM/40-143S-------------------------------------------------------------------------------
Q6W364_9EURO/163-291S-------------------------------------------------------------------------------

PF13395

B0RZQ7_FINM2/844-900--------------------------------------------------------------------------------
D6S374_9LACO/860-911--------------------------------------------------------------------------------
Q1WVK1_LACS1/821-874--------------------------------------------------------------------------------
Q5M542_STRT2/576-631--------------------------------------------------------------------------------
A8AY02_STRGC/575-630--------------------------------------------------------------------------------
C5ZYI3_9HELI/554-608--------------------------------------------------------------------------------
C4ZA16_EUBR3/583-638--------------------------------------------------------------------------------
D4IZM9_BUTFI/576-631--------------------------------------------------------------------------------
B8I085_CLOCE/550-604--------------------------------------------------------------------------------
A6GZR9_FLAPJ/723-776--------------------------------------------------------------------------------
B1GZM3_UNCTG/557-611--------------------------------------------------------------------------------
D3UFL8_HELM1/576-630--------------------------------------------------------------------------------
B2KB46_ELUMP/642-695--------------------------------------------------------------------------------
Q6KIQ7_MYCMO/662-717--------------------------------------------------------------------------------
Q7MRD3_WOLSU/573-627--------------------------------------------------------------------------------
A1WH93_VEREI/615-668--------------------------------------------------------------------------------
Q4A5I2_MYCS5/699-751--------------------------------------------------------------------------------
A7HP89_PARL1/579-633--------------------------------------------------------------------------------
C7M7G9_CAPOD/791-844--------------------------------------------------------------------------------
D1AUW6_STRM9/623-676--------------------------------------------------------------------------------
Q1QGC9_NITHX/661-714--------------------------------------------------------------------------------
A8LN05_DINSH/600-653--------------------------------------------------------------------------------
B1GZ57_UNCTG/486-539--------------------------------------------------------------------------------
B2UP49_AKKM8/631-682--------------------------------------------------------------------------------
C4LF28_TOLAT/241-289--------------------------------------------------------------------------------
Q01TQ5_SOLUE/211-274--------------------------------------------------------------------------------
A9HKP2_GLUDA/568-623--------------------------------------------------------------------------------
G4Q6A5_ACIIR/835-888--------------------------------------------------------------------------------
Q0P897_CAMJE/537-591--------------------------------------------------------------------------------
Q20XX4_RHOPB/560-615--------------------------------------------------------------------------------
Q5L8F8_BACFN/794-846--------------------------------------------------------------------------------
Q7NAI2_MYCGA/647-702--------------------------------------------------------------------------------
Q8DTE3_STRMU/821-872--------------------------------------------------------------------------------
CAS9_STRP1/821-872--------------------------------------------------------------------------------
Q9CLT2_PASMU/558-612--------------------------------------------------------------------------------
R7G6K2_9FIRM/537-591--------------------------------------------------------------------------------
T0TDV9_9STRE/576-631--------------------------------------------------------------------------------

PF12639

B0KQD0_PSEPG/501-635SPAGT.GVVSGNGQ...VAGAD----------------------------------------------------------
Q3K6V6_PSEPF/285-415PARLTPGTVTGIGEDVSGI...----------------------------------------------------------
C4T554_YERIN/799-929TPRDEPGEVTGRGQQVAGV...----------------------------------------------------------
A7FD33_YERP3/469-599SPRDEPGVVTGHGERITGI...----------------------------------------------------------
B2JZI5_YERPB/7-137SLRDEPGVVTGRGERITGI...----------------------------------------------------------
Q7N5Q1_PHOLL/427-557TPRNQPGVVTGQGQRVEGN...----------------------------------------------------------
A7MTX8_VIBCB/727-857SPRDKPGVVTGKGEDIFGI...----------------------------------------------------------
Q87GQ2_VIBPA/738-868SPRDKPGVVTGKGEDIFGI...----------------------------------------------------------
B2VB98_ERWT9/508-638SPRYTPGKVSGKGKNVGDG...----------------------------------------------------------
Q9XBT6_KLEPN/634-764SPRNMPGTASGKGQNVGNN...----------------------------------------------------------
A0A016RP44_KLEPN/642-772SPRNMPGTVSGKGQNVGNN...----------------------------------------------------------
C4SH19_YERMO/396-526NPRYESGTVSGQGKTVSGL...----------------------------------------------------------
C2DMX1_ECOLX/454-592DPRKLPGVVTGRGVLLSPGTR.----------------------------------------------------------
A9MMY5_SALAR/1057-1195DSRNQPGTATGNGVKLSGDKP.----------------------------------------------------------
A8AJ94_CITK8/445-577DPRKQPGTATGYGEILPENSR.----------------------------------------------------------
PYS1_PSEAI/486-616DPRDVPGAATGKGQPVSGN...----------------------------------------------------------
Q51502_PSEAI/639-769DPRDEPGVATGNGQPVTGN...----------------------------------------------------------
Q3KHV9_PSEPF/591-721DRRQDPGIASGIGQTVSGN...----------------------------------------------------------
Q4ZME2_PSEU2/510-640DRREDPGVATGVGQPVSGI...----------------------------------------------------------
Q3K520_PSEPF/657-787DRREDPGVASGVGQAVSGN...----------------------------------------------------------
Q4ZZN9_PSEU2/521-651DPRSIPGVASGYGEAVNGV...----------------------------------------------------------
Q88NA6_PSEPK/624-755SPRYEAGTSTGHGAQVSDT...----------------------------------------------------------
A0A025RNS1_ECOLX/450-580SKRNKPGKATGKGKPVGDK...----------------------------------------------------------
CEA7_ECOLX/445-575SKRNKPGKATGKGKPVNNK...----------------------------------------------------------
D2ZY22_NEIMU/251-385SPRNLPGIASGSGNSIGKK...----------------------------------------------------------
B7IKS1_BACC2/421-558QKRNSPGTVTSSFNLERSLGTQ----------------------------------------------------------
C3AFZ3_BACMY/16-153EKRKSPGTVTSSFNLERSLGTQ----------------------------------------------------------
C3IBA0_BACTU/269-406VKRKTPGTVTLSFNLERSLGTQ----------------------------------------------------------
D3L0R9_9BACT/87-187VRFTRSG...............----------------------------------------------------------
B9NWZ3_9RHOB/126-198VPFSGAG...............----------------------------------------------------------
D0FW92_ERWPE/64-139VPFNHAG...............----------------------------------------------------------
B5H1J3_STRC2/2188-2263VPFDAQG...............----------------------------------------------------------
A9AVI8_HERA2/2989-3061VPFDAQG...............----------------------------------------------------------
A3DH25_CLOTH/482-555VKFTNEG...............----------------------------------------------------------
Q21ED9_SACD2/494-574VTYDAEG...............----------------------------------------------------------
H2GD98_CORD2/1149-1243IYFTDEG...............----------------------------------------------------------
C3E5P5_BACTU/88-181IEISEEGIWT............----------------------------------------------------------
C2XDV9_BACCE/492-590VDFDILG...............----------------------------------------------------------
C2XW90_BACCE/506-604VDFDILG...............----------------------------------------------------------
C3H3G2_BACTU/81-179VDYDVLG...............----------------------------------------------------------
C2UXI9_BACCE/476-574IDYDVLG...............----------------------------------------------------------
E6TT53_BACCJ/211-318VPFEAQAIALEDGTEVVGV...----------------------------------------------------------
A0RAF7_BACAH/78-185VPFEKKIIELPSGEIVEGV...----------------------------------------------------------
C2SK99_BACCE/69-176VEFEKAVVEIPDGSKVEGV...----------------------------------------------------------
Q3IK23_PSEHT/83-190VPFERVEVIDQNGEKVSGV...----------------------------------------------------------
A8RX43_CLOBW/127-235VPYERKIIEI.NGVKIEGV...----------------------------------------------------------
B6BJ56_SULGG/68-165VKISKYG...............----------------------------------------------------------
C9PRI4_9PAST/54-160IPYDKRG...............----------------------------------------------------------
C9PRJ7_9PAST/54-160IPYDKRG...............----------------------------------------------------------
B4AH22_BACPU/149-244VPFSKQG...............----------------------------------------------------------
C3IFI1_BACTU/72-167IPYDADG...............----------------------------------------------------------
C2REC0_BACCE/276-371IPYDADG...............----------------------------------------------------------
A0RG76_BACAH/252-347IPYDLNG...............----------------------------------------------------------
A0A011S190_BACAN/304-399IRYDLDG...............----------------------------------------------------------
C2RQF7_BACCE/478-573VKYDKDG...............----------------------------------------------------------
D0W6H7_NEILA/84-183VPFDSKG...............----------------------------------------------------------
A6CCT8_9PLAN/320-434VVYDSKG...............----------------------------------------------------------

PF14411

R5NTS8_9CLOT/325-402--------------------------------------------------------------------------------
A6X424_OCHA4/965-1043--------------------------------------------------------------------------------
X2HIJ6_9NEIS/339-420--------------------------------------------------------------------------------
R7I8K6_9FIRM/294-372--------------------------------------------------------------------------------
I0GP52_SELRL/2256-2337--------------------------------------------------------------------------------
C4L6I7_EXISA/94-169--------------------------------------------------------------------------------
YOBL_BACSU/514-595--------------------------------------------------------------------------------
R6G1G6_9CLOT/481-566--------------------------------------------------------------------------------
R5BMP6_9FIRM/156-232--------------------------------------------------------------------------------
R6YJH0_9BACT/81-157--------------------------------------------------------------------------------
R5KIU8_9CLOT/284-360--------------------------------------------------------------------------------
U5MY94_CLOSA/168-249--------------------------------------------------------------------------------
V5XPW9_ENTMU/418-494--------------------------------------------------------------------------------
I5AXJ5_EUBCE/328-406--------------------------------------------------------------------------------
C7N7K8_SLAHD/61-142--------------------------------------------------------------------------------
Q7N7K5_PHOLL/272-349--------------------------------------------------------------------------------
Q8DV32_STRMU/147-222--------------------------------------------------------------------------------

PF05315

J9R1X7_RIEAN/2-219KTELFLELAKPDSNGVSRWVSVNEFIGKYKALQLGNGGSWCRASSSLA----------KTYTIEFDKTKTRGNS------
Q7VHB6_HELHP/4-221KIEIFLELAKPDKNGISRWVSVSEFIGEYKALALGNGGSWCRASSTLA----------KKYILEFDKSKSAGNA------
F4HDL7_GALAU/5-226KKELFLELAKPDEQGVSRWVSVDEFNGKYSELQLGNGFSWGRRSSSLA----------REYIIETDKTITSGNG------

PF03165

O15968_DROME/217-326---------------------------------------FREDFEALM----------KQLKRK.....QRNEL------
NFIA_MOUSE/91-195---------------------------------------KQKWASRLL----------AKLRKDI.RPEYREDF------
Q9NH63_SCHMA/29-129---------------------------------------KEKAVKSLV----------KRLKNG....TQLDEL------
B4IKX2_DROSE/29-129---------------------------------------SEKAVKNLV----------KKIKKN....SQLEEL------
Q8T8C9_HALRO/30-148---------------------------------------AEKSIRFLV----------NKKKPKL.....TEDV------
Q09631_CAEEL/112-215---------------------------------------KVKWASRLL----------GKIKKDI.QNDDKEAF------
SMAD2_RAT/41-171---------------------------------------CEKAVKSLV----------KKLKKT....GRLDEL------
O57475_XENLA/39-131---------------------------------------LRAAASAIL----------KRLKEQT.....LCVL------
SMA3_CAEEL/28-134---------------------------------------CEKAVEALV----------KKLKKKNNGCGTLEDL------
SMAD6_CHICK/106-204---------------------------------------LKAVTYALL----------KRLKERS.....LHSL------
O17532_CAEEL/145-246---------------------------------------DQKACESLV----------KKLKDKK...NDLQNL------
SMAD6_MOUSE/173-271---------------------------------------LKTVTYSLL----------KRLKERS.....LDTL------
Q21733_CAEEL/36-132---------------------------------------WALKVTRLL----------SRVAKKH...QCFEAF------
Q9YHB1_XENLA/59-158---------------------------------------LKALAHCVL----------KKLKEKQ.....LEGL------
SMA2_CAEEL/26-129---------------------------------------AKKAIDNLM----------KKLIKHN..KQALENL------
SMA4_CAEEL/168-268---------------------------------------VRKAIESLV----------KKLKDKR...IELDAL------
SMAD9_HUMAN/34-135---------------------------------------AEKAVDSLV----------KKLKKKK...GAMDEL------
SMAD4_PIG/36-137---------------------------------------AKRAIESLV----------KKLKEKK...DELDSL------
SMAD7_HUMAN/92-202---------------------------------------LKALTHSVL----------KKLKER.....QLELL------

PF14279

C1EJZ2_BACC3/4-72------------------------------------------CII--C----------R---------------------
A1SZ92_PSYIN/4-75------------------------------------------CYF--C----------K---------------------
D2ZR44_METSM/3-73------------------------------------------CII--C----------K---------------------
C6CI95_DICZE/4-73------------------------------------------CWL--C----------P---------------------
Q636Z7_BACCZ/5-73------------------------------------------CIF--C----------L---------------------
B2JC00_NOSP7/3-73------------------------------------------CII--C----------K---------------------
C2W902_BACCE/4-67------------------------------------------CII--C----------R---------------------
B5SI46_RALSL/7-76------------------------------------------CAL--C----------P---------------------
Q73LN7_TREDE/4-73------------------------------------------CYL--C----------K---------------------
B6VX81_9BACE/8-77------------------------------------------CYI--C----------D---------------------
C3XCW2_OXAFO/4-84------------------------------------------CIY--C----------R---------------------
A7C0Y7_9GAMM/4-72------------------------------------------CII--C----------R---------------------
A4J8Y0_DESRM/4-73------------------------------------------CYV--C----------N---------------------
B1XMH2_SYNP2/4-84------------------------------------------CIY--C----------K---------------------
A0A026XQU1_ECOLX/4-74------------------------------------------CII--C----------L---------------------

PF13391

Q3ZJ53_PSEAK/128-185------------------------------------------CVV..T----------G.......--------------
Q3ZJ54_PSEAK/137-183------------------------------------------CFL..T----------G.......--------------
B0D1S8_LACBS/452-520------------------------------------------CVV..C----------G.......--------------
D3DZU5_METRM/268-314------------------------------------------CQC..C----------G.......--------------
A1ZMP4_9BACT/24-72------------------------------------------CVF..C----------D.......--------------
A0JZY1_ARTS2/483-533------------------------------------------CAFPGC----------T.......--------------
B6QT68_PENMQ/172-253------------------------------------------CII..T----------Q.......--------------
C6H8C1_AJECH/170-261------------------------------------------CVF..T----------K.......--------------
C0SHG6_PARBP/129-219------------------------------------------CAI..T----------E.......--------------
C0NVL4_AJECG/128-219------------------------------------------CVL..T----------N.......--------------
A1CN99_ASPCL/176-240------------------------------------------CPV..L----------H.......--------------
B2WD78_PYRTR/182-246------------------------------------------NMI..S----------R.......--------------
C0SG59_PARBP/145-228------------------------------------------CPV..T----------G.......--------------
Q7SBL2_NEUCR/148-212------------------------------------------DVA..T----------G.......--------------
B8HI49_ARTCA/207-262------------------------------------------CSI..C----------G.......--------------
C5QBZ5_STAEP/274-329------------------------------------------CYF..T----------K.......--------------
D0MUB8_PHYIT/175-238------------------------------------------CVR..C----------M.......--------------
A8ILS7_CHLRE/241-301------------------------------------------CML..L----------D.......--------------
A1ZEN4_9BACT/211-269------------------------------------------CCV..S----------Q.......--------------
B3R3B4_CUPTR/129-182------------------------------------------CAV..S----------G.......--------------
C5A9D8_BURGB/190-242------------------------------------------CAV..T----------G.......--------------
Q58AC3_RALME/314-368------------------------------------------CAV..S----------G.......--------------
Q97AT3_THEVO/116-167------------------------------------------CLL..C----------G.......--------------
Q2H3K5_CHAGB/194-260------------------------------------------CCL..T----------A.......--------------
Q1Z8V3_PHOPR/45-99------------------------------------------HNI..T----------G.......--------------
C9RJH3_FIBSS/236-289------------------------------------------CAF..T----------G.......--------------
A6WRD3_SHEB8/155-207------------------------------------------CAF..T----------D.......--------------
Q1LAG0_RALME/217-269------------------------------------------CDL..T----------G.......--------------
Q8EUF0_MYCPE/252-316------------------------------------------CEFKYC----------S.......--------------
Q0HZ27_SHESR/183-234------------------------------------------CQI..N----------S.......--------------
A8RAR8_9FIRM/242-295------------------------------------------CPI..C----------H.......--------------
C1A2C0_RHOE4/177-236------------------------------------------CVF..C----------G.......--------------
D1QVC2_9BACT/149-200------------------------------------------CCI..T----------G.......--------------
B4RPU5_NEIG2/270-321------------------------------------------CML..E----------K.......--------------
A9M531_9VIBR/136-187------------------------------------------CAL..C----------E.......--------------
A0YQ47_LYNSP/170-221------------------------------------------CCL..T----------G.......--------------
C6SD53_NEIME/264-320------------------------------------------CPF..T----------L.......--------------
A5UCN4_HAEIE/226-278------------------------------------------CPI..T----------L.......--------------
B0P0S7_9CLOT/157-209------------------------------------------CCL..C----------G.......--------------
Q8XKY3_CLOPE/181-233------------------------------------------CKI..C----------G.......--------------
C4Z3W1_EUBE2/283-335------------------------------------------CNL..C----------D.......--------------
Q6KH34_MYCMO/262-326------------------------------------------CDILYC----------D.......--------------
B5JL75_9BACT/10-62------------------------------------------CCS..T----------G.......--------------
D2MUA6_CAMJU/249-300------------------------------------------CYV..E----------N.......--------------
A9M540_9VIBR/208-261------------------------------------------CAL..T----------G.......--------------
C5TPE4_NEIFL/171-223------------------------------------------CPL..T----------G.......--------------
B5ND07_SALET/226-278------------------------------------------CIV..T----------G.......--------------
A0A017QNN2_SALET/161-214------------------------------------------CPV..T----------G.......--------------
C7JF14_ACEP3/216-269------------------------------------------CRI..S----------G.......--------------
B6ESV9_ALISL/277-329------------------------------------------CSI..T----------G.......--------------
A7HHG5_ANADF/218-270------------------------------------------CRI..T----------K.......--------------
A3WLG5_9GAMM/162-214------------------------------------------CSV..S----------D.......--------------
Q2NS53_SODGM/141-193------------------------------------------CAV..T----------G.......--------------
Q11XS6_CYTH3/195-247------------------------------------------CAV..T----------G.......--------------
A6LR77_CLOB8/228-280------------------------------------------CKI..C----------G.......--------------
D5SYQ3_PLAL2/147-198------------------------------------------CAI..S----------G.......--------------
A3SEH6_9RHOB/147-198------------------------------------------CAL..T----------G.......--------------
A3IFP0_9BACI/201-253------------------------------------------CKV..C----------G.......--------------
B3E6K1_GEOLS/248-298------------------------------------------CAV..T----------G.......--------------
Q0YRR0_9CHLB/151-202------------------------------------------CCI..T----------G.......--------------
D4L965_9FIRM/137-189------------------------------------------CII..T----------G.......--------------
D1NWA4_9BIFI/170-222------------------------------------------CCI..T----------G.......--------------
A9VZD9_METEP/165-217------------------------------------------CAI..T----------G.......--------------
A0A008B479_STAAU/218-269------------------------------------------CAI..T----------G.......--------------
C7TDF7_LACRG/286-337------------------------------------------CAV..T----------G.......--------------
C7RPH5_ACCPU/152-203------------------------------------------CCV..S----------G.......--------------
D2QD13_SPILD/151-202------------------------------------------CAI..S----------G.......--------------
A4G160_HERAR/158-209------------------------------------------CCI..T----------G.......--------------
A3XG80_LEEBM/154-205------------------------------------------CAI..C----------G.......--------------
C6H7Y4_AJECH/166-242------------------------------------------CVV..T----------K.......--------------
C5G0R2_ARTOC/156-239------------------------------------------CVV..T----------K.......--------------
D4DG81_TRIVH/144-227------------------------------------------CIV..T----------G.......--------------
D4AWU5_ARTBC/72-157------------------------------------------CVV..T----------G.......--------------
D4AWT1_ARTBC/153-252------------------------------------------CQA..T----------G.......--------------
C6HSV2_AJECH/189-299------------------------------------------CVI..S----------R....VFD--------------
C4JTW4_UNCRE/156-261------------------------------------------CVI..S----------R....IFD--------------
C5FX47_ARTOC/172-283------------------------------------------CVA..T----------R...AFDT--------------
C5GIN7_AJEDR/149-259------------------------------------------CVV..S----------R...VFDR--------------
C5FYU3_ARTOC/192-299------------------------------------------CVV..T----------Q.......--------------
C5PG06_COCP7/175-290------------------------------------------CVV..T----------RV..FNWT--------------
A1DHZ4_NEOFI/144-238------------------------------------------CVI..S----------G.......--------------
C6HH53_AJECH/147-240------------------------------------------CVI..S----------K.......--------------
C6HB07_AJECH/162-258------------------------------------------CVV..T----------Q.....RM--------------
B6H206_PENCW/172-270------------------------------------------CAV..T----------G.......--------------
B6HJB7_PENCW/110-203------------------------------------------CVV..T----------G.......--------------
C5FNT1_ARTOC/164-228------------------------------------------CVL..D----------G.......--------------
D4D4G1_TRIVH/160-225------------------------------------------CNVLTG----------G.......--------------
D4AWT5_ARTBC/163-226------------------------------------------SVL..D----------G.......--------------
B0CQV9_LACBS/112-197------------------------------------------CVDEDA----------T.......--------------
B1VR35_STRGG/22-91------------------------------------------CAI..C----------R.....GE--------------
B0CUP6_LACBS/82-165------------------------------------------CLI..T----------G.......--------------
C4JQB0_UNCRE/171-234------------------------------------------CHI..L----------G.......--------------
C4JDN9_UNCRE/60-122------------------------------------------CSL..L----------G.......--------------
B6HCX9_PENCW/194-295------------------------------------------CVV..S----------S.IINYQY--------------
A2QGH8_ASPNC/178-274------------------------------------------CVV..S----------G.......--------------
A2QG51_ASPNC/197-280------------------------------------------CII..S----------K.......--------------
B8P2J0_POSPM/349-413------------------------------------------CLL..S----------L.......--------------
B8P2H7_POSPM/369-433------------------------------------------CLL..T----------H.......--------------
B8PJ67_POSPM/96-161------------------------------------------CLV..T----------G.......--------------
B8P061_POSPM/98-163------------------------------------------CII..S----------G.......--------------
B2WQ71_PYRTR/178-242------------------------------------------CRI..S----------G.......--------------
C7ZJS1_NECH7/14-80------------------------------------------CRI..S----------G.......--------------
C7ZR37_NECH7/151-217------------------------------------------CRI..S----------A.......--------------
Q0CEY0_ASPTN/158-237------------------------------------------CMI..T----------G.......--------------
C7ZM78_NECH7/156-223------------------------------------------CLLSNC----------G.......--------------
B6H0Z1_PENCW/209-303------------------------------------------CLA..T----------G.......--------------
B0DGI4_LACBS/197-310------------------------------------------YVI..I----------G.......--------------
B0DGX0_LACBS/22-98------------------------------------------CLV..T----------G.......--------------
B5JTG3_9GAMM/205-258------------------------------------------CAA..T----------G.......--------------
C0NM18_AJECG/69-132------------------------------------------CAV..T----------N.......--------------
C0NFG2_AJECG/145-208------------------------------------------CAV..T----------N.......--------------
B0CU30_LACBS/126-203------------------------------------------CCI..T----------G.......--------------
A1C9L4_ASPCL/21-95------------------------------------------RVI..T----------G.......--------------
C5FQP7_ARTOC/116-187------------------------------------------CVI..T----------H.......--------------
A1CHP5_ASPCL/119-193------------------------------------------CVI..T----------G.......--------------
C1ME87_9ENTR/110-159------------------------------------------CVV..T----------G.......--------------
D4D3B7_TRIVH/114-186------------------------------------------CVV..T----------G.......--------------
C5FLW1_ARTOC/116-189------------------------------------------CMI..T----------G.......--------------
C5FGM1_ARTOC/115-187------------------------------------------CMV..T----------G.......--------------
A0A031MZ15_ECOLX/108-157------------------------------------------CVL..T----------G.......--------------
L3VWH1_ECOLX/324-373------------------------------------------CVI..T----------G.......--------------
B2VKG6_ERWT9/66-115------------------------------------------CVV..T----------G.......--------------
E4NRW0_HALBP/214-265------------------------------------------CPI..S----------G.......--------------
Q18I98_HALWD/210-261------------------------------------------CPL..S----------G.......--------------
E4NSD1_HALBP/243-294------------------------------------------CTL..T----------G.......--------------
C7ZR46_NECH7/227-313------------------------------------------CAVSAR----------G.......--------------
C7ZLG5_NECH7/248-329------------------------------------------CAI..T----------G.......--------------
B8G8J9_CHLAD/36-82------------------------------------------CAI..S----------G.......--------------
A0A034USF7_ERWAM/216-274------------------------------------------CVV..T----------G.......--------------
E7FSP2_9LACO/263-324------------------------------------------CAW..C----------D.......--------------
D0FXK4_ERWPE/274-335------------------------------------------CSF..C----------D.......--------------
F3RA44_LISMN/276-338------------------------------------------CTL..C----------D.......--------------
B9MGY9_ACIET/216-265------------------------------------------CAF..C----------Q.......--------------
B8F0E2_THASP/225-279------------------------------------------CAV..C----------G.......--------------
A9B5H7_HERA2/140-196------------------------------------------CQI..C----------G.......--------------
D7VSZ6_9SPHI/197-252------------------------------------------CQI..C----------N.......--------------
Q82H00_STRAW/418-471------------------------------------------CQF..C----------R.......--------------
D4GVR6_HALVD/183-239------------------------------------------CQV..C----------G.......--------------
C6WB78_ACTMD/145-200------------------------------------------CQF..C----------G.......--------------
D9TEC7_MICAI/400-455------------------------------------------CQI..C----------G.......--------------
Q9RU61_DEIRA/197-252------------------------------------------CQV..C----------G.......--------------
Q82CY5_STRAW/72-128------------------------------------------CQA..C----------G.......--------------
Q2S547_SALRD/185-241------------------------------------------CAI..C----------G.......--------------
A6TQ34_ALKMQ/175-229------------------------------------------CAV..C----------G.......--------------
C1HR67_9ESCH/182-236------------------------------------------CAF..C----------G.......--------------
C5C731_MICLC/57-112------------------------------------------CVI..C----------G.......--------------
D2RPV1_HALTV/388-442------------------------------------------CAI..C----------G.......--------------
D6SU17_9DELT/210-264------------------------------------------CAL..C----------G.......--------------
Q2S548_SALRD/164-218------------------------------------------CAL..S----------G.......--------------
A9AVZ1_HERA2/214-268------------------------------------------CAI..C----------G.......--------------
C5FYU4_ARTOC/144-210------------------------------------------CRV..T----------N.......--------------
Q89W12_BRADU/199-250------------------------------------------CAF..S----------G.......--------------
Q1DFJ6_MYXXD/230-280------------------------------------------CAV..C----------R.......--------------
B1MFU6_MYCA9/186-236------------------------------------------CTV..C----------T.......--------------
C2IA18_VIBCL/139-188------------------------------------------CAV..C----------D.......--------------
B6H8R8_PENCW/114-188------------------------------------------CVL..T----------G.......--------------
C6HTE9_AJECH/70-135------------------------------------------......----------G.......--------------
C5P1V7_COCP7/116-194------------------------------------------CVV..S----------G.......--------------
C6H7P6_AJECH/116-190------------------------------------------CVI..S----------G.......--------------
C6HCT2_AJECH/118-196------------------------------------------CVI..S----------G.......--------------
E3J488_FRASU/374-423------------------------------------------CAI..T----------G.......--------------
Q0TBE0_ECOL5/325-374------------------------------------------CLL..S----------N.......--------------
A4JVB2_BURVG/309-359------------------------------------------CAI..T----------G.......--------------
C5PCJ2_COCP7/131-211------------------------------------------CMI..S----------G.......--------------
B6GYF4_PENCW/145-225------------------------------------------CVI..S----------G.......--------------
D4LVH2_9FIRM/326-375------------------------------------------CII..T----------N.......--------------
Q8YML8_NOSS1/205-259------------------------------------------CAF..C----------G.......--------------
A3X6R6_9RHOB/193-247------------------------------------------CAI..T----------G.......--------------
D0KA46_PECWW/207-263------------------------------------------CII..T----------N.......--------------
A4WEB7_ENT38/177-224------------------------------------------CAI..T----------G.......--------------
C6DI05_PECCP/215-264------------------------------------------CCV..T----------G.......--------------
A1WU45_HALHL/154-210------------------------------------------CAF..T----------G.......--------------
D5URV1_TSUPD/190-239------------------------------------------CVV..S----------G.......--------------
C2H6L1_ENTFL/305-363------------------------------------------CAI..P----------G.......--------------
D2NQL0_ROTMD/260-309------------------------------------------CAF..T----------G.......--------------
C6WN85_ACTMD/211-260------------------------------------------CAI..T----------G.......--------------
Q5KQA0_CRYNJ/196-257------------------------------------------CVV..S----------G.......--------------
D0FXE6_ERWPE/297-346------------------------------------------CAV..T----------G.......--------------
C1MEC3_9ENTR/183-232------------------------------------------CAV..S----------G.......--------------
B5XX93_KLEP3/359-407------------------------------------------CVA..T----------G.......--------------
Q82H23_STRAW/235-284------------------------------------------CPL..S----------G.......--------------
D5UBZ3_CELFN/122-171------------------------------------------CAI..S----------G.......--------------
A6UKM8_SINMW/8-59------------------------------------------CVV..S----------N.......--------------
D2B5N9_STRRD/214-263------------------------------------------CAI..T----------G.......--------------
B2FKB8_STRMK/193-242------------------------------------------CMV..T----------G.......--------------
C5CHS9_KOSOT/197-246------------------------------------------CAV..T----------R.......--------------
A7ZNC8_ECO24/319-367------------------------------------------CAV..T----------G.......--------------
A4NNK4_HAEIF/325-374------------------------------------------CVI..T----------G.......--------------
A4E9S5_9ACTN/247-296------------------------------------------CAVSDC----------G.......--------------
M7P179_KLEPN/397-443------------------------------------------CAITNS----------G.......--------------
B4UFQ3_ANASK/203-252------------------------------------------CAV..S----------G.......--------------
A4V6X0_PSEFS/373-422------------------------------------------CCI..S----------G.......--------------
C8S3P5_9RHOB/198-247------------------------------------------CAL..S----------G.......--------------
E8YPK5_9BURK/129-178------------------------------------------CAI..T----------G.......--------------
D1P2G2_9ENTR/241-290------------------------------------------CAV..T----------G.......--------------
B1XPM9_SYNP2/314-363------------------------------------------CAI..S----------G.......--------------
B0RXA4_XANCB/309-358------------------------------------------CAI..T----------G.......--------------

PF13930

D0LUR7_HALO1/91-222------------------------------------------RSTWYS----------I....TGE....HY.YIDSKGR
B0UVC7_HISS2/2603-2730------------------------------------------PNTIYK----------L...SNGH....EY.KTDALGR
YEEF_BACSU/525-655------------------------------------------PNIIYK----------T...KEGY....TY.TTDNYGR
A8FDL6_BACP2/98-224------------------------------------------PNVVYS----------T...KQGY....TY.TTDHYGR
Q7N913_PHOLL/198-325------------------------------------------PNKIYH----------VR.HASGE...KIY.HTDGLSR
A8FDL4_BACP2/498-628------------------------------------------PNVVYS----------T...KQGY....TY.TTDHYGR
Q9K6M4_BACHD/424-550------------------------------------------SNVEYM----------T...PEGY....LY.KTDGHGR
Q5WJ65_BACSK/469-594------------------------------------------PNVKYQ----------A....GEYN..YQY.KTDELGR
Q21NY0_SACD2/315-455------------------------------------------PNTIYD----------VTVVHDGQPVVYSY.ETDHLSR
C0R0R8_BRAHW/45-173------------------------------------------PNIKYN----------I....NGT....LY.STDKQSR
D2QLJ8_SPILD/282-421------------------------------------------KNFEYV----------V....DNN...FIY.KTDDAGR
D6S5M6_9LACO/124-258------------------------------------------LSTA..----------.....NGAW..QSYGDLDNLNR
B0RGD0_CLAMS/624-751------------------------------------------PSTWYQ----------AG..EHEY....LY.RTNEHGH
Q74IV6_LACJO/120-254------------------------------------------LDTNHG----------A....WQK....YG.DLDSQNR
Q1G8G9_LACDA/127-261------------------------------------------LSTSRG----------A....WQ.....TYGNLDSLNR
Q03WR4_LEUMM/85-232------------------------------------------LQIKQG----------G....WQK....LS.SLDWLGR
C2X0R6_BACCE/409-538------------------------------------------PNVKYE----------T....NGY....LY.QTDELGR
Q5FK46_LACAC/120-251------------------------------------------..TSNG----------A....WQR....YG.NLDDLNR
Q835Q6_ENTFA/75-202------------------------------------------..LKDN----------S....NGW...ITYHSLDRLKR
R5U617_9FIRM/67-203------------------------------------------.ESEYT----------M...EAFE....QYSDLDALGR
T0UB90_9ENTE/93-224------------------------------------------..IKNG----------A....WEK....YG.DLDRLNR

PF06147

A7MHN7_CROS8/117-334-------------------------------------FTERLSAIARS----------NVIAWIISVARGALAFDDTHEL
A3MZM0_ACTP2/134-333-------------------------------------SEEELNALAEA----------NWVQFIGYKIRQDLQMQADESL
Q7ME22_VIBVY/140-345-------------------------------------EVVGIDSKAAT----------NLIVFRSNVVSVRLH.GSVLPL
M9X5K0_PASHA/139-336-------------------------------------.NEKLEALADE----------NWEKFIAQQIRLTLRKTQSSAI

PF01223

Q95TI9_DROME/65-324-------------------------------------NGGIVIRVGFE----------ITSSR....FAEQMQICFNEE.
E7S4P9_STRAG/86-283-------------------------------------QSGAFIINQNK----------TDLNAKV.SSAPYAINEIKKVN
Q7NPI0_GLOVI/39-265-------------------------------------LGNPSGAVTST----------SYSYNYL.LIKSQYALSYSDY.
Q8A1U5_BACTN/46-275-------------------------------------GADDIFLSPTT----------TFNGQQV.IT...YSMEYDKS.
Q8KGT7_RHILI/434-688-------------------------------------ISQERDQEMYK----------ENGQIVV.LKYHHFSLAMNAS.
Q7QK21_ANOGA/167-356-------------------------------------NDATIVEIGFE----------M.GAR....FPKIMDVCHDEV.
Q8I9M9_PARCM/131-389-------------------------------------DQGDRHSIGFE----------YYGGSI...YYELISVCFGPV.
Q26707_9TRYP/117-408-------------------------------------FVLRLTSKGLP----------S..DDHL.RYYKGFVSSLNYE.
Q8IPZ0_DROME/71-300-------------------------------------RMRQIMKFGFP----------G.LDD.L.RLYSDFVLSYDRR.
Q7QH21_ANOGA/177-440-------------------------------------DNGTIVRVGFS----------VDEAR....FAALYEVCFDER.
NUCA_NOSS1/42-263-------------------------------------LGNPSGATPTK----------LTPDNYL.MVKNQYALSYNNS.
Q9VGU3_DROME/132-362-------------------------------------HVADIMKYGFP----------G.MDE.I.HVYKNFVLSYDRR.
Q8YKN2_NOSS1/41-276-------------------------------------MGNPTNANTS.----------..FSNFL.LSKVQYATSHNCF.
Q6TRY8_CULQU/109-345-------------------------------------KSSKTFQMGFR----------ASGGL....FVPYYELCYLMD.
Q9VU22_DROME/1089-1351-------------------------------------GGTDLLEVGFQ----------LSSSSSD.DFLQTYDVCHDEL.
Q7NI85_GLOVI/113-335-------------------------------------LGNPSRATATP----------GSVSNYL.LLKPQYALSYNAA.
Q8RE47_FUSNN/335-559-------------------------------------LSKEMEKDTAK----------TEDGNYV.LDYIHFSIVMKKS.
Q9ZJL1_HELPJ/54-273-------------------------------------HNPTHNANGML----------TNIDCKV.LKNNFYSVCYSSE.
A9QSL0_LACLK/41-258-------------------------------------NSSQVSTKSLA----------SSVKQAPLTFKNQRQMVMANTD
NUC1_CUNEE/3-231-------------------------------------NSESILQFGDP----------GTARD.F.LERESYVISYNRR.
A0A031RVU6_SERMA/25-246-------------------------------------ESIDNCAVGCP----------TGGSSNVSIVRHAYTLNNNST.
NUCG_MOUSE/57-282-------------------------------------GTGELAKYGLP----------G.VAQ.L.RSRESYVLSYDPR.
Q9AAQ2_CAUCR/422-665-------------------------------------IAAGLAKPVDA----------LPGRPHE.LRYTHFGVLFSQD.
Q9VVV1_DROME/147-406-------------------------------------GGTTLIKVGFE----------LSGSR....FATQYEVCFNED.
PNU1_SCHPO/59-291-------------------------------------NATKFFQYGIP----------GPVAD.Q.RVNHGYMSVFDRR.
Q7PZ31_ANOGA/114-367-------------------------------------SGGTLLSLGFD----------VPGLA....FVTYLQSCYNMQ.
C6IP62_9BACE/145-363-------------------------------------GNSNLFITHTT----------QYNGKEV.IT...YSFEYDCT.
Q7PVB8_ANOGA/98-351-------------------------------------SGGTLLNLGFD----------VPGVG....FVTYIQSCYNMQ.
A0A029S9H5_STRPY/60-262-------------------------------------ETSPNYYKVLG----------ESGIVEN.LFPPKGQIVYGGLD
Q9VAU2_DROME/106-358-------------------------------------IPSATFAVGFS----------FNGR.....FMELYRNCFDGY.
A0A029S6E3_STRPY/70-270-------------------------------------NDSPNYYKTLG----------TSQITPA.LFPKAGDILYSKLD
Q8RLY2_SALET/51-274-------------------------------------QQPDNCSVGCP----------QGGSQQT.IYRHVYTLNNNSA.
NUC1_YEAST/55-290-------------------------------------DPSGFFKYGFP----------GPIHD.L.QNREEFISCYNRQ.
E9DD73_COCPS/73-305-------------------------------------DPTGLLQYGFP----------GPIAD.T.INSAPLTSAYDRR.
Q8DFB3_VIBVU/21-232-------------------------------------ICGQHLDKGMP----------STQPDQV.LCRDGYAVGYNYN.
O33735_STRPY/73-293-------------------------------------RTTERVYKKSG----------QSTKPVT.....VSNIHYSVLD
Q9I417_PSEAE/377-604-------------------------------------LPKPGKSHQVL----------PVGKGTR.LDYLHFSVVMSAS.
Q7Q2Q3_ANOGA/93-346-------------------------------------NGGTIRNIGFD----------IAGIG....FVKHFSVCYNSQ.
O73911_CHICK/38-276-------------------------------------PPNEALEPENP----------AWICQRY.KNQYYFATLYDRS.
Q8K6B9_STRP3/69-287-------------------------------------KTTERVYKGQG----------TSEKRVT.....VSDVVYNPLD
Q7RY75_NEUCR/71-303-------------------------------------DPSAFFEYGFP----------GPVAD.L.ATRQGFVSSYDRR.
B0RUP9_XANCB/8-230-------------------------------------AVFLLTTFSAG----------AQAQVVT.LNKGGFLLRYDCT.
A5M2Y5_STREE/74-272-------------------------------------GSGAFIVNGNK----------TNLDAKV.SSKPYADNKTKTVG
Q8Y1E6_RALSO/63-274-------------------------------------VHGQVPKVHRL----------ESVRPRA.LCFSSFAVMYSGL.
Q8PFE6_XANAC/65-274-------------------------------------LYANGTPPSVS----------STTRTTE.ICHTEYVLLASGV.
Q9VAU3_DROME/102-344-------------------------------------CPATMYRVGYN----------VGNNQ....FLELYRACFDTR.
Q8TKR8_METAC/401-625-------------------------------------LADNLQSKVAK----------LKDGGEI.LNYLHFSIVMNAD.
EXOG_MOUSE/58-287-------------------------------------EEAVLEQFGFP----------LAGTE.T.RRYTNHALSYDQA.
Q9VU24_DROME/166-420-------------------------------------STSYLYRVGYD----------TGDGR....FVATMELCHDPN.
C0X3R4_ENTFL/87-279-------------------------------------SGGKAAIEVNN----------GQSSLDI.ATWKENKVIYGDLD
M9N460_ASHG1/44-272-------------------------------------DPAGFFKYGFP----------GPVHD.L.QTRDSFVSCYDRR.
F3IR03_PSESL/68-291-------------------------------------VDAELAADVYP----------LDNTGNR.LDYTHFSITMSRS.
C6IET4_9BACE/64-276-------------------------------------SGKDLEIPISL----------IPRQEQI.IRHKGYTVSYNKD.
NUC1_SYNRA/71-306-------------------------------------ASSDILKLGNP----------GPVSD.L.LERSGYILSYNRR.
Q9U5L8_PENJP/126-384-------------------------------------GVGVFEGIGFE----------IFGSDS...FYELIRVCFEPK.
NUCG_CAEEL/65-293-------------------------------------RSAEIMKHGYP----------G.FTN.V.RTYEDFVLSYDYK.
Q7USW1_RHOBA/592-846-------------------------------------IAAAAINRDPI----------NGDLPYV.LRFHNFSVVMNGE.
Y4FB_RHISN/398-641-------------------------------------NALRHGSPAKV----------TGAADDV.LRYQHFSVVLNANP

PF14414

D0W6H7_NEILA/149-191--------------------------------------------------------------------------------
B1J8X4_PSEPW/63-111--------------------------------------------------------------------------------
B3PHU6_CELJU/392-431--------------------------------------------------------------------------------
D3L0R9_9BACT/153-195--------------------------------------------------------------------------------
B5GPR2_STRC2/109-151--------------------------------------------------------------------------------
Q1QCA3_PSYCK/161-203--------------------------------------------------------------------------------
E5C6Z5_9BACE/106-153--------------------------------------------------------------------------------
A5Z4R4_9FIRM/339-381--------------------------------------------------------------------------------
A0A011WJ18_BACTI/19-61--------------------------------------------------------------------------------
B8I221_CLOCE/239-288--------------------------------------------------------------------------------
A3IE28_9BACI/350-392--------------------------------------------------------------------------------
B3Z4D8_BACCE/173-215--------------------------------------------------------------------------------
E1S5U4_HELP9/196-239--------------------------------------------------------------------------------
D4DXP2_SEROD/85-134--------------------------------------------------------------------------------
B2Q7F2_PROST/252-300--------------------------------------------------------------------------------
B4EP57_BURCJ/1370-1412--------------------------------------------------------------------------------
C2UG56_BACCE/26-68--------------------------------------------------------------------------------
Q3IK23_PSEHT/156-198--------------------------------------------------------------------------------
H2GD98_CORD2/1209-1251--------------------------------------------------------------------------------
B6BJ56_SULGG/129-173--------------------------------------------------------------------------------
C9PRI4_9PAST/124-168--------------------------------------------------------------------------------
D0W666_NEILA/32-76--------------------------------------------------------------------------------
B7HC27_BACC4/136-177--------------------------------------------------------------------------------
A6CCT8_9PLAN/400-442--------------------------------------------------------------------------------
A9AVI8_HERA2/3027-3069--------------------------------------------------------------------------------
A5Z4R0_9FIRM/19-65--------------------------------------------------------------------------------
A8RX43_CLOBW/197-243--------------------------------------------------------------------------------
Q7MZK5_PHOLL/1371-1416--------------------------------------------------------------------------------
A4JB11_BURVG/1495-1544--------------------------------------------------------------------------------
C2LFQ4_PROMI/165-214--------------------------------------------------------------------------------
C6MAI9_NEISI/47-95--------------------------------------------------------------------------------
A3KB10_9RHOB/227-274--------------------------------------------------------------------------------
A0A011SXZ9_VIBPH/1318-1364--------------------------------------------------------------------------------
D2YA40_VIBMI/1355-1403--------------------------------------------------------------------------------

PF14410

B9M483_GEODF/74-140--------------------------------------------------------------------------------
B2JXD4_BURP8/2948-3016--------------------------------------------------------------------------------
A4LGH9_BURPE/147-215--------------------------------------------------------------------------------
B9LCH9_CHLSY/270-334--------------------------------------------------------------------------------
C2RQE1_BACCE/43-125--------------------------------------------------------------------------------
C8NB27_9GAMM/65-134--------------------------------------------------------------------------------
A7JRY2_PASHA/3122-3192--------------------------------------------------------------------------------
E2P5A9_PASHA/3105-3174--------------------------------------------------------------------------------
F1WWY7_MORCA/195-265--------------------------------------------------------------------------------
F1WTR8_MORCA/82-151--------------------------------------------------------------------------------
D3A0M0_NEIMU/642-712--------------------------------------------------------------------------------
D6ZD49_SEGRD/415-489--------------------------------------------------------------------------------
D6ZB38_SEGRD/420-491--------------------------------------------------------------------------------
B8I219_CLOCE/1270-1339--------------------------------------------------------------------------------
E4NNI9_HALBP/322-399--------------------------------------------------------------------------------
E4NLC7_HALBP/333-403--------------------------------------------------------------------------------
D4YN65_9MICO/242-321--------------------------------------------------------------------------------
D7JC47_9BACT/1-57--------------------------------------------------------------------------------
Q48JD7_PSE14/299-370--------------------------------------------------------------------------------
D4FSV7_STROR/39-110--------------------------------------------------------------------------------
A5Z849_9FIRM/221-292--------------------------------------------------------------------------------
M1UI10_BACIU/451-522--------------------------------------------------------------------------------
Q0BGH2_BURCM/476-547--------------------------------------------------------------------------------
Q7W1H8_BORPA/221-292--------------------------------------------------------------------------------
A9I1F1_BORPD/290-361--------------------------------------------------------------------------------
C4ZDS7_EUBR3/27-110--------------------------------------------------------------------------------
C5BZG6_BEUC1/289-366--------------------------------------------------------------------------------
Q63EY8_BACCZ/261-339--------------------------------------------------------------------------------
A0A023MBG2_LACPN/545-622--------------------------------------------------------------------------------
A9VI39_BACWK/230-307--------------------------------------------------------------------------------
D4FSW1_STROR/66-143--------------------------------------------------------------------------------
C2R1N3_BACCE/87-164--------------------------------------------------------------------------------
E4NKW7_HALBP/189-266--------------------------------------------------------------------------------
Q97IK0_CLOAB/300-377--------------------------------------------------------------------------------
F2H4N8_BACTU/235-311--------------------------------------------------------------------------------
C2ZCH4_BACCE/166-242--------------------------------------------------------------------------------
B0KTG5_PSEPG/321-389--------------------------------------------------------------------------------
D8NE31_RALSL/1447-1516--------------------------------------------------------------------------------
D3A8Q2_NEISU/281-354--------------------------------------------------------------------------------
D2ZY29_NEIMU/317-390--------------------------------------------------------------------------------
D1QWB6_9BACT/59-130--------------------------------------------------------------------------------
D2ZY17_NEIMU/1290-1360--------------------------------------------------------------------------------
D7NAI5_9BACT/60-127--------------------------------------------------------------------------------
B4E5I3_BURCJ/270-339--------------------------------------------------------------------------------
C3G567_BACTU/455-525--------------------------------------------------------------------------------
B3Z4D6_BACCE/80-150--------------------------------------------------------------------------------
C3BVM6_9BACI/30-100--------------------------------------------------------------------------------
C2X0R2_BACCE/45-115--------------------------------------------------------------------------------
C2LJS8_PROMI/56-126--------------------------------------------------------------------------------
D0KGF8_PECWW/1348-1417--------------------------------------------------------------------------------
D7HX78_PSESS/176-245--------------------------------------------------------------------------------

PF05766

A4G7D7_HERAR/8-194AKPKLILCK..VC------------------------KVNRV.AKAMA----------TVCGYECA...........LKK
Q4KA59_PSEF5/8-195KAPKPKKCKNPSC------------------------GVSFTPQRLGQ----------AVCSPRCG.........LAIKD
Q8ZMY3_SALTY/1-203AKLPRRKCANKEC------------------------RQWFHPIREGQ----------IVCSYQCASAV...GKEQTRKA
B0USX4_HISS2/3-190KKVRSKKCK..VC------------------------GNAFKTNDSFR----------RWCSPECG.........VKLAQ
M9WYN9_PASHA/4-187KPPKQHKCK..EC------------------------GSYYIKFQSTQ----------QVCSVKCA.........MAMGK
NING_LAMBD/2-198AKPARRRCKNDEC------------------------REWFHPAFANQ----------WWCSPECGTKIALERRSKEREK
Q7CID4_YERPE/3-199KLPKNRNCK..VC------------------------KTRFKPETVYQ----------WWCDEEHKEEY...IKQLALKA

PF16784

Q03RB7_LACBA/20-217.PPTRRIIAGNVG------------------------QLAEIKFDDGR----------HITIDQRK---------KIFAL
Q2FUP5_STAA8/21-220EQSHIDLLENGYP------------------------LKAEVEVPDNK----------KLSIEQRK---------KIFAM

PF13392

C7QT14_CYAP0/194-244-----------QK------------------------AHWIIARSGLL.G...K....VPKFENQ..-------------
A0A026EEZ3_ECO57/59-105-----------LT------------------------YQKACYVY.TY.G...A....YD...ET..-------------
C3QU81_9BACE/58-104-----------VL------------------------VHKLCAFQ.KY.G...Y....IA..FSY..-------------
A7K8I5_9PHYC/225-274-----------RK------------------------CHHLSMMA.FRPR...EYVAKCP....G..-------------
A7ITH3_PBCVM/254-303-----------YY------------------------CHTLAFEA.FH.P...KL...WDTKKSE..-------------
A7J8G9_PBCVF/235-284-----------CL------------------------CHTLAFAA.FH.E...EL...WKAKKPG..-------------
A7J6P1_PBCVF/231-280-----------CY------------------------CHILAFAA.FH.P...DL...WKAKEPE..-------------
A7IWP5_PBCVN/225-274-----------HY------------------------VHIVCFQA.FN.P...EAYANMK...PG..-------------
A7RBV7_PBCVA/231-280-----------CF------------------------VHHLCFQA.FF.P...NEYKSMK...SE..-------------
A7K8W0_9PHYC/231-280-----------IF------------------------LHVLAFKT.FF.P...DE...YKKKGDD..-------------
A7IWX1_PBCVN/283-332-----------HH------------------------LHILVFQL.WH.P...EK...WKNKKTD..-------------
A7IW93_PBCVN/277-326-----------HL------------------------LHVLVFQL.WY.P...EL...WKNKKEN..-------------
A7RCQ9_PBCVA/277-326-----------HK------------------------IHILVFQL.WY.P...DL...WANRKPD..-------------
A7IVT6_PBCVN/276-325-----------YL------------------------LHILVFQL.WY.P...DE...WKNKKKN..-------------
A7RBJ5_PBCVA/282-331-----------YK------------------------LHILVFQL.WY.P...EL...WKNKKSD..-------------
A7IW48_PBCVN/71-118-----------VR------------------------LNRLILSS.FI.E...EK...PP...IG..-------------
Q56C21_9CAUD/55-98-----------YM------------------------RHRVIFYS.RF.G...Y....LP.......-------------
Q56BD9_9CAUD/58-104-----------FF------------------------RHHVIWYA.IH.G...T....LP...EK..-------------
Q4TZV2_9CAUD/72-115-----------YR------------------------RHRIIFYV.AN.G...Y....LP.......-------------
B1ZU98_OPITP/143-188-----------RQ------------------------LHYVIWER.AN.G...P....VP...AG..-------------
B9EBP9_MACCJ/89-134-----------EY------------------------KHIVEWRK.HY.G...E....IP...KG..-------------
C4GFQ4_9NEIS/59-100-----------IP------------------------RGRLVLGT.............FP...IG..-------------
C8P900_9LACO/34-80-----------IP------------------------YQKYIWQN.YY.H...KK...LP...KG..-------------
D0DHI8_9LACO/69-115-----------QL------------------------YQRYVWEK.AH.R...TK...LS...KD..-------------
D4FMY2_STAEP/121-166-----------KQ------------------------YTHYLWEQ.KH.G...P....VP...KG..-------------
Q6V7S9_9CAUD/61-107-----------IL------------------------AHRLVWMA.SN.G...RL...VP...EG..-------------
A2I7W9_9CAUD/55-100-----------HL------------------------VHRLVWVM.HY.G...P....IP...EG..-------------
C7N6R6_SLAHD/162-208-----------RY------------------------KHHLAWEE.AN.G...RP...VP...EG..-------------
A4NIF9_HAEIF/148-193-----------ER------------------------KSHYLWCK.A..G...RK...IP...RG..-------------
A0JQK4_LACS1/121-166-----------KP------------------------KQVHIWEQ.HN.G...P....LP...KG..-------------
Q8DFY6_VIBVU/126-171-----------RP------------------------KHYVIWEQ.EH.G...P....VP...KG..-------------
C4ZC58_EUBR3/189-234-----------EF------------------------VHRAVWEE.HN.G...P....VP...EG..-------------
C6IF55_9BACE/173-218-----------EL------------------------KHRLVWIE.HN.G...E....IP...PG..-------------
B1JD21_PSEPW/105-150-----------RP------------------------IHIYTWEQ.AN.G...P....VP...EG..-------------
Q87Y63_PSESM/75-120-----------KG------------------------LHIHAWEL.VN.G...P....VP...NG..-------------
A1RL04_SHESW/183-228-----------RL------------------------KHILEWEK.HH.G...Q....VP...DD..-------------
B6XKN8_9ENTR/115-160-----------KF------------------------KHILLWEK.SN.G...K....IP...KG..-------------
C5F4D1_LACPA/110-155-----------KP------------------------NHRRVWEE.AY.G...P....IP...KG..-------------
A0A031ABV7_PSEAI/156-201-----------KG------------------------IHILLWEE.HF.G...P....IP...TG..-------------
A3WSR8_9BRAD/121-165-----------VP------------------------KHRYLWEQ.KY.G...A....IP...AG..-------------
B2FM68_STRMK/151-200-----------RP------------------------VHVMVWEA.EN.G...P....VP...EG..-------------
A4JMG5_BURVG/144-193-----------VG------------------------VHRLVWEA.AN.G...P....VP...DG..-------------
Q15Y23_PSEA6/178-223-----------DL------------------------KQRVNYRA.VH.G...E....IP...DG..-------------
A0A021B9T1_STAAU/98-143-----------KL------------------------YHHYVWEK.YY.G...E....IP...PK..-------------
A6F4T8_9ALTE/122-168-----------KF------------------------VHVMKWEE.YH.G...QP...VP...PK..-------------
A4WTA3_RHOS5/127-172-----------AF------------------------KHRWLWEK.EN.G...P....VP...AG..-------------
Q0FIB1_PELBH/128-173-----------RA------------------------VHLIRWEE.AN.G...P....LP...DG..-------------
A5LQ22_STREE/161-206-----------VL------------------------KHRKVWEE.HH.G...P....IP...KG..-------------
A1EAC5_9CAUD/175-220-----------EH------------------------CHRAEWEK.YN.G...P....IP...KG..-------------
C5UU10_CLOBO/128-173-----------RL------------------------KHLVIWEK.KN.G...K....IP...KG..-------------
Q73NJ9_TREDE/117-162-----------CL------------------------KHVRIYEK.KH.G...S....VP...KG..-------------
C8Q074_9GAMM/121-166-----------QL------------------------KHVWLYEQ.HH.G...K....VP...DN..-------------
D0S8T8_ACIJO/121-166-----------ES------------------------KHRWIWEQ.HH.G...K....IP...DN..-------------
C6E6S5_GEOSM/133-178-----------RL------------------------KHAWLWEM.SN.G...P....VP...AG..-------------
A9C3M0_DELAS/190-235-----------AL------------------------VHRIVWEQ.HR.G...P....IP...EG..-------------
D4CX94_9FUSO/117-162-----------EY------------------------KQRVIWKE.IH.G...E....IP...SN..-------------
Q7P8C3_FUSNV/72-117-----------KL------------------------KHRWIWEQ.KY.G...E....IP...VN..-------------
C7XPL9_FUSNV/61-106-----------VR------------------------KHRWLYKQ.EH.G...V....IP...EN..-------------
D4CX93_9FUSO/115-161-----------AL------------------------KHRIVWEQ.HH.K...KK...IP...RG..-------------
B2TP02_CLOBB/128-173-----------RL------------------------KHQLVWEK.YN.G...L....IP...QK..-------------
C6CX53_PAESJ/104-150-----------KP------------------------KHVLVWEE.HH.Q...KQ...VP...DG..-------------
A6TRD3_ALKMQ/182-227-----------KL------------------------KHVLIWEE.HN.G...P....VP...DN..-------------
C3DU79_BACTS/116-161-----------RA------------------------KHRLLWEE.EN.G...P....IP...KG..-------------
E6U5S1_ETHHY/116-161-----------KM------------------------KHVVIWEA.AN.G...P....VP...DG..-------------
C3JGM1_RHOER/317-363-----------MK------------------------VHRFVYQM.ST.G...DQ...HI...AG..-------------
Y53_BPT3/45-90-----------FM------------------------FHRWVWEQ.HK.G...P....IP...DG..-------------
B3VD54_9CAUD/38-83-----------EM------------------------YHRTVWKE.HY.G...D....IP...EG..-------------
Q3YJY2_BPK1F/38-83-----------EM------------------------YHRTVWIK.AN.G...P....IP...EG..-------------
B5LJM0_9CAUD/57-102-----------VL------------------------AHRLAYSV.AN.G........EP..SPE..-------------
A6W8V6_KINRD/41-87-----------RL------------------------AHRVAWYQ.AT.G...R....WP..QSG..-------------
C5E9V7_BIFLI/27-72-----------VA------------------------AYRVSYML.FR.G...E....IP...PA..-------------
Q856N8_BPMCO/89-135-----------YA------------------------AHRYAYML.AN.G...E....IP...DG..-------------
A0MZB2_BPN4/61-106-----------SA------------------------THIIAYTH.YH.G...Y....IP...NK..-------------
B9K2P8_AGRVS/53-100-----------VA------------------------VHLVMWTN.EF.G...Y....IP...GK..-------------
A6UA36_SINMW/51-98-----------VA------------------------VHIAMWTN.EH.G...Y....IP...GK..-------------
C8ZKQ5_9CAUD/63-108-----------VA------------------------VHIVMFTN.YF.G...Y....VP...GK..-------------
C4NT45_9CAUD/52-97-----------VA------------------------VHRVMYVN.HN.G...Y....VP...GK..-------------
A1UH45_MYCSK/70-115-----------IP------------------------AHRWVYEQ.HV.G...P....IP...DG..-------------
D0U234_9CAUD/40-85-----------FS------------------------AHRLSYEA.VN.G...K....IP...DG..-------------
Q6X9Q0_9CAUD/46-92-----------LS------------------------AHRVAYEL.AT.G.TRL....LP....S..-------------
B4YQH7_9CAUD/40-85-----------TK------------------------AHIASYRL.HN.G...G....IP...AG..-------------
Q39FD2_BURS3/42-87-----------QL------------------------SHRVSYML.FN.G...D....IP...SG..-------------
B2HPG6_MYCMM/67-112-----------DR------------------------VHRWAFRA.YV.G...P....IE...DG..-------------
A0A058WBB0_BORBO/39-84-----------IG------------------------AHCASFRL.LV.G...D....IP...AG..-------------
Q8XUJ5_RALSO/52-97-----------MR------------------------AHRVAYEL.CV.A...P....IP...DG..-------------
Q8XUF6_RALSO/69-114-----------CS------------------------THRMAWEL.TY.G...A....IP...DG..-------------
A6T071_JANMA/40-85-----------TG------------------------AHRAAYEL.YV.G...P....IK...DG..-------------
Q5G8U2_9CAUD/66-111-----------VK------------------------AHRLSYEF.SK.G...I....IP...EG..-------------
I6Q9W6_9CAUD/45-90-----------QF------------------------VHRASYIQ.HK.G...P....IG...AG..-------------
C6BBU5_RALP1/42-87-----------IG------------------------AHIASYVA.AN.G...PL...AP....G..-------------
D1L332_9CAUD/27-75-----------VG------------------------AHVAAYLI.AN.N....L...TPDDVVG..-------------
B5ZXT2_RHILW/47-92-----------VD------------------------AHRVSYEC.FH.H....E...IP...AG..-------------
B7UG64_ECO27/45-90-----------ML------------------------SHRVAFEL.YH.S....P...IP...SG..-------------
B3VD64_9CAUD/26-71-----------FR------------------------VHRLEWIK.QR.G...P....IP...EG..-------------
C6BBU3_RALP1/28-76-----------VL------------------------AHRLAFVE.KH.G....L...ALSDIDG..-------------
Q6WYF0_BPT7/42-82-----------VY------------------------CHRVM....SN..........AP...KG..-------------
A9XL65_BPT7/26-71-----------VT------------------------PHRHIYEE.TY.G....P...VP...TG..-------------
Q55C13_DICDI/44-90-----------KF------------------------THRTVGQR.KV.G...RE...LY...AN..-------------
C8T858_KLEPR/128-173-----------IR------------------------LDVYVYEC.VH.G....K...LP...TG..-------------
A7IWJ9_PBCVN/166-211-----------QL------------------------MGTTSFIPKPK.N........MP...KN..-------------
A7IW40_PBCVN/137-186-----------VK------------------------VHQMMGET.RF.V...SKPENMP...SD..-------------
A7IW08_PBCVN/127-176-----------IS------------------------VHQMMGET.RF.V...PKPPNMP...SD..-------------
A7IXP3_PBCVN/63-109-----------VL------------------------LHVILMST.F..G...DQ...KP..VAT..-------------
A7IV02_PBCVM/62-108-----------FL------------------------LHRLFAST.FY.G........KP...EH..-------------
A7IW74_PBCVN/69-115-----------VY------------------------LHVLLMST.F..G........PPKTVAK..-------------
A7IWU9_PBCVN/61-106-----------LF------------------------VHRIIAST.FL.G........RP...PT..-------------
A7IWP5_PBCVN/60-106-----------LK------------------------VHRIVAST.FL.G...R....PP..TPA..-------------
A7RBV7_PBCVA/60-106-----------LI------------------------VHRIVAST.FL.G...P....PP..TLD..-------------
A7RBZ3_PBCVA/103-150-----------RS------------------------LARAMLST.FL.G...PP...PT...LE..-------------
A7IXC3_PBCVN/104-151-----------RS------------------------LARAMLST.FL.G........PP...PD..-------------
A7IWX1_PBCVN/103-150-----------RS------------------------LARAILST.FL.G........PP...PD..-------------
A7KA42_9PHYC/77-123-----------VL------------------------VGRALAST.FI.G...KP...QT...LE..-------------
A7K9V2_9PHYC/78-124-----------VR------------------------VARALAST.FL.G...PP...IT...LL..-------------
A7K8I5_9PHYC/59-105-----------LV------------------------VARALAST.FL.G...P....PP..TLQ..-------------
D3SUH7_NATMM/146-192-----------VA------------------------VHRLLAVS.EY.G...Y....EE..VGQ..-------------
A7IW48_PBCVN/260-306-----------RK------------------------LHEIVCTT.FN.G...P....IP..FEG..-------------
B8INW1_METNO/63-109-----------VG------------------------FHRLICEA.FH.G...P....SP..FVG..-------------
C3KA00_PSEFS/68-113-----------VG------------------------VHQLVADA.FH.G...A....CP...DG..-------------
A0A009UX44_ACIBA/66-111-----------IG------------------------VHQLVADA.FI.G...P....VP...EN..-------------
C4ML45_9CAUD/99-146-----------VF------------------------QHQVVMCE.HL.G...IT..AMP...KG..-------------
A5HL46_9CAUD/98-145-----------VF------------------------QHHVVMCE.AL.G...LT..QVP...DG..-------------
A3XJC2_LEEBM/63-108-----------FY------------------------LHKLLAKA.FL.K........AG..ENE..-------------
B0N8L2_9FIRM/61-106-----------TK------------------------VSYVVWEA.FN.G....L...VP...DG..-------------
Q2IFG5_ANADE/52-97-----------AW------------------------LHVHAYAF.FK.G...P....IP...WN..-------------
C7XUT9_9LACO/28-73-----------ID------------------------LHRYVWEK.YN.G...P....IP...DG..-------------
C3KZN2_CLOB6/39-84-----------QR------------------------LHVYVWEF.YN.G...R....IP...EG..-------------
Q6V7S8_9CAUD/139-185-----------VR------------------------QHRLVVER.QL.G........RP.LRDD..-------------
A9I8T5_BORPD/76-129-----------QY------------------------EHILIAQS.AL.G........RP...LRNY-------------
A6TVB1_ALKMQ/97-143-----------RH------------------------AHRVVAEQ.KL.G...RK...LK...KN..-------------
D4BUG2_PRORE/155-201-----------KY------------------------LHVVICEY.KY.G...RK...MK...KG..-------------
B5LPN5_9CAUD/94-140-----------VM------------------------EHRYIMSL.HL.G........RP...LE..-------------
C5B0P1_METEA/139-185-----------RL------------------------EHRVAVEK.DL.G...RR...LA...DD..-------------
Q633W4_BACCZ/111-157-----------KY------------------------LHRFIMEC.FLQA...E....IP...KG..-------------
C5H7P3_9CAUD/62-105-----------YM------------------------AHDLAILY.TD.G...F....LP...NR..-------------
Q6QGN6_BPT5/53-96-----------YY------------------------AQQLAFLY.MT.G...K....LP...EE..-------------
C0ZXU5_RHOE4/92-138-----------ER------------------------MHRVIAER.VL.G........VP...IG..-------------
C3KZN5_CLOB6/115-155-----------HY------------------------LHRVLMKA.KI.G.................-------------
Q6XQA1_BPT1/50-95-----------YK------------------------RSRVIWEM.FN.G...E....IP...DG..-------------
Q6KG62_BPFO1/53-98-----------YY------------------------AHNIAWIL.SG.G...D....IP...SG..-------------
Q3J217_RHOS4/61-107-----------FY------------------------AHRIIFKM.HN.P...D....VD..ISN..-------------
Q9T140_9CAUD/59-104-----------ML------------------------AHRVVWML.TH.G...E....IP...EG..-------------
D1L2U2_9CAUD/88-133-----------LL------------------------AHRVVWML.NF.G...V....IP...EG..-------------
Q6XQF0_BPT1/57-102-----------RG------------------------AHRLVWIY.HN.G...K....IP...DG..-------------
Q6XQ94_BPT1/46-91-----------EY------------------------AHRIVWKI.HY.G...N....IP...EG..-------------
B1GS34_9CAUD/33-78-----------HL------------------------IHRIVWEM.FN.G...E....IP...DG..-------------
A5PJ37_9CAUD/57-102-----------YL------------------------AHRIVWEM.HN.G...K....IP...DG..-------------
A5PJ23_9CAUD/113-158-----------VL------------------------VHRIIWEM.HN.G...K....IP...NG..-------------
B0FIJ3_BPE32/42-86-----------YL------------------------LHRLVFLM.E..G........LD..ISG..-------------
C4NTD4_9CAUD/53-96-----------YQ------------------------ASHVIWFI.VH.G...Y....QP...QE..-------------
D2K055_9CAUD/58-102-----------IK------------------------IHHLVWWF.EH.G...Y....KP...TK..-------------
B3VD46_9CAUD/50-96-----------LA------------------------VHRVVYAK.HH.G........VPLSSIR..-------------
D2EBT0_9CAUD/53-98-----------QL------------------------VHRVLWTM.RH.G.D......IP...TE..-------------
Q5IGW5_9CAUD/59-103-----------IK------------------------AHHLAWAF.VY.G...E....YH...NG..-------------
C5B0T1_METEA/50-94-----------MR------------------------AHRVAWLL.AY.G.E......WP...ET..-------------
A4JMK1_BURVG/52-94-----------ER------------------------MHRTIAGL.GF.G.............DT..-------------
B9BHP6_9BURK/57-100-----------IG------------------------VHRLIFLL.HH.G...F....LP...EF..-------------
A0A024ZD01_ECOLX/68-112-----------YK------------------------THVLVFYI.TH.N...R....WP...AG..-------------
B2ZYK2_9CAUD/71-116-----------YY------------------------AHRIIWML.VT.G...V....DP...GI..-------------
Q1QRF2_NITHX/41-86-----------HA------------------------IHRLIWQL.ER.G...P....IP...EG..-------------
A8HNZ9_9CAUD/53-96-----------YL------------------------AHRLALIY.VT.G...G....CS...GN..-------------
C9XY04_CROTZ/62-105-----------CS------------------------VHRLIWKM.HM.D...S....EP...QH..-------------
B4EME9_BURCJ/77-121-----------PY------------------------VTRVIWLL.AT.G...N....DP...LD..-------------
C4S5Y1_YERBE/57-101-----------YK------------------------GHRLACLY.MT.G........EQ...AN..-------------
Q66LV6_BPT5/53-98-----------YL------------------------AHRIIWFI.KT.G...E....DP...GD..-------------
B8QTY8_9CAUD/49-93-----------YR------------------------AHLLAWYY.VT.G...N....YP...IK..-------------
A0A024SZF9_PSEAI/58-101-----------FR------------------------IHTLVWFL.HR.Q...E....WP...VE..-------------
A4JMK3_BURVG/70-113-----------IG------------------------VHRIAMAI.TT.G...K....WA...DV..-------------
D0KHU7_PECWW/69-114-----------YA------------------------VHRIIWSL.TN.G...A....IP...AG..-------------
D8JQ74_HYPDA/54-98-----------HY------------------------AHRLAWLY.VH.G...E....FP....K..-------------
C5AFV3_BURGB/73-117-----------VY------------------------AHRIAFAL.HH.G...R....FP...IA..-------------
A9BW22_DELAS/55-99-----------YF------------------------VHRVAWML.HY.G........EP...PP..-------------
C4ML49_9CAUD/55-99-----------YM------------------------VHRLAWLL.HY.G...Q....WP...NG..-------------
D1P077_9ENTR/54-97-----------YK------------------------EHRLIWFY.VY.G...V....WP...DG..-------------
A9C0F7_DELAS/72-116-----------VL------------------------AHRVIWAM.ET.G...K....WP....D..-------------
Q4TZV0_9CAUD/53-96-----------YR------------------------AHRLAWLY.VY.G...Y....MP.......-------------
A3EZR8_9CAUD/55-99-----------YR------------------------AHRLAWWW.VY.G...V....MP...TE..-------------
K4TKR8_BORBO/58-102-----------YL------------------------AHRLAWLY.MH.G...A....WP...TQ..-------------
C5A7Y6_BURGB/56-100-----------HH------------------------AHRIAWLM.VH.G...T....FP.......-------------
B7ULS6_ECO27/31-76-----------TY------------------------AHHVIWMI.NN.G...E....IP...LG..-------------
C4ML56_9CAUD/95-139-----------YL------------------------VHRLAWLY.VH.G...R....WP...AD..-------------
D8JQ53_HYPDA/58-102-----------YP------------------------AHRLAWLY.IY.G.E......WP...PD..-------------
Q7Y5F9_9CAUD/57-101-----------YQ------------------------AHRLAWFL.SK.G...T....WP...SQ..-------------
A5H1J6_9CAUD/80-124-----------YK------------------------AHRLAWLI.ST.G...A....WP...SK..-------------
A5H1L2_9CAUD/57-101-----------YL------------------------VHRLAWLL.HT.G...S....WP...IQ..-------------
A8B107_9CAUD/57-101-----------YY------------------------AHRLAWLL.HT.G...S....WP...SK..-------------
Q2NPG0_9CAUD/57-101-----------YQ------------------------AHRLAWLL.HT.G...K....WP...SQ..-------------
A5H1K2_9CAUD/48-92-----------YL------------------------AHRLAWLL.HT.G...S....WP...SK..-------------
Q7Y5L4_9CAUD/73-117-----------YQ------------------------AHRLAWLL.HT.G...S....WP...SK..-------------
Q7Y5G7_9CAUD/59-103-----------YR------------------------AHRLAWLL.HT.G...S....WP...SQ..-------------
Q2NPD3_9CAUD/62-106-----------YM------------------------VHRIAWLL.SK.G...Y....WP....N..-------------
Q4TZV1_9CAUD/74-117-----------LY------------------------VHRVVWFL.EY.G........YQ...VD..-------------
C4MYH3_9CAUD/75-118-----------YL------------------------VHRIVWFL.EY.G...T.........QV..-------------
C4MYS3_9CAUD/74-117-----------LF------------------------VHRVVWFL.EH.G.T.Q....VR.......-------------
Q1QKU3_NITHX/67-111-----------YK------------------------AHRLAWLY.VY.G...A....WP...EG..-------------
A9DEP0_9CAUD/52-97-----------FK------------------------AHRMAWAF.VY.D...E....CP...SD..-------------
A0A028EKB2_ECO57/58-102-----------YK------------------------AHRLAWFY.VY.K...K....WP...PK..-------------
A2WAD2_9BURK/68-112-----------MY------------------------AHRLAWLY.VY.G...E....WP...SG..-------------
B7UG37_ECO27/66-110-----------YP------------------------AHRLAWLI.VY.G...T....MP...DG..-------------
A1JR30_YERE8/67-111-----------NQ------------------------GHRVAWLM.TH.G.H......WP...EG..-------------
C3AR86_BACMY/82-128-----------YL------------------------LSRLMLET.FR.S...NP...NS...DN..-------------
C2JXG4_LACRH/90-135-----------VT------------------------LSRLLALA.WI.S........NPEHLSD..-------------
B9UDM8_9CAUD/63-109-----------VN------------------------IHRLVAEN.LI.G.........PKPSDE..-------------
D4CXF1_9FUSO/31-77-----------IR------------------------KHRLVYEI.KT.F....M..KIP...KN..-------------
A6L5T7_BACV8/63-109-----------IR------------------------VHQVVATA.FW.G...QN...KE...EG..-------------
C8T854_KLEPR/51-91-----------RY------------------------LHRIIMNA....G.............PH..-------------
A7IV02_PBCVM/236-282-----------KF------------------------IHVLVAEQ.FI.D........NP...EN..-------------
A2I7Y0_9CAUD/50-95-----------FL------------------------VHRLFASK.FV.P....N...PG...NH..-------------
C7XUW2_9LACO/54-99-----------FY------------------------IHRLVAMK.FI.D........NPNLLPE..-------------
F4E585_BACAM/52-97-----------FL------------------------VHRLVAKY.FI.H....E...IP...KG..-------------
C0ZXW0_RHOE4/69-114-----------EK------------------------VHRVVARH.FI.P....N...PD...AK..-------------
D3V337_XENBS/84-129-----------YQ------------------------VHRLVALA.WI.P....N...PD...NK..-------------
D2J8C8_STAAU/58-103-----------YY------------------------VHRIVAEL.FI.G...R....IP...VG..-------------
D4CXE9_9FUSO/59-104-----------FK------------------------VHRLVALT.YL.K....N...KD...NK..-------------
Q84408_PBCV1/343-397-----------LK------------------------FHRKVVEL.FF.G...K....LP...KTVE-------------
A7IWJ9_PBCVN/358-412-----------KQ------------------------FHRVVVEK.FF.G...T....LP...KTIV-------------
A7IW40_PBCVN/332-386-----------IL------------------------FHRVIIEL.FF.G...S....LP...KTIV-------------
A7IW08_PBCVN/321-375-----------VL------------------------FHRVVVEL.FF.GP.IPKTIVIDGNTHR..-------------
Q8QNG0_ESV1K/274-319-----------KY------------------------VHVVVAEA.FL.G...E....CP...AG..-------------
O80123_9CAUD/49-92-----------TL------------------------LHKVITRA.FL.G...D.........TT..-------------
C7T1V9_9CAUD/47-90-----------EL------------------------VHRIIMSA.FK.G...E.........SE..-------------
O80140_9CAUD/47-90-----------MY------------------------VHRLVMLA.FH.G...K.........SD..-------------
Q09WS3_9CAUD/48-91-----------EK------------------------VHRIVMEA.FE.G...K.........SD..-------------
C7T218_9CAUD/56-99-----------ML------------------------VHRLIMEA.FR.G...K.........SD..-------------
Q09WT2_9CAUD/48-91-----------LL------------------------VHRIVMEA.FK.G...K.........SD..-------------
Q09YD3_9CAUD/47-90-----------MY------------------------VHRLVMLA.FY.G....K........SD..-------------

PF07510

Q5Z0T6_NOCFA/102-248-----------TT------------------------REVMMLRD-AE-G--------AVRLDPATC...QLTVGSGGGW
A1R7C6_ARTAT/113-252-----------DT------------------------RNDILRRD-LS-G--------VEFTEGSL....C..KVAGGSF
Q0RYV1_RHOSR/93-233-----------DT------------------------RNDILRRD-LV-D--------LTYKTSTRD...C..VVATGTL
Q0S639_RHOSR/133-273-----------DT------------------------RNDILRRD-LE-Q--------IVFRPGTRD...C..AVQTGTL
Q0S647_RHOSR/106-246-----------DT------------------------RNDILRRD-LV-D--------ITSRDRTRN...C..VVQSGTL
Q8FM54_COREF/109-249-----------DT------------------------RNDILNRD-LE-Q--------VTYRDNTQD...C..VVLTGVL
Q6A6U8_PROAC/86-225-----------GT------------------------RDDALARD-LV-G--------AKLKSGSR....C..RIVSGEL
A0LV32_ACIC1/126-265-----------DT------------------------RDDILRRD-LI-D--------ITYVPGSH....C..RIASGVL
Q82HG5_STRAW/78-214-----------DT------------------------RDDILKRD-LK-E--------VKFSDGK.....C..KVTAGVL
A0JTH8_ARTS2/211-350-----------DT------------------------RNDILKRD-LT-G--------ITYTNSVP....C..KVQSGTL
A0JWX0_ARTS2/105-245-----------DT------------------------RNDILARD-LT-G--------ETFKPGTHD...C..VVADGTL
A1A395_BIFAA/100-238-----------DV------------------------REDVLARD-LT-D--------VRYRQHG.....C..KVESGTL
Q8G7L0_BIFLO/75-214-----------DV------------------------RDDVLARD-LT-D--------ITYKYAGS....C..VVESGTL
Q2J4M2_FRASC/98-236-----------DT------------------------RNDILRRD-LR-S--------TTIRR.SDG...C..TVLTGEL
Q6NHN8_CORDI/105-245-----------DT------------------------RNDILQRD-LT-N--------IVFRPGTRN...C..VVSTGNL
A1T721_MYCVP/87-228-----------DT------------------------RNDILDRD-LI-D--------KTYVAIAR....CPRAVAAGTL
Q0SGG1_RHOSR/90-229-----------DT------------------------RNNVLALD-LR-S--------VAFRDGTRD...C..VVLSGVL
Q5Z121_NOCFA/118-257-----------DT------------------------RNDVLAAQ-LS-D--------VRYREGTRD...C..VVVAGTL
A7ICR1_XANP2/481-654-----------FP------------------------RDEEFERK-WL-D--------ARAYVVLQP..ARARAILQ.EI
Q2GBR5_NOVAD/473-622-----------WP------------------------SDERFREG-WL-N--------NPVYVSSRA..DRSAMILR.AL
Q88BH3_PSESM/500-658-----------WP------------------------DDASFSDK-WC-H--------RAVYKELRP..VKTCGVLR.AL
A1U086_MARAV/478-634-----------FP------------------------TDEEFKAS-IL-N--------RPIYQALAQ..YKIRAVLE.AI
Q5NWK7_AROAE/455-614-----------WP------------------------ADDRFAEA-WR-T--------QHAYHLLNN..PKIVHILK.RL
A6TCP9_KLEP7/451-620-----------WP------------------------TDSEFLNA-CI-T--------AQLYPGRLDT.PKMRMMLT.EL
Q886C3_PSESM/451-620-----------WP------------------------ENSEFRNA-CI-C--------APLYPGRLDA.AKMRSLLT.EL
A1SFN4_NOCSJ/451-594-----------WP------------------------GDNEIRVA-LT-T--------ESAYRRFPR..ARLRSFLE.AI
Q8NSE2_CORGL/410-552-----------FP------------------------SDSEFREN-FA-T--------KNFWNIHNE...NRRYLFD.CL
B3EQQ5_CHLPB/412-553-----------FP------------------------KNAEVIDA-LK-V--------KDVYNIKSK...NKIYLLE.RL
Q036N1_LACC3/426-567-----------FP------------------------TDQSLKDA-LV-E--------KDYYHMSSM...SLWFILD.EL
Q2FKU3_METHJ/422-570-----------MP------------------------DDDEFLDH-LR-Y--------SDLYQPGSD..NKLAFVILERL
A0RWN2_CENSY/426-563-----------FP------------------------GDGDFEKD-FA-E--------MDDAYK......LAKYILL.KL
A0ZGR7_NODSP/401-537-----------YP------------------------KDVDFKTR-LM-D--------VKLYGGSNRS.EKAKLILE.SI
A4J1V4_DESRM/398-534-----------YP------------------------KDVEFTAR-LQ-D--------VKLYGSGDRA.VKAKLILE.TF
A9AZI5_HERA2/396-532-----------YP------------------------NDALFKSH-LI-E--------SKLYGKGERL.VKTKLILE.TL
Q2J8U4_FRASC/408-551-----------FP------------------------TDQPVKEA-VL-L--------NPFYWTGRG..PQRTYVLR.SL
O25346_HELPY/413-546-----------FP------------------------NDDKIKAA-FL-V--------RNAYAANQ....VCKFILL.EI
Q5LGD9_BACFN/443-600-----------CA------------------------SDEQFRRS-LE-G--------DVYKDNVG....ATRYILCKLA
Q7VHA6_HELHP/428-575-----------IP------------------------KRYEIEDC-LI-S--------KDCYLANKKAALILFWIELYRR
A7UG49_FIBSS/466-641-----------EI------------------------SNTDIENG-LK-N--------NVSNSSGTLILFWIELYRAFKN
Q11AI8_CHESB/234-376-----------SA------------------------NDAVFKSR-LQ-G--------MMYERELTN..KPLKYLLI.TL
Q8YLY7_NOSS1/189-334-----------YA------------------------PDETFESL-LM-Q--------KLSYQDNSSKKMIIRHFLTTLE
A0RVA9_CENSY/414-554-----------KG------------------------RQNVGYDE-FA-K--------KIRERTDNLTNNVLKYILY.SI
Q2SGD6_HAHCH/412-558-----------EH------------------------DINEAIRQ-LQ-N--------ENCYEGWEE...ELRYLLYRYE
Q9XAG9_STRCO/398-541-----------GA------------------------TDKALALL-HN-G--------ASADPVFDA...AVRELRNLDT
A9AVQ7_HERA2/439-587-----------YA------------------------PEDDFING-NA-N--------PSDWYRTRN...RLRYTLF.EY
Q3ATS7_CHLCH/421-558-----------YP------------------------NDEAFSNA-FS-D--------KQLKTTQSRNKRIVRYILF.KL
A5V079_ROSS1/420-557-----------YV------------------------DDETFRNA-FA-N--------KVLRTTSSRNRQVARYILF.ML
A1AQQ9_PELPD/425-562-----------YP------------------------DDRQFKAA-FA-E--------KELRTTNSRNRKVVRYILF.QI
A6VMJ2_ACTSZ/423-561-----------YI------------------------DDDRFSKD-FT-E--------KVIKTTDSRSTRLVRFILC.EL
Q3AS66_CHLCH/431-567-----------YI------------------------SDADFRND-FS-T--------LELYSYG.QSKKLARYILF.EL
Q7NME9_GLOVI/421-559-----------YV------------------------PDDKLEQD-FY-R--------LAFKTNSQRK.KLAKYILA.QL
A9AVB5_HERA2/420-558-----------YP------------------------TDEEFEEA-FS-T--------KVLSDAK.....KSRYLLI.EL
A6Q5M5_NITSB/432-580-----------EA------------------------SDSDFKTA-FT-D--------FRPGTNK.....LGFYVIR.KI
Q8YA53_LISMO/416-546-----------II------------------------ADDVFLNN-FS-S--------FKTTNKL.....RLRYILK.KI
A4J5I9_DESRM/420-565-----------KK------------------------KKSSFEHD-LG-V--------LTQYDIQQY...RIRYILA.KL
Q8YPL5_NOSS1/423-586-----------QK------------------------LAEKFLLA-FR-R--------LDEDSVRKK...VLQYILA.KL
Q6F1G1_MESFL/672-827-----------EL------------------------KMPNKDLF-FE-N--------LINKKVQDK...NVAMVILKRL
A5IYB8_MYCAP/428-578-----------TP------------------------SDWRFIES-LK-S--------PKSELWLSK...SVIDIIETVT
Q5YR97_NOCFA/406-548-----------LS------------------------DEEKRLAR-ET-L--------DGEIYRKTE...RARYVLL.RL
Q4JVU8_CORJK/414-556-----------LS------------------------DSERADTL-ER-L--------DGEIYLSTR...VRKYVLL.RL
Q1DEQ6_MYXXD/411-552-----------LS------------------------TDEEKQLV-DA-L--------DGEVYLEQK...VRVYVLL.RL
Q6D0Y9_PECAS/408-551-----------LS------------------------IQEANDFI-KE-I--------DGNIYYLTA...RRRNYIILRV
Q6ZEH4_SYNY3/425-566-----------DI------------------------EKQDELIK-KV-L--------EGDIYKDKT...RRKYILL.RL
Q5KUQ7_GEOKA/389-532-----------IE------------------------TVKKYADN-KE-F--------EQLIRADIYHSPAVKAILL.RL
A6GW01_FLAPJ/386-529-----------VS------------------------KILELTNN-EE-F--------FKILESNLYGMSYAKAVLL.RL
A4G9X6_HERAR/400-542-----------VI------------------------KGLKYDPK-SI-F--------AAISSKSLYGSRYAKYFLL.RL
Q0C3X8_HYPNA/403-545-----------FA------------------------LNRDEARK-LR-D--------RLTTRFGTY...GQRRAIALRL
Q6LTS8_PHOPR/529-671-----------SS------------------------FIKSYLSE-KN-G--------VNFRHYWFQ...KLEYLLWKHN
Q11QY5_CYTH3/502-639-----------DF------------------------EYEIYLTS-SY-G--------TKFQHYWFQ...KLEFILWKNW
A0M4J9_GRAFK/551-704-----------LK------------------------NAEEYFNK-GW-G--------VDYPNYIFY...KLEYILWKNR
Q0AUV6_SYNWW/448-590-----------TK------------------------VFESKFEN-SS-G--------FGFERIVFT...YLDYLLYKNG
Q4FRY4_PSYA2/530-667-----------SD------------------------PNHDFESH-LG-Y--------DKVAVFVFN...YLDYLLWKDS
Q9PPW3_UREPA/769-912-----------QM------------------------EIKNIKNF-YN-K--------MLDEKVSDI...HLAYLIRFET
Q6AIF5_DESPS/418-563-----------EI------------------------SNDRFKDY-LS-D--------YDYYKQTG....LLRLLFLDYC
O24986_HELPY/247-392-----------AQ------------------------CRNDIGLA-FW-Q--------SVNNASNSS...CFHYIFFEKN
A1A1T1_BIFAA/469-640-----------MV------------------------YVRALRRM-GM-S--------VEGITRFGLNQFSKRYMLHILA
Q5LEB6_BACFN/377-525-----------VD------------------------ISKESIEN-NG-Y--------FSTGRSYIK...AILCIYAYHQ
A5FWM6_ACICJ/377-525-----------VD------------------------VSPDFILE-NG-W--------FNTSRSFVK...AILCLYAHRA
Q3JCQ9_NITOC/323-466-----------GR------------------------SLEVTRDT-IL-N--------TRYSSKDIH...LLFNLWYRDF
A9WEH8_CHLAA/424-558-----------.R------------------------SDAAFRAD-FA-E--------KSIKTTQSRNARIVRYILS.KL
B0RGW4_CLAMS/92-228-----------.T------------------------RNDVLRRD-LA-D--------AEIRSGTRG...C..VVQAGVL
Q8XIG5_CLOPE/441-575-----------..------------------------.TAYFENA-LN-D--------IDFYSKGRM..MIPKYIFV.RL
Q9KR77_VIBCH/513-654-----------.Q------------------------SQSTYFAK-SL-G--------TSFEHYWFQ...KLEYLIWKKM
R5T7Y2_9CLOT/410-545-----------FP------------------------DNDKFEGA-FV-N--------RDIYNMRAR.....NYILS.RL

PF14412

A5W3P0_PSEP1/1280-1394-----------DA------------------------KLLRKELG-IS----------PQGG.GQ---------------
A7MQ50_CROS8/1402-1512-----------RQ------------------------NM..IREG-IE----------EPS..FK---------------
Q1VCI2_VIBAL/107-222-----------TN------------------------RLVSNLYA-VS----------EPQPSPN---------------
Q82R58_STRAW/2257-2362-----------GD------------------------NM..TAAG-TI----------RP...AE---------------
A6G3J9_9DELT/2292-2397-----------GK------------------------NL..IAAG-FT----------RP...HG---------------
B2RK38_PORG3/122-225-----------SL------------------------AM.GDDAR-NI----------DP...KD---------------
A9AT71_BURM1/1292-1398-----------SN------------------------NM..EKSG-VT----------RP...AN---------------
C2LKS1_PROMI/54-162-----------SK------------------------NM..VADG-TP----------RP...AN---------------
D6HTD3_ECOLX/139-248-----------AK------------------------SAGYMNRA-WY----------KF...KG---------------
A9EDX2_9FLAO/535-640-----------RR------------------------SQLRKVLG-LA----------VG...DA---------------
D0LTA7_HALO1/752-883-----------DT------------------------LL..EAAG-VA----------KP...AH---------------
D0LKQ6_HALO1/810-934-----------AQ------------------------SVKRLYKR-LG----------LPSRPAN---------------
D0LLJ7_HALO1/620-748-----------GE------------------------LL.ARAGH-TA----------RP...PY---------------
A6CDX3_9PLAN/332-450-----------GQ------------------------HI.ISETG-VL----------PPAGMPR---------------
E1KPW8_9BACT/935-1042-----------SA------------------------SD..MKKM-GP----------APKNMYN---------------
F0K581_CLOAE/200-308-----------GN------------------------YL..KKKR-GN----------PPSGMSK---------------
A9VT18_BACWK/373-481-----------GK------------------------YL..RGLI-GD----------PPAAMID---------------
B1K7M0_BURCC/1371-1487-----------KE------------------------YY.SKKTG-TS----------PPSTMEN---------------
A7MQ44_CROS8/1218-1330-----------LA------------------------KA..LANG-HV----------IPAGMTN---------------
B1JMY6_YERPY/61-165-----------SQ------------------------KL..RDAN-VA----------QPGGLTN---------------
E2MFF7_PSEUB/30-137-----------GN------------------------YL.RKIGG-GV----------APAGMRN---------------
Q8XQT2_RALSO/1406-1511-----------GD------------------------LV..RKYE-GD----------PPADMTN---------------
Q2SPA9_HAHCH/25-137-----------PN------------------------EI..AFNK-NA----------YGTG.AS---------------
Q4HD84_CAMCO/120-223-----------IK------------------------YDRIRWEG-GG----------DDNKQSS---------------
D1QPX2_9BACT/380-481-----------LQ------------------------WLVHNAKK-CL----------SK...LP---------------
C2VMF9_BACCE/142-242-----------KK------------------------GIKRATLN-AM----------KK...KP---------------
Q64SC9_BACFR/1339-1449-----------YG------------------------YV.DDPNT-WI----------DV...FG---------------
Q1DCW1_MYXXD/334-445-----------AP------------------------TAVAMSTQ-DS----------SK...RW---------------
Q093F6_STIAD/232-335-----------VE------------------------PVTVADDG-FL----------VA...LP---------------
Q1D4C5_MYXXD/315-427-----------AA------------------------ALAMYSDG-RF----------PGD..TE---------------
Q1DCY3_MYXXD/316-427-----------AG------------------------AVVGAVGG-IQ----------GD...PD---------------
A6CA84_9PLAN/166-276-----------SK------------------------ALGQDLTN-NK----------IPRPQGG---------------
D3IMS2_9BACT/89-191-----------NT------------------------RIDLWGLD-CD----------VP...KK---------------
H6NWL7_SALTI/1235-1336-----------LY------------------------AYCPNPLT-WI----------DP...LG---------------
D1YPM0_9FIRM/58-154-----------DA------------------------GRFVNQDP-IG----------VE...GG---------------
Q1BS61_BURCA/453-565-----------HE------------------------ASIQRRVN-CL----------KS...QG---------------
B7VTR6_VIBSL/37-155-----------LK------------------------ALGVTEKD-KM----------EGLE.KN---------------
B2PYR7_PROST/296-406-----------PW------------------------GLAASGDY-KE----------MPVM.PG---------------
D1PUV1_9BACT/145-267-----------SS------------------------AKL.NKAL-GG----------SK...KG---------------
A0A009XFQ0_ACIBA/1498-1612-----------ST------------------------TLN.RNLG-GV----------KG...DH---------------
A7VXS4_9CLOT/154-265-----------AV------------------------EQEATIAK-PS----------KPR..NP---------------
C5BUJ2_TERTT/116-229-----------EM------------------------YM..RAEG-VP----------KPS..SQ---------------
E7J463_ECOLX/145-254-----------GK------------------------NM.MEAMG-LA----------RSTTWKG---------------
D8P630_RALSL/1305-1421-----------GK------------------------NM.....G-AR----------SGD...G---------------
Q6HKE9_BACHK/425-537-----------RE------------------------EL..KDAG-ID----------PPP..YH---------------
D0BQG1_FUSNU/310-426-----------DE------------------------EL..LKAG-VV----------KPD..YK---------------
A6DG18_9BACT/297-411-----------KV------------------------NM.EKVYG-IK----------KL...GH---------------

PF02945

Q854H7_BPMOM/21-116-----------RH------------------------WFEYAASR-CVGG--------TKADLKLILLEEQE..HRCANP
Q854C9_BPMOM/61-142-----------AR------------------------RWDSIYGI-....--------TPDEYA.AILEEQGG..RCAL.
Q853W7_BPMOM/109-202-----------SA------------------------KLRSKFNI-....--------TLDQYNHLLYEVQGG..KCANP
Q9MBZ1_9CAUD/47-128-----------DR------------------------NLRRLYGI-....--------GLNEYE.EMLTKQNG..VCAI.
Q82YG4_STRAW/252-319-----------GQ------------------------LRGVQYES-....--------.PRRRS...TRADD..YLCRL.
Q857G3_BPMB2/60-141-----------ET------------------------RIFATYGI-....--------TAEEYW.AIYEFQGG..RCYG.
Q82R65_STRAW/149-228-----------EL------------------------LHLWPPRP-ARTA--------SVRRLRAALVDALGP..DCHL.
A0A023ZVT8_9CAUD/1-97-----------ML------------------------LTGKLY..-....--------.KEEKQ.KFYDAQNG..KCLI.
Q99PZ8_STRCO/154-212-----------EE------------------------RIPIWYAW-....--------.....W.RLHDIQDG..TCAT.
Q82RY9_STRAW/40-138-----------VE------------------------RQVRRYRI-....--------TVPRRN.AIMRFQRD..VCAL.
G8I606_9CAUD/49-130-----------EK------------------------RLLELYDI-....--------TADEYW.QIYEAQGG..RCYI.
Q856T3_BPMCO/46-138-----------GR------------------------RVESGYGI-....--------PQELYW.ALYEAQGG..KCAI.
O87597_STRCO/77-153-----------VG------------------------HLKRHYGL-....--------TEAERD.AMVASQMG..LCVI.
Q849E0_STRVN/152-236-----------GH------------------------LRGVLYES-....--------.ARRRS....TRADG.YLCRL.
VG59_BPMD2/49-130-----------ET------------------------RILATYGI-....--------TAEEYW.AIYEFQGG..RCYI.
Q9ZL26_HELPJ/99-187-----------EC------------------------RKNID.GV-KLSS--------TEKKKMDEIAPPKGSVFTCPI.

PF04231

S6BR35_PSERE/26-233.......CGYEVR------------------------AQENRAQRIEW----------EHVL...---------------
H8XQY1_FLAIG/31-274....NQDDG...T------------------------GGTAECQKYNR----------EHII...---------------
Q7MB43_PHOLL/29-237.......CGYQVR------------------------SQQNRAERIEW----------EHIV...---------------
C6X0Y1_FLAB3/33-266....NQ.CG..NY------------------------NAEAVC..YNR----------EHLF...---------------
G2Z0P2_FLABF/31-278....QQ.CG..NY------------------------NSEGDC..YNR----------EHTV...---------------
E1WX28_BACMS/37-265....RV.CG..SY------------------------KNEGDC..YNR----------EHLF...---------------
A6GXH6_FLAPJ/30-267ATGGNQDTG...T------------------------LGSNECERYNR----------EHTF...---------------
A5FAQ0_FLAJ1/31-260....TQRCG..NY------------------------SAEGDC..YNR----------EHII...---------------
G8X893_FLACA/31-259....NQ.CG..TY------------------------SGEGGC..YNR----------EHMI...---------------
F6GF23_LACS5/34-268....DQ.CG..NY------------------------NSEGDC..YNR----------EHLV...---------------
Q87FN9_VIBPA/294-530....DQ.CG..QY------------------------SQEGDC..YNR----------EHSF...---------------
M4U6V7_9GAMM/209-446....DK.CGKSQV------------------------EAEGNC..YNR----------EHSF...---------------
D4ZCB1_SHEVD/20-225.......CGYQAR------------------------KQEKRAERIEW----------EHIV...---------------
H8XRD7_FLAIG/30-246TDLSTNICS..ST------------------------CPTGS...WNR----------EHCYALS---------------

PF01844

Q9RZ22_DEIRA/734-776-------CL..CC------------------------GKR........----------...T------------------
Q830G1_ENTFA/64-111-------CQ..RC------------------------GRFVFGR....----------....------------------
Q81XW6_BACAN/141-196-------CE..IC------------------------GFDFHKIYGE.----------LGKD------------------
Q8XLC6_CLOPE/63-111-------CL..NC------------------------WDKGIIE....----------...M------------------
Q81CU3_BACCR/27-71-------CI..RC------------------------KKTVLLS....----------....------------------
Q8NLR2_CORGL/374-419-------CTREGC------------------------DSPFEDN....----------....------------------
Q8YL60_NOSS1/22-69-------CE..YC------------------------LIHQDFS....----------..IY------------------
Q8DWJ8_STRMU/50-100-------CI..YC------------------------GWNCKRYD...----------..AA------------------
Q8CM00_THEEB/505-551-------CP..VC------------------------GGEIEQD....----------...M------------------
Q8YUD3_NOSS1/22-69-------CE..YC------------------------HASEKWQ....----------..YV------------------
Q9RRS6_DEIRA/105-147-------CQ..YC------------------------GSQ........----------...D------------------
Q8DXJ3_STRA5/40-90-------CD..MC------------------------GRLIHGK....----------....------------------
Q87Y88_PSESM/40-88-------CG..RC------------------------AREFAGKR...----------..LS------------------
P73905_SYNY3/19-66-------CE..YC------------------------HSPERLS....----------..AN------------------
Q81D03_BACCR/65-112-------CQ..RC------------------------GRFVFGR....----------....------------------
Q88ML0_PSEPK/67-115-------CRCDDC------------------------AQLGRIR....----------...E------------------
Q97HW0_CLOAB/32-80-------CQ..EC------------------------LRHGAIT....----------...Q------------------
Q8YKL7_NOSS1/198-241-------CA..YC------------------------GIKD.......----------...V------------------
MCRA_ECOLI/207-258-------CE..NC------------------------GKNAPFYLN..----------DGNP------------------
Q8YZ58_NOSS1/25-70-------CQ..SC------------------------GKTGLE.....----------...T------------------
Q9KMM4_VIBCH/22-66-------CP..NC------------------------GERDVST....----------....------------------
Q8XYS8_RALSO/66-114-------CV..EC------------------------KRGGHVV....----------...P------------------
Q81X85_BACAN/42-92-------CQ..RC------------------------RIKFGLMN...----------..FD------------------
P73673_SYNY3/22-69-------CE..YC------------------------LIPEALS....----------..LS------------------
Q82YG2_STRAW/26-70-------CE..TC------------------------SAPLLDG....----------....------------------
Q9A694_CAUCR/96-138-------CQ..YC------------------------GSP........----------...E------------------
Q8DLJ5_THEEB/79-122-------CQ..YC------------------------GYTG.......----------...D------------------
YOQL_BACSU/136-189-------CS..YC------------------------GLKIEDHKILF----------KGTY------------------
P72833_SYNY3/79-122-------CQ..YC------------------------NYKG.......----------...E------------------
Q8YJW6_NOSS1/99-141-------CQ..YC------------------------GST........----------...K------------------
Q892G5_CLOTE/70-118-------CK..LC------------------------LSKCNIT....----------...Y------------------
Q9RZ97_DEIRA/536-578-------CV..EC------------------------GDT........----------...N------------------
Q8KEG3_CHLTE/87-130-------CQ..YC------------------------GCKD.......----------...G------------------
Q9X2X8_BACAN/514-560-------CR..VC------------------------NNSLVGE....----------...E------------------
Q8F8A1_LEPIN/40-85-------CH..YC------------------------GKKFLP.....----------...E------------------
ANRX_NOSS1/24-67-------CM..VC------------------------WEVNSKA....----------....------------------
Q81W86_BACAN/46-96-------CQ..EC------------------------MKHDPLIP...----------..VP------------------
Q81Z15_BACAN/30-77-------CE..RC------------------------TDPGKIV....----------....------------------
Q8YJX0_NOSS1/534-580-------CT..HC------------------------GLFFHHE....----------...D------------------
Q984I3_RHILO/259-314-------CE..VC------------------------DMTFQKHYGD.----------HGKG------------------
C1DQC3_AZOVD/456-501-------CP..MC------------------------KQLITFE....----------...T------------------
Q2FYC4_STAA8/41-88-------CQ..MC------------------------LREDIVT....----------...D------------------
Q32JG4_SHIDS/27-75-------CG..RC------------------------SREFVYSN...----------..LR------------------
Q99YZ8_STRP1/30-83-------CG..IC------------------------GKPVDKSLKY.----------PHPL------------------
Q9CFR4_LACLA/90-137-------CQ..YC------------------------LNHKRVR....----------...T------------------
Q9PC69_XYLFA/109-154-------CL..YC------------------------GQQFSRF....----------....------------------

PF16786

H8L2H7_FRAAD/10-118-------CI--CC------------------------QMNRAAGRPTA----------FFGV------------------
M4NHG8_9GAMM/46-153-------CL--CC------------------------RRNAAMGMALP----------YSGP------------------
REF_BPP1/80-182-------CI--AC------------------------YMH.GVISN.E----------....------------------
Q2L2X9_BORA1/6-99-------CV--AS------------------------RMD.GFFDS.Q----------....------------------

PF05551

O46338_9EUKA/115-245-------CLIGAA------------------------NKT...KSGF.----------KVRF------------------
A3QSY4_9LECA/123-253-------CW..ES------------------------NLAGRPNSGYQ----------RVNL------------------
Q7Z9J1_9PEZI/146-281-------CWTSPD------------------------KQPSEPGKPYR----------KLNW------------------
Q966Z7_9EUKA/22-136-------CWTLRK------------------------IRR........----------TKTV------------------
A7ISR6_9EUKA/122-252-------CLLGAS------------------------NKS...KSGF.----------KCSF------------------
A7F286_SCLS1/133-280-------ALVTRT------------------------EKDGKINESVK----------LREG------------------
A7BJ62_NAEGR/88-207-------CGIVKC------------------------DYALDLCRGYN----------KTYQ------------------
Q8TGE3_9FUNG/33-165-------CW..KP------------------------TTKPTHRNGYC----------QINL------------------
Q8X1S1_BEABA/120-236-------GWCRSS------------------------VLKPNKQDGYI----------QVSF------------------
Q2TSV0_PORUM/40-143-------CY..RT------------------------NYAVVKPAGYV----------QLRL------------------
Q6W364_9EURO/163-291-------CW..AA------------------------KQESGHRNGYI----------KLNL------------------

PF13395

B0RZQ7_FINM2/844-900-------DM--YT------------------------GEKIDLDKLFD----------.STH------------------
D6S374_9LACO/860-911-------DA--YS------------------------GEKLSLDNL..----------..QD------------------
Q1WVK1_LACS1/821-874-------DM--YT------------------------GEKMNIDELH.----------..QK------------------
Q5M542_STRT2/576-631-------CL--YT------------------------GKTISIHDLIN----------NPNQ------------------
A8AY02_STRGC/575-630-------CL--YT------------------------GKNIPISDLIH----------NQYK------------------
C5ZYI3_9HELI/554-608-------CA--YS------------------------GKKITIDDLK.----------EDKA------------------
C4ZA16_EUBR3/583-638-------CL--YS------------------------GKTIDPNDIIN----------NPQL------------------
D4IZM9_BUTFI/576-631-------CP--YS------------------------GKSIKIDDLLD----------NPNL------------------
B8I085_CLOCE/550-604-------CA--YS------------------------GKPIPVCDLLN----------.DSL------------------
A6GZR9_FLAPJ/723-776-------SL--YT------------------------GNPIKASDLFS----------..KN------------------
B1GZM3_UNCTG/557-611-------CV--YS------------------------GRKISFEDLLD----------.TGF------------------
D3UFL8_HELM1/576-630-------CL--YS------------------------GEKITIDHL.K----------DQRA------------------
B2KB46_ELUMP/642-695-------CP--FC------------------------GGQISPNDIIN----------..NQ------------------
Q6KIQ7_MYCMO/662-717-------DA--YS------------------------LRKIEANDVIN----------KPWN------------------
Q7MRD3_WOLSU/573-627-------CA--YT------------------------GDVIELERLFD----------.EGY------------------
A1WH93_VEREI/615-668-------CP--YS------------------------GERISATMLLS----------..EA------------------
Q4A5I2_MYCS5/699-751-------DP--YT------------------------QLDIKINEI..----------.EDE------------------
A7HP89_PARL1/579-633-------CP--YT------------------------GDQIGFNALFR----------.EGR------------------
C7M7G9_CAPOD/791-844-------EL--YT------------------------NAPIARDMLFS----------..KN------------------
D1AUW6_STRM9/623-676-------CM--YS------------------------GRTIEKYQLTS----------..AE------------------
Q1QGC9_NITHX/661-714-------CV--YT------------------------GEQISIERLLS----------..DE------------------
A8LN05_DINSH/600-653-------CP--YT------------------------GTRISAAMIFD----------..GS------------------
B1GZ57_UNCTG/486-539-------CP--FC------------------------SEKITPDDIIN----------..SK------------------
B2UP49_AKKM8/631-682-------CP--FT------------------------GATYGDHEL..----------..EN------------------
C4LF28_TOLAT/241-289-------CI--YS------------------------DEQLNPGE...----------....------------------
Q01TQ5_SOLUE/211-274-------CF--YC------------------------FADISVENAS.----------.TRL------------------
A9HKP2_GLUDA/568-623-------CL--YT------------------------GKAIHIRQIAA----------TDNS------------------
G4Q6A5_ACIIR/835-888-------DM--YT------------------------GDPIKLEHIKD----------.QSF------------------
Q0P897_CAMJE/537-591-------CA--YS------------------------GEKIKISDLQD----------.EKM------------------
Q20XX4_RHOPB/560-615-------CI--YS------------------------GDAIDPAGVAA----------NDTR------------------
Q5L8F8_BACFN/794-846-------.L--YS------------------------NTYISREKLFS----------..KE------------------
Q7NAI2_MYCGA/647-702-------DP--YS------------------------QKEIAFDDILT----------KTEK------------------
Q8DTE3_STRMU/821-872-------DM--YT------------------------GEELDIDYLS.----------...Q------------------
CAS9_STRP1/821-872-------DM--YV------------------------DQELDINRLSD----------....------------------
Q9CLT2_PASMU/558-612-------CL--YS------------------------GKEINIHRLNE----------.KGY------------------
R7G6K2_9FIRM/537-591-------.A--YS------------------------LEPIDLKLLID----------DPNA------------------
T0TDV9_9STRE/576-631-------CL--YS------------------------GKPILIQDLVH----------NSNN------------------

PF12639

B0KQD0_PSEPG/501-635-------.WWPAN..GAAAGVAMPVQVGNQLR.....GRLFTGMPAFE----------SAVWRAI...............
Q3K6V6_PSEPF/285-415-------.WLAGA..GTGIGVPIPTRIANRLR.....GREFSSFDKFR----------EAFWEEV...............
C4T554_YERIN/799-929-------.WLAEA..GKGLGAPIPVQIADKLR.....GRKFSSFGEFR----------RALWLEI...............
A7FD33_YERP3/469-599-------.WLAGA..GKDMGGPIPAQIADKLR.....GRQFSHFGRFR----------AAFWKVV...............
B2JZI5_YERPB/7-137-------.WLAGA..GKDMGVPIPSQIADKLR.....GRWFSHFGRFR----------AAFWREV...............
Q7N5Q1_PHOLL/427-557-------.WLSLA..GQDMGAPIPSQIADKLR.....GRRFNNFDDFR----------RAFWKEV...............
A7MTX8_VIBCB/727-857-------.WLAGA..GKDLGAPIPSQIADKLR.....GKEFSSFDAFR----------KAFWLEV...............
Q87GQ2_VIBPA/738-868-------.WLADA..GKDLGAPIPSQIADKLR.....GREFSSFDAFR----------EGFWYAV...............
B2VB98_ERWT9/508-638-------.WLNKA..GQELGSPVPTQIADKLR.....GRKFASFDAFR----------KAFWQEV...............
Q9XBT6_KLEPN/634-764-------.WMGGT..STGDGAPVPSQIADKLR.....GKAFGSFDSFC----------RAFWKAV...............
A0A016RP44_KLEPN/642-772-------.WMGGA..STGDGAPVPSQIADKLR.....GKTFGSFDSSR----------RAFWKAV...............
C4SH19_YERMO/396-526-------.WFAGA..ARGLGAAIPTAIADQLR.....GRRFSTFDKFS----------EAFWAVV...............
C2DMX1_ECOLX/454-592-------.WLDMSVSNNGNGAPIPAHIADKLR.....GREFKTFDEFR----------EALWLEV...............
A9MMY5_SALAR/1057-1195-------.WLDLSVTNKGNGAPIPSHIADKLR.....GRSYGSFDDLR----------EDLWEEI...............
A8AJ94_CITK8/445-577-------.WLEAA..SSGLGAPIPAQVADKLR.....GRTFRNFDHFR----------EEFWLAV...............
PYS1_PSEAI/486-616-------.WLGAA..SQGEGAPIPSQIADKLR.....GKTFKNWRDFR----------EQFWIAV...............
Q51502_PSEAI/639-769-------.WLAGA..SQGDGVPIPSQIADQLR.....GKEFKSWRDFR----------EQFWMAV...............
Q3KHV9_PSEPF/591-721-------.WLGTA..ATQQGAPIPTQIADKLR.....GREFSSFRAFR----------KAFWKAV...............
Q4ZME2_PSEU2/510-640-------.WLGAA..SQGEGAPIPSQIADQLR.....GKEFKNFRDFR----------KAFWLAV...............
Q3K520_PSEPF/657-787-------.WLGSA..SQGEGAPVPAQIADQLR.....GREFRNFRAFR----------EAFWKAV...............
Q4ZZN9_PSEU2/521-651-------.WLGDK..TRAEGASIPAHIADQLR.....GRRFGNFDSLR----------KATWIAV...............
Q88NA6_PSEPK/624-755-------.WRKEA..ASLEGAPIPAQIAELLK.....SREFRNFDAFR----------RQFWKAV...............
A0A025RNS1_ECOLX/450-580-------.WLDDA..GKDSGAPIPDRIADKLR.....DKEFKNFDDFR----------KKFWEEV...............
CEA7_ECOLX/445-575-------.WLNNA..GKDLGSPVPDRIANKLR.....DKEFKSFDDFR----------KKFWEEV...............
D2ZY22_NEIMU/251-385-------.WLKGT..HGNAGV.FPKSVADKLR.....GKSFDSFDDFR----------AAFWKEV...............
B7IKS1_BACC2/421-558-------KKLMYN..KGSIGV.IPQEIRNKLI.....GKNFNSFDDFR----------KEFWKTV...............
C3AFZ3_BACMY/16-153-------KKLMYN..KGSIGV.IPQEIRNKLV.....GKEFKSFDEFR----------AEFWKTV...............
C3IBA0_BACTU/269-406-------KKLMYN..DGAIGI.IPQEVREKLA.....GREFKSFDDFR----------EEFWKTL...............
D3L0R9_9BACT/87-187-------.WPQFK...PVFSVRMPGNMIT........ASRSVHKRYVW----------QKFYEDL...............
B9NWZ3_9RHOB/126-198-------.YPDFS...RYS...QANVRIE.LT.....GSRSADFAAAN----------RAAGLDS...............
D0FW92_ERWPE/64-139-------.FPDFT...RYS...INNVRIE.LG.....RTRGIDFARAD----------KAVGYGR...............
B5H1J3_STRC2/2188-2263-------.FPDFS...AWRHPQVPDVRIQ.LT.....GSRSRDFRLAN----------QAAGLPS...............
A9AVI8_HERA2/2989-3061-------.YPDFS...AYS...IKDVQID.MR.....GNRGSDFAKAD----------QAAGYTV...............
A3DH25_CLOTH/482-555-------.FPDFS...PYS...KKTVKVEGLQ.....GDTYYDFIKAN----------QAAGYKS...............
Q21ED9_SACD2/494-574-------.FPDFS...PYLYDKGVNTVNIKLT.....GNRNQDFALAN----------QLAGFGN...............
H2GD98_CORD2/1149-1243-------.FPIFD...RFVAQF...............DANAMTFNPEA----------MPHGKVP..........DVTIT
C3E5P5_BACTU/88-181-------.YIDWE.........IPPNRVSY.......PGGFPNFKSAG----------L.VRQEV...............
C2XDV9_BACCE/492-590-------.FPIFKGDDVKFTMRLD...KNLHI.....SPDEAQFKECT----------RKLKEAI...............
C2XW90_BACCE/506-604-------.FPIFKGDDVKFSLKLE...KDFYV.....MKDTDQFRECT----------KLVKEAI...............
C3H3G2_BACTU/81-179-------.FPIFKGDAVKFQTKLD...KGMFI.....ASDDKQFKFCT----------KALKEAI...............
C2UXI9_BACCE/476-574-------.FPIFKGEDVKFTHKLD...ESLFI.....AKDDAQFEECT----------RQLKAAI...............
E6TT53_BACCJ/211-318-------.FPVFD...AVAEVVLP...EELYG.....SSDYLHFSYAN----------GELIDMV...............
A0RAF7_BACAH/78-185-------.FPEFP...VTYEVQLD...EQQYL.....DSDARQFKTAI----------GKLAQDI...............
C2SK99_BACCE/69-176-------.FPKFE...SLFDAQLD...ESQYE.....DSDARQFKEAN----------SQLKDAV...............
Q3IK23_PSEHT/83-190-------.FPKFE...SYCDVKLP...DENLG.....DSDSKQFRICN----------EALKEEY...............
A8RX43_CLOBW/127-235-------.FPKFD...SAFDTALD...PDNLK.....TKAYA..KECN----------AKLKEAI...............
B6BJ56_SULGG/68-165-------.LPEFE...SGCDVFIKPKDYD........KSRAQHFRVAN----------VHLKNKV...............
C9PRI4_9PAST/54-160-------.LPIFD...DVSKFTTKIEKPSNYQIILSEDRKKTEMKNAT----------LALKKAI...............
C9PRJ7_9PAST/54-160-------.LPIFD...DVSKFTTKIEKPKNYQETNSESRRIAEMKSAT----------FALKQAI...............
B4AH22_BACPU/149-244-------.FPVFS...ARHSMTLP...LKEVK.....SSNYTQFKLAN----------ADLKKRV...............
C3IFI1_BACTU/72-167-------.FPIFK...SKGEVTLK...ETDFK.....KTRTTHFRRCN----------KDLYKQI...............
C2REC0_BACCE/276-371-------.FPIFK...SKGEVILK...EADLK.....KSRTTHFRKCS----------KALYEQI...............
A0RG76_BACAH/252-347-------.FPIFD...AFAEVKLK...EVDFK.....KSRPTHDRICN----------KLLYEQI...............
A0A011S190_BACAN/304-399-------.FPIFK...ALSEVKLK...EADFK.....KSRPTHDRICS----------KALYEQI...............
C2RQF7_BACCE/478-573-------.YPIFN...SKYETSLS...ESYHL.....EPDSVQFKYLS----------QKLYDDI...............
D0W6H7_NEILA/84-183-------.FPNFE...KYVKYDTKLDIQEFRS.....KGSTGQMRLAT----------KDLAEAI...............
A6CCT8_9PLAN/320-434-------.VPIFD...RHSLFDTYITRQYSSV.....ADEAAHMRAAT----------RELRSSLGIGQGQANRVAALGA

PF14411

R5NTS8_9CLOT/325-402-------TNVDRV------------------------VKNLAPIDK.A----------G...------------------
A6X424_OCHA4/965-1043-------QNITRM------------------------RNGQAPFVR.T----------ANGS------------------
X2HIJ6_9NEIS/339-420-------TNLDLM------------------------KNGYAPIGP.D----------G...------------------
R7I8K6_9FIRM/294-372-------TNLTRM------------------------QQGLAALDPAT----------G...------------------
I0GP52_SELRL/2256-2337-------TNLELA------------------------MSWNAPIGK.D----------G...------------------
C4L6I7_EXISA/94-169-------TNLEKM------------------------LEGKAPTV..N----------G...------------------
YOBL_BACSU/514-595-------TNLQLM------------------------KNGNAPYAK.D----------G...------------------
R6G1G6_9CLOT/481-566-------TNKELA------------------------LKGKSPYTV.D----------KNGI------------------
R5BMP6_9FIRM/156-232-------.NQERI------------------------SYGLSPINR.D----------G...------------------
R6YJH0_9BACT/81-157-------.NADLI------------------------GEGYPPRDS.N----------G...------------------
R5KIU8_9CLOT/284-360-------TNRELM------------------------AKGNSPFGI.D----------G...------------------
U5MY94_CLOSA/168-249-------NNKQLA------------------------QKGFAPYAN.D----------G...------------------
V5XPW9_ENTMU/418-494-------.NLQRM------------------------ELGLAPLGP.D----------D...------------------
I5AXJ5_EUBCE/328-406-------TNLQLM------------------------EKGKAPFDAVT----------G...------------------
C7N7K8_SLAHD/61-142-------TNLQLM------------------------EGGNAPIGN.D----------G...------------------
Q7N7K5_PHOLL/272-349-------TNVELM------------------------RAGRAPIGN.D----------G...------------------
Q8DV32_STRMU/147-222-------TNLERM------------------------ERGFAPIDE.S----------G...------------------

PF05315

J9R1X7_RIEAN/2-219-------------------------IDAIRLTGFNNSNTFNQSIRKEIKDFYKNKNCV----------------------
Q7VHB6_HELHP/4-221-------------------------IDAIRLKGFNTQKTFNQAIRKDIKDFYKNQNCV----------------------
F4HDL7_GALAU/5-226-------------------------VDAIRLNGFNKEASFNQAINVKIKNYYKDQCCV----------------------

PF03165

O15968_DROME/217-326-------------------------LLAVKSRLDPPTKTQRDVVEPTTTTAPTYLQCI----------------------
NFIA_MOUSE/91-195-------------------------VLTVT..GKKP...................PCC----------------------
Q9NH63_SCHMA/29-129-------------------------ERALVSQ.DPS..................TRCV----------------------
B4IKX2_DROSE/29-129-------------------------ERAISTQ.NCQ..................TRCV----------------------
Q8T8C9_HALRO/30-148-------------------------EAAVM.QQTSK..................TKCI----------------------
Q09631_CAEEL/112-215-------------------------ISAI..NGSEP..................NKCI----------------------
SMAD2_RAT/41-171-------------------------EKAITTQ.NCN..................TKCV----------------------
O57475_XENLA/39-131-------------------------LEAVESRGAAP..................GGCV----------------------
SMA3_CAEEL/28-134-------------------------ECVLA.NPCTN..................SRCI----------------------
SMAD6_CHICK/106-204-------------------------LQAVESRGGTP..................GGCV----------------------
O17532_CAEEL/145-246-------------------------IDVVLSKGTKY..................TGCI----------------------
SMAD6_MOUSE/173-271-------------------------LEAVESRGGVP..................GGCV----------------------
Q21733_CAEEL/36-132-------------------------YDAVI.KGDP..................KTRCC----------------------
Q9YHB1_XENLA/59-158-------------------------LQAVECKGGAR..................SPCL----------------------
SMA2_CAEEL/26-129-------------------------EFALRCQGQQK..................TECV----------------------
SMA4_CAEEL/168-268-------------------------ITAVTSNGKQP..................TGCV----------------------
SMAD9_HUMAN/34-135-------------------------ERALSCP.GQP..................SKCV----------------------
SMAD4_PIG/36-137-------------------------ITAITTNGAHP..................SKCV----------------------
SMAD7_HUMAN/92-202-------------------------LQAVESRGGTR..................TACL----------------------

PF14279

C1EJZ2_BACC3/4-72---------------------------------KNRV-----------------EFS....D------------------
A1SZ92_PSYIN/4-75---------------------------------KEFD-----------------TVNVRMHD------------------
D2ZR44_METSM/3-73---------------------------------KDKQ-----------------EEDFN..E------------------
C6CI95_DICZE/4-73---------------------------------RPLE-----------------GENVT..G------------------
Q636Z7_BACCZ/5-73---------------------------------NEFE-----------------KGS....E------------------
B2JC00_NOSP7/3-73---------------------------------QDKP-----------------NENFS..E------------------
C2W902_BACCE/4-67---------------------------------KETK-----------------ELS....E------------------
B5SI46_RALSL/7-76---------------------------------NILS-----------------AKNKT..K------------------
Q73LN7_TREDE/4-73---------------------------------NEIT-----------------EQNIT..I------------------
B6VX81_9BACE/8-77---------------------------------EELT-----------------DTNNS..D------------------
C3XCW2_OXAFO/4-84---------------------------------QEKD-----------------DDQFT..L------------------
A7C0Y7_9GAMM/4-72---------------------------------KLKS-----------------KFS....D------------------
A4J8Y0_DESRM/4-73---------------------------------KDID-----------------STNIT..N------------------
B1XMH2_SYNP2/4-84---------------------------------TDKN-----------------DDEFT..L------------------
A0A026XQU1_ECOLX/4-74---------------------------------EEKE-----------------VTSFG..E------------------

PF13391

Q3ZJ53_PSEAK/128-185--------------------------.........IQ.......................KK------------------
Q3ZJ54_PSEAK/137-183--------------------------......ALSNL.......................EC------------------
B0D1S8_LACBS/452-520--------------------------......ASSIE...................GL..EH------------------
D3DZU5_METRM/268-314--------------------------........GSK...................HL..EA------------------
A1ZMP4_9BACT/24-72--------------------------.......MTES....................L..DA------------------
A0JZY1_ARTS2/483-533--------------------------.......IPAP...................WC..EA------------------
B6QT68_PENMQ/172-253--------------------------......IENWA...................VL..EN------------------
C6H8C1_AJECH/170-261--------------------------............................SSIF..EV------------------
C0SHG6_PARBP/129-219--------------------------............................GEVF..EV------------------
C0NVL4_AJECG/128-219--------------------------.......ITLC.......................EA------------------
A1CN99_ASPCL/176-240--------------------------.......DYVP................IR.YV..TA------------------
B2WD78_PYRTR/182-246--------------------------.......QYEP................RT.AF..TA------------------
C0SG59_PARBP/145-228--------------------------.......IYDT........FTATNVEPQG.TL..AA------------------
Q7SBL2_NEUCR/148-212--------------------------.......LYQP.................VGLM..VA------------------
B8HI49_ARTCA/207-262--------------------------.......QSFP.................EELL..VA------------------
C5QBZ5_STAEP/274-329--------------------------.......KSLQ...................GL..TA------------------
D0MUB8_PHYIT/175-238--------------------------....LLDVAFP.................NSLV..IA------------------
A8ILS7_CHLRE/241-301--------------------------.......VQLP.................MTLV..TG------------------
A1ZEN4_9BACT/211-269--------------------------.......LNIQ.........VNPKVKRKISMV..EG------------------
B3R3B4_CUPTR/129-182--------------------------....LGLSAAL.......................RA------------------
C5A9D8_BURGB/190-242--------------------------.......CSVG.................T.LL..IA------------------
Q58AC3_RALME/314-368--------------------------.......VSTP.................A.VL..RA------------------
Q97AT3_THEVO/116-167--------------------------.......IDVD.................D.LL..VV------------------
Q2H3K5_CHAGB/194-260--------------------------......WTNAT.......................EA------------------
Q1Z8V3_PHOPR/45-99--------------------------.......VKYP...................AANCVA------------------
C9RJH3_FIBSS/236-289--------------------------.......CDNP.................E.LL..VA------------------
A6WRD3_SHEB8/155-207--------------------------.......I..S........A.......LV.TL..EA------------------
Q1LAG0_RALME/217-269--------------------------.......LGDP.................A.LL..CV------------------
Q8EUF0_MYCPE/252-316--------------------------.......VKLP.................E.LL..IA------------------
Q0HZ27_SHESR/183-234--------------------------.......VITR...................NL..IA------------------
A8RAR8_9FIRM/242-295--------------------------.......IRIP.................H.ML..IA------------------
C1A2C0_RHOE4/177-236--------------------------.......LSAN...........IGGRRRPRLL..TA------------------
D1QVC2_9BACT/149-200--------------------------.......IGTP..................SLL..EA------------------
B4RPU5_NEIG2/270-321--------------------------.......LAYP...................VL..IA------------------
A9M531_9VIBR/136-187--------------------------......ITQDD...................LL..IC------------------
A0YQ47_LYNSP/170-221--------------------------......EQNIR...................LL..EA------------------
C6SD53_NEIME/264-320--------------------------.......ITDE..................ILL..RA------------------
A5UCN4_HAEIE/226-278--------------------------.......ISDD..................RLL..IA------------------
B0P0S7_9CLOT/157-209--------------------------.......VRNP..................AFA..IA------------------
Q8XKY3_CLOPE/181-233--------------------------.......LAHK.................E.LL..IA------------------
C4Z3W1_EUBE2/283-335--------------------------.......ISTT..................SVL..RA------------------
Q6KH34_MYCMO/262-326--------------------------.......ISEK.................E.LL..VA------------------
B5JL75_9BACT/10-62--------------------------.......NPIP.................T.LL..TA------------------
D2MUA6_CAMJU/249-300--------------------------.......LKYP...................LL..VA------------------
A9M540_9VIBR/208-261--------------------------.......IGTK.................A.LL..VA------------------
C5TPE4_NEIFL/171-223--------------------------.......LDIE.................P.LL..IA------------------
B5ND07_SALET/226-278--------------------------.......IPYE..................FML..RA------------------
A0A017QNN2_SALET/161-214--------------------------.......TTFA.................P.LL..RA------------------
C7JF14_ACEP3/216-269--------------------------.......ITDP.................R.HL..TA------------------
B6ESV9_ALISL/277-329--------------------------......YKNTQ...................ML..VA------------------
A7HHG5_ANADF/218-270--------------------------.......VSNP.................A.YL..IA------------------
A3WLG5_9GAMM/162-214--------------------------.......ISLT..................GIL..KA------------------
Q2NS53_SODGM/141-193--------------------------......LKNIS...................FL..RA------------------
Q11XS6_CYTH3/195-247--------------------------.......FDKL.................N.LL..NA------------------
A6LR77_CLOB8/228-280--------------------------.......LNDE.................R.FL..IA------------------
D5SYQ3_PLAL2/147-198--------------------------.......VAGA.................E.LL..TA------------------
A3SEH6_9RHOB/147-198--------------------------.......IDDT.................R.LL..TA------------------
A3IFP0_9BACI/201-253--------------------------.......MNIP.................D.LL..VA------------------
B3E6K1_GEOLS/248-298--------------------------.......S..S.................L.FV..TA------------------
Q0YRR0_9CHLB/151-202--------------------------.......LQNS.................E.LL..IA------------------
D4L965_9FIRM/137-189--------------------------.......IDDS.................R.LL..LA------------------
D1NWA4_9BIFI/170-222--------------------------.......IDEP.................E.LL..IA------------------
A9VZD9_METEP/165-217--------------------------.......MRDR.................E.LL..RA------------------
A0A008B479_STAAU/218-269--------------------------.......IKTK.................D.FL..VV------------------
C7TDF7_LACRG/286-337--------------------------.......IHTR.................S.LL..IA------------------
C7RPH5_ACCPU/152-203--------------------------.......NPVA.................E.LL..VA------------------
D2QD13_SPILD/151-202--------------------------.......INIP.................E.ML..RA------------------
A4G160_HERAR/158-209--------------------------.......LAEP.................R.LL..VA------------------
A3XG80_LEEBM/154-205--------------------------.......LNID.................G.LL..VA------------------
C6H7Y4_AJECH/166-242--------------------------.......FEGP....................M..DA------------------
C5G0R2_ARTOC/156-239--------------------------.......SLHP....................V..DA------------------
D4DG81_TRIVH/144-227--------------------------.......AGRP....................I..EV------------------
D4AWU5_ARTBC/72-157--------------------------.......ADDP....................V..EA------------------
D4AWT1_ARTBC/153-252--------------------------.......LWDD....RSVERGLIIPNDHKALTTTET------------------
C6HSV2_AJECH/189-299--------------------------YQQDIKRSNQHGADARDDDGNLLSNEVTITSL..EV------------------
C4JTW4_UNCRE/156-261--------------------------ASQEVKRTDQHGLDAQDDVGNLLRDENRFEEL..KV------------------
C5FX47_ARTOC/172-283--------------------------VEAVKRYERDGVDSRDDEGRPLLDSKDSIEIL..EV------------------
C5GIN7_AJEDR/149-259--------------------------EEAAERVNRDRSNARDDDGQRLVYVPGQFSYL..QV------------------
C5FYU3_ARTOC/192-299--------------------------QFDVTEAINRGKRDPEPKDDENLPLAGPFTRI..EV------------------
C5PG06_COCP7/175-290--------------------------QALERLKQDPSNPKDDDGQQLIFAPGKLA.LL..EV------------------
A1DHZ4_NEOFI/144-238--------------------------..EYDVNLEDE............YPDEDTADL..ET------------------
C6HH53_AJECH/147-240--------------------------.......AHNE........DAHPPPDSLFAPL..ET------------------
C6HB07_AJECH/162-258--------------------------DINLWKNINRP.............SEVDHGDV..EA------------------
B6H206_PENCW/172-270--------------------------.......HFDQGRYEELGLDSPDLNPTDT.....QG------------------
B6HJB7_PENCW/110-203--------------------------.......LFDE.......DSLDASSTSPSTYT..DC------------------
C5FNT1_ARTOC/164-228--------------------------.......KMYH.................ASMF..RA------------------
D4D4G1_TRIVH/160-225--------------------------......WHVRQ...................YF..VA------------------
D4AWT5_ARTBC/163-226--------------------------.......TRRE.................RDEF..VA------------------
B0CQV9_LACBS/112-197--------------------------...YLYKADSE...................LF..IG------------------
B1VR35_STRGG/22-91--------------------------VITPGTDCDDP...................SVFGEE------------------
B0CUP6_LACBS/82-165--------------------------.......L..E.SYTWTQSRAA............HN------------------
C4JQB0_UNCRE/171-234--------------------------.....DWLEAR...................LV..KT------------------
C4JDN9_UNCRE/60-122--------------------------......WSDAT...................AV..TA------------------
B6HCX9_PENCW/194-295--------------------------AEETGLSYDIP.................AALT..EG------------------
A2QGH8_ASPNC/178-274--------------------------.......D..M.DVDKFCERGSPEGVISR.DL..EV------------------
A2QG51_ASPNC/197-280--------------------------.......ATDP....................L..HA------------------
B8P2J0_POSPM/349-413--------------------------.......QDDK...................SV..QG------------------
B8P2H7_POSPM/369-433--------------------------.......QDDK...................SI..QG------------------
B8PJ67_POSPM/96-161--------------------------.......FRDK...................SI..QC------------------
B8P061_POSPM/98-163--------------------------.......FKDK...................SI..QH------------------
B2WQ71_PYRTR/178-242--------------------------..........Y.................REEL..QV------------------
C7ZJS1_NECH7/14-80--------------------------......YLDAV.......................EV------------------
C7ZR37_NECH7/151-217--------------------------.......SSSP.................N.....ET------------------
Q0CEY0_ASPTN/158-237--------------------------..........T.PHPEG..EDW......G.GY..ES------------------
C7ZM78_NECH7/156-223--------------------------..........D...................AV..EF------------------
B6H0Z1_PENCW/209-303--------------------------..........A.YSHNHAHPQN...ALTT.HL..EA------------------
B0DGI4_LACBS/197-310--------------------------..........R.QDLSHPSPDPTSDFYPV.SL..EV------------------
B0DGX0_LACBS/22-98--------------------------..........Q.RF.....ATW......S.PL..RA------------------
B5JTG3_9GAMM/205-258--------------------------...TRLILPDE.................SVLV..EA------------------
C0NM18_AJECG/69-132--------------------------..........F...................SLCTKQ------------------
C0NFG2_AJECG/145-208--------------------------.......FSIC....................L..EE------------------
B0CU30_LACBS/126-203--------------------------..........E.L...VESGRY......H.PF..RT------------------
A1C9L4_ASPCL/21-95--------------------------....EIDIDAD................VGWWVGYEA------------------
C5FQP7_ARTOC/116-187--------------------------....RINVEAP.................INWTTYEA------------------
A1CHP5_ASPCL/119-193--------------------------....QINRTAE................HDIWVGFDA------------------
C1ME87_9ENTR/110-159--------------------------....VKTKCRG.......................EA------------------
D4D3B7_TRIVH/114-186--------------------------..........K.VNRSSGVGVW......R.GF..EA------------------
C5FLW1_ARTOC/116-189--------------------------.......FMNR.............EIKDDRWIGFET------------------
C5FGM1_ARTOC/115-187--------------------------..........A.IAMDAEDDYW......S.GF..EA------------------
A0A031MZ15_ECOLX/108-157--------------------------....VRGRQRT.......................EA------------------
L3VWH1_ECOLX/324-373--------------------------....SRLRQRT.......................EA------------------
B2VKG6_ERWT9/66-115--------------------------.......ASLR.................C.IT..EA------------------
E4NRW0_HALBP/214-265--------------------------.......VDHP.................G.LL..DV------------------
Q18I98_HALWD/210-261--------------------------.......IENS.................A.LL..TI------------------
E4NSD1_HALBP/243-294--------------------------.......IRED.................E.LL..DL------------------
C7ZR46_NECH7/227-313--------------------------....RSWCPAP...............SFGPAL..QA------------------
C7ZLG5_NECH7/248-329--------------------------..KGRSWYMNP.................TVGLGVQA------------------
B8G8J9_CHLAD/36-82--------------------------..............................CQ..VD------------------
A0A034USF7_ERWAM/216-274--------------------------..........T...................QL..TD------------------
E7FSP2_9LACO/263-324--------------------------.......CDVP.................Q.II..EG------------------
D0FXK4_ERWPE/274-335--------------------------.......CDIP.................Q.II..QG------------------
F3RA44_LISMN/276-338--------------------------.......CEIP.................E.LI..EG------------------
B9MGY9_ACIET/216-265--------------------------.......VQLA...................LI..DA------------------
B8F0E2_THASP/225-279--------------------------.....EGLKSP.................AGATEVEA------------------
A9B5H7_HERA2/140-196--------------------------.......IRLQ...............IGQDKFYAEC------------------
D7VSZ6_9SPHI/197-252--------------------------.......ITIA................VHNVKYAEG------------------
Q82H00_STRAW/418-471--------------------------.....TKIEFP................AQPFSYSEG------------------
D4GVR6_HALVD/183-239--------------------------.ERRRRGVHDG...................YA..EA------------------
C6WB78_ACTMD/145-200--------------------------.......TRLD................LGYGHFSNA------------------
D9TEC7_MICAI/400-455--------------------------.......VRLA................TRDGYYSEA------------------
Q9RU61_DEIRA/197-252--------------------------.....ERLETP................AGAYA..EA------------------
Q82CY5_STRAW/72-128--------------------------.LRLVGPDGRP...................YS..EG------------------
Q2S547_SALRD/185-241--------------------------.......FNLQ.............LGMSGTPIGVEA------------------
A6TQ34_ALKMQ/175-229--------------------------.......FNVR...............LGNNLIAVEA------------------
C1HR67_9ESCH/182-236--------------------------.....YDLRLD.................GALVGIEA------------------
C5C731_MICLC/57-112--------------------------....EYLAGGP...............GVSSGI..EA------------------
D2RPV1_HALTV/388-442--------------------------.....ASRESP.................AGTVDIEA------------------
D6SU17_9DELT/210-264--------------------------.....IRMLTP...............EGHTIV..EA------------------
Q2S548_SALRD/164-218--------------------------....VRILTVD................HHTAV..DA------------------
A9AVZ1_HERA2/214-268--------------------------...................IRVITPEGRS.AA..EA------------------
C5FYU4_ARTOC/144-210--------------------------......HTEGT.......................EH------------------
Q89W12_BRADU/199-250--------------------------.......LPEP.................L.LL..DA------------------
Q1DFJ6_MYXXD/230-280--------------------------.......FPRP.................E.LL..DA------------------
B1MFU6_MYCA9/186-236--------------------------.......LRHG.................K.LL..DA------------------
C2IA18_VIBCL/139-188--------------------------.......ISEK.................S.LL..RA------------------
B6H8R8_PENCW/114-188--------------------------..........V.VNNGASEGMWT.......GF..EA------------------
C6HTE9_AJECH/70-135--------------------------.......IWAP....................F..EA------------------
C5P1V7_COCP7/116-194--------------------------..........I.VNVRAPWNTW......S.GF..EA------------------
C6H7P6_AJECH/116-190--------------------------....LVNLLAP.................HRWTGFEA------------------
C6HCT2_AJECH/118-196--------------------------..........Q.VNPSAQWDDW......A.GL..EA------------------
E3J488_FRASU/374-423--------------------------.......VQPP..................DAI..EA------------------
Q0TBE0_ECOL5/325-374--------------------------.......ASIS..................EVL..QA------------------
A4JVB2_BURVG/309-359--------------------------.......CAIP.................E.AL..EA------------------
C5PCJ2_COCP7/131-211--------------------------.......MRNP...........LADLGRYTGL..EV------------------
B6GYF4_PENCW/145-225--------------------------.QARTIDIEHP.................FRGL..GA------------------
D4LVH2_9FIRM/326-375--------------------------.......VTMP.................E.VL..EA------------------
Q8YML8_NOSS1/205-259--------------------------.......LRVT.............KAINQNIV..DG------------------
A3X6R6_9RHOB/193-247--------------------------....LRLINGG................GRAEV..EA------------------
D0KA46_PECWW/207-263--------------------------....APKIKDS.................L.YV..QA------------------
A4WEB7_ENT38/177-224--------------------------.......CTLA....................L..EA------------------
C6DI05_PECCP/215-264--------------------------.......TDIL.................E.TL..EA------------------
A1WU45_HALHL/154-210--------------------------.RKFISPVGDN...................VLGLDA------------------
D5URV1_TSUPD/190-239--------------------------.......CAVE..................AAV..EA------------------
C2H6L1_ENTFL/305-363--------------------------.......CDAE................GTLFI..QA------------------
D2NQL0_ROTMD/260-309--------------------------......ACHTA...................AL..DA------------------
C6WN85_ACTMD/211-260--------------------------......KCPAE...................AL..QA------------------
Q5KQA0_CRYNJ/196-257--------------------------.......AHWE...................SC..TA------------------
D0FXE6_ERWPE/297-346--------------------------.......QKIG..................ALL..QA------------------
C1MEC3_9ENTR/183-232--------------------------.....KHLN......................GVLEA------------------
B5XX93_KLEP3/359-407--------------------------............................ASIIRCEA------------------
Q82H23_STRAW/235-284--------------------------.......IAVP.................E.MI..EA------------------
D5UBZ3_CELFN/122-171--------------------------.......IPVK.................E.VL..DA------------------
A6UKM8_SINMW/8-59--------------------------.......FAVA..................EVL..EA------------------
D2B5N9_STRRD/214-263--------------------------......SRILP...................AL..QA------------------
B2FKB8_STRMK/193-242--------------------------.......TALA..................SVI..DA------------------
C5CHS9_KOSOT/197-246--------------------------.......EDYP.................L.VL..EA------------------
A7ZNC8_ECO24/319-367--------------------------......WQNGE...................RL..QA------------------
A4NNK4_HAEIF/325-374--------------------------......NMLTR...................VL..QA------------------
A4E9S5_9ACTN/247-296--------------------------.......VSEA....................L..EA------------------
M7P179_KLEPN/397-443--------------------------..........E...................AL..EA------------------
B4UFQ3_ANASK/203-252--------------------------......EHSLP...................VL..EA------------------
A4V6X0_PSEFS/373-422--------------------------.......CKVD.................T.LL..EA------------------
C8S3P5_9RHOB/198-247--------------------------.......CTVR..................DAL..EA------------------
E8YPK5_9BURK/129-178--------------------------......STVTP...................LL..EA------------------
D1P2G2_9ENTR/241-290--------------------------......SKIIE...................LL..EA------------------
B1XPM9_SYNP2/314-363--------------------------.......CDAE..................PAI..EA------------------
B0RXA4_XANCB/309-358--------------------------.......CSAK.................E.VL..EA------------------

PF13930

D0LUR7_HALO1/91-222PSKAYA..YLP..PA.I..T......EARNSSCQASV..GQWG....D.AAN...PGTDYDG------------------
B0UVC7_HISS2/2603-2730VEEVKG..RLK..L..E..V......NDRNRYQQAIT..GG......E.C.....RLESDCG------------------
YEEF_BACSU/525-655ITSVKA..DLQ..L..G..E......AKRNQYAQTNA..GK........PQD...RKPDDDG------------------
A8FDL6_BACP2/98-224IVKVEA..SDL..KY.G..E......IKRNQYAQSNS..GK.........PD...RLLDDDG------------------
Q7N913_PHOLL/198-325PVHIET..SLH..L..S..K......NDRNTYQQCKA..GKCG........N...PGD..EG------------------
A8FDL4_BACP2/498-628IVKVQA..SDL..KY.G..E......VKRNQYAQSNS..GK.........PD...RLLDDDG------------------
Q9K6M4_BACHD/424-550ITHVEG..DLS..L..G..A......AKRNNYAQRNV..EG.........KN...PGD..DG------------------
Q5WJ65_BACSK/469-594LTDFNA.DDLK..LT.K..R......DNRLSHKSNTP..GK..........E...PG..DHA------------------
Q21NY0_SACD2/315-455VVRVQG..SLA..LS.IAKT......PKDRDKNHRNP..RTQR....K.YGG...PVKEYDG------------------
C0R0R8_BRAHW/45-173IYKVIR..KEN..LILS..N......AKRNNYAQRKV..VELY....G.IKD......HDQG------------------
D2QLJ8_SPILD/282-421VSKITV.EDLQ..TN.Q..A......RPRNTYQQQKA..KDIK....D.GKTTDSIDPTDDG------------------
D6S5M6_9LACO/124-258ATSANA..LLNISLM.P..K......AKREPLHVNPT..GWHN....K.RIS...GGWLYNR------------------
B0RGD0_CLAMS/624-751IDRVII.QDLQ..LK.T..H......EGRLPHQRNPV..GK...............LQGDHA------------------
Q74IV6_LACJO/120-254VTAANA..LLNSSLM.P..K......TKREPLHVNPT..GWHN....K.KIN...DHWLYNR------------------
Q1G8G9_LACDA/127-261ATMANA..MLNQSLM.P..T......AKREPLHWDPT..GWHN....K.RIS...SGWLYNR------------------
Q03WR4_LEUMM/85-232PQVANG..LLN..QK.L..MPPSQKYQARERLTIKTPGYHAIK....TGTNN...TEWLYNR------------------
C2X0R6_BACCE/409-538IERASG..ELT..L..E..M......GERNSKHQLAA..GGEE....R.VKA..PSTQGDHG------------------
Q5FK46_LACAC/120-251VTSANA..LLNESLM.P..N......SPREALHVDPT..GWHN....K.RIP...RGWLYNR------------------
Q835Q6_ENTFA/75-202ATGADA..LLK..PA.MVNT......GTSANKDIRPA..GFIS....G.KA.......NHSR------------------
R5U617_9FIRM/67-203CQAAYANICQE..IM.P..T......QERGKIGMIKP..SGWHTVKYD.CVD...GKYLYNR------------------
T0UB90_9ENTE/93-224ATSAEA..MLNQSLM.P..T......EKRGDISSVTP..TGWH....NKKLK...KGYLYNR------------------

PF06147

A7MHN7_CROS8/117-334TLPELCWWAVRMDITDALPDSVARRALRLPPLPVQGVSR...ESDMVPG.PSAAEIVQTKAQRAGAVKTLVNCDELQEQQ
A3MZM0_ACTP2/134-333NLGCLLAWAIAKNCVSAIDESDLRRLLNLPQKEVPDHR....ESTTYAAEQADPHKIFKTLA..................
Q7ME22_VIBVY/140-345TMPELCWWAVRNKVYHALPHDLLSKIFEEEKTRRRVGGRGYIDTNARYI.QQDSREVLENLA..................
M9X5K0_PASHA/139-336EFADLVLFASIKGLLDELDSNALQQFLGYPPLNNSGVSK...ESNIGFDDVPNARANLKKWA..................

PF01223

Q95TI9_DROME/65-324.EEVTRYTRHKL.............EPGSNYYE.TGV..........ARI......TF--QT------------------
E7S4P9_STRAG/86-283NQIVPTKANALL.............TKATRQYRNREETG........NGRTYWKPAGW--HQ------------------
Q7NPI0_GLOVI/39-265.DKIPNWVSWQL.............NSSWLGSAS.............RQN......DF--RP------------------
Q8A1U5_BACTN/46-275.KKHARWVAFKY.............YNVTGQTNWN...RNDWKQTEWGGD......PW--QS------------------
Q8KGT7_RHILI/434-688.RRMQMWSAVNV.............DYDASKRTS.............SGRAFFGQDRW--VF------------------
Q7QK21_ANOGA/167-356.TYDNHYLVHEF.............TPANAGFQ.TGV..........PRP......GW--IQ------------------
Q8I9M9_PARCM/131-389.SETTLRTEHVL.............HGANIAAKDIET..........SRP......SF--KT------------------
Q26707_9TRYP/117-408.RRIPNWVLEYIPGTTTAADSVVTADNDLVNASAAEAQR........DGM......RF--FA------------------
Q8IPZ0_DROME/71-300.NRVAHWVCEHL.............QADSIHPNRG.R.R........GRN......PY--QP------------------
Q7QH21_ANOGA/177-440.NLRTHYTKHRL.............TPHNDHHQ.RAV..........KRP......SF--LQ------------------
NUCA_NOSS1/42-263.KGTANWVAWQL.............NSSWLGNAE.............RQD......NF--RP------------------
Q9VGU3_DROME/132-362.NRIAHWVCEHV.............KSGCVQERDEKTLN........KPN......AY--IT------------------
Q8YKN2_NOSS1/41-276.RGTPNWVSWQL.............NQSWLGSAP.............RQD......DF--RA------------------
Q6TRY8_CULQU/109-345.TCSVSHVKHRL.............LGASFGGVSG............TRE......KS--FQ------------------
Q9VU22_DROME/1089-1351.SEVTRYVHHVL.............YPGSDQYQ.RSV..........SRP......SF--IP------------------
Q7NI85_GLOVI/113-335.KGIPNWASWQL.............NRSWLGRTD.............RQN......DF--RP------------------
Q8RE47_FUSNN/335-559.RGLAYFTAVNI.............DGTDAVKIR.............RTA.....DNW--KF------------------
Q9ZJL1_HELPJ/54-273.LKNPIYGVSVL.............FGDLVDKNNIE...........KRY......EF--KP------------------
A9QSL0_LACLK/41-258ALGRAVDSHIQL.............KDSQEPKVK.............REPLTYNPVGW--HN------------------
NUC1_CUNEE/3-231.DRVASWTGEHL.............TADSLKTGDGVD.R........DHS......KF--KE------------------
A0A031RVU6_SERMA/25-246.TKFANWVAYHI.............TKDTPASG..............KTR......NW--KT------------------
NUCG_MOUSE/57-282.TRGALWVLEQL.............RPERLR.GDG.D.R........SAC......DF--RE------------------
Q9AAQ2_CAUCR/422-665.LKLPAATAVNI.............DGKQPVRIK.............RGD.....DKW--FV------------------
Q9VVV1_DROME/147-406.EEVTRYVYHRL.............EPGNNYYA.TGV..........DRI......TF--GA------------------
PNU1_SCHPO/59-291.TRNPFYTAETI.............TQESLNQRKG.N.R........RYS......EF--VP------------------
Q7PZ31_ANOGA/114-367.TASVLFTRHMI.............RGSAINYAITDT..........NRT......SF--KT------------------
C6IP62_9BACE/145-363.QKSSRWVAFTF.............NTSTPDNNVG............RAG......DF--SD------------------
Q7PVB8_ANOGA/98-351.TASVIYTRHII.............PGAAISHSISES..........YRP......SF--KT------------------
A0A029S9H5_STRPY/60-262SLGRTLTVRGTL.............TFNNVLGSYNIRKDF.......KRSKAETLSGW--LG------------------
Q9VAU2_DROME/106-358....SLAFQHSI.............YKAYRYVNTVPR..........PNP......TW--QS------------------
A0A029S6E3_STRPY/70-270ELGRTRTARGTL.............TYANVEGSYGVRQ.........SFGKNQNPAGW--TG------------------
Q8RLY2_SALET/51-274.TKFANWVAYSV.............TKTSQASG..............RPR......NW--AQ------------------
NUC1_YEAST/55-290.TQNPYWVLEHI.............TPESLAARNA.D.R........KNS......FF--KE------------------
E9DD73_COCPS/73-305.TRNPSWVAEHI.............TPESLKLNNA.D.R........KHS......VF--YE------------------
Q8DFB3_VIBVU/21-232.TKNADWVAYHI.............TAESVNASYK............RSN......SF--KE------------------
O33735_STRPY/73-293GYGRSGEAYGII.............TKDMIDMSAGYRE.........KWESKPEPSGW--YS------------------
Q9I417_PSEAE/377-604.RRLPILTAVNI.............DGALKRSLK.............RKD......SW--GF------------------
Q7Q2Q3_ANOGA/93-346.TASAIYTKHVI.............HGDSIADSIVES..........YRP......SF--KV------------------
O73911_CHICK/38-276.RRIPVYSAYLY.............QPGPGT................RPK......TW--LV------------------
Q8K6B9_STRP3/69-287GYKRSTGAYGVV.............TKDMIDMSKGYRE.........KWETNPEPSGW--FR------------------
Q7RY75_NEUCR/71-303.TKNPHWTVEHI.............TPESLSMSEG.D.R........KKS......TF--VE------------------
B0RUP9_XANCB/8-230.NRTALRYEYTL.............TADTGSAA..............RPS......SF--FL------------------
A5M2Y5_STREE/74-272KETVPTVANALL.............SKATRQYKNRKETG........NGSTSWTPPGW--HQ------------------
Q8Y1E6_RALSO/63-274.TMTPLYVAERL.............NAAQVARAREER..........RTN......RF--FA------------------
Q8PFE6_XANAC/65-274.TKDPAYSAEHL.............TDQQVAGAEAIG..........RVG......SF--HD------------------
Q9VAU3_DROME/102-344.AVRAIFVEHRV.............YGKPFYITRPCV...................QF--SS------------------
Q8TKR8_METAC/401-625.RRLAFYTAANI.............DGKKLKKIK.............RDR.....DKW--YF------------------
EXOG_MOUSE/58-287.KRVPRWVLEHI.............SKDKIIGDAD...R........KHC......KF--KP------------------
Q9VU24_DROME/166-420.QLRTHYAHHQL.............TPANVHFQ.KKL..........KRP......RF--ST------------------
C0X3R4_ENTFL/87-279SLNRTTFVTAYL.............DRKNLGRSEG............RERQVWQPTGW--HQ------------------
M9N460_ASHG1/44-272.MRNPYWVVEHV.............TAQSLATKNG.S.R........KNS......IF--KE------------------
F3IR03_PSESL/68-291.RRLALYVGVNI.............DGASSVEVK.............RGK.....DAW--SF------------------
C6IET4_9BACE/64-276.LKIPNWVSYEL.............TRQETKGKEK............RGD......NF--IA------------------
NUC1_SYNRA/71-306.DRLAHWVGEHL.............TSASLQAGQGVD.R........DKS......NF--QE------------------
Q9U5L8_PENJP/126-384.AETTLYSEHVL.............HGANIAAKDIDS..........SRP......SF--KS------------------
NUCG_CAEEL/65-293.TRTAHWVCEHL.............TPERLKHAEGVD.R........KLC......EF--KP------------------
Q7USW1_RHOBA/592-846.RRLAYFTAVNI.............DGEKLIRI..............RSGDDGGSASW--SE------------------
Y4FB_RHISN/398-641KRKMAFYTAVNI.............DGARWTNLE.............RGN.....DVW--FY------------------

PF14414

D0W6H7_NEILA/149-191-------------------------KGKDKIPGY----------------------TW--HH------------------
B1J8X4_PSEPW/63-111-------------------------NQKTTPIGH----------------------GW--HH------------------
B3PHU6_CELJU/392-431-------------------------TTNLRSGKW----------------------TW--HH------------------
D3L0R9_9BACT/153-195-------------------------GKNPKGLGF----------------------VV--HH------------------
B5GPR2_STRC2/109-151-------------------------PAVATPHGW----------------------TW--HH------------------
Q1QCA3_PSYCK/161-203-------------------------ANWRKENGY----------------------TW--HE------------------
E5C6Z5_9BACE/106-153-------------------------KKGKLPQCK----------------------TM--HH------------------
A5Z4R4_9FIRM/339-381-------------------------SNYGKPNGY----------------------TW--HH------------------
A0A011WJ18_BACTI/19-61-------------------------KLGKKPKSV----------------------TW--HH------------------
B8I221_CLOCE/239-288-------------------------ERKSIKENY----------------------TW--HH------------------
A3IE28_9BACI/350-392-------------------------KKYREKNKL----------------------TW--HE------------------
B3Z4D8_BACCE/173-215-------------------------RAMVENGSY----------------------TW--HH------------------
E1S5U4_HELP9/196-239-------------------------AKGFIPRGY----------------------LW--HF------------------
D4DXP2_SEROD/85-134-------------------------TGRSHPTDY----------------------TW--HH------------------
B2Q7F2_PROST/252-300-------------------------TPMLDGERY----------------------LW--HH------------------
B4EP57_BURCJ/1370-1412-------------------------GSPADYTKN----------------------TW--HH------------------
C2UG56_BACCE/26-68-------------------------PNGPKLDEN----------------------TW--HH------------------
Q3IK23_PSEHT/156-198-------------------------KNGDKPEGF----------------------TW--HH------------------
H2GD98_CORD2/1209-1251-------------------------RRYRKEHGL----------------------VW--HH------------------
B6BJ56_SULGG/129-173-------------------------YIGKNPEGY----------------------TW--HH------------------
C9PRI4_9PAST/124-168-------------------------QGRPNIDGF----------------------TW--HH------------------
D0W666_NEILA/32-76-------------------------AGNEKIPSY----------------------TW--HH------------------
B7HC27_BACC4/136-177-------------------------DGLPRIDGL----------------------IW--HH------------------
A6CCT8_9PLAN/400-442-------------------------GGKKNIDGL----------------------TW--HH------------------
A9AVI8_HERA2/3027-3069-------------------------GYTVRPSGY----------------------TW--HH------------------
A5Z4R0_9FIRM/19-65-------------------------KGSKPPKGY----------------------TW--HH------------------
A8RX43_CLOBW/197-243-------------------------EEGRTPTGY----------------------VW--HH------------------
Q7MZK5_PHOLL/1371-1416-------------------------FRGTSPKNM----------------------TW--HH------------------
A4JB11_BURVG/1495-1544-------------------------YKSSAPPGF----------------------SW--HH------------------
C2LFQ4_PROMI/165-214-------------------------PRRSPLPEL----------------------TW--HH------------------
C6MAI9_NEISI/47-95-------------------------GKGKNKQGL----------------------TW--HH------------------
A3KB10_9RHOB/227-274-------------------------DNWTRPEGY----------------------TW--HH------------------
A0A011SXZ9_VIBPH/1318-1364-------------------------ITKYDKSKY----------------------VW--HH------------------
D2YA40_VIBMI/1355-1403-------------------------APRRPPEGF----------------------TW--HH------------------

PF14410

B9M483_GEODF/74-140-RLTRVWAC...-------------EDCKQPVLY.............E--------GV--QI------------------
B2JXD4_BURP8/2948-3016-STDGTKAC...-------------PTCGKDVTVAPGQGA.......R--------DW--DV------------------
A4LGH9_BURPE/147-215-SQSNTKAC...-------------PTCGKDVTVPPGQGR.......R--------DW--DV------------------
B9LCH9_CHLSY/270-334-NEEGEMIC...-------------PTCGRTM...............T--------KP--DL------------------
C2RQE1_BACCE/43-125-NASGKMIC...-------------PTCGKDIPGSITINTKNGPVKRI--------GY--DL------------------
C8NB27_9GAMM/65-134-QPDGSYKG...-------------.QKGEIIN..............G--------PF--DI------------------
A7JRY2_PASHA/3122-3192-LPNGNYRN...-------------KLTRQEIE..............Q--------PI--DI------------------
E2P5A9_PASHA/3105-3174-LPNGNYRD...-------------.LDGNIIK..............G--------PI--DI------------------
F1WWY7_MORCA/195-265-LPNGNYQH...-------------KDTREIVI..............S--------PT--QY------------------
F1WTR8_MORCA/82-151-LPNGDYVH...-------------.RDGTVVR..............T--------PV--QY------------------
D3A0M0_NEIMU/642-712-LPNGSYMN...-------------KDTFEVVK..............P--------PI--HI------------------
D6ZD49_SEGRD/415-489-DSTGKYYV.DA-------------EGRKYPVD..............P--------VW--HY------------------
D6ZB38_SEGRD/420-491-TDNGKYYQ.GA-------------DGTLYPVN..............T--------QI--HI------------------
B8I219_CLOCE/1270-1339-GANGTFFD...-------------ANTLLPIE..............G--------TP--DI------------------
E4NNI9_HALBP/322-399-GIDDKVRD...-------------PNTEEVLTWDKDRGRG......E--------QW--HM------------------
E4NLC7_HALBP/333-403-GPNGVVFC...-------------AVDEVPLDR.............D--------EW--CM------------------
D4YN65_9MICO/242-321-EKDEIYVI.DV-------------DGNWRSVKWKPGQSRG......G--------KW--DM------------------
D7JC47_9BACT/1-57-MDVLGLRC...-------------......................K--------KI--VI------------------
Q48JD7_PSE14/299-370-SPDGIVRD...-------------PLLEKPMKFD............E--------PW--DM------------------
D4FSV7_STROR/39-110-DEQGVVKD...-------------PITKKVMDIE............E--------PW--DM------------------
A5Z849_9FIRM/221-292-SPDGIVHD...-------------PKTGRPMSKD............E--------PW--DM------------------
M1UI10_BACIU/451-522-DSTGSVKD...-------------PLTKQVMKKD............E--------PW--DM------------------
Q0BGH2_BURCM/476-547-SPDGKVRD...-------------PMTEKEMNPD............D--------PW--DM------------------
Q7W1H8_BORPA/221-292-SKDGVVRD...-------------PVSGKKMKKD............E--------PW--DM------------------
A9I1F1_BORPD/290-361-GKDGQVRD...-------------PVTKKTMRKD............E--------PW--DM------------------
C4ZDS7_EUBR3/27-110-RMLKVLMD..W-------------LEIQIQVRLLIGHQENLE.KGYG--------VW--DM------------------
C5BZG6_BEUC1/289-366-GPDGVVRD...-------------PNTGDVIDWTPGTPRR......D--------VW--DM------------------
Q63EY8_BACCZ/261-339-GPDGLVRD..P-------------LYPEKIIEWKPGQPRK......N--------VW--DM------------------
A0A023MBG2_LACPN/545-622-VKDGVLID...-------------RNTKQVIHWKPGQPRK......G--------KV--DF------------------
A9VI39_BACWK/230-307-DPDGILRD...-------------PNTSEVLDWKPGQARK......N--------KV--DF------------------
D4FSW1_STROR/66-143-DPDGVLRD...-------------LNTGEIIEWKPGQPRK......G--------AV--DF------------------
C2R1N3_BACCE/87-164-DPDGILRD...-------------PNTSETIDWKPGRPRK......G--------KV--DF------------------
E4NKW7_HALBP/189-266-DEDGNVYD...-------------PNTGERLEWDRGEPRE......G--------QW--DM------------------
Q97IK0_CLOAB/300-377-DIDGKVYD...-------------PNTGEELSWDTSKSRA......G--------QW--DM------------------
F2H4N8_BACTU/235-311-SIDGKVYD...-------------.PSGVEIIWDKSKTRS......G--------QW--DM------------------
C2ZCH4_BACCE/166-242-SIDGKVYD...-------------.PSGVEIIWDKSKRRS......G--------QW--DM------------------
B0KTG5_PSEPG/321-389-KHAGKVMT...-------------.ADGDKVYRND...........P--------RL--TI------------------
D8NE31_RALSL/1447-1516-EGDGRKVL.GA-------------DGEWYPI...............D--------QT--DM------------------
D3A8Q2_NEISU/281-354-PSSAQFWD.TP-------------TKSWQPV...............R--------SA--HM------------------
D2ZY29_NEIMU/317-390-PRSAQFWD.AP-------------TKSWQPV...............R--------SA--HM------------------
D1QWB6_9BACT/59-130-NGKKQFKS.KK-------------DGKWYDI...............D--------KA--DM------------------
D2ZY17_NEIMU/1290-1360-IPEGAVFK.DV-------------DGKKYSL...............R--------NA--HM------------------
D7NAI5_9BACT/60-127-RGEKQFWD...-------------GQRWRNI...............K--------EA--DM------------------
B4E5I3_BURCJ/270-339-PFTGEKEF.EY-------------KGNWYPL...............K--------DA--DM------------------
C3G567_BACTU/455-525-TVRGKTEFLDG-------------NNKWRPL...............S--------EA--DM------------------
B3Z4D6_BACCE/80-150-TVRGKTEFLDG-------------NNKWRPL...............S--------EA--DM------------------
C3BVM6_9BACI/30-100-TRDGEIEFMAS-------------DNKWYPI...............D--------QA--DM------------------
C2X0R2_BACCE/45-115-TRDGEIEFMAS-------------DNKWYPI...............D--------QA--DM------------------
C2LJS8_PROMI/56-126-DVNGQTIFKAS-------------DGNWYPL...............R--------EA--DM------------------
D0KGF8_PECWW/1348-1417-VGEDTIFQ.AS-------------DGRWHPL...............A--------DA--DM------------------
D7HX78_PSESS/176-245-EGARMRFK.SK-------------DEKWYPI...............K--------EA--DM------------------

PF05766

A4G7D7_HERAR/8-194...VELDNLKKA-------------AKREQEERAAHRVKKQAAKKHGEWEGDLQKLVN--K-------------------
Q4KA59_PSEF5/8-195.....VNQEKAR-------------KSLAQVQRQEIKVRKERLKTRADHLREAQAVFN--E-------------------
Q8ZMY3_SALTY/1-203REAAQRKAQSLQ-------------RAAEKKERAAWRQRKAAVKPLKHWIDLTQRAVN--D-------------------
B0USX4_HISS2/3-190M.ALVKSQEKEK-------------IKREKEERAKIKAVKERLKSRSERLKELQGVFN--R-------------------
M9WYN9_PASHA/4-187.....RKTEAKR-------------KKSAKIDRLEQRKRLEKLKSRRDFEKDLQKIFN--K-------------------
NING_LAMBD/2-198...AEKAAEKKR-------------RREEQKQKDKLKIRKLALKPRSYWIKQAQQAVN--A-------------------
Q7CID4_YERPE/3-199RQNRIQKTEQRR-------------REETQAERRSLKIRKLAVKPLSYFAKQAQQAFN--E-------------------

PF16784

Q03RB7_LACBA/20-217LGEIDQWTGNFT-------------MDITERQMKQLFISEKGLDEEFSFSDCSLKLAS--E-------------------
Q2FUP5_STAA8/21-220CRDIELHWGE.P-------------VESTRKLLQTELEIMKGYEE.ISLRDCSMKVAR--E-------------------

PF13392

C7QT14_CYAP0/194-244------......-------------RT----V-------------------------I--H.------------------
A0A026EEZ3_ECO57/59-105------......-------------LY----E-------------------------V--H.------------------
C3QU81_9BACE/58-104------......-------------.E----C-------------------------I--R.------------------
A7K8I5_9PHYC/225-274------......-------------.D----I-------------------------I--L.------------------
A7ITH3_PBCVM/254-303------......-------------.E----N-------------------------V--L.------------------
A7J8G9_PBCVF/235-284------......-------------.E----M-------------------------V--L.------------------
A7J6P1_PBCVF/231-280------......-------------.E----M-------------------------V--L.------------------
A7IWP5_PBCVN/225-274------......-------------.E----L-------------------------V--R.------------------
A7RBV7_PBCVA/231-280------......-------------.E----I-------------------------I--R.------------------
A7K8W0_9PHYC/231-280------......-------------.M----M-------------------------V--L.------------------
A7IWX1_PBCVN/283-332------......-------------.E----M-------------------------V--L.------------------
A7IW93_PBCVN/277-326------......-------------.E----M-------------------------V--L.------------------
A7RCQ9_PBCVA/277-326------......-------------.D----M-------------------------V--L.------------------
A7IVT6_PBCVN/276-325------......-------------.E----M-------------------------V--L.------------------
A7RBJ5_PBCVA/282-331------......-------------.E----M-------------------------V--L.------------------
A7IW48_PBCVN/71-118------......-------------.Y----H-------------------------A--D.------------------
Q56C21_9CAUD/55-98------......-------------.D----M-------------------------I--D.------------------
Q56BD9_9CAUD/58-104------......-------------PY----V-------------------------I--D.------------------
Q4TZV2_9CAUD/72-115------......-------------.L----V-------------------------V--D.------------------
B1ZU98_OPITP/143-188------......-------------.H----Q-------------------------V--T.------------------
B9EBP9_MACCJ/89-134------......-------------.Y----V-------------------------V--S.------------------
C4GFQ4_9NEIS/59-100------......-------------.Y----V-------------------------V--L.------------------
C8P900_9LACO/34-80------......-------------.M----I-------------------------I--I.------------------
D0DHI8_9LACO/69-115------......-------------.Q----I-------------------------V--I.------------------
D4FMY2_STAEP/121-166------......-------------.Y----C-------------------------L--I.------------------
Q6V7S9_9CAUD/61-107------......-------------.F----E-------------------------I--N.------------------
A2I7W9_9CAUD/55-100------......-------------.Y----E-------------------------I--E.------------------
C7N6R6_SLAHD/162-208------......-------------.C----A-------------------------I--V.------------------
A4NIF9_HAEIF/148-193------......-------------.H----I-------------------------I--D.------------------
A0JQK4_LACS1/121-166------......-------------.Y----I-------------------------I--T.------------------
Q8DFY6_VIBVU/126-171------......-------------.M----I-------------------------L--R.------------------
C4ZC58_EUBR3/189-234------......-------------.K----M-------------------------V--S.------------------
C6IF55_9BACE/173-218------......-------------.Y----N-------------------------I--Q.------------------
B1JD21_PSEPW/105-150------......-------------.M----V-------------------------V--A.------------------
Q87Y63_PSESM/75-120------......-------------.H----I-------------------------V--A.------------------
A1RL04_SHESW/183-228------......-------------.H----K-------------------------I--W.------------------
B6XKN8_9ENTR/115-160------......-------------.H----V-------------------------I--K.------------------
C5F4D1_LACPA/110-155------......-------------.Y----K-------------------------T--V.------------------
A0A031ABV7_PSEAI/156-201------......-------------.H----C-------------------------V--C.------------------
A3WSR8_9BRAD/121-165------......-------------.Y----F-------------------------L--K.------------------
B2FM68_STRMK/151-200------......-------------.H----I-------------------------V--V.------------------
A4JMG5_BURVG/144-193------......-------------.H----V-------------------------V--C.------------------
Q15Y23_PSEA6/178-223------......-------------.M----V-------------------------V--I.------------------
A0A021B9T1_STAAU/98-143------......-------------.H----A-------------------------V--I.------------------
A6F4T8_9ALTE/122-168------......-------------.H----I-------------------------V--R.------------------
A4WTA3_RHOS5/127-172------......-------------.H----A-------------------------L--K.------------------
Q0FIB1_PELBH/128-173------......-------------.H----C-------------------------L--K.------------------
A5LQ22_STREE/161-206------......-------------.H----S-------------------------I--V.------------------
A1EAC5_9CAUD/175-220------......-------------.H----S-------------------------I--V.------------------
C5UU10_CLOBO/128-173------......-------------.Y----A-------------------------I--V.------------------
Q73NJ9_TREDE/117-162------......-------------.M----I-------------------------V--T.------------------
C8Q074_9GAMM/121-166------......-------------.H----V-------------------------V--R.------------------
D0S8T8_ACIJO/121-166------......-------------.H----V-------------------------L--V.------------------
C6E6S5_GEOSM/133-178------......-------------.H----A-------------------------L--I.------------------
A9C3M0_DELAS/190-235------......-------------.H----A-------------------------V--I.------------------
D4CX94_9FUSO/117-162------......-------------.H----V-------------------------I--I.------------------
Q7P8C3_FUSNV/72-117------......-------------.H----V-------------------------V--I.------------------
C7XPL9_FUSNV/61-106------......-------------.S----V-------------------------I--I.------------------
D4CX93_9FUSO/115-161------......-------------.S----V-------------------------I--I.------------------
B2TP02_CLOBB/128-173------......-------------.H----V-------------------------V--I.------------------
C6CX53_PAESJ/104-150------......-------------.H----V-------------------------V--I.------------------
A6TRD3_ALKMQ/182-227------......-------------.H----A-------------------------V--I.------------------
C3DU79_BACTS/116-161------......-------------.Y----V-------------------------I--I.------------------
E6U5S1_ETHHY/116-161------......-------------.H----V-------------------------I--I.------------------
C3JGM1_RHOER/317-363------......-------------.A----Q-------------------------I--H.------------------
Y53_BPT3/45-90------......-------------.Y----E-------------------------I--D.------------------
B3VD54_9CAUD/38-83------......-------------.Y----E-------------------------V--D.------------------
Q3YJY2_BPK1F/38-83------......-------------.F----E-------------------------V--D.------------------
B5LJM0_9CAUD/57-102------......-------------.Q----Q-------------------------V--D.------------------
A6W8V6_KINRD/41-87------......-------------.L----V-------------------------L--D.------------------
C5E9V7_BIFLI/27-72------......-------------.M----Q-------------------------I--D.------------------
Q856N8_BPMCO/89-135------......-------------.M----E-------------------------V--D.------------------
A0MZB2_BPN4/61-106------......-------------.M----Q-------------------------V--D.------------------
B9K2P8_AGRVS/53-100------......-------------.K----E-------------------------I--D.------------------
A6UA36_SINMW/51-98------......-------------.K----E-------------------------L--D.------------------
C8ZKQ5_9CAUD/63-108------......-------------.K----Q-------------------------I--D.------------------
C4NT45_9CAUD/52-97------......-------------.K----Q-------------------------I--D.------------------
A1UH45_MYCSK/70-115------......-------------.L----E-------------------------I--D.------------------
D0U234_9CAUD/40-85------......-------------.L----Q-------------------------I--D.------------------
Q6X9Q0_9CAUD/46-92------......-------------.V----L-------------------------V--C.------------------
B4YQH7_9CAUD/40-85------......-------------.M----V-------------------------I--R.------------------
Q39FD2_BURS3/42-87------......-------------.L----H-------------------------V--L.------------------
B2HPG6_MYCMM/67-112------......-------------.L----H-------------------------V--L.------------------
A0A058WBB0_BORBO/39-84------......-------------.M----Y-------------------------V--C.------------------
Q8XUJ5_RALSO/52-97------......-------------.M----V-------------------------A--C.------------------
Q8XUF6_RALSO/69-114------......-------------.L----H-------------------------V--C.------------------
A6T071_JANMA/40-85------......-------------.L----H-------------------------V--C.------------------
Q5G8U2_9CAUD/66-111------......-------------.K----V-------------------------V--I.------------------
I6Q9W6_9CAUD/45-90------......-------------.L----V-------------------------V--R.------------------
C6BBU5_RALP1/42-87------......-------------.M----C-------------------------V--M.------------------
D1L332_9CAUD/27-75------......-------------.K----V-------------------------V--M.------------------
B5ZXT2_RHILW/47-92------......-------------.M----F-------------------------V--C.------------------
B7UG64_ECO27/45-90------......-------------.K----M-------------------------V--C.------------------
B3VD64_9CAUD/26-71------......-------------.L----V-------------------------V--R.------------------
C6BBU3_RALP1/28-76------......-------------.Q----F-------------------------V--R.------------------
Q6WYF0_BPT7/42-82------......-------------.S----T-------------------------V--L.------------------
A9XL65_BPT7/26-71------......-------------.I----V-------------------------V--M.------------------
Q55C13_DICDI/44-90------......-------------.E----V-------------------------V--H.------------------
C8T858_KLEPR/128-173------......-------------.Y----S-------------------------V--I.------------------
A7IWJ9_PBCVN/166-211------......-------------.W----T-------------------------I--H.------------------
A7IW40_PBCVN/137-186------......-------------.W----T-------------------------V--H.------------------
A7IW08_PBCVN/127-176------......-------------.W----T-------------------------V--H.------------------
A7IXP3_PBCVN/63-109------......-------------.Y----T-------------------------V--D.------------------
A7IV02_PBCVM/62-108------......-------------.P----S-------------------------F--TP------------------
A7IW74_PBCVN/69-115------......-------------.H----T-------------------------V--D.------------------
A7IWU9_PBCVN/61-106------......-------------.L----L-------------------------H--SP------------------
A7IWP5_PBCVN/60-106------......-------------.H----T-------------------------P--D.------------------
A7RBV7_PBCVA/60-106------......-------------.H----T-------------------------P--D.------------------
A7RBZ3_PBCVA/103-150------......-------------.Y----T-------------------------I--D.------------------
A7IXC3_PBCVN/104-151------......-------------.L----T-------------------------F--TA------------------
A7IWX1_PBCVN/103-150------......-------------.M----T-------------------------F--TA------------------
A7KA42_9PHYC/77-123------......-------------.H----T-------------------------V--D.------------------
A7K9V2_9PHYC/78-124------......-------------.H----T-------------------------V--D.------------------
A7K8I5_9PHYC/59-105------......-------------.H----T-------------------------A--D.------------------
D3SUH7_NATMM/146-192------......-------------.K----V-------------------------V--H.------------------
A7IW48_PBCVN/260-306------......-------------.A----V-------------------------V--R.------------------
B8INW1_METNO/63-109------......-------------.A----I-------------------------P--R.------------------
C3KA00_PSEFS/68-113------......-------------.L----V-------------------------V--R.------------------
A0A009UX44_ACIBA/66-111------......-------------.Q----E-------------------------V--R.------------------
C4ML45_9CAUD/99-146------......-------------.Y----V-------------------------V--H.------------------
A5HL46_9CAUD/98-145------......-------------.F----H-------------------------V--H.------------------
A3XJC2_LEEBM/63-108------......-------------.K----A-------------------------V--L.------------------
B0N8L2_9FIRM/61-106------......-------------.H----A-------------------------V--T.------------------
Q2IFG5_ANADE/52-97------......-------------.W----E-------------------------V--H.------------------
C7XUT9_9LACO/28-73------......-------------.Y----E-------------------------V--H.------------------
C3KZN2_CLOB6/39-84------......-------------.Y----E-------------------------V--H.------------------
Q6V7S8_9CAUD/139-185------......-------------.E----D-------------------------V--H.------------------
A9I8T5_BORPD/76-129------GRGNPK-------------TE----V-------------------------V--H.------------------
A6TVB1_ALKMQ/97-143------......-------------.E----V-------------------------V--H.------------------
D4BUG2_PRORE/155-201------......-------------.E----H-------------------------V--H.------------------
B5LPN5_9CAUD/94-140------.....D-------------WE----V-------------------------V--H.------------------
C5B0P1_METEA/139-185------......-------------.E----I-------------------------V--H.------------------
Q633W4_BACCZ/111-157------......-------------.F----I-------------------------V--D.------------------
C5H7P3_9CAUD/62-105------......-------------..----.-------------------------V--D.------------------
Q6QGN6_BPT5/53-96------......-------------..----.-------------------------V--D.------------------
C0ZXU5_RHOE4/92-138------......-------------.D----K-------------------------V--QV------------------
C3KZN5_CLOB6/115-155------......-------------.Q----F-------------------------I--D.------------------
Q6XQA1_BPT1/50-95------......-------------.F----V-------------------------I--D.------------------
Q6KG62_BPFO1/53-98------......-------------.Y----E-------------------------I--D.------------------
Q3J217_RHOS4/61-107------......-------------.L----V-------------------------I--D.------------------
Q9T140_9CAUD/59-104------......-------------.M----V-------------------------I--D.------------------
D1L2U2_9CAUD/88-133------......-------------.L----V-------------------------I--D.------------------
Q6XQF0_BPT1/57-102------......-------------.M----E-------------------------V--D.------------------
Q6XQ94_BPT1/46-91------......-------------.M----D-------------------------V--D.------------------
B1GS34_9CAUD/33-78------......-------------.M----Q-------------------------I--D.------------------
A5PJ37_9CAUD/57-102------......-------------.M----Q-------------------------I--D.------------------
A5PJ23_9CAUD/113-158------......-------------.M----E-------------------------I--D.------------------
B0FIJ3_BPE32/42-86------......-------------.K----I-------------------------V--D.------------------
C4NTD4_9CAUD/53-96------......-------------..----.-------------------------V--D.------------------
D2K055_9CAUD/58-102------......-------------.M----.-------------------------I--D.------------------
B3VD46_9CAUD/50-96------......-------------..----E-------------------------I--D.------------------
D2EBT0_9CAUD/53-98------......-------------.L----L-------------------------V--D.------------------
Q5IGW5_9CAUD/59-103------......-------------.E----.-------------------------L--D.------------------
C5B0T1_METEA/50-94------......-------------..----D-------------------------V--D.------------------
A4JMK1_BURVG/52-94------......-------------.R----V-------------------------P--D.------------------
B9BHP6_9BURK/57-100------......-------------..----.-------------------------V--D.------------------
A0A024ZD01_ECOLX/68-112------......-------------.Q----.-------------------------I--D.------------------
B2ZYK2_9CAUD/71-116------......-------------.L----E-------------------------V--D.------------------
Q1QRF2_NITHX/41-86------......-------------.F----F-------------------------V--D.------------------
A8HNZ9_9CAUD/53-96------......-------------..----.-------------------------I--D.------------------
C9XY04_CROTZ/62-105------......-------------..----.-------------------------L--D.------------------
B4EME9_BURCJ/77-121------......-------------.M----V-------------------------I--D.------------------
C4S5Y1_YERBE/57-101------......-------------.S----Q-------------------------I--D.------------------
Q66LV6_BPT5/53-98------......-------------.K----T-------------------------I--D.------------------
B8QTY8_9CAUD/49-93------......-------------..----I-------------------------I--D.------------------
A0A024SZF9_PSEAI/58-101------......-------------..----.-------------------------V--D.------------------
A4JMK3_BURVG/70-113------......-------------..----.-------------------------V--D.------------------
D0KHU7_PECWW/69-114------......-------------.H----C-------------------------I--D.------------------
D8JQ74_HYPDA/54-98------......-------------.L----L-------------------------I--D.------------------
C5AFV3_BURGB/73-117------......-------------..----E-------------------------I--D.------------------
A9BW22_DELAS/55-99------......-------------.K----I-------------------------I--D.------------------
C4ML49_9CAUD/55-99------......-------------..----L-------------------------I--D.------------------
D1P077_9ENTR/54-97------......-------------..----D-------------------------I--D.------------------
A9C0F7_DELAS/72-116------......-------------.V----D-------------------------I--D.------------------
Q4TZV0_9CAUD/53-96------......-------------.E----L-------------------------I--D.------------------
A3EZR8_9CAUD/55-99------......-------------.Q----.-------------------------I--D.------------------
K4TKR8_BORBO/58-102------......-------------..----H-------------------------I--D.------------------
C5A7Y6_BURGB/56-100------......-------------IF----E-------------------------I--D.------------------
B7ULS6_ECO27/31-76------......-------------.Y----K-------------------------I--D.------------------
C4ML56_9CAUD/95-139------......-------------..----K-------------------------V--D.------------------
D8JQ53_HYPDA/58-102------......-------------..----Q-------------------------I--D.------------------
Q7Y5F9_9CAUD/57-101------......-------------..----Q-------------------------L--D.------------------
A5H1J6_9CAUD/80-124------......-------------..----Q-------------------------L--D.------------------
A5H1L2_9CAUD/57-101------......-------------..----Q-------------------------L--D.------------------
A8B107_9CAUD/57-101------......-------------..----H-------------------------L--D.------------------
Q2NPG0_9CAUD/57-101------......-------------..----Q-------------------------L--D.------------------
A5H1K2_9CAUD/48-92------......-------------..----Q-------------------------I--D.------------------
Q7Y5L4_9CAUD/73-117------......-------------..----H-------------------------L--D.------------------
Q7Y5G7_9CAUD/59-103------......-------------..----H-------------------------L--D.------------------
Q2NPD3_9CAUD/62-106------......-------------.Q----Q-------------------------I--D.------------------
Q4TZV1_9CAUD/74-117------......-------------..----T-------------------------I--D.------------------
C4MYH3_9CAUD/75-118------......-------------.K----V-------------------------I--D.------------------
C4MYS3_9CAUD/74-117------......-------------.L----.-------------------------I--D.------------------
Q1QKU3_NITHX/67-111------......-------------..----E-------------------------I--D.------------------
A9DEP0_9CAUD/52-97------......-------------.M----E-------------------------I--D.------------------
A0A028EKB2_ECO57/58-102------......-------------.F----.-------------------------I--D.------------------
A2WAD2_9BURK/68-112------......-------------..----D-------------------------I--D.------------------
B7UG37_ECO27/66-110------......-------------..----F-------------------------I--D.------------------
A1JR30_YERE8/67-111------......-------------..----I-------------------------I--D.------------------
C3AR86_BACMY/82-128------......-------------.L----E-------------------------A--D.------------------
C2JXG4_LACRH/90-135------......-------------..----.-------------------------V--D.------------------
B9UDM8_9CAUD/63-109------......-------------.H----V-------------------------I--N.------------------
D4CXF1_9FUSO/31-77------......-------------.I----V-------------------------I--N.------------------
A6L5T7_BACV8/63-109------......-------------.M----V-------------------------V--D.------------------
C8T854_KLEPR/51-91------......-------------.D----V-------------------------V--D.------------------
A7IV02_PBCVM/236-282------......-------------KP----I-------------------------V--N.------------------
A2I7Y0_9CAUD/50-95------......-------------.P----V-------------------------V--N.------------------
C7XUW2_9LACO/54-99------......-------------..----.-------------------------V--N.------------------
F4E585_BACAM/52-97------......-------------.M----F-------------------------V--N.------------------
C0ZXW0_RHOE4/69-114------......-------------.P----Q-------------------------V--N.------------------
D3V337_XENBS/84-129------......-------------.P----Q-------------------------V--N.------------------
D2J8C8_STAAU/58-103------......-------------.M----Q-------------------------V--D.------------------
D4CXE9_9FUSO/59-104------......-------------.P----T-------------------------V--N.------------------
Q84408_PBCV1/343-397------INGKTH-------------HL----I-------------------------V--D.------------------
A7IWJ9_PBCVN/358-412------IDGKKH-------------RL----V-------------------------V--D.------------------
A7IW40_PBCVN/332-386------IDEKTH-------------RL----V-------------------------V--D.------------------
A7IW08_PBCVN/321-375------......-------------.L----V-------------------------V--D.------------------
Q8QNG0_ESV1K/274-319------......-------------.Y----Q-------------------------V--D.------------------
O80123_9CAUD/49-92------......-------------.L----T-------------------------V--D.------------------
C7T1V9_9CAUD/47-90------......-------------.L----T-------------------------V--D.------------------
O80140_9CAUD/47-90------......-------------.L----T-------------------------V--D.------------------
Q09WS3_9CAUD/48-91------......-------------.L----T-------------------------V--D.------------------
C7T218_9CAUD/56-99------......-------------.L----T-------------------------V--D.------------------
Q09WT2_9CAUD/48-91------......-------------.L----T-------------------------V--D.------------------
Q09YD3_9CAUD/47-90------......-------------.L----T-------------------------V--D.------------------

PF07510

Q5Z0T6_NOCFA/102-248R.DEY.GT.LDR-------------KT----G...QLKPYKWITDPAA.......VDA--E-------------------
A1R7C6_ARTAT/113-252H.EPY.......-------------TG----A...QVTFQRGQDTSAA.......VQI--D-------------------
Q0RYV1_RHOSR/93-233H.DTY.......-------------TG----T...TIAFVRGQDTSTA.......VQI--D-------------------
Q0S639_RHOSR/133-273L.DPY.......-------------TG----N...TISFVRGADTSNA.......VQI--D-------------------
Q0S647_RHOSR/106-246R.DLY.......-------------TG----T...IIAFTRGTKTSDA.......VQI--D-------------------
Q8FM54_COREF/109-249N.DPY.......-------------TA----T...QINFQRGQDTSTA.......VQI--D-------------------
Q6A6U8_PROAC/86-225H.DPY.......-------------TG----R...TIQWRCGRNTSAV.......VQI--D-------------------
A0LV32_ACIC1/126-265H.DPY.......-------------TG----K...TIHFVRGETTSLA.......VQI--D-------------------
Q82HG5_STRAW/78-214DPDPY.......-------------TG----Q...QVTFARG..R.SQ.......VDI--D-------------------
A0JTH8_ARTS2/211-350A.DPY.......-------------TG----T...SISFLRGSGTSSK.......VQI--D-------------------
A0JWX0_ARTS2/105-245A.DKY.......-------------TG----K...TIRFVRGAETSSA.......VQI--D-------------------
A1A395_BIFAA/100-238A.DPY.......-------------TG----K...TIHFVRGARTSSA.......VQI--D-------------------
Q8G7L0_BIFLO/75-214A.DPY.......-------------TA----Q...TIHFVRGRATSAK.......VQI--D-------------------
Q2J4M2_FRASC/98-236R.DPY.......-------------TT----R...IIRFDRG.RNSAS.......VQI--D-------------------
Q6NHN8_CORDI/105-245H.DLY.......-------------SG----V...DVAFTRGPKTSTM.......VEI--D-------------------
A1T721_MYCVP/87-228R.DPY.......-------------TN----A...TVAFVRGEQTGAA.......VQI--D-------------------
Q0SGG1_RHOSR/90-229A.DPY.......-------------SG----E...VLPFDRA..DAKA.......VQI--D-------------------
Q5Z121_NOCFA/118-257R.DPY.......-------------TG----R...LLEFRKA..DARD.......VQI--D-------------------
A7ICR1_XANP2/481-654EIAKR.TKFHET-------------TT----L..APSLT..................V--E-------------------
Q2GBR5_NOVAD/473-622GDAMT.TSRNEQ-------------LD----L..SGPVT..................V--E-------------------
Q88BH3_PSESM/500-658EYAAR.GSQQAS-------------NH----VPAQSDLT..................V--E-------------------
A1U086_MARAV/478-634DQVQA.DRKSEN-------------LE----L..PNDLT..................I--E-------------------
Q5NWK7_AROAE/455-614SDTYF.TSKNEG-------------VS----F..DHPLT..................V--E-------------------
A6TCP9_KLEP7/451-620EGELRRQVKTEE-------------PD----VPKLSSLD..................I--D-------------------
Q886C3_PSESM/451-620EGALRLSVKSEE-------------CG----LPDLTNLD..................I--D-------------------
A1SFN4_NOCSJ/451-594ENHYRAETKQPQ-------------AE----RSGFP.....................I--E-------------------
Q8NSE2_CORGL/410-552ENADS.NDVRDI-------------QT----SLDEGSLS..................I--E-------------------
B3EQQ5_CHLPB/412-553ENYEN.IERVAI-------------EG----NPDIT.....................I--E-------------------
Q036N1_LACC3/426-567NNASG.EEQDLF-------------DA----AQSGKYS...................I--E-------------------
Q2FKU3_METHJ/422-570EEYFS.SQPRGS-------------DP----APSYALFEDEAEVRM...........I--D-------------------
A0RWN2_CENSY/426-563ENHGD.DFKTAK-------------KD----L..T......................I--E-------------------
A0ZGR7_NODSP/401-537EESFQHKEQVSF-------------DK----L..S......................I--E-------------------
A4J1V4_DESRM/398-534EESYQHKEQVPL-------------DD----C..S......................I--E-------------------
A9AZI5_HERA2/396-532ESHFHHKEQTSF-------------ET----L..S......................I--E-------------------
Q2J8U4_FRASC/408-551EEDYE.HL.EPV-------------DW----G..VKLT...................V--E-------------------
O25346_HELPY/413-546EKLSN.AEPPRE-------------EN----L..E......................V--E-------------------
Q5LGD9_BACFN/443-600ESAMTQETWTDL-------------WR----RTDKKVFVWT................I--E-------------------
Q7VHA6_HELHP/428-575HTNKK.TQ.DSI-------------EL----S..YKWT...................L--E-------------------
A7UG49_FIBSS/466-641QDSKS.DY.EKT-------------EL----E..YNFT...................L--E-------------------
Q11AI8_CHESB/234-376ESYLR.WY.RDG-------------AK----G..APRCLDKMVVFDPSA......TTV--E-------------------
Q8YLY7_NOSS1/189-334DHTGW.YS.NGA-------------NG----K..PKPNEISIFDLSKV........TI--E-------------------
A0RVA9_CENSY/414-554EYKLQ.EP.RPV-------------KN----T..PNLE...................L--E-------------------
Q2SGD6_HAHCH/412-558E.HLS.EN.KGQ-------------DF----S...NEQWARIWEASAA.......KSI--E-------------------
Q9XAG9_STRCO/398-541SAARY.LL.REI-------------EI----S..LRNGEETDVARPPK.......IHI--E-------------------
A9AVQ7_HERA2/439-587ELHLL.AT.EGK-------------NS----E..PRLGWDQLSDST...........I--E-------------------
Q3ATS7_CHLCH/421-558E.TLL.SG.TEY-------------DF----D..SDRYN..................I--E-------------------
A5V079_ROSS1/420-557E.EQI.SN.NHY-------------DM----D..NPAYS..................L--E-------------------
A1AQQ9_PELPD/425-562E.KQQ.SG.HNF-------------DF----E..SATYN..................L--E-------------------
A6VMJ2_ACTSZ/423-561EQYVS.NN.PGI-------------DF----S..SDAFN..................I--E-------------------
Q3AS66_CHLCH/431-567ENNMM.QG.GDR-------------DY----E..LDPAT..................I--E-------------------
Q7NME9_GLOVI/421-559E.CDA.SG.RAC-------------DP----E..TDPAS..................V--E-------------------
A9AVB5_HERA2/420-558EKNFN.GGSSQV-------------SN----D..PRKVN..................L--E-------------------
A6Q5M5_NITSB/432-580EDYLS.QGQGVK-------------VL----D..QSPNQH.................L--E-------------------
Q8YA53_LISMO/416-546NDSYS.KE.IAV-------------LN----D..NNKIH..................L--E-------------------
A4J5I9_DESRM/420-565TQSLD.EK.AWG-------------SS----P..ALISLDAYLHKGV.........DI--E-------------------
Q8YPL5_NOSS1/423-586TQYID.EL.AYG-------------EI----E..AHTNLKNYINKTV.........EI--E-------------------
Q6F1G1_MESFL/672-827ESFLI.NN.WEI-------------KR----D...KNS...................L--E-------------------
A5IYB8_MYCAP/428-578LDQNS.GE.NIN-------------QV----D...MRT...................I--E-------------------
Q5YR97_NOCFA/406-548DEILA.NN.PGA-------------TY----S..HSIIS..................I--E-------------------
Q4JVU8_CORJK/414-556DSVLA.AD.PGA-------------SY----D..HKIIT..................V--E-------------------
Q1DEQ6_MYXXD/411-552DRALG.DK..GA-------------KY----D..VDTIT..................V--E-------------------
Q6D0Y9_PECAS/408-551DSFLT.DK..AA-------------KY----D..HSILT..................I--E-------------------
Q6ZEH4_SYNY3/425-566DSALA.ES.GQS-------------ES----L..KSKTLT.................I--E-------------------
Q5KUQ7_GEOKA/389-532EQESQ.DQ.SVV-------------KQ----F..HGRIT..................V--E-------------------
A6GW01_FLAPJ/386-529ENSIQ.DD.SVF-------------KS----Y..SGLIS..................I--E-------------------
A4G9X6_HERAR/400-542EVLST.EN.DVY-------------KE----M..NAKS...................I--E-------------------
Q0C3X8_HYPNA/403-545NAAIE.GG.RTI-------------PP----D..SDAT...................V--E-------------------
Q6LTS8_PHOPR/529-671SDYLK.....DI-------------DQ----N...KFMRYRIISRNS..........V--E-------------------
Q11QY5_CYTH3/502-639S.........FP-------------KT----S...EFENYRITSRNS..........V--E-------------------
A0M4J9_GRAFK/551-704N.NLI.RD.FKL-------------DQ----E...KWDNYRLTAKSS..........V--E-------------------
Q0AUV6_SYNWW/448-590YSYLG.KE.IIP-------------PL----Y..DEWQFQFR.SS............I--E-------------------
Q4FRY4_PSYA2/530-667NVSIP.KK.KEF-------------RF----S...FKSS..................K--E-------------------
Q9PPW3_UREPA/769-912YLTFF.LD.DTQ-------------IN----K...NKDTKVFFYPPSNADNEKADLTI--E-------------------
Q6AIF5_DESPS/418-563ERLNK.KQYSLI-------------EL----Q..KIMGNDP...T............I--E-------------------
O24986_HELPY/247-392CQEMG.LA.DLK-------------KL----I..PRKQFSQ...E............K--E-------------------
A1A1T1_BIFAA/469-640RFTSY.VNVLMG-------------NP----S..HFEEYVDRKRQGNT.......YDI--E-------------------
Q5LEB6_BACFN/377-525P.KSF..N.DGS-------------LI----N.....ISNYWLKQANS.......KNY--H-------------------
A5FWM6_ACICJ/377-525P.KSF..R.DNS-------------NV----N.....ISNNWLKQSNS.......KNY--H-------------------
Q3JCQ9_NITOC/323-466NYQPA.YE.NNL-------------PQ----..........................V--D-------------------
A9WEH8_CHLAA/424-558ERQVG..G.IEF-------------DQ----D..SPAYT..................I--E-------------------
B0RGW4_CLAMS/92-228E.DPY.SG....-------------..----A...RVSFDRS.RDPEA.......VQI--D-------------------
Q8XIG5_CLOPE/441-575DMEKR.AN.EVL-------------DY----S...DKIM..................I--E-------------------
Q9KR77_VIBCH/513-654KASES.SLPSEE-------------LN----K..FKKY..R...ITSK.......NSV--E-------------------
R5T7Y2_9CLOT/410-545ENFEN..K.API-------------TI----E....NYT..................I--E-------------------

PF14412

A5W3P0_PSEP1/1280-1394--------------------------Y----D-------------------------A--H-------------------
A7MQ50_CROS8/1402-1512--------------------------N----S-------------------------A--H-------------------
Q1VCI2_VIBAL/107-222--------------------------H----A-------------------------A--H-------------------
Q82R58_STRAW/2257-2362--------------------------T----A-------------------------A--H-------------------
A6G3J9_9DELT/2292-2397--------------------------H----A-------------------------A--H-------------------
B2RK38_PORG3/122-225--------------------------S----R-------------------------A--H-------------------
A9AT71_BURM1/1292-1398--------------------------S----A-------------------------A--H-------------------
C2LKS1_PROMI/54-162--------------------------T----A-------------------------A--H-------------------
D6HTD3_ECOLX/139-248--------------------------S----A-------------------------A--H-------------------
A9EDX2_9FLAO/535-640--------------------------R----Q-------------------------A--H-------------------
D0LTA7_HALO1/752-883--------------------------H----Q-------------------------A--H-------------------
D0LKQ6_HALO1/810-934--------------------------H----E-------------------------A--H-------------------
D0LLJ7_HALO1/620-748--------------------------H----Q-------------------------A--H-------------------
A6CDX3_9PLAN/332-450--------------------------S----H-------------------------E--H-------------------
E1KPW8_9BACT/935-1042--------------------------P----H-------------------------R--H-------------------
F0K581_CLOAE/200-308--------------------------P----H-------------------------A--H-------------------
A9VT18_BACWK/373-481--------------------------P----H-------------------------A--H-------------------
B1K7M0_BURCC/1371-1487--------------------------P----H-------------------------A--H-------------------
A7MQ44_CROS8/1218-1330--------------------------P----H-------------------------G--H-------------------
B1JMY6_YERPY/61-165--------------------------A----H-------------------------G--H-------------------
E2MFF7_PSEUB/30-137--------------------------P----H-------------------------A--H-------------------
Q8XQT2_RALSO/1406-1511--------------------------P----H-------------------------G--H-------------------
Q2SPA9_HAHCH/25-137--------------------------V----E-------------------------G--H-------------------
Q4HD84_CAMCO/120-223--------------------------I----Q-------------------------T--H-------------------
D1QPX2_9BACT/380-481--------------------------Q----Q-------------------------I--H-------------------
C2VMF9_BACCE/142-242--------------------------F----Q-------------------------V--H-------------------
Q64SC9_BACFR/1339-1449--------------------------L----H-------------------------V--H-------------------
Q1DCW1_MYXXD/334-445--------------------------T----H-------------------------R--H-------------------
Q093F6_STIAD/232-335--------------------------P----G-------------------------A--V-------------------
Q1D4C5_MYXXD/315-427--------------------------G----P-------------------------V--H-------------------
Q1DCY3_MYXXD/316-427--------------------------G----K-------------------------V--H-------------------
A6CA84_9PLAN/166-276--------------------------Y----Q-------------------------A--A-------------------
D3IMS2_9BACT/89-191--------------------------T----Q-------------------------T--H-------------------
H6NWL7_SALTI/1235-1336--------------------------L----D-------------------------L--H-------------------
D1YPM0_9FIRM/58-154--------------------------F----N-------------------------F--Y-------------------
Q1BS61_BURCA/453-565--------------------------F----Q-------------------------E--H-------------------
B7VTR6_VIBSL/37-155--------------------------L----Q-------------------------A--H-------------------
B2PYR7_PROST/296-406--------------------------F----Q-------------------------K--H-------------------
D1PUV1_9BACT/145-267--------------------------M----Q-------------------------A--H-------------------
A0A009XFQ0_ACIBA/1498-1612--------------------------L----Q-------------------------A--H-------------------
A7VXS4_9CLOT/154-265--------------------------N----D-------------------------L--H-------------------
C5BUJ2_TERTT/116-229--------------------------H----T-------------------------A--H-------------------
E7J463_ECOLX/145-254--------------------------Y----R-------------------------A--H-------------------
D8P630_RALSL/1305-1421--------------------------M----A-------------------------N--H-------------------
Q6HKE9_BACHK/425-537--------------------------N----A-------------------------A--H-------------------
D0BQG1_FUSNU/310-426--------------------------C----A-------------------------A--H-------------------
A6DG18_9BACT/297-411--------------------------M----A-------------------------A--H-------------------

PF02945

Q854H7_BPMOM/21-116GCRAPLAAG..R-------------GA....H-------------------------L--DH------------------
Q854C9_BPMOM/61-142.CQ.RANGT.TK-------------AL....A-------------------------V--EH------------------
Q853W7_BPMOM/109-202GCDARPKEG.AR-------------RF....P-------------------------V--DH------------------
Q9MBZ1_9CAUD/47-128.CGITERVE.GR-------------AL....A-------------------------V--DH------------------
Q82YG4_STRAW/252-319.CKK......RQ-------------AS....A-------------------------W--DH------------------
Q857G3_BPMB2/60-141.CR.RANGK.RK-------------RL....S-------------------------V--DH------------------
Q82R65_STRAW/149-228.CGL......YP-------------GA....M-------------------------V--DH------------------
A0A023ZVT8_9CAUD/1-97.CQ.RELNPDVQ-------------AN....H-------------------------L--DH------------------
Q99PZ8_STRCO/154-212.CSA.......P-------------AY....A-------------------------I--DH------------------
Q82RY9_STRAW/40-138.CQEGPPTDHCP-------------DAVSFWH-------------------------I--DH------------------
G8I606_9CAUD/49-130.CR.KGRGL.RK-------------KL....A-------------------------V--DH------------------
Q856T3_BPMCO/46-138.CQI.ATGK.TK-------------RL....A-------------------------V--DH------------------
O87597_STRCO/77-153.CLK......AP-------------AV....H-------------------------V--DH------------------
Q849E0_STRVN/152-236.CSE......SR-------------AA....V-------------------------W--DH------------------
VG59_BPMD2/49-130.CQ.RANGK.RK-------------RL....S-------------------------V--DH------------------
Q9ZL26_HELPJ/99-187.CEKRSIVGVTA-------------NL....V-------------------------H--DH------------------

PF04231

S6BR35_PSERE/26-233--------...P-------------AYAFGSQRQCWQNGGRKNCIDTDPVFRKMEADM--H-------------------
H8XQY1_FLAIG/31-274--------...P-------------QSVFGSAT...................PMYSDA--H-------------------
Q7MB43_PHOLL/29-237--------...P-------------AWVFGHQRQCWRNGGRKNCVSSDPVFRAMESDI--H-------------------
C6X0Y1_FLAB3/33-266--------...P-------------QGFFDEAF...................PMKNDY--L-------------------
G2Z0P2_FLABF/31-278--------...P-------------QSYFGGSGSY.................PMYSDA--H-------------------
E1WX28_BACMS/37-265--------...P-------------QGLFDKKR...................PMKTDI--F-------------------
A6GXH6_FLAPJ/30-267--------...P-------------KSWFGGPSGV.................PMYTDA--F-------------------
A5FAQ0_FLAJ1/31-260--------...P-------------QSVFNEQS...................PMVADA--H-------------------
G8X893_FLACA/31-259--------...P-------------QSVFNNAA...................PMVSDA--H-------------------
F6GF23_LACS5/34-268--------...P-------------QSSFGEAS...................PMKNDV--H-------------------
Q87FN9_VIBPA/294-530--------...P-------------KSWFGGKVE..................PMNSDG--H-------------------
M4U6V7_9GAMM/209-446--------...P-------------KSWFGGEIS..................PMYTDI--H-------------------
D4ZCB1_SHEVD/20-225--------...P-------------AWALGHQRQCWHEGGRKNCTKNDPIFRIMEADL--H-------------------
H8XRD7_FLAIG/30-246--------LGTP-------------ALVTSSPG...................P.GTDA--H-------------------

PF01844

Q9RZ22_DEIRA/734-776------------------------------------------------------QLQV--D-------------------
Q830G1_ENTFA/64-111------------------------------------------------------QAHR--H-------------------
Q81XW6_BACAN/141-196------------------------------------------------------FIEG--H-------------------
Q8XLC6_CLOPE/63-111------------------------------------------------------CTTT--H-------------------
Q81CU3_BACCR/27-71------------------------------------------------------ECHI--D-------------------
Q8NLR2_CORGL/374-419------------------------------------------------------..EI--H-------------------
Q8YL60_NOSS1/22-69------------------------------------------------------THEV--D-------------------
Q8DWJ8_STRMU/50-100------------------------------------------------------SFHI--E-------------------
Q8CM00_THEEB/505-551------------------------------------------------------LTDI--H-------------------
Q8YUD3_NOSS1/22-69------------------------------------------------------LFTV--D-------------------
Q9RRS6_DEIRA/105-147------------------------------------------------------DLTM--D-------------------
Q8DXJ3_STRA5/40-90------------------------------------------------------.SIV--D-------------------
Q87Y88_PSESM/40-88------------------------------------------------------ELTV--H-------------------
P73905_SYNY3/19-66------------------------------------------------------RFTI--D-------------------
Q81D03_BACCR/65-112------------------------------------------------------RAHV--H-------------------
Q88ML0_PSEPK/67-115------------------------------------------------------AHEV--D-------------------
Q97HW0_CLOAB/32-80------------------------------------------------------ANTV--H-------------------
Q8YKL7_NOSS1/198-241------------------------------------------------------PLQI--E-------------------
MCRA_ECOLI/207-258------------------------------------------------------YLEV--H-------------------
Q8YZ58_NOSS1/25-70------------------------------------------------------NLTI--D-------------------
Q9KMM4_VIBCH/22-66------------------------------------------------------.FEI--H-------------------
Q8XYS8_RALSO/66-114------------------------------------------------------AKVV--D-------------------
Q81X85_BACAN/42-92------------------------------------------------------DLQC--H-------------------
P73673_SYNY3/22-69------------------------------------------------------SHHV--D-------------------
Q82YG2_STRAW/26-70------------------------------------------------------.WEA--D-------------------
Q9A694_CAUCR/96-138------------------------------------------------------DLTF--D-------------------
Q8DLJ5_THEEB/79-122------------------------------------------------------ELTL--D-------------------
YOQL_BACSU/136-189------------------------------------------------------IQSD--F-------------------
P72833_SYNY3/79-122------------------------------------------------------QLTL--D-------------------
Q8YJW6_NOSS1/99-141------------------------------------------------------HLTL--D-------------------
Q892G5_CLOTE/70-118------------------------------------------------------MDTV--H-------------------
Q9RZ97_DEIRA/536-578------------------------------------------------------YLEF--D-------------------
Q8KEG3_CHLTE/87-130------------------------------------------------------SLTV--D-------------------
Q9X2X8_BACAN/514-560------------------------------------------------------PLES--N-------------------
Q8F8A1_LEPIN/40-85------------------------------------------------------ELTM--D-------------------
ANRX_NOSS1/24-67------------------------------------------------------..NG--H-------------------
Q81W86_BACAN/46-96------------------------------------------------------ADMV--H-------------------
Q81Z15_BACAN/30-77------------------------------------------------------.HHK--N-------------------
Q8YJX0_NOSS1/534-580------------------------------------------------------LMEI--D-------------------
Q984I3_RHILO/259-314------------------------------------------------------FIEV--H-------------------
C1DQC3_AZOVD/456-501------------------------------------------------------GWNI--H-------------------
Q2FYC4_STAA8/41-88------------------------------------------------------ANIV--H-------------------
Q32JG4_SHIDS/27-75------------------------------------------------------ELTV--H-------------------
Q99YZ8_STRP1/30-83------------------------------------------------------SAAI--D-------------------
Q9CFR4_LACLA/90-137------------------------------------------------------GNIG--D-------------------
Q9PC69_XYLFA/109-154------------------------------------------------------QLTR--D-------------------

PF16786

H8L2H7_FRAAD/10-118-------------------------------------------------------AEA--H-------------------
M4NHG8_9GAMM/46-153-------------------------------------------------------CEA--H-------------------
REF_BPP1/80-182-------------------------------------------------------VSL--H-------------------
Q2L2X9_BORA1/6-99-------------------------------------------------------CLI--H-------------------

PF05551

O46338_9EUKA/115-245------------------------------MNN..................KGSDSYV--H-------------------
A3QSY4_9LECA/123-253------------------------------RNT...VINGRK.........AEVQIYL--H-------------------
Q7Z9J1_9PEZI/146-281------------------------------RNTNHPNRPSEK.........IGHVFYA--H-------------------
Q966Z7_9EUKA/22-136------------------------------KKGTMTYPPGFKTGKKLQYKIEGRYVVA--H-------------------
A7ISR6_9EUKA/122-252------------------------------LSD..................KGSDGYV--H-------------------
A7F286_SCLS1/133-280------------------------------RNANKDRPGVILTKG......SRTKVYV--Y-------------------
A7BJ62_NAEGR/88-207------------------------------VSE..................RNVHLSF--H-------------------
Q8TGE3_9FUNG/33-165------------------------------RHTLLDASDKK..........IGRCIYL--H-------------------
Q8X1S1_BEABA/120-236------------------------------KG...................ANKIALL--H-------------------
Q2TSV0_PORUM/40-143------------------------------.....................HGRKYYG--H-------------------
Q6W364_9EURO/163-291------------------------------RNTVGPTGQK...........IGVSPWA--H-------------------

PF13395

B0RZQ7_FINM2/844-900-------------------------------------------------------YDK--D-------------------
D6S374_9LACO/860-911-------------------------------------------------------YDI--D-------------------
Q1WVK1_LACS1/821-874-------------------------------------------------------YDI--D-------------------
Q5M542_STRT2/576-631-------------------------------------------------------FEV--D-------------------
A8AY02_STRGC/575-630-------------------------------------------------------YEI--D-------------------
C5ZYI3_9HELI/554-608-------------------------------------------------------LEV--D-------------------
C4ZA16_EUBR3/583-638-------------------------------------------------------FEI--D-------------------
D4IZM9_BUTFI/576-631-------------------------------------------------------FEV--D-------------------
B8I085_CLOCE/550-604-------------------------------------------------------TQI--D-------------------
A6GZR9_FLAPJ/723-776-------------------------------------------------------YDI--E-------------------
B1GZM3_UNCTG/557-611-------------------------------------------------------LDI--D-------------------
D3UFL8_HELM1/576-630-------------------------------------------------------LQI--D-------------------
B2KB46_ELUMP/642-695-------------------------------------------------------ADI--E-------------------
Q6KIQ7_MYCMO/662-717-------------------------------------------------------YDI--D-------------------
Q7MRD3_WOLSU/573-627-------------------------------------------------------CEI--D-------------------
A1WH93_VEREI/615-668-------------------------------------------------------VEI--E-------------------
Q4A5I2_MYCS5/699-751-------------------------------------------------------TEI--D-------------------
A7HP89_PARL1/579-633-------------------------------------------------------YEV--E-------------------
C7M7G9_CAPOD/791-844-------------------------------------------------------IEI--E-------------------
D1AUW6_STRM9/623-676-------------------------------------------------------VQI--D-------------------
Q1QGC9_NITHX/661-714-------------------------------------------------------VDI--D-------------------
A8LN05_DINSH/600-653-------------------------------------------------------CDV--D-------------------
B1GZ57_UNCTG/486-539-------------------------------------------------------VDV--E-------------------
B2UP49_AKKM8/631-682-------------------------------------------------------LEL--E-------------------
C4LF28_TOLAT/241-289-------------------------------------------------------YDL--D-------------------
Q01TQ5_SOLUE/211-274-------------------------------------------------------ADV--D-------------------
A9HKP2_GLUDA/568-623-------------------------------------------------------VQV--D-------------------
G4Q6A5_ACIIR/835-888-------------------------------------------------------YNI--D-------------------
Q0P897_CAMJE/537-591-------------------------------------------------------LEI--D-------------------
Q20XX4_RHOPB/560-615-------------------------------------------------------YQV--D-------------------
Q5L8F8_BACFN/794-846-------------------------------------------------------FDI--E-------------------
Q7NAI2_MYCGA/647-702-------------------------------------------------------TEI--D-------------------
Q8DTE3_STRMU/821-872-------------------------------------------------------YDI--D-------------------
CAS9_STRP1/821-872-------------------------------------------------------YDV--D-------------------
Q9CLT2_PASMU/558-612-------------------------------------------------------VEI--D-------------------
R7G6K2_9FIRM/537-591-------------------------------------------------------YEV--D-------------------
T0TDV9_9STRE/576-631-------------------------------------------------------FEI--D-------------------

PF12639

B0KQD0_PSEPG/501-635AAEQGLLGQFDE-------------VNQRRI.IRGFPPVAPRASWSGAR....HEFEL--R-------------------
Q3K6V6_PSEPF/285-415ANDPDLAEQFIQ-------------GNIERM.RNGLSPKARRQDWAGDR....TSYEL--H-------------------
C4T554_YERIN/799-929SKDPTLSEQFKS-------------GNLGNI.KNGKAPSPRESEQVGGR....VKHEL--H-------------------
A7FD33_YERP3/469-599GEDPNLVKYFKS-------------GNLGNI.KNGKAPSPKEREQVGRR....VKYEL--H-------------------
B2JZI5_YERPB/7-137ANDPELVGQFII-------------SNRERM.SVGKAPKAKKIDSGGKR....IPFEI--H-------------------
Q7N5Q1_PHOLL/427-557GNDPELSQQFNS-------------HNKEFL.KKSYSPYSPRQEHIGNR....EKYEI--H-------------------
A7MTX8_VIBCB/727-857SKDSDLKGQFNA-------------QNQIRI.GLGKAPKARSRDKVGKR....KSFEL--H-------------------
Q87GQ2_VIBPA/738-868GEDQTLINQFSR-------------ANQRLI.KRGRSPFSLPSEQVGGR....QRYEL--H-------------------
B2VB98_ERWT9/508-638SKDPALGKQFNN-------------QNRTNI.KNGKSPFVPESERVGSR....QRYEL--H-------------------
Q9XBT6_KLEPN/634-764AADPDLSKQFYP-------------DDIERM.KLGRAPTVRFRDSVGKR....VKVEL--H-------------------
A0A016RP44_KLEPN/642-772ADDSALSKQFSE-------------ADINQM.KAGRAPTADFLESVGKR....VKIEL--H-------------------
C4SH19_YERMO/396-526GHDPELSRQFKR-------------HNISLM.KKRFSPFTPASEKINGR....DKFEC--H-------------------
C2DMX1_ECOLX/454-592SKDSVLLAQFIK-------------SNQNNV.SQGYSPYVPEEGYYYGPNEIVKKFQI--H-------------------
A9MMY5_SALAR/1057-1195SNDPKLMAQFGE-------------DNQERI.SNGLAPWVPSDGYYHGPNEVVKKFQI--H-------------------
A8AJ94_CITK8/445-577SECPELMKDFKP-------------SNQTLI.RMGLAPYPIPSEQVGGR....TTFEL--H-------------------
PYS1_PSEAI/486-616ANDPELSKQFNP-------------GSLAVM.RDGGAPYVRESEQAGGR....IKIEI--H-------------------
Q51502_PSEAI/639-769SKDPSALENLSP-------------SNRYFV.SQGLAPYAVPEEHLGSK....EKFEI--H-------------------
Q3KHV9_PSEPF/591-721GDDQALFEQFTT-------------FSKFDI.KKGLSPTAPRSEQVGGK....TKLDI--H-------------------
Q4ZME2_PSEU2/510-640GADLELSKQFKG-------------SNNTLI.KGGTAPFAIPSEQVGGR....GQFEI--H-------------------
Q3K520_PSEPF/657-787ADDSELVSQFNN-------------SSAFEM.KNGRAPFVRKIDRVGGQ....VKFEL--H-------------------
Q4ZZN9_PSEU2/521-651ANDPELVKQFTQ-------------HNLEIM.RDGGAPYPRLVDQAGGR....TKFEI--H-------------------
Q88NA6_PSEPK/624-755ANDPELSKQFDE-------------MSLSRMRKNGYSPIVDFPDSHLSQ....KTFIL--H-------------------
A0A025RNS1_ECOLX/450-580SKDPDLSKQFKG-------------SNKTNI.QKGKAPFARKKDQVGGR....ERFEL--H-------------------
CEA7_ECOLX/445-575SKDPELSKQFSR-------------NNNDRM.KVGKAPKTRTQDVSGKR....TSFEL--H-------------------
D2ZY22_NEIMU/251-385AKDPKLVEGFSE-------------ANKKRM.AQGKAPKAAKCQHDGKV....SSYQI--H-------------------
B7IKS1_BACC2/421-558.ADSDYATEFNQ-------------RNINLM.KEGKAPFAPLSEKYGQH....NQYIL--H-------------------
C3AFZ3_BACMY/16-153.ADSSYANEFNR-------------MNRMRM.LEGKAPYTPGSEQYGAH....KVYVL--H-------------------
C3IBA0_BACTU/269-406.ANSSYAKEFNP-------------MNIKLM.KKGKAPYSPRTEHYGNH....NKYIL--H-------------------
D3L0R9_9BACT/87-187.KNNPEKYNFTK-------------KQIEAIEEAARTGKNPKG..........LGFVV--H-------------------
B9NWZ3_9RHOB/126-198............-------------...........TP...............PNMTW--H-------------------
D0FW92_ERWPE/64-139............-------------........GNPRP...............DDYTW--H-------------------
B5H1J3_STRC2/2188-2263............-------------...........TP...............TGYTW--H-------------------
A9AVI8_HERA2/2989-3061............-------------...........RP...............SGYTW--H-------------------
A3DH25_CLOTH/482-555............-------------...........TP...............KGYTW--H-------------------
Q21ED9_SACD2/494-574............-------------.......SAKSTP...............KHFTW--H-------------------
H2GD98_CORD2/1149-1243PTGRSYKDIRAA-------------DAVLGIDRRYRKE...............HGLVW--H-------------------
C3E5P5_BACTU/88-181PIGEFNRYDIDF-------------AKADELASNGTKL...............DENTW--H-------------------
C2XDV9_BACCE/492-590DSGKIPKELFSP-------------DQLAQINAGKARI...............KGLTW--H-------------------
C2XW90_BACCE/506-604EKGEISKELFTK-------------KQLAQINDGLPRI...............DGLIW--H-------------------
C3H3G2_BACTU/81-179EKGDIPKEIFTE-------------KQLRDIYNEEARI...............KGLTW--H-------------------
C2UXI9_BACCE/476-574NKGEIPRDIFTP-------------KQLKMIELELPRI...............VDLTW--H-------------------
E6TT53_BACCJ/211-318SENETIAAQFSI-------------DQLEQIYAGE.TP...............DGYTW--H-------------------
A0RAF7_BACAH/78-185ENNPDLQKKFTP-------------EQLEQIKYGE.TP...............DGYVW--H-------------------
C2SK99_BACCE/69-176ENNPDIRGQFTE-------------EQLEQIEAGD.TP...............EGYVW--H-------------------
Q3IK23_PSEHT/83-190ENGTLNCSKFSE-------------RQLDQIKNGD.KP...............EGFTW--H-------------------
A8RX43_CLOBW/127-235ENDPELRSKFTE-------------EQLKDIEEGR.TP...............TGYVW--H-------------------
B6BJ56_SULGG/68-165EEDEELRNFFTN-------------RQLKQIYIGK.NP...............EGYTW--H-------------------
C9PRI4_9PAST/54-160QDGQINVKQFNK-------------KQLSQINQGRPNI...............DGFTW--H-------------------
C9PRJ7_9PAST/54-160ERGEVNKNQFTD-------------QQLKEIYSGKAQI...............NKYTW--H-------------------
B4AH22_BACPU/149-244NSNITLMGKFTK-------------AQLKEIDAGK.TP...............TGYTW--H-------------------
C3IFI1_BACTU/72-167MEDPKLASKFTK-------------EEIELFRIGK.TP...............ENYTW--H-------------------
C2REC0_BACCE/276-371IKDPDLASRFTK-------------EEIQMFKQGE.TP...............KHYTW--H-------------------
A0RG76_BACAH/252-347LEDPKLAAKFTA-------------EEIELFKNGQ.KP...............KTYTW--H-------------------
A0A011S190_BACAN/304-399MKDPKLAAKFTE-------------EEIELFKLGE.VP...............ENYTW--H-------------------
C2RQF7_BACCE/478-573MKDPNLAKQFSQ-------------TDIELFKLGK.KP...............KSVTW--H-------------------
D0W6H7_NEILA/84-183KRGKVRSSAFTT-------------KQLKAIEKGKDKI...............PGYTW--H-------------------
A6CCT8_9PLAN/320-434IKNKVNFQGFNP-------------VQLRQIMGGKKNI...............DGLTW--H-------------------

PF14411

R5NTS8_9CLOT/325-402----------------------------------------------------.ESFEL--H-------------------
A6X424_OCHA4/965-1043----------------------------------------------------WEPIQL--H-------------------
X2HIJ6_9NEIS/339-420----------------------------------------------------.KQMNL--H-------------------
R7I8K6_9FIRM/294-372----------------------------------------------------.EEYQL--Y-------------------
I0GP52_SELRL/2256-2337----------------------------------------------------.KPIEL--H-------------------
C4L6I7_EXISA/94-169----------------------------------------------------.EPIDL--H-------------------
YOBL_BACSU/514-595----------------------------------------------------.TQINL--H-------------------
R6G1G6_9CLOT/481-566----------------------------------------------------EAKIEL--H-------------------
R5BMP6_9FIRM/156-232----------------------------------------------------.KIIEL--H-------------------
R6YJH0_9BACT/81-157----------------------------------------------------.DPYEL--H-------------------
R5KIU8_9CLOT/284-360----------------------------------------------------.KRINI--H-------------------
U5MY94_CLOSA/168-249----------------------------------------------------.TKIEL--H-------------------
V5XPW9_ENTMU/418-494----------------------------------------------------.NPINL--H-------------------
I5AXJ5_EUBCE/328-406----------------------------------------------------.KRFDL--H-------------------
C7N7K8_SLAHD/61-142----------------------------------------------------.KPVQL--H-------------------
Q7N7K5_PHOLL/272-349----------------------------------------------------.KPVNL--H-------------------
Q8DV32_STRMU/147-222----------------------------------------------------.KPFNL--H-------------------

PF05315

J9R1X7_RIEAN/2-219-------M--LG-------------INGNSINTKIEIDHKDGRKDNDRVSNIKTQRLEDFQPLSKAANDAKRQICKRCKE
Q7VHB6_HELHP/4-221-------M--LG-------------ICGKSENTKIEIDHKDGRKNDLRISNQQTQKLEDFQPLCKAANDVKRQICKVCRE
F4HDL7_GALAU/5-226-------M--LG-------------VKGFSENTRIEIDHKDGRKNDLRVSDINSQHIDDFQPLCKAANDVKRQICKRCKE

PF03165

O15968_DROME/217-326-------L--IP.....................................-...........CKTQTVWEPHVTAS.....
NFIA_MOUSE/91-195-------V--LS.....................................-...........N.PDQKGKMRRIDCLRQAD
Q9NH63_SCHMA/29-129-------T--IP..............................RSLDGRL-QV...........AQKKGLPHVFYC.....
B4IKX2_DROSE/29-129-------T--VP..............................RSKPAPA-GE...........HLRKGLPHVIYC.....
Q8T8C9_HALRO/30-148-------V--IYWSDWKNHVR...........SKLDIGGINGSYNNGST-DI...........ASHKLHPHVWFC.....
Q09631_CAEEL/112-215-------.--IS.....................................-.V...........ADQKGKMRRIDCLRQAD
SMAD2_RAT/41-171-------T--IPSTCSEIWGLSTANTVDQWDTTGLYSFSEQTRSLDGRL-QV...........SHRKGLPHVIYC.....
O57475_XENLA/39-131-------M--VT..............................R......-...............HGPPPHLLLC.....
SMA3_CAEEL/28-134-------T--IA..............................KSLDGRL-QV...........SHKKGLPHVIYC.....
SMAD6_CHICK/106-204-------L--VA..............................RG.ELRL-G............AARRPPPHLLLG.....
O17532_CAEEL/145-246-------T--IP..............................RTLDGRL-QV...........HGRKGFPHVVYG.....
SMAD6_MOUSE/173-271-------L--VP..............................RA.DLRL-G.............GQPAPPQLLLG.....
Q21733_CAEEL/36-132-------P--AH.............................NEKLIGNF-G...................RAIMC...VL
Q9YHB1_XENLA/59-158-------L--LP.............................AAKLDSRL-G............QQAFSLP.LLLC.....
SMA2_CAEEL/26-129-------T--IP..............................RSLDGRL-QI...........SHRKALPHVIYC.....
SMA4_CAEEL/168-268-------T--IQ..............................RSLDGRL-QV...........AGRKGVPHVVYA.....
SMAD9_HUMAN/34-135-------T--IP..............................RSLDGRL-QV...........SHRKGLPHVIYC.....
SMAD4_PIG/36-137-------T--IQ..............................RTLDGRL-QV...........AGRKGFPHVIYA.....
SMAD7_HUMAN/92-202-------L--LP..............................GRLDCRL-GPGAPAGAQPAQPPSSYSLP.LLLC.....

PF14279

C1EJZ2_BACC3/4-72EH-----V--IP-------------------------------------------------------------DSING..
A1SZ92_PSYIN/4-75EH-----I--IQ-------------------------------------------------------------NSIGG..
D2ZR44_METSM/3-73EH-----V--FP-------------------------------------------------------------ESIGG..
C6CI95_DICZE/4-73EH-----V--IP-------------------------------------------------------------SAIGG..
Q636Z7_BACCZ/5-73EH-----V--FP-------------------------------------------------------------DSLGG..
B2JC00_NOSP7/3-73EH-----I--FP-------------------------------------------------------------DSIGG..
C2W902_BACCE/4-67QH-----V--IP-------------------------------------------------------------EILCG..
B5SI46_RALSL/7-76EH-----I--IP-------------------------------------------------------------NAIGG..
Q73LN7_TREDE/4-73EH-----I--IL-------------------------------------------------------------NSMGG..
B6VX81_9BACE/8-77EH-----I--IL-------------------------------------------------------------NAIGG..
C3XCW2_OXAFO/4-84EH-----V--IP-------------------------------------------------------------QFLGGAY
A7C0Y7_9GAMM/4-72EH-----V--IP-------------------------------------------------------------DSLNG..
A4J8Y0_DESRM/4-73EH-----I--LL-------------------------------------------------------------NSIGG..
B1XMH2_SYNP2/4-84EH-----V--IS-------------------------------------------------------------QFLGGAQ
A0A026XQU1_ECOLX/4-74EH-----V--IP-------------------------------------------------------------ETIGG..

PF13391

Q3ZJ53_PSEAK/128-185NF-----IPSAP....................FGES.....................................LVVHH..
Q3ZJ54_PSEAK/137-183HH-----L.................................................................NSWDS..
B0D1S8_LACBS/452-520CH-----I..IM....................VSEPQTW..................................KDLKARS
D3DZU5_METRM/268-314HH-----I..FS.............................................................YQNNP..
A1ZMP4_9BACT/24-72HH-----I.................................................................TDRSE..
A0JZY1_ARTS2/483-533HH-----T..TY....................WS.......................................HGGTT..
B6QT68_PENMQ/172-253AH-----I..YP........NSLGPTGYKLELWDRLRLFW.................................SEEKVNK
C6H8C1_AJECH/170-261AH-----I..YPHCLIRPATPPNERTEAIQSFWKTLEFFWKPEQI............................QQWRQEI
C0SHG6_PARBP/129-219AH-----I..FP.HFMINTKPSTNLDASIPPFWNLLDVFFEPDRL............................NRWRAEI
C0NVL4_AJECG/128-219AH-----I..FPHCMINETPPQTSLAAAVPPFWKLLHFFFEPDRL............................NRWRAEI
A1CN99_ASPCL/176-240SH-----IFSYR.............................................................HGQAAMD
B2WD78_PYRTR/182-246SH-----IVACR.............................................................HGQEMMT
C0SG59_PARBP/145-228VH-----I..IPPRI................SYNKTAKTLISK..............................FTGGQ..
Q7SBL2_NEUCR/148-212AH-----L..VP...........................................................RSLGTDIMV
B8HI49_ARTCA/207-262AH-----I..KP.............................................................RSACS..
C5QBZ5_STAEP/274-329SH-----I..WS.............................................................FNDAM..
D0MUB8_PHYIT/175-238SH-----L..FR.............................................................RSNEN..
A8ILS7_CHLRE/241-301AH-----L..FK.............................................................HCWKD..
A1ZEN4_9BACT/211-269CH-----I..EP.............................................................FHIHG..
B3R3B4_CUPTR/129-182SH-----S..LA....................WGRC.....................................ETDEQ..
C5A9D8_BURGB/190-242SH-----A..MA....................WADS.....................................NDDQR..
Q58AC3_RALME/314-368AH-----I..HR....................WADC.....................................GDTPT..
Q97AT3_THEVO/116-167SH-----IKDVF.............................................................LFPED..
Q2H3K5_CHAGB/194-260SH-----L..IP....................FASSTWF..................................LVNNMSQ
Q1Z8V3_PHOPR/45-99SH-----I..KP.............................................................LAQCE..
C9RJH3_FIBSS/236-289CH-----A..KP.............................................................CAACE..
A6WRD3_SHEB8/155-207CH-----I..VP....................WSQA......................................SNAE..
Q1LAG0_RALME/217-269TH-----L..KP....................WSAC.....................................TDAER..
Q8EUF0_MYCPE/252-316SH-----I..EP............................................................VYSIVQDD
Q0HZ27_SHESR/183-234SH-----I..KP....................WAES.....................................ELVEK..
A8RAR8_9FIRM/242-295SH-----I..KP.............................................................FRDCA..
C1A2C0_RHOE4/177-236SH-----I..KP....................WRDS.....................................TGRER..
D1QVC2_9BACT/149-200CH-----I.................................................................TGWAE..
B4RPU5_NEIG2/270-321SH-----I..KP.............................................................FILSD..
A9M531_9VIBR/136-187SH-----I..KP.............................................................WSIDE..
A0YQ47_LYNSP/170-221SH-----I..IP.............................................................WSIRL..
C6SD53_NEIME/264-320SH-----I..KP.............................................................YMVCI..
A5UCN4_HAEIE/226-278SH-----I..KP.............................................................WAKSN..
B0P0S7_9CLOT/157-209SH-----I..KP.............................................................WSECK..
Q8XKY3_CLOPE/181-233SH-----I..KP....................WSKS.....................................TPEEK..
C4Z3W1_EUBE2/283-335SH-----I..KE.............................................................WAESS..
Q6KH34_MYCMO/262-326SH-----I..KS............................................................VENIVKDK
B5JL75_9BACT/10-62SH-----I..KP....................SSVC.....................................TAIEK..
D2MUA6_CAMJU/249-300SH-----I..KP.............................................................YRVCD..
A9M540_9VIBR/208-261SH-----I..KP....................WALC.....................................DSDKE..
C5TPE4_NEIFL/171-223SH-----I..KP....................WSVC.....................................NNKER..
B5ND07_SALET/226-278SH-----I..KP.............................................................WRVSN..
A0A017QNN2_SALET/161-214SH-----I..KP....................WAACE....................................NGNER..
C7JF14_ACEP3/216-269SH-----I..KP....................WRVCE....................................TGTER..
B6ESV9_ALISL/277-329SH-----I..KP.............................................................WREAN..
A7HHG5_ANADF/218-270SH-----I..KP....................WRHA.....................................TNDER..
A3WLG5_9GAMM/162-214SH-----I..KP.............................................................WSESN..
Q2NS53_SODGM/141-193SH-----I..NP.............................................................WKDFS..
Q11XS6_CYTH3/195-247SH-----I..HP....................WKDA.....................................TDKER..
A6LR77_CLOB8/228-280SH-----I..QR....................WAES.....................................NDNER..
D5SYQ3_PLAL2/147-198SH-----I..IP....................WSES.....................................IERRA..
A3SEH6_9RHOB/147-198SH-----I..VG....................WQED.....................................DAQRF..
A3IFP0_9BACI/201-253SH-----I..KP....................WKDS.....................................NDNER..
B3E6K1_GEOLS/248-298GH-----I..KP....................WKDS.....................................DNSER..
Q0YRR0_9CHLB/151-202GH-----I..KP....................WSSD.....................................EKNRL..
D4L965_9FIRM/137-189SH-----I..KP....................WRSA.....................................SNYER..
D1NWA4_9BIFI/170-222SH-----I..KP....................WAQS.....................................DATER..
A9VZD9_METEP/165-217SH-----I..KP....................WTAS.....................................NDYER..
A0A008B479_STAAU/218-269TH-----I..IP....................WHE......................................NEFIR..
C7TDF7_LACRG/286-337SH-----I..IP....................WASS.....................................PENRL..
C7RPH5_ACCPU/152-203SH-----I..LP....................WASY.....................................PAHRV..
D2QD13_SPILD/151-202SH-----I..VP....................WSKD.....................................ERARV..
A4G160_HERAR/158-209SH-----I..VP....................WHTD.....................................SNHRL..
A3XG80_LEEBM/154-205SH-----I..LK....................WSEN.....................................QNERL..
C6H7Y4_AJECH/166-242CH-----I..VP....................FSLNQQSSRASFFELLR........................ILWPRRF
C5G0R2_ARTOC/156-239AH-----I..FP....................YSLQESWKLDNPNNNF..WTLLKTFW...............TEDHVNT
D4DG81_TRIVH/144-227AH-----I..FP....................FSMRYAQSPEASNDIYSPWRVLRR.................FWTEDKV
D4AWU5_ARTBC/72-157AH-----I..FP....................FSMRGLQAPDIVNDTYNPWSVLRMFW...............GQERVDA
D4AWT1_ARTBC/153-252AH-----I..LP....................FSLGKFDGDKAIETENKARIWQ...................CLYRYFP
C6HSV2_AJECH/189-299AH-----I..LP....................HSLTKMSEDLQLNDARRTTIG....................ILNMFDC
C4JTW4_UNCRE/156-261AH-----I..FP....................HSLTQMNVNLQLGNSR.........................QTTIGIL
C5FX47_ARTOC/172-283AH-----I..LP....................HSLMSTGGQQELSESKKSALA....................ILNLFDH
C5GIN7_AJEDR/149-259AH-----I..IP....................HSIMSTTRDNQSEAKKSTLA.....................ILNMFAP
C5FYU3_ARTOC/192-299AH-----I..IP....................HSIMSSKTTNELSTAKKTALS....................ILNMFDR
C5PG06_COCP7/175-290AH-----I..IP....................HSIMSTTATVSGELQLSESKKTAL.AILNM...........FDPGV..
A1DHZ4_NEOFI/144-238AH-----I..IP....................FAIAKFENDAERQRMIAIWVKM...................FRYFPSI
C6HH53_AJECH/147-240AH-----I..IP....................FSLASFSGEEERLRTSTIWTNI...................YRYFPSL
C6HB07_AJECH/162-258AH-----I..IP....................FAYASWHNISGEKNAANVWET....................LFRCFPS
B6H206_PENCW/172-270AH-----I..IP....................FSYGFWNSSQSPPPDMATAWEV...................LYRCFPA
B6HJB7_PENCW/110-203VH-----I..IP....................FSLASWSTKSEGYAKHIIWTN....................LIRHFPT
C5FNT1_ARTOC/164-228AH-----I..FP...........................................................LSLGQRSMA
D4D4G1_TRIVH/160-225AH-----I..FP...........................................................LSYGQQAMD
D4AWT5_ARTBC/163-226AH-----I..FP...........................................................LSIGPKAME
B0CQV9_LACBS/112-197AH-----I..FP....................LQYHDLWDRKEYSQIVVDP......................YSVAIRS
B1VR35_STRGG/22-91AH-----I..VA.............................................................RSKGG..
B0CUP6_LACBS/82-165TH-----L..SG....................WLHKRF......................YEHINDPGGTPSLQAQVD..
C4JQB0_UNCRE/171-234AH-----I..VP............................................................KSLDPDAI
C4JDN9_UNCRE/60-122AH-----I..VP............................................................RSLDKKSL
B6HCX9_PENCW/194-295AH-----I..TP....................YSYASWKTLVYTLPIRMRTKRTSAWT...............FLYESFP
A2QGH8_ASPNC/178-274AH-----I..VP....................FSYVNWNTST..................PLPQDSTIWEALMRCFPG..
A2QG51_ASPNC/197-280AH-----I..IP....................ASVCDTTTPTKKLKFLEFKALLRM.................FWSQETI
B8P2J0_POSPM/349-413CH-----V..VP....................RRTD.....................................DRTCAKV
B8P2H7_POSPM/369-433CH-----V..IP....................RGTN.....................................GNLRRRL
B8PJ67_POSPM/96-161CH-----V..VQ....................RATYH....................................SELKHLE
B8P061_POSPM/98-163CH-----V..LP....................RATKP....................................HVLTPLE
B2WQ71_PYRTR/178-242AH-----I..VP....................QAELDWW..................................MANSM..
C7ZJS1_NECH7/14-80AH-----I..VP....................RASGYWF..................................EYNSMAR
C7ZR37_NECH7/151-217AH-----I..IP....................ASQSKWW..................................RRNDMSQ
Q0CEY0_ASPTN/158-237TH-----I..WP....................LAREGTWNATPQLHG..........................WITDT..
C7ZM78_NECH7/156-223AH-----L..VP....................SAQSHWWT.................................INLMKRY
B6H0Z1_PENCW/209-303AH-----I..IP....................FALGSFQANDGE................AVDRNATIWVNLRRYFPV..
B0DGI4_LACBS/197-310CH-----N..LP....................RVISSFDNDRKSDSTCISLIRDRFLCIQFTSAVTSFDILANFTGLP..
B0DGX0_LACBS/22-98AH-----I..FP....................RAHVDEWVSKQF................HHL..........VTDTA..
B5JTG3_9GAMM/205-258AH-----L..EE.............................................................FRIRG..
C0NM18_AJECG/69-132AH-----I..VP....................REEETW...................................YARNG..
C0NFG2_AJECG/145-208AH-----L..IP....................KEEA.....................................TWYTRNG
B0CU30_LACBS/126-203TH-----I..FP....................VAHRDVWDLLQL................SQ...........HIRDD..
A1C9L4_ASPCL/21-95AY-----I..AP....................LSLDEI...................................CMGRGFS
C5FQP7_ARTOC/116-187AH-----I..FP....................LSLS.....................................SLFTQIG
A1CHP5_ASPCL/119-193AH-----I..FP....................LALDSI...................................FASQGFQ
C1ME87_9ENTR/110-159AH-----L..IE.............................................................HHKAG..
D4D3B7_TRIVH/114-186AH-----V..FP....................LALS.....................................MIFSSCG
C5FLW1_ARTOC/116-189AH-----I..IP....................LSLSD....................................SYLSSKF
C5FGM1_ARTOC/115-187AH-----I..FP....................LALS.....................................ELFSSFD
A0A031MZ15_ECOLX/108-157AH-----I..KP.............................................................RHAGG..
L3VWH1_ECOLX/324-373AH-----L..ME.............................................................HRNGG..
B2VKG6_ERWT9/66-115AH-----L..TP.............................................................HCDRG..
E4NRW0_HALBP/214-265AH-----V..LS....................WNDY.....................................PEYRA..
Q18I98_HALWD/210-261SH-----V..LS.............................................................RSKHP..
E4NSD1_HALBP/243-294AH-----I..LP.............................................................RSQRP..
C7ZR46_NECH7/227-313CH-----I..VP....................QQHYHVYPDPDGLSDLA........................DADVFYS
C7ZLG5_NECH7/248-329CH-----I..VP....................QQHYHVYPVPSS.............................FPGGRYD
B8G8J9_CHLAD/36-82AV-----L..RP.............................................................VLIDP..
A0A034USF7_ERWAM/216-274EH-----A..WP....................W........................................VEACHIN
E7FSP2_9LACO/263-324AH-----I..WP.............................................................VYKIRKS
D0FXK4_ERWPE/274-335AH-----I..WP.............................................................VSEIKKI
F3RA44_LISMN/276-338AH-----I..WP............................................................VADIKADK
B9MGY9_ACIET/216-265AH-----I..IP.............................................................VSAPD..
B8F0E2_THASP/225-279AH-----V..VP.............................................................RSQFG..
A9B5H7_HERA2/140-196HH-----I..RP.............................................................LGGVH..
D7VSZ6_9SPHI/197-252AH-----I..KP.............................................................LGTPH..
Q82H00_STRAW/418-471AH-----I..QA.............................................................LGAPH..
D4GVR6_HALVD/183-239HH-----L..KP.............................................................LGRPH..
C6WB78_ACTMD/145-200AH-----I..RA.............................................................LGAPH..
D9TEC7_MICAI/400-455AH-----I..RG.............................................................LGKPH..
Q9RU61_DEIRA/197-252AH-----I..RP.............................................................LGAPH..
Q82CY5_STRAW/72-128AH-----I..RP.............................................................LGKPH..
Q2S547_SALRD/185-241AH-----I..KW.............................................................KQARG..
A6TQ34_ALKMQ/175-229AH-----I..KW.............................................................HQAGG..
C1HR67_9ESCH/182-236AH-----I..HW.............................................................KTYGG..
C5C731_MICLC/57-112AH-----I..LP.............................................................WSKFD..
D2RPV1_HALTV/388-442AH-----I..YP.............................................................KKENG..
D6SU17_9DELT/210-264AH-----I..RP.............................................................WSDTS..
Q2S548_SALRD/164-218AH-----I..KP....................WSVS............................................
A9AVZ1_HERA2/214-268AH-----I..IP....................WSRSYN..........................................
C5FYU4_ARTOC/144-210AH-----L..IP....................RSEQQWY..................................IQNRMSR
Q89W12_BRADU/199-250AH-----I..IA.............................................................DKDER..
Q1DFJ6_MYXXD/230-280AH-----I..LP.............................................................DRDER..
B1MFU6_MYCA9/186-236AH-----I..IG.............................................................DHKPN..
C2IA18_VIBCL/139-188AH-----I..ID.............................................................VAKGG..
B6H8R8_PENCW/114-188AH-----I..FP....................LERREL...................................WRQCNFD
C6HTE9_AJECH/70-135AH-----I..FP....................LEYENIWIEH...............................NYGRRIT
C5P1V7_COCP7/116-194AH-----V..FP....................LDCESVWIEFNY.............................GRWIT..
C6H7P6_AJECH/116-190AH-----I..FP....................LEKEALW..................................KQFGYGC
C6HCT2_AJECH/118-196AH-----V..FP....................VAKESLWIALNY.............................GHWIT..
E3J488_FRASU/374-423AH-----L..YR.............................................................FSDTP..
Q0TBE0_ECOL5/325-374CH-----I..IP.............................................................VKNNG..
A4JVB2_BURVG/309-359AH-----L..HG.............................................................RDWRE..
C5PCJ2_COCP7/131-211AH-----I..FP....................QARVIEWRQRGF.............................QQLVTDN
B6GYF4_PENCW/145-225TH-----V..FP....................VSMIEEWRRNGY.............................RQYITDT
D4LVH2_9FIRM/326-375AH-----I..KP.............................................................FKYKG..
Q8YML8_NOSS1/205-259AH-----I..KP.............................................................FAQFY..
A3X6R6_9RHOB/193-247AH-----I..RP.............................................................VEHDG..
D0KA46_PECWW/207-263CH-----I..SN.............................................................ERDSD..
A4WEB7_ENT38/177-224CH-----I..IS.............................................................HATKV..
C6DI05_PECCP/215-264AH-----I..IS.............................................................HAKTG..
A1WU45_HALHL/154-210AH-----V..IP.............................................................VSRAG..
D5URV1_TSUPD/190-239AH-----L..VE.............................................................VRDLN..
C2H6L1_ENTFL/305-363AH-----I..MP.............................................................FSAED..
D2NQL0_ROTMD/260-309AH-----L..YS.............................................................YAREG..
C6WN85_ACTMD/211-260AH-----L..RA.............................................................FAVHE..
Q5KQA0_CRYNJ/196-257SH-----I..VP............................................................ASRPDIYD
D0FXE6_ERWPE/297-346CH-----I..ED.............................................................YALGG..
C1MEC3_9ENTR/183-232AH-----I..EP...............................................................TSV..
B5XX93_KLEP3/359-407AH-----L..VQ.............................................................HARKG..
Q82H23_STRAW/235-284AH-----L..RP.............................................................DAEDG..
D5UBZ3_CELFN/122-171AH-----V..IP.............................................................VADGG..
A6UKM8_SINMW/8-59AH-----I..VP.............................................................FSEDT..
D2B5N9_STRRD/214-263AH-----I..RP.............................................................VSAGG..
B2FKB8_STRMK/193-242AH-----I..VP.............................................................YNGAS..
C5CHS9_KOSOT/197-246AH-----I..DP.............................................................YLGEN..
A7ZNC8_ECO24/319-367AH-----I..EP.............................................................ATSGN..
A4NNK4_HAEIF/325-374AH-----I..KP.............................................................YAYGG..
A4E9S5_9ACTN/247-296AH-----I..EN.............................................................YSGPK..
M7P179_KLEPN/397-443AH-----I..EP.............................................................VGTGN..
B4UFQ3_ANASK/203-252AH-----I..RP.............................................................YGAEG..
A4V6X0_PSEFS/373-422AH-----I..IP.............................................................YRGNQ..
C8S3P5_9RHOB/198-247AH-----L..HR.............................................................YGGVN..
E8YPK5_9BURK/129-178AH-----I..VP.............................................................HALKT..
D1P2G2_9ENTR/241-290AH-----I..RP.............................................................YQGRW..
B1XPM9_SYNP2/314-363AH-----I..FP.............................................................YQGTQ..
B0RXA4_XANCB/309-358AH-----I..LP.............................................................YRGDH..

PF13930

D0LUR7_HALO1/91-222GH-----L--IG-------------------------------------------------------------SQLGGWG
B0UVC7_HISS2/2603-2730GH-----L--LA-------------------------------------------------------------SMFGGAG
YEEF_BACSU/525-655GH-----L--IA-------------------------------------------------------------TQFKGSG
A8FDL6_BACP2/98-224GH-----L--IA-------------------------------------------------------------SIFKGSG
Q7N913_PHOLL/198-325GH-----L--IA-------------------------------------------------------------SIFGGPG
A8FDL4_BACP2/498-628GH-----L--IA-------------------------------------------------------------TIFKGSG
Q9K6M4_BACHD/424-550GH-----L--IA-------------------------------------------------------------SIFKGSG
Q5WJ65_BACSK/469-594GH-----L--AA-------------------------------------------------------------DRFGGSP
Q21NY0_SACD2/315-455GH-----L--IA-------------------------------------------------------------TLFQGPA
C0R0R8_BRAHW/45-173GH-----I--IG-------------------------------------------------------------RQFGGSP
D2QLJ8_SPILD/282-421GH-----M--VA-------------------------------------------------------------SQFYGPS
D6S5M6_9LACO/124-258CH-----L--IG-------------------------------------------------------------YQLTGQN
B0RGD0_CLAMS/624-751GH-----L--AA-------------------------------------------------------------DAAGGSP
Q74IV6_LACJO/120-254SH-----L--IG-------------------------------------------------------------YQLTGQN
Q1G8G9_LACDA/127-261SH-----L--IG-------------------------------------------------------------YQLTGQN
Q03WR4_LEUMM/85-232SH-----L--IG-------------------------------------------------------------YQFTGLN
C2X0R6_BACCE/409-538GH-----L--IG-------------------------------------------------------------TQFNGSP
Q5FK46_LACAC/120-251CH-----L--IG-------------------------------------------------------------YQLTGQN
Q835Q6_ENTFA/75-202GH-----L--IG-------------------------------------------------------------RQMGGSG
R5U617_9FIRM/67-203AH-----L--IG-------------------------------------------------------------FQLAGEN
T0UB90_9ENTE/93-224TH-----L--IG-------------------------------------------------------------FALAGEN

PF06147

A7MHN7_CROS8/117-334PR-----VVALT--------------------IDPESPESYMLRPKRRRWENEKYTRWVKQQPCACCN....QRADDPHH
A3MZM0_ACTP2/134-333QP-----ILKLK--------------------ADPEPPASFMAKPKEKRFESSKWLQFVKSQPCVCCG....KRADDPHH
Q7ME22_VIBVY/140-345KP-----VLKLS--------------------VDEDPPLLYMRKPKPTTYTSEAYLAFVRKLPCVVNGPGTERDPVVAHH
M9X5K0_PASHA/139-336E.-----TLKLK--------------------VEPEPLAAFMAKPKLQRFEWRKWLQFVKAQPCMCCG....QQADDPHH

PF01223

Q95TI9_DROME/65-324AG-----F--FD--------------------GKNVDKL.YTQATQLETINNELG..GDAEKYFDSSSN.VYLARGHLGA
E7S4P9_STRAG/86-283IN-----G--LK--------------------GSYNHA..................................VDRGHLIG
Q7NPI0_GLOVI/39-265DS-----A--LP--------------------SGWYRVA.SDDYTNS.......G.................YDRGHMTP
Q8A1U5_BACTN/46-275DP-----N--IP--------------------QA.DQRV.QSDFGKQ.......G.................YDRGHICA
Q8KGT7_RHILI/434-688DP-----R--IP--------------------QKYQLGD.PDIYAPAKQ.......................IDRGHIVR
Q7QK21_ANOGA/167-356GN-----F--YP--------------------GVTVNTL.YTVNMQRETIATILDSQPRADELVQTTNNGIYMARGHIAA
Q8I9M9_PARCM/131-389ST-----G--FF--------------------SVSMSTV.YSQASQLQLMTDILGDSDLANNIIDPSQQ.LYFAKGHMSP
Q26707_9TRYP/117-408DM-----T--VP--------------------QL.FRVQ.PGDYIGGGRGQDSRG.................LSRGHLAA
Q8IPZ0_DROME/71-300DL-----S--VP--------------------SN.FRSE.LSDYRRS.......G.................FDRGHLAA
Q7QH21_ANOGA/177-440GE-----F--YG--------------------DLKMATL.YSFAAQHATLARILSSPARADALLSSKKG.LFFARGHLAA
NUCA_NOSS1/42-263DK-----T--LP--------------------AGWVRVT.PSMYSGS.......G.................YDRGHIAP
Q9VGU3_DROME/132-362DN-----T--IP--------------------TI.FSAN.MRDFKNS.......D.................WVGGHLAS
Q8YKN2_NOSS1/41-276DT-----T--LP--------------------SGCYRVT.SSDYTGS.......G.................FDRGHMAP
Q6TRY8_CULQU/109-345SF-----V--CP--------------------GLRYNTH.YTQASQK..................QPDPRFYFQRGHLFP
Q9VU22_DROME/1089-1351GD-----F--YG--------------------GKDVNTL.YTQVQQNITVSEILG..MDASPYFNTTGN.VYLARGHLSA
Q7NI85_GLOVI/113-335DE-----S--LP--------------------VSFYRVN.PADYTGS.......G.................YDRGHLVP
Q8RE47_FUSNN/335-559DP-----R--IS--------------------QNYQYG..DEVYVNND........................LDRGHLVR
Q9ZJL1_HELPJ/54-273DT-----R--LA--------------------EY.QQAV.TQDYTRS.......G.................FDRGHFVA
A9QSL0_LACLK/41-258YN-----F--YY--------------------KKSDGSI............................GKMWLMARGHLVG
NUC1_CUNEE/3-231DP-----D--VP--------------------SL.FRST.LADYSGS.......G.................FDRGHMAP
A0A031RVU6_SERMA/25-246DP-----A--LN--------------------PA.DTLA.PADYTGA...NAALK.................VDRGHQAP
NUCG_MOUSE/57-282DD-----S--VH--------------------AY.HRAT.NADYRGS.......G.................FDRGHLAA
Q9AAQ2_CAUCR/422-665DA-----R--ID--------------------PACQYT..AKHYGDQA........................IDRGHMVR
Q9VVV1_DROME/147-406GG-----Y--FA--------------------GKNVDKL.YTQAVQKETIDKELD..MDSSRFFDSAKN.IFLARGHMGA
PNU1_SCHPO/59-291DD-----N--IP--------------------EM.FQAK.LGDYRGS.......G.................YDRGHQVP
Q7PZ31_ANOGA/114-367NG-----A--PA--------------------NVPFATA.YTQAQQLKRFTDLLGSAAQAQRFISSGS...NLERGHMVP
C6IP62_9BACE/145-363DP-----S--IP--------------------SQ.YRTH.DGDYTGS.......G.................YSRGHLAA
Q7PVB8_ANOGA/98-351AG-----T--AP--------------------HVQPATS.YTTAQQAIRFAQLLGSQAQADRFITSSS...YLSRGHLSP
A0A029S9H5_STRPY/60-262NK-----N--GE--------------------VYVIKGLGDDSYQGY........................FWNKSHLIA
Q9VAU2_DROME/106-358DQ-----L--SG--------------------GFDNA...YEGRATQACLLTNLG..........AVQPQCKFDRGHMTP
A0A029S6E3_STRPY/70-270NP-----N--HV--------------------KYKIEWLNGLSYVGD........................FWNRSHLIA
Q8RLY2_SALET/51-274DP-----D--LP--------------------PS.DTLA.PSAYKNA...HTLLK.................VDRGHQAP
NUC1_YEAST/55-290DE-----V--IP--------------------EK.FRGK.LRDYFRS.......G.................YDRGHQAP
E9DD73_COCPS/73-305DQ-----S--IP--------------------AA.FRAK.LSDYFRS.......G.................YDRGHQVP
Q8DFB3_VIBVU/21-232DA-----E--LP--------------------DY.ARST.LADYSNS.......G.................YDRGHLAP
O33735_STRPY/73-293YF-----F--KN--------------------TNQRATESDYKHSPKNVSKISNNIKASILLSNGNVRNGYLFDRSHLIA
Q9I417_PSEAE/377-604DP-----R--IE--------------------AAAQVGH.KDFYGPAS........................FDKGHMVR
Q7Q2Q3_ANOGA/93-346TG-----V--PS--------------------SVMVDTS.YTIKAQQTRLADLLGSSTQAAKYVNSTN...YLARGHLTP
O73911_CHICK/38-276EP-----Q--LM--------------------GLSYPKTMEREWTLSKYYSVTSEQLGKSQAILQDYKNLTGLNRGHLNP
Q8K6B9_STRP3/69-287FY-----N--RA--------------------DNEEISEKEYDSRRTKSYKVTNNVPVVLTTLKGKQYNSHLFVRSHLFA
Q7RY75_NEUCR/71-303DE-----A--IP--------------------EK.FRGK.LKDYFRS.......G.................FDRGHQVP
B0RUP9_XANCB/8-230DT-----D--LP--------------------SGCAGQT.TTNSYAS....VRSG.................YDRGHLVT
A5M2Y5_STREE/74-272VK-----N--LK--------------------GSYTHA..................................VDRGHLLG
Q8Y1E6_RALSO/63-274DA-----R--LP--------------------SV.ERAE.LADYRGS.......G.................FDRGHMAP
Q8PFE6_XANAC/65-274ET-----G--IP--------------------AA.DRSK.SSDYTNT.......G.................YDRGHMTP
Q9VAU3_DROME/102-344DG-----V--IS--------------------GADEAS..YTVRNIHGTFRRLFG....NNQNYIPNNRDVIINRGHLAA
Q8TKR8_METAC/401-625DP-----R--LD--------------------QRYQAG..PKLYKGNP........................LDRGHLVR
EXOG_MOUSE/58-287DP-----S--VP--------------------SA.FSAL.NEDYIGS.......G.................WSRGHMAP
Q9VU24_DROME/166-420AG-----H--FT--------------------GFDMARI.YSPKSQEKLM.........VPGLIDVKSG.LFLARGHLTA
C0X3R4_ENTFL/87-279KQ-----I--DG--------------------DPI.....................................VNRGHLLA
M9N460_ASHG1/44-272DE-----E--IP--------------------ET.FRAR.LRDYFRS.......G.................YDRGHMVP
F3IR03_PSESL/68-291DG-----R--LP--------------------AEAQIG..ESVYADNL........................LDRGHLVR
C6IET4_9BACE/64-276DP-----L--VK--------------------GA..IAT.NADYARS.......G.................YDKGHMAP
NUC1_SYNRA/71-306DT-----D--IP--------------------EM.FRAH.LKDYVSS.......G.................YDRGHQAP
Q9U5L8_PENJP/126-384ST-----G--FF--------------------TVSMSTC.YTQNSQLASMKILLGDDDLANAIINPHEQ.YYFAKGHLAP
NUCG_CAEEL/65-293DI-----T--FP--------------------QK.FLSQ.NTDYKCS.......G.................FDRGHLAA
Q7USW1_RHOBA/592-846DR-----R--IG--------------------AHEQTN..NDHYRGRDNK......................LDRGHLVR
Y4FB_RHISN/398-641DP-----R--IP--------------------EELQNG..DELYGDEPVPSKNY..................FDRGHLVR

PF14414

D0W6H7_NEILA/149-191HQ-----D--T.--------------------.....GR-----------------------------------------
B1J8X4_PSEPW/63-111VD-----D--YG--------------------PVTSKGT-----------------------------------------
B3PHU6_CELJU/392-431LP-----A--T.--------------------.....YK-----------------------------------------
D3L0R9_9BACT/153-195SE-----R--P.--------------------.....GV-----------------------------------------
B5GPR2_STRC2/109-151VR-----G--T.--------------------.....RR-----------------------------------------
Q1QCA3_PSYCK/161-203CK-----D--C.--------------------.....QT-----------------------------------------
E5C6Z5_9BACE/106-153CP-----E--TT--------------------KE.GTIV-----------------------------------------
A5Z4R4_9FIRM/339-381LE-----D--G.--------------------.....KG-----------------------------------------
A0A011WJ18_BACTI/19-61HQ-----E--T.--------------------.....GK-----------------------------------------
B8I221_CLOCE/239-288AD-----D--FD--------------------PKSGTCS-----------------------------------------
A3IE28_9BACI/350-392LN-----D--V.--------------------.....KT-----------------------------------------
B3Z4D8_BACCE/173-215TE-----V--P.--------------------.....GK-----------------------------------------
E1S5U4_HELP9/196-239DA-----N--VL--------------------.....GN-----------------------------------------
D4DXP2_SEROD/85-134LD-----D--YD--------------------PKTNTST-----------------------------------------
B2Q7F2_PROST/252-300LD-----D--YD--------------------PITNEGT-----------------------------------------
B4EP57_BURCJ/1370-1412HE-----N--M.--------------------.....VT-----------------------------------------
C2UG56_BACCE/26-68HQ-----D--L.--------------------.....TT-----------------------------------------
Q3IK23_PSEHT/156-198HQ-----E--T.--------------------.....GA-----------------------------------------
H2GD98_CORD2/1209-1251HQ-----D--T.--------------------.....GR-----------------------------------------
B6BJ56_SULGG/129-173DG-----N--PP--------------------P....GR-----------------------------------------
C9PRI4_9PAST/124-168NA-----Q--SA--------------------P....NN-----------------------------------------
D0W666_NEILA/32-76NA-----Q--SP--------------------P....NN-----------------------------------------
B7HC27_BACC4/136-177HQ-----I--P.--------------------.....GK-----------------------------------------
A6CCT8_9PLAN/400-442HQ-----D--I.--------------------.....GR-----------------------------------------
A9AVI8_HERA2/3027-3069HQ-----D--R.--------------------.....TT-----------------------------------------
A5Z4R0_9FIRM/19-65ME-----D--G.--------------------.....KS-----------------------------------------
A8RX43_CLOBW/197-243NE-----E--P.--------------------.....GK-----------------------------------------
Q7MZK5_PHOLL/1371-1416EN-----Q--P.--------------------.....GK-----------------------------------------
A4JB11_BURVG/1495-1544HP-----C--RK--------------------.....GV-----------------------------------------
C2LFQ4_PROMI/165-214EA-----S--QP--------------------.....GV-----------------------------------------
C6MAI9_NEISI/47-95HE-----D--T.--------------------.....KR-----------------------------------------
A3KB10_9RHOB/227-274NE-----N--G.--------------------.....TT-----------------------------------------
A0A011SXZ9_VIBPH/1318-1364HQ-----D--G.--------------------.....KT-----------------------------------------
D2YA40_VIBMI/1355-1403EV-----E--D.--------------------.....GL-----------------------------------------

PF14410

B9M483_GEODF/74-140GH-----R--..--------------------..RKWRDELKHAGV.---------------------------------
B2JXD4_BURP8/2948-3016DH-----Q--.P--------------------.PWSQRDLTG.....---------------------------------
A4LGH9_BURPE/147-215DH-----Q--.P--------------------.PWSTRDLSG.....---------------------------------
B9LCH9_CHLSY/270-334DH-----T--.P--------------------...PWRDRVARM..F---------------------------------
C2RQE1_BACCE/43-125DH-----Y--.P--------------------DTWAERVASMKTGEV---------------------------------
C8NB27_9GAMM/65-134GH-----K--.D--------------------.GYEHRRLALAAHEI---------------------------------
A7JRY2_PASHA/3122-3192GH-----M--.Y--------------------.GWEHRRLSLAAKEL---------------------------------
E2P5A9_PASHA/3105-3174GH-----M--.Y--------------------.GWEHRRLSLAAKEL---------------------------------
F1WWY7_MORCA/195-265GH-----T--.Y--------------------.GREHRRLVLAAEQT---------------------------------
F1WTR8_MORCA/82-151GH-----T--.Y--------------------.GREHRRLVLAAEQT---------------------------------
D3A0M0_NEIMU/642-712GH-----K--.Y--------------------.GWENRRILKAADEL---------------------------------
D6ZD49_SEGRD/415-489GH-----E--.Y--------------------.DREWWRLQEEARSA---------------------------------
D6ZB38_SEGRD/420-491GH-----I--.K--------------------.YSEWARLRNDAIAK---------------------------------
B8I219_CLOCE/1270-1339GH-----V--.Y--------------------.GREFWRERDKAEDK---------------------------------
E4NNI9_HALBP/322-399GH-----K--.K--------------------.QREYRYLLEYYQQG---------------------------------
E4NLC7_HALBP/333-403GH-----K--.P--------------------.RREYWYLVEYYLRG---------------------------------
D4YN65_9MICO/242-321GH-----R--.E--------------------.GHEYRKTYKDYMSG---------------------------------
D7JC47_9BACT/1-57GE-----G--..--------------------.....MDRVKSAAKR---------------------------------
Q48JD7_PSE14/299-370GH-----K--.P--------------------.CFEHWKHVRSAEAR---------------------------------
D4FSV7_STROR/39-110GH-----K--.P--------------------.GHEFRKHQQSAADR---------------------------------
A5Z849_9FIRM/221-292GH-----K--.P--------------------.GYEFRKHRASARER---------------------------------
M1UI10_BACIU/451-522GH-----K--.P--------------------.GYEFRKHQQSAMER---------------------------------
Q0BGH2_BURCM/476-547GH-----K--.P--------------------.GLEHRKHVISAAER---------------------------------
Q7W1H8_BORPA/221-292GH-----K--.P--------------------.GYEHRKHVRSAKER---------------------------------
A9I1F1_BORPD/290-361GH-----K--.P--------------------.GYEHHKHVKSAAER---------------------------------
C4ZDS7_EUBR3/27-110GH-----I--.P--------------------.EAKYSEMHEAYMNG---------------------------------
C5BZG6_BEUC1/289-366GH-----V--.P--------------------.GERYHDVWERYMRG---------------------------------
Q63EY8_BACCZ/261-339GH-----L--.P--------------------.EHKYSDMHKRYLNG---------------------------------
A0A023MBG2_LACPN/545-622GH-----L--.P--------------------.GKSYKEMFNLYKNR---------------------------------
A9VI39_BACWK/230-307GH-----T--.E--------------------.GNTYKNMFEKYKNR---------------------------------
D4FSW1_STROR/66-143GH-----E--.K--------------------.GKSYKEMFEKYKNR---------------------------------
C2R1N3_BACCE/87-164GH-----T--.E--------------------.GNSYKKMFEKYKHG---------------------------------
E4NKW7_HALBP/189-266GH-----K--.P--------------------.RREYRKLHQKYISG---------------------------------
Q97IK0_CLOAB/300-377GH-----T--.P--------------------.ENKYSEWHKKYIDG---------------------------------
F2H4N8_BACTU/235-311GH-----I--.P--------------------.GEKYSDMHELYMNE---------------------------------
C2ZCH4_BACCE/166-242GH-----I--.P--------------------.GEKYSDMHELYMNE---------------------------------
B0KTG5_PSEPG/321-389EH-----N--KP--------------------.VVEHWNEVGYN...---------------------------------
D8NE31_RALSL/1447-1516GH-----K--.Q--------------------SAVDYWNTEGRY..Y---------------------------------
D3A8Q2_NEISU/281-354GH-----A--GE--------------------DAVDYWNRRGKF..F---------------------------------
D2ZY29_NEIMU/317-390GH-----V--GE--------------------DVVDYWNRRGKF..F---------------------------------
D1QWB6_9BACT/59-130SH-----K--.R--------------------DAVDWWNNVANKRGY---------------------------------
D2ZY17_NEIMU/1290-1360GH-----N--PE--------------------DAVSYWNRCGRY..H---------------------------------
D7NAI5_9BACT/60-127GH-----K--.I--------------------DAVHWWNTEGRK..Y---------------------------------
B4E5I3_BURCJ/270-339AH-----Q--.T--------------------DAVTWWNNVGRE..Y---------------------------------
C3G567_BACTU/455-525AH-----K--.I--------------------DAVTWWNEVGRK..Y---------------------------------
B3Z4D6_BACCE/80-150AH-----K--.I--------------------DAVTWWNEVGRK..Y---------------------------------
C3BVM6_9BACI/30-100AH-----L--.T--------------------DAVSWWNSTGRY..Y---------------------------------
C2X0R2_BACCE/45-115AH-----L--.T--------------------DAVSWWNSTGRY..Y---------------------------------
C2LJS8_PROMI/56-126SH-----K--.T--------------------DAVTWWNNTGRY..L---------------------------------
D0KGF8_PECWW/1348-1417SH-----K--.M--------------------DAVAWWNTTG..RDF---------------------------------
D7HX78_PSESS/176-245AH-----K--.T--------------------DAVTYWNTKGGY..F---------------------------------

PF05766

A4G7D7_HERAR/8-194-W-----V--RV--------------------VRDV..NEPCISCGTTKTVQWEAGHYIAVGANNTLRFVLDNIHKQCHR
Q4KA59_PSEF5/8-195-W-----V--R.--------------------LRDA..DLPCVSCGRHHDGQYHAGHYRTVGANPEIRFEPLNVWKQCAP
Q8ZMY3_SALTY/1-203-I-----C--R.--------------------ETELAEGLGCISCGTKTAFAWHAGHYRSTAAAGHLRFTRFNIHLQCDV
B0USX4_HISS2/3-190-F-----I--R.--------------------LRDK..NLPCISCGRYHQGQWHAGHYRSVGACPELRFNEDNVHKQCSV
M9WYN9_PASHA/4-187-F-----I--R.--------------------LRDK..DLPCISCGRYHQGKYDAGHYKTVGGNPELRFNEDNCHSQCVP
NING_LAMBD/2-198-F-----I--R.--------------------ERDR..DLPCISCGTLTSAQWDAGHYRTTAAAPQLRFNERNIHKQCVV
Q7CID4_YERPE/3-199-Y-----I--R.--------------------TRDA..GDACVSCGRFHEGQYHAGHYLTVGANPELRFNEDNCHRQCAP

PF16784

Q03RB7_LACBA/20-217-F-----I--E-----------------------------FLIGTCFEYDIPFAGKTLDAIREQYGWDMFC-IKYHRCMI
Q2FUP5_STAA8/21-220-L-----I--E-----------------------------LIIAFMFHHQIPMSVETSKLLSEDKALLYWA-TINRNCVI

PF13392

C7QT14_CYAP0/194-244.H-----K--N.--------------------FNQA.-------------------------------------------
A0A026EEZ3_ECO57/59-105.H-----V--N.--------------------LNKQ.-------------------------------------------
C3QU81_9BACE/58-104.H-----L--D.--------------------GNRT.-------------------------------------------
A7K8I5_9PHYC/225-274.H-----K--N.--------------------DDPL.-------------------------------------------
A7ITH3_PBCVM/254-303.H-----K--D.--------------------DDKE.-------------------------------------------
A7J8G9_PBCVF/235-284.H-----E--D.--------------------DDKE.-------------------------------------------
A7J6P1_PBCVF/231-280.H-----E--D.--------------------DDRE.-------------------------------------------
A7IWP5_PBCVN/225-274.H-----E--K.--------------------DDRL.-------------------------------------------
A7RBV7_PBCVA/231-280.H-----K--N.--------------------DDRL.-------------------------------------------
A7K8W0_9PHYC/231-280.H-----K--K.--------------------DIKT.-------------------------------------------
A7IWX1_PBCVN/283-332.H-----R--K.--------------------DNKF.-------------------------------------------
A7IW93_PBCVN/277-326.H-----D--K.--------------------DNKL.-------------------------------------------
A7RCQ9_PBCVA/277-326.H-----K--H.--------------------DNRL.-------------------------------------------
A7IVT6_PBCVN/276-325.H-----K--E.--------------------DDRL.-------------------------------------------
A7RBJ5_PBCVA/282-331.H-----K--E.--------------------DNRL.-------------------------------------------
A7IW48_PBCVN/71-118.H-----K--DE--------------------EKWN.-------------------------------------------
Q56C21_9CAUD/55-98.H-----I--K.--------------------GVDV.-------------------------------------------
Q56BD9_9CAUD/58-104.H-----V--H.--------------------GVER.-------------------------------------------
Q4TZV2_9CAUD/72-115.H-----K--H.--------------------GVES.-------------------------------------------
B1ZU98_OPITP/143-188.F-----K--N.--------------------ADKR.-------------------------------------------
B9EBP9_MACCJ/89-134.A-----R--N.--------------------RDLR.-------------------------------------------
C4GFQ4_9NEIS/59-100.H-----I--D.--------------------GDRY.-------------------------------------------
C8P900_9LACO/34-80.F-----L--D.--------------------GNKC.-------------------------------------------
D0DHI8_9LACO/69-115.F-----L--D.--------------------GNKE.-------------------------------------------
D4FMY2_STAEP/121-166.H-----L--N.--------------------QNRS.-------------------------------------------
Q6V7S9_9CAUD/61-107.H-----E--N.--------------------GIKP.-------------------------------------------
A2I7W9_9CAUD/55-100.H-----L--D.--------------------GNPA.-------------------------------------------
C7N6R6_SLAHD/162-208.F-----A--D.--------------------GDPG.-------------------------------------------
A4NIF9_HAEIF/148-193.Y-----K--D.--------------------GNSR.-------------------------------------------
A0JQK4_LACS1/121-166.F-----I--D.--------------------GDKS.-------------------------------------------
Q8DFY6_VIBVU/126-171.F-----I--D.--------------------GDKL.-------------------------------------------
C4ZC58_EUBR3/189-234.F-----L--D.--------------------GNKD.-------------------------------------------
C6IF55_9BACE/173-218.F-----K--D.--------------------GNRQ.-------------------------------------------
B1JD21_PSEPW/105-150.A-----K--D.--------------------GDVQ.-------------------------------------------
Q87Y63_PSESM/75-120.A-----K--D.--------------------SNRK.-------------------------------------------
A1RL04_SHESW/183-228.F-----I--D.--------------------NDRT.-------------------------------------------
B6XKN8_9ENTR/115-160.F-----I--D.--------------------GNPL.-------------------------------------------
C5F4D1_LACPA/110-155.F-----L--D.--------------------GNSL.-------------------------------------------
A0A031ABV7_PSEAI/156-201.F-----K--D.--------------------NNKQ.-------------------------------------------
A3WSR8_9BRAD/121-165..-----.--CK--------------------GDRA.-------------------------------------------
B2FM68_STRMK/151-200.F-----R--P.--------------------GLKTL-------------------------------------------
A4JMG5_BURVG/144-193.F-----L--P.--------------------GHRSA-------------------------------------------
Q15Y23_PSEA6/178-223.F-----K--D.--------------------NNKL.-------------------------------------------
A0A021B9T1_STAAU/98-143.F-----L--N.--------------------GNKK.-------------------------------------------
A6F4T8_9ALTE/122-168.L-----K--D.--------------------GDKR.-------------------------------------------
A4WTA3_RHOS5/127-172.C-----L--D.--------------------GNKR.-------------------------------------------
Q0FIB1_PELBH/128-173.C-----L--D.--------------------GDKA.-------------------------------------------
A5LQ22_STREE/161-206.F-----L--D.--------------------GDKT.-------------------------------------------
A1EAC5_9CAUD/175-220.F-----L--N.--------------------GDKT.-------------------------------------------
C5UU10_CLOBO/128-173.F-----S--D.--------------------RDKT.-------------------------------------------
Q73NJ9_TREDE/117-162.F-----K--D.--------------------GNKQ.-------------------------------------------
C8Q074_9GAMM/121-166.F-----A--D.--------------------GNTF.-------------------------------------------
D0S8T8_ACIJO/121-166.F-----K--N.--------------------MNKQ.-------------------------------------------
C6E6S5_GEOSM/133-178.F-----K--D.--------------------GEKQ.-------------------------------------------
A9C3M0_DELAS/190-235.F-----H--D.--------------------GDTS.-------------------------------------------
D4CX94_9FUSO/117-162.F-----A--D.--------------------GNKS.-------------------------------------------
Q7P8C3_FUSNV/72-117.F-----A--D.--------------------GNKK.-------------------------------------------
C7XPL9_FUSNV/61-106.F-----A--D.--------------------GDKT.-------------------------------------------
D4CX93_9FUSO/115-161.F-----A--D.--------------------GNKS.-------------------------------------------
B2TP02_CLOBB/128-173.F-----A--D.--------------------GDKR.-------------------------------------------
C6CX53_PAESJ/104-150.F-----G--D.--------------------GDNR.-------------------------------------------
A6TRD3_ALKMQ/182-227.F-----G--D.--------------------GDKR.-------------------------------------------
C3DU79_BACTS/116-161.F-----G--D.--------------------GNRR.-------------------------------------------
E6U5S1_ETHHY/116-161.F-----G--D.--------------------GNRL.-------------------------------------------
C3JGM1_RHOER/317-363.H-----T--C.--------------------ANSR.-------------------------------------------
Y53_BPT3/45-90.H-----I--C.--------------------LNRG.-------------------------------------------
B3VD54_9CAUD/38-83.H-----K--C.--------------------RNRA.-------------------------------------------
Q3YJY2_BPK1F/38-83.H-----K--C.--------------------RNRA.-------------------------------------------
B5LJM0_9CAUD/57-102.H-----R--C.--------------------FNPQ.-------------------------------------------
A6W8V6_KINRD/41-87.H-----L--C.--------------------DVKA.-------------------------------------------
C5E9V7_BIFLI/27-72.H-----I--C.--------------------HNRA.-------------------------------------------
Q856N8_BPMCO/89-135.H-----R--HT--------------------CPKL.-------------------------------------------
A0MZB2_BPN4/61-106.H-----L--C.--------------------NNRL.-------------------------------------------
B9K2P8_AGRVS/53-100.H-----V--C.--------------------RNRL.-------------------------------------------
A6UA36_SINMW/51-98.H-----A--C.--------------------RNRL.-------------------------------------------
C8ZKQ5_9CAUD/63-108.H-----L--C.--------------------GQRL.-------------------------------------------
C4NT45_9CAUD/52-97.H-----K--C.--------------------RNRM.-------------------------------------------
A1UH45_MYCSK/70-115.H-----L--C.--------------------NNPP.-------------------------------------------
D0U234_9CAUD/40-85.H-----L--C.--------------------RNRM.-------------------------------------------
Q6X9Q0_9CAUD/46-92.H-----H--C.--------------------DNRR.-------------------------------------------
B4YQH7_9CAUD/40-85.H-----T--C.--------------------DNKR.-------------------------------------------
Q39FD2_BURS3/42-87.H-----R--C.--------------------DVPC.-------------------------------------------
B2HPG6_MYCMM/67-112.H-----H--C.--------------------DNKR.-------------------------------------------
A0A058WBB0_BORBO/39-84.H-----T--C.--------------------DTPS.-------------------------------------------
Q8XUJ5_RALSO/52-97.H-----R--C.--------------------DNRA.-------------------------------------------
Q8XUF6_RALSO/69-114.H-----R--C.--------------------DNPC.-------------------------------------------
A6T071_JANMA/40-85.H-----R--C.--------------------DNRS.-------------------------------------------
Q5G8U2_9CAUD/66-111.H-----L--C.--------------------DNPS.-------------------------------------------
I6Q9W6_9CAUD/45-90.H-----L--C.--------------------HNRK.-------------------------------------------
C6BBU5_RALP1/42-87.H-----V--C.--------------------DNPL.-------------------------------------------
D1L332_9CAUD/27-75.H-----K--C.--------------------DNRA.-------------------------------------------
B5ZXT2_RHILW/47-92.H-----R--C.--------------------DNRK.-------------------------------------------
B7UG64_ECO27/45-90.H-----K--C.--------------------DNQC.-------------------------------------------
B3VD64_9CAUD/26-71.H-----K--C.--------------------DNPK.-------------------------------------------
C6BBU3_RALP1/28-76.H-----K--C.--------------------DNPA.-------------------------------------------
Q6WYF0_BPT7/42-82.H-----S--C.--------------------DNPL.-------------------------------------------
A9XL65_BPT7/26-71.H-----I--C.--------------------DNPR.-------------------------------------------
Q55C13_DICDI/44-90.H-----I--N.--------------------KDTS.-------------------------------------------
C8T858_KLEPR/128-173.H-----L--D.--------------------NDLN.-------------------------------------------
A7IWJ9_PBCVN/166-211.H-----I--D.--------------------NVKS.-------------------------------------------
A7IW40_PBCVN/137-186.H-----I--D.--------------------NDPS.-------------------------------------------
A7IW08_PBCVN/127-176.H-----I--D.--------------------NDPS.-------------------------------------------
A7IXP3_PBCVN/63-109.H-----R--D.--------------------RNPK.-------------------------------------------
A7IV02_PBCVM/62-108NH-----K--N.--------------------RIKS.-------------------------------------------
A7IW74_PBCVN/69-115.H-----F--D.--------------------KNRK.-------------------------------------------
A7IWU9_PBCVN/61-106DH-----K--H.--------------------RDRT.-------------------------------------------
A7IWP5_PBCVN/60-106.H-----K--N.--------------------RIRS.-------------------------------------------
A7RBV7_PBCVA/60-106.H-----L--N.--------------------RNRS.-------------------------------------------
A7RBZ3_PBCVA/103-150.H-----I--ES--------------------DQKL.-------------------------------------------
A7IXC3_PBCVN/104-151DH-----I--DS--------------------ERKL.-------------------------------------------
A7IWX1_PBCVN/103-150DH-----I--KS--------------------EHKL.-------------------------------------------
A7KA42_9PHYC/77-123.H-----I--D.--------------------KNRE.-------------------------------------------
A7K9V2_9PHYC/78-124.H-----I--D.--------------------KNSF.-------------------------------------------
A7K8I5_9PHYC/59-105.H-----K--D.--------------------KNSF.-------------------------------------------
D3SUH7_NATMM/146-192.H-----K--N.--------------------GIPW.-------------------------------------------
A7IW48_PBCVN/260-306.H-----L--N.--------------------DDNM.-------------------------------------------
B8INW1_METNO/63-109.H-----L--N.--------------------GDPL.-------------------------------------------
C3KA00_PSEFS/68-113.H-----L--N.--------------------GVPS.-------------------------------------------
A0A009UX44_ACIBA/66-111.H-----L--N.--------------------GIPS.-------------------------------------------
C4ML45_9CAUD/99-146.H-----C--D.--------------------ENPH.-------------------------------------------
A5HL46_9CAUD/98-145.H-----V--D.--------------------GDKT.-------------------------------------------
A3XJC2_LEEBM/63-108.H-----L--N.--------------------HDKT.-------------------------------------------
B0N8L2_9FIRM/61-106.H-----R--N.--------------------KCYG.-------------------------------------------
Q2IFG5_ANADE/52-97.H-----R--D.--------------------GNTR.-------------------------------------------
C7XUT9_9LACO/28-73.H-----K--D.--------------------RNTD.-------------------------------------------
C3KZN2_CLOB6/39-84.H-----K--D.--------------------EDKG.-------------------------------------------
Q6V7S8_9CAUD/139-185.H-----K--N.--------------------HTKG.-------------------------------------------
A9I8T5_BORPD/76-129.H-----V--D.--------------------GDKT.-------------------------------------------
A6TVB1_ALKMQ/97-143.H-----I--D.--------------------GNRR.-------------------------------------------
D4BUG2_PRORE/155-201.H-----I--D.--------------------GNKL.-------------------------------------------
B5LPN5_9CAUD/94-140.H-----K--D.--------------------HNKQ.-------------------------------------------
C5B0P1_METEA/139-185.H-----R--D.--------------------GDKS.-------------------------------------------
Q633W4_BACCZ/111-157.H-----K--N.--------------------NNPE.-------------------------------------------
C5H7P3_9CAUD/62-105.H-----R--N.--------------------GITN.-------------------------------------------
Q6QGN6_BPT5/53-96.H-----I--N.--------------------RIRS.-------------------------------------------
C0ZXU5_RHOE4/92-138DH-----K--D.--------------------GDRL.-------------------------------------------
C3KZN5_CLOB6/115-155.H-----I--N.--------------------NNKK.-------------------------------------------
Q6XQA1_BPT1/50-95.H-----L--N.--------------------HNAT.-------------------------------------------
Q6KG62_BPFO1/53-98.H-----I--D.--------------------LDKT.-------------------------------------------
Q3J217_RHOS4/61-107.H-----K--D.--------------------GDRL.-------------------------------------------
Q9T140_9CAUD/59-104.H-----I--N.--------------------RNPS.-------------------------------------------
D1L2U2_9CAUD/88-133.H-----I--N.--------------------RDPS.-------------------------------------------
Q6XQF0_BPT1/57-102.H-----M--D.--------------------GDIT.-------------------------------------------
Q6XQ94_BPT1/46-91.H-----I--N.--------------------HERD.-------------------------------------------
B1GS34_9CAUD/33-78.H-----I--N.--------------------HDRG.-------------------------------------------
A5PJ37_9CAUD/57-102.H-----I--N.--------------------HDRT.-------------------------------------------
A5PJ23_9CAUD/113-158.H-----I--N.--------------------HDRT.-------------------------------------------
B0FIJ3_BPE32/42-86.H-----I--D.--------------------CDRQ.-------------------------------------------
C4NTD4_9CAUD/53-96.H-----R--D.--------------------RNPD.-------------------------------------------
D2K055_9CAUD/58-102.H-----I--D.--------------------GNRS.-