Sequence alignment for CL0264

PF14286

D4LDC0_RUMC1/65-436--------------------------------------------------------------------------------
C4Z3Y8_EUBE2/59-440--------------------------------------------------------------------------------
R6N2Z9_9CLOT/53-417--------------------------------------------------------------------------------

PF16822

M4X2G9_PSEDE/89-360--------------------------------------------------------------------------------
D9SK13_GALCS/90-349--------------------------------------------------------------------------------
D7CVL9_TRURR/113-377--------------------------------------------------------------------------------
A4XSW9_PSEMY/87-346--------------------------------------------------------------------------------
A7IG51_XANP2/41-300--------------------------------------------------------------------------------
Q0VSK8_ALCBS/79-348--------------------------------------------------------------------------------
D9SC65_GALCS/39-314--------------------------------------------------------------------------------
Q2KWS4_BORA1/105-364--------------------------------------------------------------------------------
A4XSW7_PSEMY/65-332--------------------------------------------------------------------------------
A8LND2_DINSH/79-327--------------------------------------------------------------------------------
C4LEL0_TOLAT/54-306--------------------------------------------------------------------------------
Q0VSL0_ALCBS/86-342--------------------------------------------------------------------------------
D7CSL0_TRURR/51-309--------------------------------------------------------------------------------
F6AHE0_PSEF1/87-346--------------------------------------------------------------------------------
A9BZH9_DELAS/53-312--------------------------------------------------------------------------------
A7IG52_XANP2/88-341--------------------------------------------------------------------------------
A8ICK2_AZOC5/86-338--------------------------------------------------------------------------------
H9UGT7_SPIAZ/108-374--------------------------------------------------------------------------------
F6AHE2_PSEF1/62-330--------------------------------------------------------------------------------
A8ICK4_AZOC5/30-289--------------------------------------------------------------------------------
A4XR24_PSEMY/81-343--------------------------------------------------------------------------------
A4XR27_PSEMY/64-322--------------------------------------------------------------------------------
A9BZH8_DELAS/91-352--------------------------------------------------------------------------------
C1DP87_AZOVD/81-346--------------------------------------------------------------------------------
C1DP90_AZOVD/67-327--------------------------------------------------------------------------------
F2KL48_PSEBN/64-330--------------------------------------------------------------------------------
ALGX_PSEAE/64-325--------------------------------------------------------------------------------
ALGJ_PSEAE/85-355--------------------------------------------------------------------------------
Q6N6N6_RHOPA/99-362--------------------------------------------------------------------------------
ALGJ_PSESM/81-346--------------------------------------------------------------------------------
Q888J0_PSESM/99-365--------------------------------------------------------------------------------
ALGJ_PSEPK/81-346--------------------------------------------------------------------------------

PF00657

O04702_DAUCA/33-364--------------------------------------------------------------------------------
Q39308_BRANA/36-320--------------------------------------------------------------------------------
AOAH_HUMAN/257-543--------------------------------------------------------------------------------
GDL49_ARATH/37-365--------------------------------------------------------------------------------
Q9A6E2_CAUCR/200-399--------------------------------------------------------------------------------
Q97ET2_CLOAB/64-257--------------------------------------------------------------------------------
A5FND2_FLAJ1/74-458--------------------------------------------------------------------------------
Q9HZ99_PSEAE/215-418--------------------------------------------------------------------------------
YQEF_BACSU/25-235--------------------------------------------------------------------------------
YPMR_BACSU/43-243--------------------------------------------------------------------------------
Q9RDP5_STRCO/66-296--------------------------------------------------------------------------------
Q9LHY3_ORYSJ/5-203--------------------------------------------------------------------------------
Q98E95_RHILO/55-223--------------------------------------------------------------------------------
H0H5K0_RHIRD/5-204--------------------------------------------------------------------------------
RHA1_ASPAC/20-225--------------------------------------------------------------------------------
Q40317_MEDSA/37-362--------------------------------------------------------------------------------
Q9KZR1_STRCO/239-441--------------------------------------------------------------------------------
IAH1_YEAST/6-203--------------------------------------------------------------------------------
APG_ARATH/205-524--------------------------------------------------------------------------------
GDL88_ARATH/5-204--------------------------------------------------------------------------------
Q7AQI8_MYCLE/42-222--------------------------------------------------------------------------------
Q97DM5_CLOAB/3-182--------------------------------------------------------------------------------
Q9XIY6_ORYSJ/32-357--------------------------------------------------------------------------------
Q55601_SYNY3/103-399--------------------------------------------------------------------------------
RHGT2_BACSU/5-198--------------------------------------------------------------------------------
GCAT_AERHY/28-322--------------------------------------------------------------------------------
APG_BRANA/126-441--------------------------------------------------------------------------------
GUNE_CLOTM/606-804--------------------------------------------------------------------------------
GDL20_ARATH/34-330--------------------------------------------------------------------------------
PLB1_RABIT/741-1015--------------------------------------------------------------------------------
O13496_NEOPA/166-382--------------------------------------------------------------------------------
Q9KZ70_STRCO/75-262--------------------------------------------------------------------------------
GDL17_ARATH/35-352--------------------------------------------------------------------------------
GDL14_ARATH/33-344--------------------------------------------------------------------------------
ESM1_ARATH/37-340--------------------------------------------------------------------------------
GDL84_ARATH/6-205--------------------------------------------------------------------------------
IAH1_MOUSE/18-213--------------------------------------------------------------------------------
Q4A932_MYCHJ/42-337--------------------------------------------------------------------------------
Q9AYM5_VIGUN/9-201--------------------------------------------------------------------------------
Q9AUZ9_ORYSJ/6-205--------------------------------------------------------------------------------
LIP4_ARATH/41-355--------------------------------------------------------------------------------
LIP1_PHOLU/28-343--------------------------------------------------------------------------------
PLB1_RABIT/394-668--------------------------------------------------------------------------------
HLT_VIBPA/147-406--------------------------------------------------------------------------------
O05695_RHILE/46-219--------------------------------------------------------------------------------
Q9Y7C6_ASPTE/61-245--------------------------------------------------------------------------------
Q9A5J3_CAUCR/136-332--------------------------------------------------------------------------------
GDL2_ARATH/38-352--------------------------------------------------------------------------------
LIPC_BACSU/5-202--------------------------------------------------------------------------------
IAH1_SCHPO/40-217--------------------------------------------------------------------------------
TESA_ECOLI/30-196--------------------------------------------------------------------------------
P74310_SYNY3/108-371--------------------------------------------------------------------------------
P72634_SYNY3/22-217--------------------------------------------------------------------------------
Q98EU1_RHILO/215-418--------------------------------------------------------------------------------
GDL61_ARATH/35-364--------------------------------------------------------------------------------
Q9X7W9_STRCO/5-186--------------------------------------------------------------------------------
Q98FI8_RHILO/49-230--------------------------------------------------------------------------------
PLB1_RABIT/1097-1363--------------------------------------------------------------------------------
A0A0D1GQ15_VIBPH/23-192--------------------------------------------------------------------------------
Q9FCB4_STRCO/10-188--------------------------------------------------------------------------------
Q97FV7_CLOAB/81-259--------------------------------------------------------------------------------
O82681_DIGLA/36-364--------------------------------------------------------------------------------
GDL51_ARATH/33-334--------------------------------------------------------------------------------
Q9N4P5_CAEEL/105-346--------------------------------------------------------------------------------
O13497_NEOPA/65-271--------------------------------------------------------------------------------
Q9RLB8_RUMFL/46-256--------------------------------------------------------------------------------

PF13472

G2LGZ8_CHLTF/6-185--------------------------------------------------------------------------------
F9ZYV1_METMM/34-186--------------------------------------------------------------------------------
K9VZK4_9CYAN/24-214--------------------------------------------------------------------------------
E7Q9P0_YEASB/8-198--------------------------------------------------------------------------------
Q0C8V3_ASPTN/19-227--------------------------------------------------------------------------------
K0F6Y4_9NOCA/25-257--------------------------------------------------------------------------------
G2MGQ8_9ARCH/46-224--------------------------------------------------------------------------------
W5TFJ6_9NOCA/8-180--------------------------------------------------------------------------------
K0I3M2_9BURK/62-234--------------------------------------------------------------------------------
R7NK93_9BACE/47-209--------------------------------------------------------------------------------
G8TQQ3_NIAKG/29-211--------------------------------------------------------------------------------
M7UUV3_BOTF1/27-206--------------------------------------------------------------------------------
W5WAN1_9PSEU/47-277--------------------------------------------------------------------------------
B1VMZ9_STRGG/190-372--------------------------------------------------------------------------------
G8LWX2_CLOCD/190-376--------------------------------------------------------------------------------
R6Z4P1_9FIRM/217-388--------------------------------------------------------------------------------
Q99YY1_STRP1/58-268--------------------------------------------------------------------------------
A0A0D1CT64_USTMA/5-263--------------------------------------------------------------------------------
D2QLR8_SPILD/53-227--------------------------------------------------------------------------------
E0W141_PEDHC/39-199--------------------------------------------------------------------------------
D3KGI8_GIAIC/11-195--------------------------------------------------------------------------------
C0NLZ7_AJECG/25-255--------------------------------------------------------------------------------
Q01UG4_SOLUE/29-210--------------------------------------------------------------------------------
C6W2P5_DYAFD/419-583--------------------------------------------------------------------------------
B1MDW2_MYCA9/39-269--------------------------------------------------------------------------------
B1XKZ4_SYNP2/23-212--------------------------------------------------------------------------------
Q4FPU8_PSYA2/77-239--------------------------------------------------------------------------------
H1YA85_9SPHI/544-727--------------------------------------------------------------------------------
I4EU60_MODMB/15-192--------------------------------------------------------------------------------
A9WQ20_RENSM/91-269--------------------------------------------------------------------------------
I3WJV1_BIFBI/52-230--------------------------------------------------------------------------------
V4I0K6_9ACTN/63-286--------------------------------------------------------------------------------
B6IVX9_RHOCS/64-225--------------------------------------------------------------------------------
H6LH44_ACEWD/195-425--------------------------------------------------------------------------------
Q47RM5_THEFY/14-185--------------------------------------------------------------------------------
F5XHG7_MICPN/9-183--------------------------------------------------------------------------------
G3AIA7_SPAPN/11-222--------------------------------------------------------------------------------
D4IL07_9BACT/44-208--------------------------------------------------------------------------------
S5XQR0_PARAH/29-196--------------------------------------------------------------------------------
R7R449_9FIRM/38-202--------------------------------------------------------------------------------
C7Q6B9_CATAD/41-283--------------------------------------------------------------------------------
R6QP90_9FIRM/6-201--------------------------------------------------------------------------------
Q1IT33_KORVE/202-395--------------------------------------------------------------------------------
D7C8R3_STRBB/220-415--------------------------------------------------------------------------------
I7E542_PHAIB/29-200--------------------------------------------------------------------------------
B9HCW5_POPTR/11-197--------------------------------------------------------------------------------
R7EM00_9FIRM/12-234--------------------------------------------------------------------------------
J7QEQ8_METSZ/35-196--------------------------------------------------------------------------------
F5YS39_MYCSD/49-220--------------------------------------------------------------------------------
A1RB28_ARTAT/9-183--------------------------------------------------------------------------------
D5BWK2_NITHN/13-175--------------------------------------------------------------------------------
R5HE58_9FIRM/156-328--------------------------------------------------------------------------------
H6NB59_9BACL/165-326--------------------------------------------------------------------------------
Q813K9_BACCR/21-195--------------------------------------------------------------------------------
H2MKJ0_ORYLA/14-203--------------------------------------------------------------------------------
K0F6E7_9NOCA/83-262--------------------------------------------------------------------------------
Q01NA0_SOLUE/52-213--------------------------------------------------------------------------------
D6ZFQ3_SEGRD/129-368--------------------------------------------------------------------------------
A0A098DVS0_GIBZA/10-226--------------------------------------------------------------------------------
A6W6W8_KINRD/62-234--------------------------------------------------------------------------------
W0EF85_9FIRM/4-192--------------------------------------------------------------------------------
Q3A0X5_PELCD/10-171--------------------------------------------------------------------------------
Q7MI76_VIBVY/123-275--------------------------------------------------------------------------------
G0FS27_AMYMS/50-289--------------------------------------------------------------------------------
B0U7X0_METS4/37-231--------------------------------------------------------------------------------
R7GXG0_9FIRM/17-225--------------------------------------------------------------------------------
D7BXS4_STRBB/226-417--------------------------------------------------------------------------------
D7C0R4_STRBB/190-361--------------------------------------------------------------------------------
Q47MP1_THEFY/158-409--------------------------------------------------------------------------------
I3Z927_BELBD/30-207--------------------------------------------------------------------------------
C4XJ93_DESMR/5-180--------------------------------------------------------------------------------
D2BFK8_STRRD/36-259--------------------------------------------------------------------------------
F8JNB8_STREN/215-410--------------------------------------------------------------------------------
V6JFF1_STRNV/209-394--------------------------------------------------------------------------------
A0M409_GRAFK/37-216--------------------------------------------------------------------------------
B9E790_MACCJ/42-216--------------------------------------------------------------------------------
U5W125_9ACTN/5-181--------------------------------------------------------------------------------
W0JAF8_9BACT/24-221--------------------------------------------------------------------------------
E6K1M3_PARDN/179-354--------------------------------------------------------------------------------
G0L4M3_ZOBGA/50-213--------------------------------------------------------------------------------
K0KD71_SACES/32-274--------------------------------------------------------------------------------
R6YJR8_9FIRM/72-238--------------------------------------------------------------------------------
B0SYS7_CAUSK/39-200--------------------------------------------------------------------------------
C4XUC8_DESMR/132-313--------------------------------------------------------------------------------
F6FTU7_ISOV2/41-229--------------------------------------------------------------------------------
B3E7P1_GEOLS/36-187--------------------------------------------------------------------------------
W1NXM8_AMBTC/8-198--------------------------------------------------------------------------------
C5D2B2_GEOSW/60-247--------------------------------------------------------------------------------
R6C2Q7_9CLOT/80-250--------------------------------------------------------------------------------
G0FM14_AMYMS/156-328--------------------------------------------------------------------------------
C7MV43_SACVD/7-181--------------------------------------------------------------------------------
Q28L10_JANSC/41-209--------------------------------------------------------------------------------
D1BAN3_SANKS/13-204--------------------------------------------------------------------------------
F4L671_HALH1/418-583--------------------------------------------------------------------------------
D0MEZ1_RHOM4/64-227--------------------------------------------------------------------------------
I0JR57_HALH3/6-174--------------------------------------------------------------------------------
I0H891_ACTM4/29-215--------------------------------------------------------------------------------
F8EG49_RUNSL/341-505--------------------------------------------------------------------------------
M4SL10_9SPHN/105-292--------------------------------------------------------------------------------
Q984F4_RHILO/76-269--------------------------------------------------------------------------------
A5MZI3_CLOK5/7-181--------------------------------------------------------------------------------
A7T1B4_NEMVE/280-473--------------------------------------------------------------------------------
I0GPP6_SELRL/261-430--------------------------------------------------------------------------------
C6WBG5_ACTMD/47-259--------------------------------------------------------------------------------
R6QFZ7_9FIRM/97-267--------------------------------------------------------------------------------
B2UPK1_AKKM8/70-228--------------------------------------------------------------------------------
G0AEJ9_COLFT/82-263--------------------------------------------------------------------------------
M0V6E2_HORVD/7-199--------------------------------------------------------------------------------
C0ZWX3_RHOE4/10-184--------------------------------------------------------------------------------
H2ME21_ORYLA/44-204--------------------------------------------------------------------------------
Q63PZ5_BURPS/212-408--------------------------------------------------------------------------------
R6V1Y1_9FIRM/6-194--------------------------------------------------------------------------------
A0JR03_ARTS2/36-210--------------------------------------------------------------------------------
W0J7T0_9BACT/65-240--------------------------------------------------------------------------------
R7NKF5_9BACE/27-204--------------------------------------------------------------------------------
E6UDP6_RUMA7/641-806--------------------------------------------------------------------------------
F8GFH2_NITSI/28-190--------------------------------------------------------------------------------
F9F2R2_FUSOF/1277-1464--------------------------------------------------------------------------------
K0K2E0_SACES/203-395--------------------------------------------------------------------------------
F0SWM2_SYNGF/60-221--------------------------------------------------------------------------------
R7C788_9CLOT/25-185--------------------------------------------------------------------------------
W0AIR7_9SPHN/199-388--------------------------------------------------------------------------------
D2PP87_KRIFD/69-245--------------------------------------------------------------------------------
F4AWM3_DOKS4/68-232--------------------------------------------------------------------------------
B1VVX0_STRGG/223-407--------------------------------------------------------------------------------
U7Q2W9_SPOS1/220-402--------------------------------------------------------------------------------
A6M2F1_CLOB8/61-248--------------------------------------------------------------------------------
R5KXB7_9BACT/63-283--------------------------------------------------------------------------------
K3XZ16_SETIT/8-196--------------------------------------------------------------------------------
E6S752_INTC7/87-258--------------------------------------------------------------------------------
W5WIW8_9PSEU/205-397--------------------------------------------------------------------------------
Q5LWA7_RUEPO/26-193--------------------------------------------------------------------------------
A4XHL3_CALS8/11-203--------------------------------------------------------------------------------
C6C0K9_DESAD/5-174--------------------------------------------------------------------------------
B2ATA5_PODAN/25-209--------------------------------------------------------------------------------
J7ISV3_DESMD/58-224--------------------------------------------------------------------------------
H2K4A1_STRHJ/39-278--------------------------------------------------------------------------------
Q2G976_NOVAD/44-208--------------------------------------------------------------------------------
G4SUG0_META2/35-187--------------------------------------------------------------------------------
H2K4Z9_STRHJ/15-186--------------------------------------------------------------------------------
W0J432_9BACT/44-236--------------------------------------------------------------------------------
D3VJU5_XENNA/169-356--------------------------------------------------------------------------------
C5AYG7_METEA/74-249--------------------------------------------------------------------------------
E6U6E7_ETHHY/40-256--------------------------------------------------------------------------------
Q5LD72_BACFN/407-572--------------------------------------------------------------------------------
S3DDW3_GLAL2/10-191--------------------------------------------------------------------------------
E3J9G5_FRASU/58-281--------------------------------------------------------------------------------
R5QR45_9FIRM/96-249--------------------------------------------------------------------------------
K0F878_9NOCA/13-210--------------------------------------------------------------------------------
K4R9L2_9ACTN/231-426--------------------------------------------------------------------------------
A3DDK3_CLOTH/608-799--------------------------------------------------------------------------------
T0UH59_9STRE/46-208--------------------------------------------------------------------------------
J7IXJ3_DESMD/9-200--------------------------------------------------------------------------------
R7PCH8_9BACT/46-205--------------------------------------------------------------------------------
G2XB74_VERDV/55-232--------------------------------------------------------------------------------
R5FUC6_9FIRM/6-196--------------------------------------------------------------------------------
R8BFZ6_TOGMI/64-246--------------------------------------------------------------------------------
F7V8U7_CLOSS/9-188--------------------------------------------------------------------------------
R6T7B3_9BACE/46-211--------------------------------------------------------------------------------
W5W593_9PSEU/19-191--------------------------------------------------------------------------------
I0GS99_SELRL/183-349--------------------------------------------------------------------------------
Q65H30_BACLD/28-229--------------------------------------------------------------------------------
R7D037_9BACE/44-258--------------------------------------------------------------------------------
E1ZCH1_CHLVA/857-1058--------------------------------------------------------------------------------
U5LBE1_9BACI/9-207--------------------------------------------------------------------------------
E4NAV6_KITSK/55-306--------------------------------------------------------------------------------
Q0ABE5_ALKEH/37-188--------------------------------------------------------------------------------
S7ZFH0_PENO1/20-225--------------------------------------------------------------------------------
I4B2X9_TURPD/40-194--------------------------------------------------------------------------------
B9L4V0_THERP/33-227--------------------------------------------------------------------------------
D6Y3T6_THEBD/234-419--------------------------------------------------------------------------------
G7Z6X1_AZOL4/17-178--------------------------------------------------------------------------------
R6AQE2_9CLOT/122-304--------------------------------------------------------------------------------
L0DI14_SINAD/69-237--------------------------------------------------------------------------------
M9LYA1_PSEA3/5-259--------------------------------------------------------------------------------
D6X6Z3_STRPR/78-346--------------------------------------------------------------------------------
D2B3J3_STRRD/19-192--------------------------------------------------------------------------------
R5FJF8_9ACTN/33-236--------------------------------------------------------------------------------
C8WJI0_EGGLE/6-233--------------------------------------------------------------------------------
D9QEV2_CORP2/42-283--------------------------------------------------------------------------------
L0FBT6_DESDL/12-200--------------------------------------------------------------------------------
Q827I8_STRAW/8-184--------------------------------------------------------------------------------
G8SIP9_ACTS5/82-259--------------------------------------------------------------------------------
Q5L832_BACFN/496-664--------------------------------------------------------------------------------
W5TVY7_9NOCA/81-260--------------------------------------------------------------------------------
K9UCV4_9CHRO/139-310--------------------------------------------------------------------------------
B7GHZ1_ANOFW/71-259--------------------------------------------------------------------------------
E8R2J2_ISOPI/71-259--------------------------------------------------------------------------------
H2JL95_STRHJ/34-272--------------------------------------------------------------------------------
F3Z6T3_9ACTN/29-204--------------------------------------------------------------------------------
W5WIB8_9PSEU/47-222--------------------------------------------------------------------------------
C4L1B0_EXISA/56-239--------------------------------------------------------------------------------
B2HQ03_MYCMM/13-256--------------------------------------------------------------------------------
H8KZ14_FRAAD/10-187--------------------------------------------------------------------------------
B2KBC9_ELUMP/39-189--------------------------------------------------------------------------------
A0K1Y5_ARTS2/18-192--------------------------------------------------------------------------------
G4UPA5_NEUT9/10-218--------------------------------------------------------------------------------
I6S3G7_ENTHA/9-180--------------------------------------------------------------------------------
G2TP44_BACCO/5-211--------------------------------------------------------------------------------
X4ZEZ6_9BACL/185-371--------------------------------------------------------------------------------
F2F9R1_SOLSS/29-226--------------------------------------------------------------------------------
D8LR17_ECTSI/140-327--------------------------------------------------------------------------------
F0XSC4_GROCL/10-192--------------------------------------------------------------------------------
W5WU70_BDEBC/25-187--------------------------------------------------------------------------------
Q30ZF8_DESAG/9-172--------------------------------------------------------------------------------
E6U3Z0_ETHHY/13-221--------------------------------------------------------------------------------
K9Z576_CYAAP/133-304--------------------------------------------------------------------------------
R6QD03_9BACT/279-453--------------------------------------------------------------------------------
U5VVT9_9ACTN/94-270--------------------------------------------------------------------------------
A6W7C6_KINRD/11-181--------------------------------------------------------------------------------
G2NBW0_STREK/62-285--------------------------------------------------------------------------------
G9N929_HYPVG/206-405--------------------------------------------------------------------------------
J7IVY1_DESMD/124-291--------------------------------------------------------------------------------
R6CR61_9CLOT/153-322--------------------------------------------------------------------------------
G0VN30_MEGEL/280-449--------------------------------------------------------------------------------
Q741R5_MYCPA/80-259--------------------------------------------------------------------------------
N1SAZ9_FUSC4/198-391--------------------------------------------------------------------------------
C0QFP2_DESAH/32-194--------------------------------------------------------------------------------
B2GLV0_KOCRD/10-179--------------------------------------------------------------------------------
G0J2G6_CYCMS/26-199--------------------------------------------------------------------------------
B7JX19_CYAP8/85-295--------------------------------------------------------------------------------
G0N3A6_CAEBE/128-371--------------------------------------------------------------------------------
A0ZJZ9_NODSP/82-300--------------------------------------------------------------------------------
F4H6M1_CELFA/18-186--------------------------------------------------------------------------------
I1N2X5_SOYBN/12-196--------------------------------------------------------------------------------
K9G952_PEND2/13-237--------------------------------------------------------------------------------
R5HM64_9FIRM/189-382--------------------------------------------------------------------------------
Q6AS77_DESPS/6-158--------------------------------------------------------------------------------
D4ILH5_9BACT/164-325--------------------------------------------------------------------------------
A7RJR6_NEMVE/10-191--------------------------------------------------------------------------------
R6RA51_9FIRM/215-387--------------------------------------------------------------------------------
D8PRB9_SCHCM/27-228--------------------------------------------------------------------------------
F2R6G0_STRVP/238-432--------------------------------------------------------------------------------
F8DDA0_HALXS/10-205--------------------------------------------------------------------------------
W0RQX1_9BACT/215-404--------------------------------------------------------------------------------
R5PNX1_9BACT/61-237--------------------------------------------------------------------------------
G8TBC2_NIAKG/518-690--------------------------------------------------------------------------------
R7F7N4_9CLOT/10-189--------------------------------------------------------------------------------
R6SAU8_9BACE/30-207--------------------------------------------------------------------------------
A4F857_SACEN/77-254--------------------------------------------------------------------------------
F6EJ21_AMYSD/11-256--------------------------------------------------------------------------------
Q4WIS4_ASPFU/228-426--------------------------------------------------------------------------------
F2R494_STRVP/11-189--------------------------------------------------------------------------------
Q5L832_BACFN/29-203--------------------------------------------------------------------------------
F4GLH5_SPHCD/33-199--------------------------------------------------------------------------------
K0JNT7_SACES/54-226--------------------------------------------------------------------------------
C7PW60_CATAD/592-784--------------------------------------------------------------------------------
A9WPA1_RENSM/70-249--------------------------------------------------------------------------------
B5H390_STRC2/231-417--------------------------------------------------------------------------------
R6MYM2_9BACE/51-216--------------------------------------------------------------------------------
I4F3W7_MODMB/5-181--------------------------------------------------------------------------------
Q38WY1_LACSS/61-282--------------------------------------------------------------------------------
V2XCK0_MONRO/11-210--------------------------------------------------------------------------------
B2WI22_PYRTR/182-379--------------------------------------------------------------------------------
B5Y4J5_PHATC/14-211--------------------------------------------------------------------------------
D7BPT6_STRBB/218-404--------------------------------------------------------------------------------
J7Q741_METSZ/49-211--------------------------------------------------------------------------------
W0AKN6_9SPHN/107-270--------------------------------------------------------------------------------
G0VNQ9_MEGEL/5-178--------------------------------------------------------------------------------
Q11JW6_CHESB/159-347--------------------------------------------------------------------------------
D7C830_STRBB/124-301--------------------------------------------------------------------------------
F8JN95_STREN/61-302--------------------------------------------------------------------------------
F2KZ29_PREDF/46-223--------------------------------------------------------------------------------
K9S6S4_9CYAN/29-219--------------------------------------------------------------------------------
Q6AE96_LEIXX/18-179--------------------------------------------------------------------------------
F6B5J1_DESCC/53-207--------------------------------------------------------------------------------
W0EUS0_9SPHI/181-343--------------------------------------------------------------------------------
R6T524_9FIRM/110-271--------------------------------------------------------------------------------
J7IWI7_DESMD/59-219--------------------------------------------------------------------------------
A8IXQ3_CHLRE/5-169--------------------------------------------------------------------------------
C5AQE3_METEA/66-244--------------------------------------------------------------------------------
F8DAN2_HALXS/162-326--------------------------------------------------------------------------------
F3Y895_MELPT/6-178--------------------------------------------------------------------------------
C6D6S5_PAESJ/43-220--------------------------------------------------------------------------------
K8E6E4_CARML/7-174--------------------------------------------------------------------------------
A5FD35_FLAJ1/213-403--------------------------------------------------------------------------------
G3Y471_ASPNA/215-415--------------------------------------------------------------------------------
D4IKZ7_9BACT/176-338--------------------------------------------------------------------------------
W0J141_9BACT/53-225--------------------------------------------------------------------------------
L0GVE5_9GAMM/38-189--------------------------------------------------------------------------------
D2B805_STRRD/33-196--------------------------------------------------------------------------------
Q7UYW6_RHOBA/44-227--------------------------------------------------------------------------------
H1Y5L1_9SPHI/67-232--------------------------------------------------------------------------------
R5UKQ6_9BACE/276-450--------------------------------------------------------------------------------
D2VNU3_NAEGR/47-259--------------------------------------------------------------------------------
K0J7V1_AMPXN/8-193--------------------------------------------------------------------------------
R6TJ61_9FIRM/115-284--------------------------------------------------------------------------------
Q3AES5_CARHZ/6-166--------------------------------------------------------------------------------
F5Y754_TREAZ/51-226--------------------------------------------------------------------------------
I2EW44_EMTOG/30-213--------------------------------------------------------------------------------
Q2KC63_RHIEC/16-181--------------------------------------------------------------------------------
G2Q479_THIHA/11-200--------------------------------------------------------------------------------
F4CX93_PSEUX/44-288--------------------------------------------------------------------------------
F2K441_MARM1/39-201--------------------------------------------------------------------------------
G0SCK7_CHATD/220-415--------------------------------------------------------------------------------
E2SDW1_9ACTN/295-492--------------------------------------------------------------------------------
W8S2P1_9RHOB/29-199--------------------------------------------------------------------------------
D5QBC4_KOMHA/27-197--------------------------------------------------------------------------------
R6VZ51_9FIRM/5-211--------------------------------------------------------------------------------
C9SBJ5_VERA1/56-239--------------------------------------------------------------------------------
R5HMF9_9FIRM/10-201--------------------------------------------------------------------------------
C7QIT4_CATAD/174-342--------------------------------------------------------------------------------
C7NEU8_KYTSD/77-256--------------------------------------------------------------------------------
L0EDP3_THECK/52-222--------------------------------------------------------------------------------
A3I0B5_9BACT/411-576--------------------------------------------------------------------------------
C6Y2G7_PEDHD/17-213--------------------------------------------------------------------------------
A0A068NQ24_9BACT/304-475--------------------------------------------------------------------------------
W0F2F1_9SPHI/300-469--------------------------------------------------------------------------------
Q0AXT3_SYNWW/9-171--------------------------------------------------------------------------------
G0IW62_CYCMS/53-216--------------------------------------------------------------------------------
R6GYU7_9FIRM/5-176--------------------------------------------------------------------------------
C7PXM1_CATAD/208-402--------------------------------------------------------------------------------
D1A6Y3_THECD/85-332--------------------------------------------------------------------------------
D5ET48_PRER2/169-360--------------------------------------------------------------------------------
C6D1K9_PAESJ/68-265--------------------------------------------------------------------------------
R5RKB7_9FIRM/11-201--------------------------------------------------------------------------------
Q8PE64_XANCP/207-406--------------------------------------------------------------------------------
R5UQU2_9PORP/27-204--------------------------------------------------------------------------------
C4LIB2_CORK4/94-340--------------------------------------------------------------------------------
L8FS37_PSED2/8-238--------------------------------------------------------------------------------
R5NYB5_9CLOT/6-194--------------------------------------------------------------------------------
Q28MK4_JANSC/6-192--------------------------------------------------------------------------------
F4D1F9_PSEUX/9-182--------------------------------------------------------------------------------
F6DPQ3_DESRL/121-297--------------------------------------------------------------------------------
Q08RB4_STIAD/156-336--------------------------------------------------------------------------------
Q4A638_MYCS5/67-329--------------------------------------------------------------------------------
G2Q2N0_THIHA/215-412--------------------------------------------------------------------------------
D4Z883_SPHJU/203-400--------------------------------------------------------------------------------
C7MTG5_SACVD/41-279--------------------------------------------------------------------------------
W5WRL6_9CORY/35-268--------------------------------------------------------------------------------
G0FQT7_AMYMS/216-401--------------------------------------------------------------------------------
K1WT60_MARBU/219-416--------------------------------------------------------------------------------
Q2IJI2_ANADE/217-376--------------------------------------------------------------------------------
B5HGC9_STRPR/286-467--------------------------------------------------------------------------------
C5C9F6_MICLC/56-217--------------------------------------------------------------------------------
K9SEF6_9CYAN/68-250--------------------------------------------------------------------------------
Q6AEG4_LEIXX/39-217--------------------------------------------------------------------------------
M1NU08_9CORY/51-286--------------------------------------------------------------------------------
W8FDN5_9BACT/6-181--------------------------------------------------------------------------------
I2ERE8_EMTOG/36-233--------------------------------------------------------------------------------
A7H6E3_ANADF/41-216--------------------------------------------------------------------------------
Q0RYP1_RHOJR/26-263--------------------------------------------------------------------------------
F8EDQ7_RUNSL/37-216--------------------------------------------------------------------------------
G0FJD1_AMYMS/206-390--------------------------------------------------------------------------------
R6NCV8_9FIRM/6-193--------------------------------------------------------------------------------
R6PG94_9CLOT/121-280--------------------------------------------------------------------------------
Q82UM7_NITEU/30-192--------------------------------------------------------------------------------
C6WRE5_ACTMD/217-404--------------------------------------------------------------------------------
L0DHA9_SINAD/127-277--------------------------------------------------------------------------------
A5V0A0_ROSS1/41-245--------------------------------------------------------------------------------
D2NPI4_ROTMD/21-195--------------------------------------------------------------------------------
B0TE03_HELMI/9-186--------------------------------------------------------------------------------
Q8A4H8_BACTN/225-425--------------------------------------------------------------------------------
G0IUF5_CYCMS/53-234--------------------------------------------------------------------------------
D4ZHS5_SHEVD/49-220--------------------------------------------------------------------------------
Q5YZY5_NOCFA/37-212--------------------------------------------------------------------------------
D6ZHH5_MOBCV/133-302--------------------------------------------------------------------------------
K0SZ26_THAOC/9-209--------------------------------------------------------------------------------
Q2H5R4_CHAGB/11-199--------------------------------------------------------------------------------
R4SGZ1_AMYOR/48-219--------------------------------------------------------------------------------
R7DDH5_9FIRM/7-189--------------------------------------------------------------------------------
Q8Y9N1_LISMO/6-187--------------------------------------------------------------------------------
F8JTD2_STREN/229-421--------------------------------------------------------------------------------
E3Q6Q5_COLGM/11-186--------------------------------------------------------------------------------
H6N4I8_GORPV/55-221--------------------------------------------------------------------------------
A4J6W7_DESRM/116-292--------------------------------------------------------------------------------
Q039F3_LACC3/51-264--------------------------------------------------------------------------------
D4IPK2_9BACT/148-338--------------------------------------------------------------------------------
K5Y4R4_AGABU/11-211--------------------------------------------------------------------------------
G2P709_STRVO/96-318--------------------------------------------------------------------------------
W5XQ30_9CORY/32-259--------------------------------------------------------------------------------
R6EI94_9FIRM/48-212--------------------------------------------------------------------------------
C9YVQ8_STRSW/12-185--------------------------------------------------------------------------------
B5ECT5_GEOBB/43-204--------------------------------------------------------------------------------
L0IZI7_MYCSM/42-213--------------------------------------------------------------------------------
G8TMV1_NIAKG/60-223--------------------------------------------------------------------------------
D5CUL0_SIDLE/53-210--------------------------------------------------------------------------------
R7DJG6_9PORP/55-219--------------------------------------------------------------------------------
Q47RM4_THEFY/15-193--------------------------------------------------------------------------------
F0SHA0_RUBBR/63-240--------------------------------------------------------------------------------
E2PZZ8_STRC2/8-209--------------------------------------------------------------------------------
R5H640_9FIRM/141-306--------------------------------------------------------------------------------
I6Y6F5_PROPF/50-219--------------------------------------------------------------------------------
T5AQ29_OPHSC/11-176--------------------------------------------------------------------------------
R6V294_9FIRM/69-258--------------------------------------------------------------------------------
W0IX57_9BACT/13-200--------------------------------------------------------------------------------
S0DLQ3_GIBF5/10-185--------------------------------------------------------------------------------
K4L7W0_9FIRM/82-241--------------------------------------------------------------------------------
G2T4L0_ROSHA/46-226--------------------------------------------------------------------------------
R6AWH7_9BACT/279-454--------------------------------------------------------------------------------
G7WK40_METH6/28-202--------------------------------------------------------------------------------
R5GWK8_9FIRM/31-258--------------------------------------------------------------------------------
V6KNE3_STRNV/37-209--------------------------------------------------------------------------------
R7ETW3_9FIRM/179-369--------------------------------------------------------------------------------
R5GTV3_9FIRM/170-363--------------------------------------------------------------------------------
V6JZS2_STRRC/975-1284--------------------------------------------------------------------------------
G3XVI5_ASPNA/22-227--------------------------------------------------------------------------------
F0Y8S6_AURAN/6-192--------------------------------------------------------------------------------
M3J465_CANMX/8-216--------------------------------------------------------------------------------
D4K508_9FIRM/7-199--------------------------------------------------------------------------------
Q8YU46_NOSS1/82-300--------------------------------------------------------------------------------
R7BJR6_9FIRM/40-204--------------------------------------------------------------------------------
F9FZ25_FUSOF/61-245--------------------------------------------------------------------------------
R5FF96_9FIRM/37-265--------------------------------------------------------------------------------
B9IG91_POPTR/11-195--------------------------------------------------------------------------------
B9LZW9_GEODF/33-184--------------------------------------------------------------------------------
C6W7W0_ACTMD/17-192--------------------------------------------------------------------------------
R6QBA2_9FIRM/141-316--------------------------------------------------------------------------------
K9SJM4_9CYAN/133-375--------------------------------------------------------------------------------
R6MI53_9BACE/31-206--------------------------------------------------------------------------------
C6VYJ9_DYAFD/51-229--------------------------------------------------------------------------------
E4N364_KITSK/7-181--------------------------------------------------------------------------------
K4L2F9_9FIRM/16-224--------------------------------------------------------------------------------
E3HK46_ACHXA/219-415--------------------------------------------------------------------------------
H6MZH3_GORPV/43-278--------------------------------------------------------------------------------
E0SNG4_IGNAA/16-203--------------------------------------------------------------------------------
B2FLV5_STRMK/36-208--------------------------------------------------------------------------------
A6L9E6_PARD8/406-571--------------------------------------------------------------------------------
A5N0W3_CLOK5/50-280--------------------------------------------------------------------------------
R5V256_9FIRM/2373-2581--------------------------------------------------------------------------------
C7QHD3_CATAD/45-285--------------------------------------------------------------------------------
W5W8K9_9PSEU/13-210--------------------------------------------------------------------------------
I0H5M1_ACTM4/180-370--------------------------------------------------------------------------------
D5UM11_TSUPD/42-279--------------------------------------------------------------------------------
Q6BXY7_DEBHA/10-210--------------------------------------------------------------------------------
R7L8L2_9BACT/27-201--------------------------------------------------------------------------------
G8TKW5_NIAKG/416-581--------------------------------------------------------------------------------
B1ZMB2_OPITP/56-221--------------------------------------------------------------------------------
E4RYV2_LEAB4/25-222--------------------------------------------------------------------------------
Q2J4R6_FRASC/59-291--------------------------------------------------------------------------------
B1LTZ6_METRJ/11-172--------------------------------------------------------------------------------
C7YKB0_NECH7/63-247--------------------------------------------------------------------------------
D4IKA2_9BACT/180-341--------------------------------------------------------------------------------
F6FXF1_ISOV2/50-264--------------------------------------------------------------------------------
D2QSD1_SPILD/28-207--------------------------------------------------------------------------------
E9T017_RHOHA/12-185--------------------------------------------------------------------------------
F6EG43_AMYSD/49-298--------------------------------------------------------------------------------
D9QE05_CORP2/33-261--------------------------------------------------------------------------------
W5TIF4_9NOCA/14-188--------------------------------------------------------------------------------
A1AK13_PELPD/35-186--------------------------------------------------------------------------------
C6WRZ7_ACTMD/45-317--------------------------------------------------------------------------------
W0RP45_9BACT/63-226--------------------------------------------------------------------------------
A7HAV9_ANADF/46-221--------------------------------------------------------------------------------
A8MBU5_CALMQ/14-202--------------------------------------------------------------------------------
K9UBB8_9CHRO/31-266--------------------------------------------------------------------------------
J3NZ99_GAGT3/233-426--------------------------------------------------------------------------------
D2B220_STRRD/9-190--------------------------------------------------------------------------------
A4X5Q2_SALTO/46-271--------------------------------------------------------------------------------
M3A1S9_PSEFD/40-254--------------------------------------------------------------------------------
R6S0J7_9BACE/51-225--------------------------------------------------------------------------------
D6YAB7_THEBD/194-387--------------------------------------------------------------------------------
K9XU50_STAC7/82-299--------------------------------------------------------------------------------
E8UXT2_TERSS/206-412--------------------------------------------------------------------------------
E3RHX5_PYRTT/204-397--------------------------------------------------------------------------------
Q6LG08_PHOPR/49-220--------------------------------------------------------------------------------
X2GTY0_9GAMM/243-493--------------------------------------------------------------------------------
W0EFL6_9FIRM/61-220--------------------------------------------------------------------------------
E6UBD0_RUMA7/94-255--------------------------------------------------------------------------------
H8MKT4_CORCM/238-410--------------------------------------------------------------------------------
F8B3H7_FRADG/102-290--------------------------------------------------------------------------------
D2SFR9_GEOOG/10-185--------------------------------------------------------------------------------
H6R5S6_NOCCG/225-420--------------------------------------------------------------------------------
Q6ACS0_LEIXX/65-230--------------------------------------------------------------------------------
X2GLQ8_9BACI/91-283--------------------------------------------------------------------------------
R5TIV7_9CLOT/6-187--------------------------------------------------------------------------------
N4UMB5_FUSC1/35-233--------------------------------------------------------------------------------
H6MSH0_GORPV/85-264--------------------------------------------------------------------------------
J7ISJ6_DESMD/43-209--------------------------------------------------------------------------------
A7E806_SCLS1/11-186--------------------------------------------------------------------------------
A3QG84_SHELP/34-204--------------------------------------------------------------------------------
K1Y1R1_MARBU/11-192--------------------------------------------------------------------------------
E4TNS7_MARTH/50-214--------------------------------------------------------------------------------
B7GI34_ANOFW/42-229--------------------------------------------------------------------------------
T1L096_TETUR/43-222--------------------------------------------------------------------------------
W0J1J6_9BACT/50-222--------------------------------------------------------------------------------
I4ET37_MODMB/5-180--------------------------------------------------------------------------------
X2GSK3_9BACI/31-228--------------------------------------------------------------------------------
V5G6S2_BYSSN/231-429--------------------------------------------------------------------------------
B7GCS4_PHATC/222-406--------------------------------------------------------------------------------
D8PWM2_SCHCM/11-212--------------------------------------------------------------------------------
A3HWF5_9BACT/52-227--------------------------------------------------------------------------------
B2AU74_PODAN/11-194--------------------------------------------------------------------------------
Q82LC7_STRAW/221-407--------------------------------------------------------------------------------
G4RC97_PELHB/88-269--------------------------------------------------------------------------------
R5V8J1_9BACE/37-214--------------------------------------------------------------------------------
L0FX57_ECHVK/54-236--------------------------------------------------------------------------------
H6RW39_BLASD/35-273--------------------------------------------------------------------------------
R5QDP9_9FIRM/35-241--------------------------------------------------------------------------------
Q9F2Z1_STRCO/6-203--------------------------------------------------------------------------------
E1VUZ0_ARTAR/38-207--------------------------------------------------------------------------------
H1VDB1_COLHI/28-214--------------------------------------------------------------------------------
E4N961_KITSK/9-187--------------------------------------------------------------------------------
Q63PL7_BURPS/72-243--------------------------------------------------------------------------------
Q01A18_OSTTA/135-339--------------------------------------------------------------------------------
B8ET23_METSB/91-262--------------------------------------------------------------------------------
M2XH33_DOTSN/21-233--------------------------------------------------------------------------------
E9DZN0_METAQ/10-185--------------------------------------------------------------------------------
Q8DU46_STRMU/21-182--------------------------------------------------------------------------------
Q46LN4_PROMT/10-197--------------------------------------------------------------------------------
A6WER1_KINRD/11-184--------------------------------------------------------------------------------
D7B0X9_NOCDD/25-198--------------------------------------------------------------------------------
L0FTR2_ECHVK/52-227--------------------------------------------------------------------------------
R6SKX4_9CLOT/10-205--------------------------------------------------------------------------------
L0RUM6_MYCC1/103-370--------------------------------------------------------------------------------
R7FCL5_9FIRM/197-361--------------------------------------------------------------------------------
B1ZNN8_OPITP/84-244--------------------------------------------------------------------------------
G0HFZ3_CORVD/69-287--------------------------------------------------------------------------------
U9SUF4_RHIID/7-187--------------------------------------------------------------------------------
R6X2A1_9BACT/277-446--------------------------------------------------------------------------------
H6C8Z7_EXODN/226-426--------------------------------------------------------------------------------
R4TFY0_AMYOR/8-182--------------------------------------------------------------------------------
A4CMT0_ROBBH/52-215--------------------------------------------------------------------------------
S8EH10_FOMPI/156-349--------------------------------------------------------------------------------
B3PBS6_CELJU/890-1055--------------------------------------------------------------------------------
R5VR65_9FIRM/9-214--------------------------------------------------------------------------------
G2QV43_THITE/247-448--------------------------------------------------------------------------------
K0RH82_THAOC/57-262--------------------------------------------------------------------------------
Q9CEW1_LACLA/11-179--------------------------------------------------------------------------------
D6D175_9BACE/34-224--------------------------------------------------------------------------------
A6LQD3_CLOB8/9-178--------------------------------------------------------------------------------
B5HV00_9ACTN/172-361--------------------------------------------------------------------------------
W0J5S6_9BACT/184-351--------------------------------------------------------------------------------
B8LXC2_TALSN/172-366--------------------------------------------------------------------------------
B5Y584_PHATC/141-329--------------------------------------------------------------------------------
K1WTL0_MARBU/815-989--------------------------------------------------------------------------------
F2RCI5_STRVP/147-314--------------------------------------------------------------------------------
Q89X56_BRADU/70-231--------------------------------------------------------------------------------
H6NTM1_9BACL/1012-1217--------------------------------------------------------------------------------
A7SDI5_NEMVE/12-202--------------------------------------------------------------------------------
D2ARC6_STRRD/35-218--------------------------------------------------------------------------------
R5AQH7_9FIRM/9-215--------------------------------------------------------------------------------
C7R0X4_JONDD/29-208--------------------------------------------------------------------------------
F3ZF62_9ACTN/11-212--------------------------------------------------------------------------------
S6AI95_PSERE/58-229--------------------------------------------------------------------------------
R7GGE4_9CLOT/174-327--------------------------------------------------------------------------------
D9T465_MICAI/8-182--------------------------------------------------------------------------------
R6I9F2_9FIRM/75-243--------------------------------------------------------------------------------
B7K022_CYAP8/137-308--------------------------------------------------------------------------------
K2RQT3_MACPH/254-460--------------------------------------------------------------------------------
G0FWK7_AMYMS/34-271--------------------------------------------------------------------------------
C2X2M1_BACCE/57-245--------------------------------------------------------------------------------
D6XC24_9ACTN/201-386--------------------------------------------------------------------------------
R4LPL8_9ACTN/5-178--------------------------------------------------------------------------------
A4XXU1_PSEMY/56-227--------------------------------------------------------------------------------
C5B3G4_METEA/36-229--------------------------------------------------------------------------------
E3FI96_STIAD/7-182--------------------------------------------------------------------------------
C7Q166_CATAD/207-386--------------------------------------------------------------------------------
Q0RH78_FRAAA/18-203--------------------------------------------------------------------------------
G4L5Q0_TETHN/52-229--------------------------------------------------------------------------------
A8LCM3_FRASN/78-310--------------------------------------------------------------------------------
M1P8N9_9CORY/171-338--------------------------------------------------------------------------------
G8RZH6_ACTS5/15-191--------------------------------------------------------------------------------
E1STC6_FERBD/38-189--------------------------------------------------------------------------------
I3ZLP4_TERRK/91-256--------------------------------------------------------------------------------
D4LF09_RUMC1/40-277--------------------------------------------------------------------------------
Q8PE29_XANCP/18-208--------------------------------------------------------------------------------
R6FKM3_9BACE/45-260--------------------------------------------------------------------------------
R5IBD6_9PORP/52-216--------------------------------------------------------------------------------
D3Q5A1_STANL/37-279--------------------------------------------------------------------------------
A1SQ25_NOCSJ/8-182--------------------------------------------------------------------------------
L0G5F4_ECHVK/35-212--------------------------------------------------------------------------------
Q839J6_ENTFA/6-177--------------------------------------------------------------------------------
K0EVN5_9NOCA/37-290--------------------------------------------------------------------------------
Q10VH9_TRIEI/82-295--------------------------------------------------------------------------------
R6C9R5_9FIRM/45-206--------------------------------------------------------------------------------
D9TB24_MICAI/66-244--------------------------------------------------------------------------------
D5ELH5_CORAD/13-199--------------------------------------------------------------------------------
C6WNW7_ACTMD/47-323--------------------------------------------------------------------------------
K9WLU5_9CYAN/84-307--------------------------------------------------------------------------------
D3E715_GEOS4/8-197--------------------------------------------------------------------------------
D3FEM1_CONWI/415-592--------------------------------------------------------------------------------
D5SU16_PLAL2/85-244--------------------------------------------------------------------------------
G8RLC6_MYCRN/60-234--------------------------------------------------------------------------------
F0YPY0_AURAN/182-368--------------------------------------------------------------------------------
D4KX07_9FIRM/201-394--------------------------------------------------------------------------------
Q4K496_PSEF5/169-357--------------------------------------------------------------------------------
F6FRQ0_ISOV2/49-238--------------------------------------------------------------------------------
A0K019_ARTS2/43-282--------------------------------------------------------------------------------
R6PJS4_9FIRM/86-266--------------------------------------------------------------------------------
S8FIW6_FOMPI/11-210--------------------------------------------------------------------------------
A3QHA7_SHELP/37-188--------------------------------------------------------------------------------
B0RG54_CLAMS/57-217--------------------------------------------------------------------------------
R7EUZ9_9FIRM/269-454--------------------------------------------------------------------------------
Q74HT7_LACJO/6-172--------------------------------------------------------------------------------
B8I7W3_CLOCE/42-205--------------------------------------------------------------------------------
D4LAZ2_RUMC1/46-210--------------------------------------------------------------------------------
Q7VBS0_PROMA/10-197--------------------------------------------------------------------------------
G4UBG4_NEUT9/10-196--------------------------------------------------------------------------------
J3KHS7_COCIM/25-230--------------------------------------------------------------------------------
Q7UQP2_RHOBA/74-262--------------------------------------------------------------------------------
C7MDV1_BRAFD/20-196--------------------------------------------------------------------------------
G8T838_NIAKG/9-190--------------------------------------------------------------------------------
C5CN33_VARPS/214-410--------------------------------------------------------------------------------
R7K7T0_9FIRM/11-224--------------------------------------------------------------------------------
W0EZN1_9SPHI/65-230--------------------------------------------------------------------------------
M3CID9_SPHMS/13-237--------------------------------------------------------------------------------
R6SBW2_9BACE/34-225--------------------------------------------------------------------------------
C9A9E6_ENTCA/11-200--------------------------------------------------------------------------------
M7XMK5_RHOT1/11-211--------------------------------------------------------------------------------
W4XYX6_STRPU/23-183--------------------------------------------------------------------------------
C4XN11_DESMR/68-257--------------------------------------------------------------------------------
W0J3X9_9BACT/160-327--------------------------------------------------------------------------------
Q8PAG8_XANCP/48-225--------------------------------------------------------------------------------
B2FKH3_STRMK/82-246--------------------------------------------------------------------------------
R5M563_9BACE/30-204--------------------------------------------------------------------------------
C8XK01_NAKMY/7-181--------------------------------------------------------------------------------
R7J6X0_9PORP/29-206--------------------------------------------------------------------------------
F0Y9D3_AURAN/33-215--------------------------------------------------------------------------------
Q6AS67_DESPS/32-193--------------------------------------------------------------------------------
B2HRK1_MYCMM/57-228--------------------------------------------------------------------------------
D3EBN6_GEOS4/195-386--------------------------------------------------------------------------------
H1ZF87_MYROD/168-331--------------------------------------------------------------------------------
J3NIZ3_GAGT3/10-186--------------------------------------------------------------------------------
A0K1Y0_ARTS2/9-183--------------------------------------------------------------------------------
R4SXF6_AMYOR/58-298--------------------------------------------------------------------------------
G0AG80_COLFT/214-410--------------------------------------------------------------------------------
R5VAM2_9FIRM/35-199--------------------------------------------------------------------------------
Q2JBR1_FRASC/12-197--------------------------------------------------------------------------------
R6CUV2_9CLOT/6-194--------------------------------------------------------------------------------
H6NN37_9BACL/149-345--------------------------------------------------------------------------------
E8RJ13_DESPD/29-191--------------------------------------------------------------------------------
A9KK54_CLOPH/37-201--------------------------------------------------------------------------------
K0JVB8_SACES/62-239--------------------------------------------------------------------------------
R7FB09_9FIRM/6-191--------------------------------------------------------------------------------
D1B186_SULD5/43-196--------------------------------------------------------------------------------
M2UZE9_COCH5/10-222--------------------------------------------------------------------------------
N1JLC8_BLUG1/21-196--------------------------------------------------------------------------------
R5JET5_9FIRM/100-320--------------------------------------------------------------------------------
A5E6K3_LODEL/8-219--------------------------------------------------------------------------------
Q03D66_PEDPA/141-305--------------------------------------------------------------------------------
D2UC74_XANAP/13-194--------------------------------------------------------------------------------
V4IY07_9ACTN/384-578--------------------------------------------------------------------------------
R5QH07_9FIRM/8-208--------------------------------------------------------------------------------
F8QC87_SERL3/87-292--------------------------------------------------------------------------------
I0JI92_HALH3/207-394--------------------------------------------------------------------------------
Q1WRY6_LACS1/6-170--------------------------------------------------------------------------------
A9B0D3_HERA2/8-175--------------------------------------------------------------------------------
R7C524_9CLOT/6-191--------------------------------------------------------------------------------
G4U649_NEUT9/225-421--------------------------------------------------------------------------------
Q4A5V3_MYCS5/113-381--------------------------------------------------------------------------------
C5E1V3_ZYGRC/8-200--------------------------------------------------------------------------------
A3U4E6_CROAH/37-216--------------------------------------------------------------------------------
E6UHY0_RUMA7/43-275--------------------------------------------------------------------------------
I1JLE8_SOYBN/11-198--------------------------------------------------------------------------------
D7C0R4_STRBB/523-694--------------------------------------------------------------------------------
Q5WKP5_BACSK/26-209--------------------------------------------------------------------------------
E3J4T5_FRASU/61-294--------------------------------------------------------------------------------
G2Z5A6_FLABF/51-214--------------------------------------------------------------------------------
L0J5A7_MYCSM/7-181--------------------------------------------------------------------------------
D1A8A5_THECD/36-245--------------------------------------------------------------------------------
D3F514_CONWI/33-210--------------------------------------------------------------------------------
H5X671_9PSEU/34-273--------------------------------------------------------------------------------
K4IJV6_BIFAP/15-210--------------------------------------------------------------------------------
R6ZTW7_9FIRM/37-201--------------------------------------------------------------------------------
Q5KZ32_GEOKA/49-238--------------------------------------------------------------------------------
B1XWT3_LEPCP/48-231--------------------------------------------------------------------------------
M9RH72_9RHOB/66-237--------------------------------------------------------------------------------
R7CS48_9FIRM/33-203--------------------------------------------------------------------------------
Q8Y638_LISMO/41-241--------------------------------------------------------------------------------
G0G4C2_AMYMS/9-181--------------------------------------------------------------------------------
Q21DI0_SACD2/47-242--------------------------------------------------------------------------------
D4JTJ1_9FIRM/124-289--------------------------------------------------------------------------------
R7NSU5_9FIRM/32-237--------------------------------------------------------------------------------
S8DZS0_FOMPI/85-290--------------------------------------------------------------------------------
R5B6L2_9CLOT/9-216--------------------------------------------------------------------------------
C1A9H7_GEMAT/28-191--------------------------------------------------------------------------------
M1P5I2_DESSD/53-214--------------------------------------------------------------------------------
R4LI70_9ACTN/160-332--------------------------------------------------------------------------------
D7AZC7_NOCDD/435-633--------------------------------------------------------------------------------
M1NQ10_9CORY/42-278--------------------------------------------------------------------------------
D3E8J1_GEOS4/76-273--------------------------------------------------------------------------------
C6XV53_PEDHD/54-229--------------------------------------------------------------------------------
T0JK18_COLGC/72-249--------------------------------------------------------------------------------
Q5NG41_FRATT/43-193--------------------------------------------------------------------------------
D9SXV4_MICAI/221-424--------------------------------------------------------------------------------
D0IXP8_COMT2/50-207--------------------------------------------------------------------------------
G8S0V3_ACTS5/17-192--------------------------------------------------------------------------------
G8NYD6_GRAMM/53-214--------------------------------------------------------------------------------
M0SBH1_MUSAM/7-197--------------------------------------------------------------------------------
Q977Y6_CLOAB/158-350--------------------------------------------------------------------------------
U5LEA4_9BACI/5-218--------------------------------------------------------------------------------
C4XUC5_DESMR/100-277--------------------------------------------------------------------------------
R6XCS9_9PORP/32-243--------------------------------------------------------------------------------
E8V6W2_TERSS/196-388--------------------------------------------------------------------------------
B1MBB4_MYCA9/7-244--------------------------------------------------------------------------------
I4DC15_DESAJ/821-1051--------------------------------------------------------------------------------
A0A088ABE4_APIME/112-301--------------------------------------------------------------------------------
D1ARS6_SEBTE/79-246--------------------------------------------------------------------------------
C4Y266_CLAL4/10-202--------------------------------------------------------------------------------
C8WTT5_ALIAD/5-198--------------------------------------------------------------------------------
J4UX24_BEAB2/13-189--------------------------------------------------------------------------------
G2RF40_THITE/219-412--------------------------------------------------------------------------------
R7FDT6_9FIRM/41-279--------------------------------------------------------------------------------
C7NJR7_KYTSD/36-206--------------------------------------------------------------------------------
R5PWA8_9FIRM/30-247--------------------------------------------------------------------------------
Q8Y8Y7_LISMO/61-248--------------------------------------------------------------------------------
H6MYJ2_GORPV/2-233--------------------------------------------------------------------------------
D5B9W5_ZUNPS/55-218--------------------------------------------------------------------------------
D7MSP9_ARALL/8-200--------------------------------------------------------------------------------
G8QV54_SPHPG/8-201--------------------------------------------------------------------------------
H6CB89_EXODN/83-280--------------------------------------------------------------------------------
R5BHF6_9FIRM/12-184--------------------------------------------------------------------------------
R4KAJ0_CLOPA/5-177--------------------------------------------------------------------------------
A1R9P0_ARTAT/43-277--------------------------------------------------------------------------------
I3TMC9_TISMK/92-265--------------------------------------------------------------------------------
M1MWR4_9CLOT/40-203--------------------------------------------------------------------------------
U7PNF6_SPOS1/10-232--------------------------------------------------------------------------------
A1CMI9_ASPCL/9-179--------------------------------------------------------------------------------
R5AFJ6_9FIRM/8-200--------------------------------------------------------------------------------
A9WMI8_RENSM/43-217--------------------------------------------------------------------------------
A8J1E2_CHLRE/29-239--------------------------------------------------------------------------------
C5AYH8_METEA/19-260--------------------------------------------------------------------------------
B9DS11_STRU0/34-195--------------------------------------------------------------------------------
R7Y0Z2_9ACTN/69-247--------------------------------------------------------------------------------
B7KG25_CYAP7/24-214--------------------------------------------------------------------------------
R5JW71_9CLOT/118-285--------------------------------------------------------------------------------
G2P3G1_STRVO/12-183--------------------------------------------------------------------------------
I4ESS0_MODMB/71-247--------------------------------------------------------------------------------
G2LJ66_CHLTF/58-219--------------------------------------------------------------------------------
Q8A4H8_BACTN/25-198--------------------------------------------------------------------------------
W0EZI2_9SPHI/55-233--------------------------------------------------------------------------------
R5MPX6_9BACE/47-222--------------------------------------------------------------------------------
D5DJH7_BACMD/62-254--------------------------------------------------------------------------------
C6WW20_METML/34-196--------------------------------------------------------------------------------
D9QNG5_BRESC/186-375--------------------------------------------------------------------------------
J7IY22_DESMD/66-253--------------------------------------------------------------------------------
I0H330_ACTM4/6-182--------------------------------------------------------------------------------
A0A0C4DWB2_MAGP6/181-372--------------------------------------------------------------------------------
L0DCW1_SINAD/35-220--------------------------------------------------------------------------------
Q81JQ1_BACAN/60-248--------------------------------------------------------------------------------
R6L2K6_9FIRM/7-189--------------------------------------------------------------------------------
E2Q5Y8_STRC2/48-287--------------------------------------------------------------------------------
R5CCG2_9FIRM/189-363--------------------------------------------------------------------------------
W0J2A5_9BACT/77-251--------------------------------------------------------------------------------
R7YS62_CONA1/10-219--------------------------------------------------------------------------------
M1MR22_9CLOT/220-395--------------------------------------------------------------------------------
G1XET3_ARTOA/217-415--------------------------------------------------------------------------------
E0RWQ1_BUTPB/139-308--------------------------------------------------------------------------------
C7PM41_CHIPD/32-222--------------------------------------------------------------------------------
D3IBV9_9BACT/28-205--------------------------------------------------------------------------------
A4VWX6_STRSY/62-269--------------------------------------------------------------------------------
R6TL15_9FIRM/5-201--------------------------------------------------------------------------------
V6F7L3_9PROT/35-196--------------------------------------------------------------------------------
D0L3H8_GORB4/60-295--------------------------------------------------------------------------------
Q7V7G3_PROMM/10-197--------------------------------------------------------------------------------
X5EBR8_9CORY/45-280--------------------------------------------------------------------------------
R7QXV4_9FIRM/37-201--------------------------------------------------------------------------------
Q1DA77_MYXXD/212-426--------------------------------------------------------------------------------
Q1AUI1_RUBXD/35-225--------------------------------------------------------------------------------
A5I5D4_CLOBH/10-175--------------------------------------------------------------------------------
Q01S84_SOLUE/31-287--------------------------------------------------------------------------------
D6CZJ5_9BACE/168-330--------------------------------------------------------------------------------
D3UGN5_HELM1/81-260--------------------------------------------------------------------------------
D8LJK3_ECTSI/97-284--------------------------------------------------------------------------------
F2JR77_CELLD/23-187--------------------------------------------------------------------------------
E1ZCH2_CHLVA/62-274--------------------------------------------------------------------------------
M4VED3_9DELT/39-200--------------------------------------------------------------------------------
R8BYB3_TOGMI/185-378--------------------------------------------------------------------------------
W6RHN6_9RHIZ/17-209--------------------------------------------------------------------------------
R6DQS4_9BACE/183-345--------------------------------------------------------------------------------
G4TQV6_PIRID/222-418--------------------------------------------------------------------------------
H5WK90_9BURK/212-407--------------------------------------------------------------------------------
W0E9D7_9FIRM/58-245--------------------------------------------------------------------------------
R5PV31_9FIRM/180-339--------------------------------------------------------------------------------
D5DHH7_BACMD/65-253--------------------------------------------------------------------------------
G8RTL2_MYCRN/61-232--------------------------------------------------------------------------------
W5WI34_9PSEU/17-193--------------------------------------------------------------------------------
R7MQT7_9FIRM/41-205--------------------------------------------------------------------------------
A5GVJ4_SYNR3/11-198--------------------------------------------------------------------------------
E8UXS9_TERSS/207-406--------------------------------------------------------------------------------
A0LCN0_MAGMM/6-177--------------------------------------------------------------------------------
Q0C8G8_ASPTN/29-216--------------------------------------------------------------------------------
K0JYN3_SACES/16-188--------------------------------------------------------------------------------
S3CLA2_OPHP1/10-232--------------------------------------------------------------------------------
D5URZ7_TSUPD/38-213--------------------------------------------------------------------------------
E2SEE8_9ACTN/52-274--------------------------------------------------------------------------------
E1QVU1_OLSUV/197-360--------------------------------------------------------------------------------
F0YK74_AURAN/169-368--------------------------------------------------------------------------------
W0J0T3_9BACT/49-239--------------------------------------------------------------------------------
Q11X58_CYTH3/164-372--------------------------------------------------------------------------------
L0IWL1_MYCSM/9-182--------------------------------------------------------------------------------
K9XBL6_9CHRO/101-294--------------------------------------------------------------------------------
S5RL76_9STRE/46-208--------------------------------------------------------------------------------
G0S779_CHATD/201-393--------------------------------------------------------------------------------
R6S4H2_9FIRM/11-202--------------------------------------------------------------------------------
F4PCR4_BATDJ/100-300--------------------------------------------------------------------------------
Q0VS26_ALCBS/88-261--------------------------------------------------------------------------------
E2SCC7_9ACTN/39-277--------------------------------------------------------------------------------
U1M2Z6_ASCSU/140-398--------------------------------------------------------------------------------
G9MUE7_HYPVG/6-203--------------------------------------------------------------------------------
W5TJM1_9NOCA/42-271--------------------------------------------------------------------------------
R5HMY0_9FIRM/7-196--------------------------------------------------------------------------------
B9SQ29_RICCO/11-195--------------------------------------------------------------------------------
J7S4W9_KAZNA/10-194--------------------------------------------------------------------------------
D2B037_STRRD/82-260--------------------------------------------------------------------------------
LIPC_BACLD/7-197--------------------------------------------------------------------------------
K9VPA6_9CYAN/82-311--------------------------------------------------------------------------------
U5RX39_9CLOT/5-180--------------------------------------------------------------------------------
C5BSD1_TERTT/883-1048--------------------------------------------------------------------------------
A3I2P8_9BACT/38-227--------------------------------------------------------------------------------
Q15Q96_PSEA6/48-274--------------------------------------------------------------------------------
D7B873_NOCDD/49-285--------------------------------------------------------------------------------
B1M205_METRJ/18-181--------------------------------------------------------------------------------
R4L459_9ACTN/11-196--------------------------------------------------------------------------------
B8IR64_METNO/59-220--------------------------------------------------------------------------------
D1A4M6_THECD/44-217--------------------------------------------------------------------------------
B7VT44_VIBTL/112-264--------------------------------------------------------------------------------
R7IHP6_9FIRM/169-362--------------------------------------------------------------------------------
B6QSJ8_PENMQ/7-195--------------------------------------------------------------------------------
Q0BTT4_GRABC/71-247--------------------------------------------------------------------------------
S5TFU8_9CORY/39-277--------------------------------------------------------------------------------
U5LHY6_9BACI/37-223--------------------------------------------------------------------------------
F6IGQ3_9SPHN/59-301--------------------------------------------------------------------------------
C6D766_PAESJ/55-230--------------------------------------------------------------------------------
Q128U7_POLSJ/23-188--------------------------------------------------------------------------------
A8FFF8_BACP2/27-228--------------------------------------------------------------------------------
R5JVL3_9FIRM/199-367--------------------------------------------------------------------------------
C4Z845_EUBR3/318-505--------------------------------------------------------------------------------
A7HUI9_PARL1/82-267--------------------------------------------------------------------------------
V9XA96_9NOCA/22-236--------------------------------------------------------------------------------
F2JXL5_MARM1/6-193--------------------------------------------------------------------------------
F0Y861_AURAN/24-215--------------------------------------------------------------------------------
I3YMQ8_ALIFI/43-207--------------------------------------------------------------------------------
R6TKI3_9FIRM/67-257--------------------------------------------------------------------------------
D9SNT7_CLOC7/192-384--------------------------------------------------------------------------------
D4IYQ5_BUTFI/6-179--------------------------------------------------------------------------------
F4C1U8_SPHS2/54-215--------------------------------------------------------------------------------
M4EZC7_BRARP/11-198--------------------------------------------------------------------------------
B8DQP4_DESVM/33-194--------------------------------------------------------------------------------
Q8PAG8_XANCP/290-467--------------------------------------------------------------------------------
Q24RD6_DESHY/72-226--------------------------------------------------------------------------------
E8NG61_MICTS/8-183--------------------------------------------------------------------------------
H6R6Z0_NOCCG/175-377--------------------------------------------------------------------------------
M2YIH9_DOTSN/82-270--------------------------------------------------------------------------------
W0EQU7_9PORP/53-218--------------------------------------------------------------------------------
W0EZ82_9SPHI/28-211--------------------------------------------------------------------------------
C1DDE2_LARHH/16-209--------------------------------------------------------------------------------
K9SYE0_9SYNE/72-251--------------------------------------------------------------------------------
R6AUR3_9FIRM/13-183--------------------------------------------------------------------------------
D3Q6I6_STANL/34-248--------------------------------------------------------------------------------
B2GKW8_KOCRD/3-177--------------------------------------------------------------------------------
A5FWG0_ACICJ/57-235--------------------------------------------------------------------------------
E6SCR0_INTC7/73-252--------------------------------------------------------------------------------
R7XTG0_9ACTN/60-210--------------------------------------------------------------------------------
Q7UYD1_RHOBA/70-245--------------------------------------------------------------------------------
R7NMQ0_9BACE/523-696--------------------------------------------------------------------------------
S3DGQ2_GLAL2/30-213--------------------------------------------------------------------------------
H6RTH8_BLASD/10-184--------------------------------------------------------------------------------
W0F2D5_9SPHI/29-219--------------------------------------------------------------------------------
B2UQW3_AKKM8/129-304--------------------------------------------------------------------------------
F2F4U6_SOLSS/85-277--------------------------------------------------------------------------------
M7XM87_RHOT1/30-228--------------------------------------------------------------------------------
Q1D3N6_MYXXD/182-352--------------------------------------------------------------------------------
R7G1X0_9PROT/10-205--------------------------------------------------------------------------------
D8TLC4_VOLCA/28-233--------------------------------------------------------------------------------
F4CQN5_PSEUX/229-416--------------------------------------------------------------------------------
D1BPP2_VEIPT/5-170--------------------------------------------------------------------------------
Q1G7V0_LACDA/5-178--------------------------------------------------------------------------------
D9SWK7_CLOC7/43-206--------------------------------------------------------------------------------
H3G4Z4_PHYRM/7-200--------------------------------------------------------------------------------
D5VD77_MORCR/165-352--------------------------------------------------------------------------------
F3ZRM4_9BACE/425-588--------------------------------------------------------------------------------
B2FTV1_STRMK/7-188--------------------------------------------------------------------------------
F4CEW5_SPHS2/42-235--------------------------------------------------------------------------------
F6DQC0_DESRL/38-192--------------------------------------------------------------------------------
F2KWZ0_PREDF/198-391--------------------------------------------------------------------------------
B0RD91_CLAMS/81-245--------------------------------------------------------------------------------
M2LUW8_BAUCO/247-443--------------------------------------------------------------------------------
D4IPK1_9BACT/47-210--------------------------------------------------------------------------------
E0UE35_CYAP2/82-295--------------------------------------------------------------------------------
K0F563_9NOCA/35-207--------------------------------------------------------------------------------
D2AQL6_STRRD/216-411--------------------------------------------------------------------------------
A0B5L6_METTP/22-192--------------------------------------------------------------------------------
W1QGK1_OGAPD/11-207--------------------------------------------------------------------------------
D7B7I6_NOCDD/212-414--------------------------------------------------------------------------------
R6PIT1_9FIRM/9-197--------------------------------------------------------------------------------
K9WJ28_9CYAN/75-233--------------------------------------------------------------------------------
A0A068NM23_9BACT/41-216--------------------------------------------------------------------------------
D5DGY9_BACMD/72-229--------------------------------------------------------------------------------
L0EBK8_THECK/11-202--------------------------------------------------------------------------------
G8SHF1_ACTS5/212-401--------------------------------------------------------------------------------
F4L672_HALH1/674-843--------------------------------------------------------------------------------
B8BV65_THAPS/8-209--------------------------------------------------------------------------------
J7IV45_DESMD/5-167--------------------------------------------------------------------------------
R6YJ43_9CLOT/182-348--------------------------------------------------------------------------------
R6TR66_9FIRM/14-206--------------------------------------------------------------------------------
F3Z1W7_DESAF/11-172--------------------------------------------------------------------------------
Q7UMZ8_RHOBA/185-346--------------------------------------------------------------------------------
H3HE43_PHYRM/341-538--------------------------------------------------------------------------------
R5M4L7_9MOLU/65-231--------------------------------------------------------------------------------
U4LCB5_PYROM/8-204--------------------------------------------------------------------------------
D4K9Y7_9FIRM/21-212--------------------------------------------------------------------------------
D3RSH4_ALLVD/28-190--------------------------------------------------------------------------------
K9RFS6_9CYAN/8-182--------------------------------------------------------------------------------
R6TRC3_9STAP/11-192--------------------------------------------------------------------------------
D6Z9B1_SEGRD/46-286--------------------------------------------------------------------------------
F8EFQ5_RUNSL/32-224--------------------------------------------------------------------------------
Q2S860_HAHCH/15-195--------------------------------------------------------------------------------
R6TET1_9FIRM/9-216--------------------------------------------------------------------------------
R5U2Z5_9CLOT/7-200--------------------------------------------------------------------------------
A0A068NUF3_9BACT/63-234--------------------------------------------------------------------------------
V6L0F8_STRRC/201-383--------------------------------------------------------------------------------
C7ZB38_NECH7/10-215--------------------------------------------------------------------------------
A0A068NT01_9BACT/58-229--------------------------------------------------------------------------------
D0MRI1_PHYIT/69-266--------------------------------------------------------------------------------
B2IGP8_BEII9/56-227--------------------------------------------------------------------------------
E1V8Y0_HALED/214-409--------------------------------------------------------------------------------
U5VZI7_9ACTN/176-359--------------------------------------------------------------------------------
C6WMZ3_ACTMD/152-321--------------------------------------------------------------------------------
C6WAW0_ACTMD/28-211--------------------------------------------------------------------------------
K9XRJ0_STAC7/56-208--------------------------------------------------------------------------------
B3QTC5_CHLT3/38-201--------------------------------------------------------------------------------
R6SZ18_9FIRM/34-198--------------------------------------------------------------------------------
Q9HXP4_PSEAE/58-229--------------------------------------------------------------------------------
Q3XYR5_ENTFC/7-197--------------------------------------------------------------------------------
R4T3K4_AMYOR/31-207--------------------------------------------------------------------------------
Q9CI67_LACLA/61-273--------------------------------------------------------------------------------
F9D3P4_PREDD/208-404--------------------------------------------------------------------------------
L0DFM0_SINAD/189-389--------------------------------------------------------------------------------
Q896W5_CLOTE/5-178--------------------------------------------------------------------------------
F8JNS4_STREN/225-411--------------------------------------------------------------------------------
W0EXI5_9PORP/22-180--------------------------------------------------------------------------------
R4T4K1_AMYOR/209-394--------------------------------------------------------------------------------
B8NBN0_ASPFN/17-222--------------------------------------------------------------------------------
J3NRB8_GAGT3/45-230--------------------------------------------------------------------------------
F8ELT2_RUNSL/47-238--------------------------------------------------------------------------------
G0G3V8_AMYMS/32-270--------------------------------------------------------------------------------
I4DBB4_DESAJ/52-218--------------------------------------------------------------------------------
X5DV85_9BACT/48-227--------------------------------------------------------------------------------
J7SJM3_MORMO/177-372--------------------------------------------------------------------------------
Q0JY79_CUPNH/212-408--------------------------------------------------------------------------------
R6RJJ3_9FIRM/37-217--------------------------------------------------------------------------------
R5WGA5_9CLOT/41-248--------------------------------------------------------------------------------
E1ZFS5_CHLVA/124-330--------------------------------------------------------------------------------
R7FDY7_9FIRM/178-371--------------------------------------------------------------------------------
E1VYY3_ARTAR/2-175--------------------------------------------------------------------------------
H6NGP4_9BACL/65-253--------------------------------------------------------------------------------
T0JKW9_COLGC/10-226--------------------------------------------------------------------------------
E8NDF4_MICTS/61-224--------------------------------------------------------------------------------
G1XRV7_ARTOA/69-246--------------------------------------------------------------------------------
W0IYI0_9BACT/178-371--------------------------------------------------------------------------------
A9WTS0_RENSM/9-183--------------------------------------------------------------------------------
D2U9P1_XANAP/8-173--------------------------------------------------------------------------------
Q01ZF8_SOLUE/79-242--------------------------------------------------------------------------------
S8FBV4_FOMPI/11-210--------------------------------------------------------------------------------
E6TTI1_BACCJ/8-196--------------------------------------------------------------------------------
F6ELE1_AMYSD/184-385--------------------------------------------------------------------------------
V9XHS4_9NOCA/38-275--------------------------------------------------------------------------------
C4XUC6_DESMR/167-355--------------------------------------------------------------------------------
G8ZT92_TORDC/8-198--------------------------------------------------------------------------------
R5V9J5_9FIRM/184-349--------------------------------------------------------------------------------
L0DQ13_SINAD/145-355--------------------------------------------------------------------------------
D7SHQ7_VITVI/7-199--------------------------------------------------------------------------------
C7QJH0_CATAD/16-190--------------------------------------------------------------------------------
A9F9E9_SORC5/53-230--------------------------------------------------------------------------------
F9VBT4_LACGL/53-261--------------------------------------------------------------------------------
D2SC17_GEOOG/46-294--------------------------------------------------------------------------------
H6R4L3_NOCCG/12-204--------------------------------------------------------------------------------
B1ZU86_OPITP/72-243--------------------------------------------------------------------------------
G8TBC2_NIAKG/31-206--------------------------------------------------------------------------------
E1W079_ARTAR/7-183--------------------------------------------------------------------------------
W0IWB1_9BACT/47-219--------------------------------------------------------------------------------
Q825X9_STRAW/245-442--------------------------------------------------------------------------------
R6RVB6_9FIRM/22-210--------------------------------------------------------------------------------
F8EL35_RUNSL/142-329--------------------------------------------------------------------------------
R7I2W2_9CLOT/6-194--------------------------------------------------------------------------------
R5SCZ7_9BACE/7-223--------------------------------------------------------------------------------
C8XDX0_NAKMY/9-184--------------------------------------------------------------------------------
D2QGG8_SPILD/26-205--------------------------------------------------------------------------------
C8W9U3_ATOPD/186-344--------------------------------------------------------------------------------
D5UVA7_TSUPD/9-183--------------------------------------------------------------------------------
N0B1S0_9BACI/62-254--------------------------------------------------------------------------------
R6TA56_9FIRM/39-273--------------------------------------------------------------------------------
H6NLK8_9BACL/11-196--------------------------------------------------------------------------------
D9SQS3_CLOC7/207-373--------------------------------------------------------------------------------
K9UBE7_9CHRO/47-225--------------------------------------------------------------------------------
R6PPW1_9BACT/194-387--------------------------------------------------------------------------------
E8NCY2_MICTS/84-261--------------------------------------------------------------------------------
E0S190_BUTPB/91-246--------------------------------------------------------------------------------
H1YA85_9SPHI/311-483--------------------------------------------------------------------------------
I3VS17_THESW/14-222--------------------------------------------------------------------------------
C7QAZ6_CATAD/33-274--------------------------------------------------------------------------------
F6B7I7_DESCC/118-294--------------------------------------------------------------------------------
R5RJI0_9FIRM/39-220--------------------------------------------------------------------------------
S3D6H9_GLAL2/226-423--------------------------------------------------------------------------------
G0FIF1_AMYMS/207-400--------------------------------------------------------------------------------
R5R0C2_9FIRM/39-207--------------------------------------------------------------------------------
G8S363_ACTS5/8-183--------------------------------------------------------------------------------
D8P8Y5_9BACT/70-235--------------------------------------------------------------------------------
D4ZRN4_ARTPN/83-297--------------------------------------------------------------------------------
E3E7V0_PAEPS/81-275--------------------------------------------------------------------------------
D2Q1M6_KRIFD/42-286--------------------------------------------------------------------------------
L0DZM5_THIND/51-203--------------------------------------------------------------------------------
K5WAB2_PHACS/2-204--------------------------------------------------------------------------------
E8NA60_MICTS/422-597--------------------------------------------------------------------------------
B9DUT2_STRU0/52-262--------------------------------------------------------------------------------
R7K8F0_9FIRM/61-222--------------------------------------------------------------------------------
C6D221_PAESJ/11-202--------------------------------------------------------------------------------
R5GT16_9FIRM/101-270--------------------------------------------------------------------------------
R7L7H8_9BACT/44-208--------------------------------------------------------------------------------
G2IPF8_9SPHN/199-400--------------------------------------------------------------------------------
A6VT95_MARMS/598-841--------------------------------------------------------------------------------
G8SAJ2_ACTS5/29-248--------------------------------------------------------------------------------
D0MG26_RHOM4/171-362--------------------------------------------------------------------------------
G4Q7A0_ACIIR/299-467--------------------------------------------------------------------------------
N0AVY9_9BACI/33-222--------------------------------------------------------------------------------
R6V823_9FIRM/6-190--------------------------------------------------------------------------------
L0DME4_SINAD/55-259--------------------------------------------------------------------------------
D4LAQ7_RUMC1/127-297--------------------------------------------------------------------------------
K1QNQ0_CRAGI/39-200--------------------------------------------------------------------------------
F3YVV9_DESAF/5-180--------------------------------------------------------------------------------
R7C837_9CLOT/355-530--------------------------------------------------------------------------------
C1DC01_LARHH/5-181--------------------------------------------------------------------------------
C7MXV0_SACVD/37-254--------------------------------------------------------------------------------
C5CA01_MICLC/10-180--------------------------------------------------------------------------------
A0A0C4E6U9_MAGP6/10-189--------------------------------------------------------------------------------
G2TMF8_BACCO/50-242--------------------------------------------------------------------------------
Q15YL1_PSEA6/49-221--------------------------------------------------------------------------------
R5PFH0_9BACT/54-219--------------------------------------------------------------------------------
F7PG88_9EURY/160-324--------------------------------------------------------------------------------
R5CWS2_9BACT/198-383--------------------------------------------------------------------------------
C7PM89_CHIPD/42-221--------------------------------------------------------------------------------
R7HMG2_9BACT/46-208--------------------------------------------------------------------------------
I3YVQ5_AEQSU/35-215--------------------------------------------------------------------------------
C7QAL8_CATAD/12-198--------------------------------------------------------------------------------
F9YVE2_CAPCC/46-207--------------------------------------------------------------------------------
S5VAB4_STRCU/40-259--------------------------------------------------------------------------------
A0A016Q6L5_GIBZA/10-185--------------------------------------------------------------------------------
R6LIN1_9FIRM/5-193--------------------------------------------------------------------------------
R6CBN0_9CLOT/6-203--------------------------------------------------------------------------------
K0NF06_DESTT/39-189--------------------------------------------------------------------------------
H6NAM6_9BACL/69-264--------------------------------------------------------------------------------
K0F740_9NOCA/184-371--------------------------------------------------------------------------------
B3PIB1_CELJU/26-188--------------------------------------------------------------------------------
F9D671_PREDD/277-454--------------------------------------------------------------------------------
A4FQW5_SACEN/17-252--------------------------------------------------------------------------------
C1F1E1_ACIC5/207-404--------------------------------------------------------------------------------
K4D3V1_SOLLC/15-198--------------------------------------------------------------------------------
R6NZ78_9FIRM/113-282--------------------------------------------------------------------------------
R6ZDG3_9CLOT/52-215--------------------------------------------------------------------------------
F6IIE7_9SPHN/9-173--------------------------------------------------------------------------------
D4K7J8_9FIRM/113-288--------------------------------------------------------------------------------
I0H913_ACTM4/207-395--------------------------------------------------------------------------------
D5EI22_CORAD/39-232--------------------------------------------------------------------------------
V5UBD6_9BURK/209-405--------------------------------------------------------------------------------
R7L2X7_9FIRM/85-248--------------------------------------------------------------------------------
D7CMJ9_SYNLT/6-167--------------------------------------------------------------------------------
R7FXK7_9PROT/11-229--------------------------------------------------------------------------------
C6WQF9_ACTMD/45-280--------------------------------------------------------------------------------
K4IRB9_BIFAP/46-220--------------------------------------------------------------------------------
E2SF75_9ACTN/61-215--------------------------------------------------------------------------------
Q3ID43_PSEHT/7-195--------------------------------------------------------------------------------
Q2JLM7_SYNJB/147-318--------------------------------------------------------------------------------
R7E8T9_9BACE/120-299--------------------------------------------------------------------------------
R5UZG2_9FIRM/6-192--------------------------------------------------------------------------------
D5UV22_TSUPD/80-259--------------------------------------------------------------------------------
H2JR61_STRHJ/34-271--------------------------------------------------------------------------------
U9TNM8_RHIID/101-284--------------------------------------------------------------------------------
G8NQY9_GRAMM/203-395--------------------------------------------------------------------------------
G4NCX4_MAGO7/11-185--------------------------------------------------------------------------------
Q3JBY8_NITOC/45-198--------------------------------------------------------------------------------
D1APC7_SEBTE/35-209--------------------------------------------------------------------------------
B1ZZ20_OPITP/203-397--------------------------------------------------------------------------------
B1ZRF4_OPITP/60-271--------------------------------------------------------------------------------
H6LIN8_ACEWD/13-219--------------------------------------------------------------------------------
R6RYZ5_9CLOT/54-282--------------------------------------------------------------------------------
E6WWL2_PSEUU/7-192--------------------------------------------------------------------------------
I4EW73_MODMB/6-248--------------------------------------------------------------------------------
H8KS67_SOLCM/30-212--------------------------------------------------------------------------------
Q3SGZ1_THIDA/37-188--------------------------------------------------------------------------------
L0DBK1_SINAD/641-814--------------------------------------------------------------------------------
Q9A7G3_CAUCR/35-196--------------------------------------------------------------------------------
A1S8X6_SHEAM/32-183--------------------------------------------------------------------------------
E3HBW7_ILYPC/41-201--------------------------------------------------------------------------------
R6D7T5_9BACE/37-210--------------------------------------------------------------------------------
R6E9V5_9BACT/211-400--------------------------------------------------------------------------------
R7GLU6_9FIRM/5-165--------------------------------------------------------------------------------
E2Q2V2_STRC2/101-326--------------------------------------------------------------------------------
D7BYZ0_STRBB/7-190--------------------------------------------------------------------------------
G0L3B5_ZOBGA/44-240--------------------------------------------------------------------------------
F8QHB9_SERL3/156-349--------------------------------------------------------------------------------
D5BHE7_ZUNPS/221-411--------------------------------------------------------------------------------
B5HNT3_9ACTN/253-448--------------------------------------------------------------------------------
K9YKP4_CYASC/74-235--------------------------------------------------------------------------------
F3ZT72_9BACE/50-214--------------------------------------------------------------------------------
C6WMZ2_ACTMD/150-318--------------------------------------------------------------------------------
Q8RDJ0_CALS4/10-218--------------------------------------------------------------------------------
R6CU74_9BACE/44-259--------------------------------------------------------------------------------
E1ZG79_CHLVA/58-212--------------------------------------------------------------------------------
R7PBV3_9BACT/15-192--------------------------------------------------------------------------------
Q5K8F3_CRYNJ/13-212--------------------------------------------------------------------------------
C7R907_KANKD/39-190--------------------------------------------------------------------------------
A6Q4Y8_NITSB/4-201--------------------------------------------------------------------------------
R5UFU1_9BACE/33-252--------------------------------------------------------------------------------
B5HEJ4_STRPR/58-266--------------------------------------------------------------------------------
R6XI62_9BACT/47-212--------------------------------------------------------------------------------
B4RGH4_PHEZH/212-409--------------------------------------------------------------------------------
G7E8B7_MIXOS/54-272--------------------------------------------------------------------------------
I0JSX5_HALH3/31-222--------------------------------------------------------------------------------
K9VEU6_9CYAN/67-260--------------------------------------------------------------------------------
R7KTB2_9FIRM/97-260--------------------------------------------------------------------------------
G8UJ84_TANFA/28-205--------------------------------------------------------------------------------
D5SQT1_PLAL2/71-275--------------------------------------------------------------------------------
E8RUM8_ASTEC/207-403--------------------------------------------------------------------------------
B0SW94_CAUSK/234-427--------------------------------------------------------------------------------
H6LBV1_ACEWD/6-201--------------------------------------------------------------------------------
B8FJ19_DESAA/45-273--------------------------------------------------------------------------------
H5X006_9PSEU/9-181--------------------------------------------------------------------------------
F0Y3N1_AURAN/25-203--------------------------------------------------------------------------------
F0R7Z2_BACSH/52-267--------------------------------------------------------------------------------
G8UQE7_TANFA/401-564--------------------------------------------------------------------------------
R8BU19_TOGMI/22-237--------------------------------------------------------------------------------
A4X7S7_SALTO/237-438--------------------------------------------------------------------------------
C7PZ23_CATAD/76-258--------------------------------------------------------------------------------
U4LWA4_PYROM/131-377--------------------------------------------------------------------------------
C7NJL5_KYTSD/224-410--------------------------------------------------------------------------------
D2QIP1_SPILD/416-581--------------------------------------------------------------------------------
R6ZBU7_9FIRM/220-411--------------------------------------------------------------------------------
G2NPZ2_STREK/230-407--------------------------------------------------------------------------------
B2UL80_AKKM8/55-222--------------------------------------------------------------------------------
D9QH71_BRESC/81-267--------------------------------------------------------------------------------
B1M3V4_METRJ/7-172--------------------------------------------------------------------------------
M7SUI5_EUTLA/10-193--------------------------------------------------------------------------------
U5ML33_CLOSA/9-179--------------------------------------------------------------------------------
K9SBI9_9CYAN/84-304--------------------------------------------------------------------------------
R7BC63_9FIRM/205-376--------------------------------------------------------------------------------
I3ZD38_TERRK/237-427--------------------------------------------------------------------------------
V6F8X5_9PROT/9-181--------------------------------------------------------------------------------
I6XMY0_PROPF/10-186--------------------------------------------------------------------------------
W0ISM4_9BACT/151-323--------------------------------------------------------------------------------
A6KWZ2_BACV8/112-309--------------------------------------------------------------------------------
E8RV16_ASTEC/208-405--------------------------------------------------------------------------------
D4JRT2_9FIRM/122-286--------------------------------------------------------------------------------
R6VWP7_9FIRM/105-284--------------------------------------------------------------------------------
W0J500_9BACT/60-244--------------------------------------------------------------------------------
F2R8E8_STRVP/46-240--------------------------------------------------------------------------------
B2ULS5_AKKM8/68-235--------------------------------------------------------------------------------
U5LHI2_9BACI/56-241--------------------------------------------------------------------------------
D6Y065_BACIE/81-269--------------------------------------------------------------------------------
A4RWW2_OSTLU/6-219--------------------------------------------------------------------------------
E8UX12_TERSS/71-232--------------------------------------------------------------------------------
L0IZT1_MYCSM/7-244--------------------------------------------------------------------------------
N4TW03_FUSC1/29-191--------------------------------------------------------------------------------
R5HTW8_9FIRM/69-252--------------------------------------------------------------------------------
B8DPD7_DESVM/9-194--------------------------------------------------------------------------------
F7E4T5_XENTR/18-204--------------------------------------------------------------------------------
G3QAJ4_GASAC/44-204--------------------------------------------------------------------------------
Q482D4_COLP3/194-365--------------------------------------------------------------------------------
A1SNE8_NOCSJ/72-224--------------------------------------------------------------------------------
V5GFN7_PSEBG/6-263--------------------------------------------------------------------------------
D5A2C4_ARTPN/62-249--------------------------------------------------------------------------------
D7FM38_ECTSI/53-240--------------------------------------------------------------------------------
E4T286_PALPW/221-411--------------------------------------------------------------------------------
A0A068NP31_9BACT/31-219--------------------------------------------------------------------------------
R5HSH6_9FIRM/6-191--------------------------------------------------------------------------------
I4F3A0_MODMB/3-165--------------------------------------------------------------------------------
R7R963_9FIRM/96-280--------------------------------------------------------------------------------
A5GLS9_SYNPW/9-196--------------------------------------------------------------------------------
R5ZSR5_9BACT/27-204--------------------------------------------------------------------------------
U5LEB3_9BACI/12-202--------------------------------------------------------------------------------
I4D6J4_DESAJ/67-254--------------------------------------------------------------------------------
I0HJK1_ACTM4/61-238--------------------------------------------------------------------------------
C7NLH5_KYTSD/41-233--------------------------------------------------------------------------------
H2YVJ4_CIOSA/9-197--------------------------------------------------------------------------------
E0S1T9_BUTPB/6-194--------------------------------------------------------------------------------
D6D0F6_9BACE/180-341--------------------------------------------------------------------------------
D2PZ80_KRIFD/167-334--------------------------------------------------------------------------------
R7D434_9ACTN/6-204--------------------------------------------------------------------------------
W5VY75_9PSEU/9-181--------------------------------------------------------------------------------
Q026I9_SOLUE/144-335--------------------------------------------------------------------------------
D2R5K2_PIRSD/56-220--------------------------------------------------------------------------------
R5EZB3_9CLOT/164-328--------------------------------------------------------------------------------
G4TPN4_PIRID/142-334--------------------------------------------------------------------------------
M4RGN9_9BIFI/43-217--------------------------------------------------------------------------------
K9YIS9_CYASC/82-298--------------------------------------------------------------------------------
R7BE44_9FIRM/49-226--------------------------------------------------------------------------------
D4JYD0_9FIRM/112-285--------------------------------------------------------------------------------
A1U2I7_MARHV/52-225--------------------------------------------------------------------------------
F9ULR4_LACPL/132-315--------------------------------------------------------------------------------
R6WF41_9FIRM/426-590--------------------------------------------------------------------------------
R5KWS5_9BACT/186-371--------------------------------------------------------------------------------
R6MJG2_9FIRM/38-237--------------------------------------------------------------------------------
I0H537_ACTM4/30-201--------------------------------------------------------------------------------
U5LEW5_9BACI/55-247--------------------------------------------------------------------------------
K5W9N6_PHACS/11-202--------------------------------------------------------------------------------
R5NF46_9BACT/298-473--------------------------------------------------------------------------------
N4VB34_COLOR/219-412--------------------------------------------------------------------------------
B2AV39_PODAN/51-239--------------------------------------------------------------------------------
G0FLK0_AMYMS/13-188--------------------------------------------------------------------------------
R5SUL3_9CLOT/30-214--------------------------------------------------------------------------------
Q5WLH6_BACSK/7-176--------------------------------------------------------------------------------
Q21HS2_SACD2/892-1057--------------------------------------------------------------------------------
R4TAL2_AMYOR/210-393--------------------------------------------------------------------------------
G8RSA8_MYCRN/9-182--------------------------------------------------------------------------------
E4XM23_OIKDI/8-191--------------------------------------------------------------------------------
G0J5D5_CYCMS/91-275--------------------------------------------------------------------------------
B5I5M7_9ACTN/11-184--------------------------------------------------------------------------------
K0R8S4_THAOC/39-228--------------------------------------------------------------------------------
C7ZQC4_NECH7/200-387--------------------------------------------------------------------------------
E3IWT2_FRASU/5-181--------------------------------------------------------------------------------
R6EWN4_9BACT/196-378--------------------------------------------------------------------------------
L0J8J4_MYCSM/36-198--------------------------------------------------------------------------------
R5B674_9CLOT/6-196--------------------------------------------------------------------------------
C1F7Y4_ACIC5/203-398--------------------------------------------------------------------------------
I1M034_SOYBN/7-201--------------------------------------------------------------------------------
U5VYD0_9ACTN/246-502--------------------------------------------------------------------------------
D2VPA0_NAEGR/184-377--------------------------------------------------------------------------------
W0A6S8_9SPHN/211-403--------------------------------------------------------------------------------
Q2S0H3_SALRD/389-553--------------------------------------------------------------------------------
I4DBQ8_DESAJ/64-224--------------------------------------------------------------------------------
D7BMF1_ARCHD/25-193--------------------------------------------------------------------------------
B2FMY0_STRMK/197-393--------------------------------------------------------------------------------
C5MI95_CANTT/8-213--------------------------------------------------------------------------------
H6LGP1_ACEWD/5-176--------------------------------------------------------------------------------
R7L7H6_9CLOT/90-266--------------------------------------------------------------------------------
A9FSD2_SORC5/241-433--------------------------------------------------------------------------------
R7H8W5_9FIRM/6-194--------------------------------------------------------------------------------
C1F1E2_ACIC5/217-415--------------------------------------------------------------------------------
R1GXC4_BOTPV/10-212--------------------------------------------------------------------------------
R7C5Q6_9CLOT/40-247--------------------------------------------------------------------------------
R5HIJ0_9FIRM/274-454--------------------------------------------------------------------------------
Q24SF9_DESHY/58-218--------------------------------------------------------------------------------
Q7UPK6_RHOBA/125-364--------------------------------------------------------------------------------
R7FW59_9FIRM/107-263--------------------------------------------------------------------------------
D6DLD3_CLOSC/6-185--------------------------------------------------------------------------------
A6L2S7_BACV8/309-488--------------------------------------------------------------------------------
A0K069_ARTS2/5-197--------------------------------------------------------------------------------
R4KGW4_9FIRM/7-182--------------------------------------------------------------------------------
C6CUK6_PAESJ/42-214--------------------------------------------------------------------------------
D5WQL7_KYRT2/10-193--------------------------------------------------------------------------------
Q5HMH9_STAEQ/313-501--------------------------------------------------------------------------------
W5WJN0_9PSEU/34-249--------------------------------------------------------------------------------
N1PRM3_DOTSN/13-227--------------------------------------------------------------------------------
R6LLM9_9FIRM/11-202--------------------------------------------------------------------------------
C1N3W6_MICPC/12-210--------------------------------------------------------------------------------
Q7US11_RHOBA/99-286--------------------------------------------------------------------------------
A1K7D5_AZOSB/34-191--------------------------------------------------------------------------------
K4IHM2_PSYTT/14-194--------------------------------------------------------------------------------
Q026K7_SOLUE/83-246--------------------------------------------------------------------------------
G4NFX8_MAGO7/80-245--------------------------------------------------------------------------------
H6LIA9_ACEWD/61-245--------------------------------------------------------------------------------
C9ZBE8_STRSW/347-534--------------------------------------------------------------------------------
R7L9V8_9BACT/46-260--------------------------------------------------------------------------------
R4LL64_9ACTN/175-355--------------------------------------------------------------------------------
Q11WA7_CYTH3/37-215--------------------------------------------------------------------------------
B2ULI0_AKKM8/65-236--------------------------------------------------------------------------------
A5VJU1_LACRD/6-187--------------------------------------------------------------------------------
C0ZSP2_RHOE4/41-281--------------------------------------------------------------------------------
R5C084_9FIRM/6-190--------------------------------------------------------------------------------
D2R5J9_PIRSD/329-531--------------------------------------------------------------------------------
C6VTV7_DYAFD/307-476--------------------------------------------------------------------------------
W8KUA7_HALHR/42-194--------------------------------------------------------------------------------
I6ZPV1_MELRP/57-221--------------------------------------------------------------------------------
R6FU80_9CLOT/6-177--------------------------------------------------------------------------------
A7RN27_NEMVE/410-598--------------------------------------------------------------------------------
E6VQW5_DESAO/9-170--------------------------------------------------------------------------------
A1SQA2_NOCSJ/51-289--------------------------------------------------------------------------------
K4QTH4_9ACTN/381-574--------------------------------------------------------------------------------
E3J726_FRASU/31-259--------------------------------------------------------------------------------
Q75BS0_ASHGO/8-198--------------------------------------------------------------------------------
Q5YZU8_NOCFA/41-300--------------------------------------------------------------------------------
A8LEU2_FRASN/146-313--------------------------------------------------------------------------------
U5RZI1_9CLOT/68-258--------------------------------------------------------------------------------
E0U859_CYAP2/24-214--------------------------------------------------------------------------------
E1RCI1_SPISS/6-194--------------------------------------------------------------------------------
B2UMX7_AKKM8/63-230--------------------------------------------------------------------------------
R5Y3G7_9BACE/28-201--------------------------------------------------------------------------------
B2UNI1_AKKM8/29-223--------------------------------------------------------------------------------
C0ZNQ8_RHOE4/49-286--------------------------------------------------------------------------------
R5VJB4_9FIRM/42-279--------------------------------------------------------------------------------
W8EV81_9BACT/28-220--------------------------------------------------------------------------------
C0Q8S6_DESAH/50-221--------------------------------------------------------------------------------
K9FYE8_PEND2/21-226--------------------------------------------------------------------------------
W0J2U2_9BACT/150-343--------------------------------------------------------------------------------
B0CGA4_ACAM1/255-419--------------------------------------------------------------------------------
R5IGK7_9BACT/37-235--------------------------------------------------------------------------------
B0RDH5_CLAMS/19-179--------------------------------------------------------------------------------
D4LED5_RUMC1/79-242--------------------------------------------------------------------------------
H6N001_GORPV/2-177--------------------------------------------------------------------------------
Q8EM12_OCEIH/105-297--------------------------------------------------------------------------------
A6L8L4_PARD8/57-246--------------------------------------------------------------------------------
Q3A7F4_PELCD/44-195--------------------------------------------------------------------------------
D1C8L4_SPHTD/42-242--------------------------------------------------------------------------------
F0LZR5_VIBFN/587-830--------------------------------------------------------------------------------
R5VCX5_9FIRM/31-199--------------------------------------------------------------------------------
D7AYJ1_NOCDD/17-190--------------------------------------------------------------------------------
K9RC41_9CYAN/83-304--------------------------------------------------------------------------------
C9YU70_STRSW/227-421--------------------------------------------------------------------------------
D7DVG6_NOSA0/78-294--------------------------------------------------------------------------------
A5D049_PELTS/169-342--------------------------------------------------------------------------------
V4IE27_9DELT/41-203--------------------------------------------------------------------------------
C9Z2K0_STRSW/212-406--------------------------------------------------------------------------------
B0CCB8_ACAM1/12-186--------------------------------------------------------------------------------
Q7UX66_RHOBA/86-245--------------------------------------------------------------------------------
Q082B4_SHEFN/49-245--------------------------------------------------------------------------------
G8S2B6_ACTS5/34-293--------------------------------------------------------------------------------
E1WZN2_HALMS/24-186--------------------------------------------------------------------------------
G2TN38_BACCO/62-250--------------------------------------------------------------------------------
R4LCA1_9ACTN/7-182--------------------------------------------------------------------------------
G8TLQ5_NIAKG/171-346--------------------------------------------------------------------------------
I4D2M3_DESAJ/5-167--------------------------------------------------------------------------------
D2R4N1_PIRSD/62-225--------------------------------------------------------------------------------
U5VRD1_9ACTN/64-245--------------------------------------------------------------------------------
F7V8V0_CLOSS/6-194--------------------------------------------------------------------------------
A8LHP1_DINSH/32-210--------------------------------------------------------------------------------
E0RYI1_BUTPB/220-393--------------------------------------------------------------------------------
R5V2R8_9FIRM/215-387--------------------------------------------------------------------------------
R7G6H7_9PROT/9-220--------------------------------------------------------------------------------
V5RUS5_9BACT/249-510--------------------------------------------------------------------------------
W5DPY3_WHEAT/41-232--------------------------------------------------------------------------------
I0HV54_RUBGI/62-233--------------------------------------------------------------------------------
G4Q841_ACIIR/5-180--------------------------------------------------------------------------------
X5DZB8_9BACT/16-191--------------------------------------------------------------------------------
A1CSV7_ASPCL/22-227--------------------------------------------------------------------------------
I0JSN6_HALH3/104-297--------------------------------------------------------------------------------
X2H1A6_9BACI/46-255--------------------------------------------------------------------------------
R7AHW1_9BACE/172-351--------------------------------------------------------------------------------
K4LU24_THEPS/9-172--------------------------------------------------------------------------------
F0SML8_RUBBR/119-270--------------------------------------------------------------------------------
A5N0Q6_CLOK5/5-180--------------------------------------------------------------------------------
R7PBV3_9BACT/507-676--------------------------------------------------------------------------------
D8PA69_9BACT/78-239--------------------------------------------------------------------------------
E8V3G3_TERSS/68-234--------------------------------------------------------------------------------
D4LQG8_9FIRM/5-193--------------------------------------------------------------------------------
B1ZUX9_OPITP/78-236--------------------------------------------------------------------------------
R6TN72_9FIRM/139-308--------------------------------------------------------------------------------
V4JKV1_9GAMM/42-193--------------------------------------------------------------------------------
M1WN30_DESPC/10-171--------------------------------------------------------------------------------
E3JV53_PUCGT/26-233--------------------------------------------------------------------------------
Q74AG1_GEOSL/44-205--------------------------------------------------------------------------------
D4M1J3_9FIRM/5-193--------------------------------------------------------------------------------
B2ULH8_AKKM8/64-237--------------------------------------------------------------------------------
Q2U8P5_ASPOR/229-427--------------------------------------------------------------------------------
H6NBG6_9BACL/17-206--------------------------------------------------------------------------------
E6XCX1_CELAD/55-240--------------------------------------------------------------------------------
G3AWF1_CANTC/10-208--------------------------------------------------------------------------------
R5VD22_9FIRM/132-311--------------------------------------------------------------------------------
A8FEB0_BACP2/44-236--------------------------------------------------------------------------------
V5RTX1_9BACT/57-236--------------------------------------------------------------------------------
F8Q7C9_SERL3/11-198--------------------------------------------------------------------------------
N4VMZ5_COLOR/11-184--------------------------------------------------------------------------------
Q5YVD7_NOCFA/14-187--------------------------------------------------------------------------------
D5XEK6_THEPJ/5-166--------------------------------------------------------------------------------
B0T7S4_CAUSK/71-234--------------------------------------------------------------------------------
E8SE57_STAPH/144-333--------------------------------------------------------------------------------
R4SVH9_AMYOR/37-278--------------------------------------------------------------------------------
R6C0K0_9CLOT/36-201--------------------------------------------------------------------------------
V5WK61_9SPIO/67-248--------------------------------------------------------------------------------
E1SMZ7_FERBD/48-221--------------------------------------------------------------------------------
D4LIQ9_9FIRM/6-195--------------------------------------------------------------------------------
R7XU65_9ACTN/49-226--------------------------------------------------------------------------------
R6NPJ4_9FIRM/6-194--------------------------------------------------------------------------------
E3IVV5_FRASU/35-210--------------------------------------------------------------------------------
V6K3T9_STRNV/234-420--------------------------------------------------------------------------------
F9X7V5_ZYMTI/6-220--------------------------------------------------------------------------------
R5U3B1_9BACE/147-311--------------------------------------------------------------------------------
E1ZRG8_CHLVA/136-293--------------------------------------------------------------------------------
F4CYS8_PSEUX/11-186--------------------------------------------------------------------------------
H9UHJ7_SPIAZ/62-247--------------------------------------------------------------------------------
B8PBK6_POSPM/11-208--------------------------------------------------------------------------------
F2UH19_SALR5/12-182--------------------------------------------------------------------------------
H5WNQ7_9BURK/43-200--------------------------------------------------------------------------------
E9H7V0_DAPPU/39-199--------------------------------------------------------------------------------
E6SAB9_INTC7/17-200--------------------------------------------------------------------------------
A1T2Z9_MYCVP/2-238--------------------------------------------------------------------------------
R8BB48_TOGMI/14-199--------------------------------------------------------------------------------
D5SJT3_STRC2/200-397--------------------------------------------------------------------------------
R5B0L1_9BACE/31-208--------------------------------------------------------------------------------
F0SRA9_RUBBR/43-248--------------------------------------------------------------------------------
A2SLH8_METPP/327-506--------------------------------------------------------------------------------
G7LZ46_9CLOT/9-178--------------------------------------------------------------------------------
K9U0J6_9CYAN/5-179--------------------------------------------------------------------------------
A4FF09_SACEN/11-184--------------------------------------------------------------------------------
I1YLL8_METFJ/38-189--------------------------------------------------------------------------------
W1PZU1_AMBTC/7-205--------------------------------------------------------------------------------
D2NSR3_ROTMD/234-408--------------------------------------------------------------------------------
E8WX74_GRATM/282-468--------------------------------------------------------------------------------
Q1GDU1_RUEST/30-213--------------------------------------------------------------------------------
A1TYS4_MARHV/6-206--------------------------------------------------------------------------------
I0H220_ACTM4/46-269--------------------------------------------------------------------------------
R6U5P2_9BACE/206-367--------------------------------------------------------------------------------
I2EYQ3_EMTOG/9-188--------------------------------------------------------------------------------
R7GQN6_9FIRM/41-259--------------------------------------------------------------------------------
D9R9L3_CLOSW/7-193--------------------------------------------------------------------------------
C7QFZ1_CATAD/11-196--------------------------------------------------------------------------------
G4QE65_GLANF/39-204--------------------------------------------------------------------------------
R7MZN6_9FIRM/216-382--------------------------------------------------------------------------------
E3EIX1_PAEPS/7-198--------------------------------------------------------------------------------
K9T8D9_9CYAN/83-301--------------------------------------------------------------------------------
X5ED53_9CORY/40-281--------------------------------------------------------------------------------
D3AYD8_POLPA/162-349--------------------------------------------------------------------------------
S3BMP2_OPHP1/9-188--------------------------------------------------------------------------------
F4KTY0_HALH1/35-215--------------------------------------------------------------------------------
D3SCM9_THISK/43-200--------------------------------------------------------------------------------
H1YBS3_9SPHI/57-222--------------------------------------------------------------------------------
D9T818_MICAI/44-286--------------------------------------------------------------------------------
U5W1M2_9ACTN/206-412--------------------------------------------------------------------------------
A9BZ66_DELAS/224-420--------------------------------------------------------------------------------
R7IDR0_9FIRM/304-467--------------------------------------------------------------------------------
B2B688_PODAN/226-418--------------------------------------------------------------------------------
I3TH33_TISMK/15-191--------------------------------------------------------------------------------
C6Y404_PEDHD/29-206--------------------------------------------------------------------------------
H2Z3K4_CIOSA/43-203--------------------------------------------------------------------------------
R6CKS8_9BACE/404-569--------------------------------------------------------------------------------
E4TZG3_SULKY/42-194--------------------------------------------------------------------------------
D5X549_THIK1/79-258--------------------------------------------------------------------------------
K7ADM4_9ALTE/41-206--------------------------------------------------------------------------------
D2PRA6_KRIFD/47-220--------------------------------------------------------------------------------
U5W9U3_9ACTN/183-378--------------------------------------------------------------------------------
R7KD91_9CLOT/32-232--------------------------------------------------------------------------------
C8XKQ3_NAKMY/143-319--------------------------------------------------------------------------------
F8B6L5_FRADG/8-182--------------------------------------------------------------------------------
A3GIC5_PICST/10-208--------------------------------------------------------------------------------
R6W0U7_9BACT/148-340--------------------------------------------------------------------------------
W0IUM8_9BACT/38-203--------------------------------------------------------------------------------
A8LIG9_DINSH/47-215--------------------------------------------------------------------------------
R6L2T8_9FIRM/6-197--------------------------------------------------------------------------------
G2T5T3_ROSHA/6-194--------------------------------------------------------------------------------
Q7UXZ9_RHOBA/568-733--------------------------------------------------------------------------------
X4RBV3_9ACTO/5-173--------------------------------------------------------------------------------
E8WZ83_GRATM/61-268--------------------------------------------------------------------------------
X5A298_9BACL/158-325--------------------------------------------------------------------------------
M4NSS9_9GAMM/6-184--------------------------------------------------------------------------------
Q24ST3_DESHY/12-200--------------------------------------------------------------------------------
E6UEI8_RUMA7/680-893--------------------------------------------------------------------------------
C8X8C1_NAKMY/5-246--------------------------------------------------------------------------------
C7MVN8_SACVD/47-236--------------------------------------------------------------------------------
R7FMM7_9CLOT/71-236--------------------------------------------------------------------------------
R6QJZ5_9FIRM/6-192--------------------------------------------------------------------------------
X4ZE64_9BACL/7-197--------------------------------------------------------------------------------
R6DJ61_9BACE/410-575--------------------------------------------------------------------------------
Q6CPS9_KLULA/10-199--------------------------------------------------------------------------------
F0JH26_DESDE/9-170--------------------------------------------------------------------------------
D7C950_STRBB/86-307--------------------------------------------------------------------------------
C1CZT8_DEIDV/11-195--------------------------------------------------------------------------------
K0CJC9_ALCDB/51-222--------------------------------------------------------------------------------
C0ZGX1_BREBN/64-252--------------------------------------------------------------------------------
G0IZ64_CYCMS/432-621--------------------------------------------------------------------------------
Q0RKM9_FRAAA/67-247--------------------------------------------------------------------------------
B2JTV7_BURP8/220-405--------------------------------------------------------------------------------
M1MHB6_9CLOT/7-175--------------------------------------------------------------------------------
J9RGS5_9ACTN/475-652--------------------------------------------------------------------------------
E0RWX6_BUTPB/152-323--------------------------------------------------------------------------------
C7MDW0_BRAFD/14-198--------------------------------------------------------------------------------
R6FLH8_9BACE/438-604--------------------------------------------------------------------------------
B0SME6_LEPBP/41-205--------------------------------------------------------------------------------
W5W553_9PSEU/27-244--------------------------------------------------------------------------------
Q31K43_SYNE7/15-205--------------------------------------------------------------------------------
R7JB56_9PORP/47-210--------------------------------------------------------------------------------
J3NM06_GAGT3/41-227--------------------------------------------------------------------------------
I6Z820_MELRP/208-394--------------------------------------------------------------------------------
R7DK20_9PORP/25-200--------------------------------------------------------------------------------
D8PFA8_9BACT/12-196--------------------------------------------------------------------------------
W0J3V7_9BACT/53-230--------------------------------------------------------------------------------
R5TVZ1_9CLOT/159-345--------------------------------------------------------------------------------
E1ZTI1_CHLVA/79-271--------------------------------------------------------------------------------
T0VCM3_9ENTE/13-202--------------------------------------------------------------------------------
G0RZP4_CHATD/19-209--------------------------------------------------------------------------------
R7FVE4_9FIRM/118-277--------------------------------------------------------------------------------
C1F2Z5_ACIC5/34-195--------------------------------------------------------------------------------
D4LCL4_RUMC1/195-359--------------------------------------------------------------------------------
B2JII2_BURP8/240-436--------------------------------------------------------------------------------
D3PZ44_STANL/10-182--------------------------------------------------------------------------------
W5WNJ2_9PSEU/203-389--------------------------------------------------------------------------------
G2PJ35_MURRD/57-220--------------------------------------------------------------------------------
D3FAV1_CONWI/8-181--------------------------------------------------------------------------------
R6YP46_9BACT/207-391--------------------------------------------------------------------------------
F2F7D8_SOLSS/37-250--------------------------------------------------------------------------------
R5FMI1_9BACT/209-394--------------------------------------------------------------------------------
G7XG91_ASPKW/22-226--------------------------------------------------------------------------------
F6EQA8_AMYSD/45-282--------------------------------------------------------------------------------
E4TUR4_MARTH/30-213--------------------------------------------------------------------------------
R5PWT2_9FIRM/10-211--------------------------------------------------------------------------------
A8FA14_BACP2/7-197--------------------------------------------------------------------------------
B2IH68_BEII9/69-230--------------------------------------------------------------------------------
Q2IM16_ANADE/40-216--------------------------------------------------------------------------------
G8P069_GRAMM/78-242--------------------------------------------------------------------------------
A8PX90_MALGO/42-309--------------------------------------------------------------------------------
E3JAI1_FRASU/9-255--------------------------------------------------------------------------------
Q5LN18_RUEPO/39-209--------------------------------------------------------------------------------
Q5K9U6_CRYNJ/165-345--------------------------------------------------------------------------------
D4J5M8_9FIRM/7-185--------------------------------------------------------------------------------
K9WTW9_9NOST/81-299--------------------------------------------------------------------------------
G8R4C6_OWEHD/27-206--------------------------------------------------------------------------------
D5UYZ9_TSUPD/9-249--------------------------------------------------------------------------------
Q15PA8_PSEA6/42-207--------------------------------------------------------------------------------
G7V9L0_THELD/43-194--------------------------------------------------------------------------------
I5B2A7_9DELT/36-198--------------------------------------------------------------------------------
B0JM17_MICAN/89-299--------------------------------------------------------------------------------
D3Q3C1_STANL/215-410--------------------------------------------------------------------------------
R5PIN8_9BACT/280-455--------------------------------------------------------------------------------
K0J7Z4_AMPXN/77-268--------------------------------------------------------------------------------
B8GTV2_THISH/26-192--------------------------------------------------------------------------------
Q7NG29_GLOVI/224-395--------------------------------------------------------------------------------
Q026K5_SOLUE/144-335--------------------------------------------------------------------------------
B2URJ9_AKKM8/532-713--------------------------------------------------------------------------------
C5DAS0_GEOSW/53-242--------------------------------------------------------------------------------
S0EX80_CHTCT/42-230--------------------------------------------------------------------------------
I3Z6J3_BELBD/41-223--------------------------------------------------------------------------------
R7R3D6_9FIRM/142-310--------------------------------------------------------------------------------
D2PPH8_KRIFD/2-191--------------------------------------------------------------------------------
D4J0V8_BUTFI/46-226--------------------------------------------------------------------------------
Q586T2_TRYB2/6-210--------------------------------------------------------------------------------
G0IUV4_CYCMS/47-237--------------------------------------------------------------------------------
W5WT64_9CORY/22-256--------------------------------------------------------------------------------
G0FUA5_AMYMS/181-377--------------------------------------------------------------------------------
K9U897_9CYAN/45-229--------------------------------------------------------------------------------
R4SU39_AMYOR/11-191--------------------------------------------------------------------------------
C7N1W9_SLAHD/5-219--------------------------------------------------------------------------------
C8WUS4_ALIAD/56-260--------------------------------------------------------------------------------
R5T570_9CLOT/164-327--------------------------------------------------------------------------------
C7RKH7_ACCPU/34-191--------------------------------------------------------------------------------
A5I5Y3_CLOBH/5-180--------------------------------------------------------------------------------
Q023U6_SOLUE/217-404--------------------------------------------------------------------------------
G2NHP3_STREK/210-397--------------------------------------------------------------------------------
Q67QN7_SYMTH/65-226--------------------------------------------------------------------------------
C3ZQT2_BRAFL/20-206--------------------------------------------------------------------------------
F2ID25_FLUTR/30-208--------------------------------------------------------------------------------
A2U0C9_9FLAO/55-240--------------------------------------------------------------------------------
H3H1L5_PHYRM/329-520--------------------------------------------------------------------------------
Q186D1_PEPD6/5-180--------------------------------------------------------------------------------
D3R2N7_MAGIU/21-198--------------------------------------------------------------------------------
D5EL59_CORAD/48-211--------------------------------------------------------------------------------
U7PMJ7_SPOS1/10-195--------------------------------------------------------------------------------
A0R4U1_MYCS2/56-232--------------------------------------------------------------------------------
Q8F350_LEPIN/24-188--------------------------------------------------------------------------------
E0S508_BUTPB/6-198--------------------------------------------------------------------------------
F3ZEI9_9ACTN/52-288--------------------------------------------------------------------------------
K9SR20_9SYNE/131-302--------------------------------------------------------------------------------
Q02CW1_SOLUE/34-222--------------------------------------------------------------------------------
R5ILU3_9FIRM/6-210--------------------------------------------------------------------------------
R5K5X9_9CLOT/126-293--------------------------------------------------------------------------------
E1VUT6_ARTAR/9-185--------------------------------------------------------------------------------
K0KUJ4_WICCF/12-203--------------------------------------------------------------------------------
R7D9Y1_9FIRM/6-196--------------------------------------------------------------------------------
D2VIH1_NAEGR/2-183--------------------------------------------------------------------------------
W0EYF1_9SPHI/26-205--------------------------------------------------------------------------------
Q2J8V1_FRASC/18-192--------------------------------------------------------------------------------
C6W6L7_DYAFD/30-213--------------------------------------------------------------------------------
E3J525_FRASU/223-424--------------------------------------------------------------------------------
J9W3Q2_LACBU/139-337--------------------------------------------------------------------------------
T0M3T0_COLGC/11-198--------------------------------------------------------------------------------
M4SHS5_9SPHN/199-396--------------------------------------------------------------------------------
C4R727_PICPG/13-207--------------------------------------------------------------------------------
R7FZ82_9FIRM/37-212--------------------------------------------------------------------------------
M7SS21_EUTLA/66-254--------------------------------------------------------------------------------
R4LNE9_9ACTN/27-213--------------------------------------------------------------------------------
W0J5Z7_9BACT/213-400--------------------------------------------------------------------------------
G1X473_ARTOA/18-243--------------------------------------------------------------------------------
T1H8F4_RHOPR/38-200--------------------------------------------------------------------------------
F3YAQ4_MELPT/59-273--------------------------------------------------------------------------------
F9XPX0_ZYMTI/229-430--------------------------------------------------------------------------------
W5TSW8_9NOCA/9-184--------------------------------------------------------------------------------
D2Q178_KRIFD/222-406--------------------------------------------------------------------------------
E6S761_INTC7/29-206--------------------------------------------------------------------------------
C5DJE1_LACTC/10-202--------------------------------------------------------------------------------
I3Z6C5_BELBD/60-231--------------------------------------------------------------------------------
Q0RKW9_FRAAA/8-182--------------------------------------------------------------------------------
C7ZJ69_NECH7/26-227--------------------------------------------------------------------------------
R4XGD4_TAPDE/19-215--------------------------------------------------------------------------------
B0RCH8_CLAMS/28-193--------------------------------------------------------------------------------
B0T4K8_CAUSK/209-406--------------------------------------------------------------------------------
R7FWP8_9FIRM/6-191--------------------------------------------------------------------------------
K0JXS8_SACES/5-181--------------------------------------------------------------------------------
G7URL1_PSEUP/10-191--------------------------------------------------------------------------------
Q5ACH5_CANAL/23-227--------------------------------------------------------------------------------
C6BYT1_DESAD/8-169--------------------------------------------------------------------------------
Q5M3Z8_STRT2/33-249--------------------------------------------------------------------------------
W0PI03_9BURK/205-401--------------------------------------------------------------------------------
D2PT05_KRIFD/220-419--------------------------------------------------------------------------------
I6TDJ2_ENTHA/56-274--------------------------------------------------------------------------------
R7CYI6_9BACE/30-248--------------------------------------------------------------------------------
Q08XP7_STIAD/161-353--------------------------------------------------------------------------------
R7ESY8_9FIRM/8-218--------------------------------------------------------------------------------
F0T1M2_SYNGF/7-196--------------------------------------------------------------------------------
F1TJZ3_RHOHA/79-258--------------------------------------------------------------------------------
D2R645_PIRSD/39-221--------------------------------------------------------------------------------
F0S8G7_PSESL/178-340--------------------------------------------------------------------------------
H8KN25_SOLCM/10-188--------------------------------------------------------------------------------
G8JSE3_ERECY/8-197--------------------------------------------------------------------------------
A4FC13_SACEN/45-319--------------------------------------------------------------------------------
A0LIG2_SYNFM/42-193--------------------------------------------------------------------------------
Q8ED42_SHEON/26-184--------------------------------------------------------------------------------
C6WEE8_ACTMD/41-311--------------------------------------------------------------------------------
I5AU77_EUBCE/10-205--------------------------------------------------------------------------------
W0J963_9BACT/43-220--------------------------------------------------------------------------------
R6WLC7_9FIRM/33-213--------------------------------------------------------------------------------
R6LZ92_9FIRM/6-210--------------------------------------------------------------------------------
E6U1V7_BACCJ/11-194--------------------------------------------------------------------------------
U5MQJ3_CLOSA/6-201--------------------------------------------------------------------------------
F5Y6H6_RAMTT/24-245--------------------------------------------------------------------------------
B2FSX1_STRMK/189-379--------------------------------------------------------------------------------
Q0SH82_RHOJR/2-242--------------------------------------------------------------------------------
W5TQY6_9NOCA/233-435--------------------------------------------------------------------------------
R6W7D8_9BACT/280-458--------------------------------------------------------------------------------
R5GUN4_9FIRM/111-273--------------------------------------------------------------------------------
Q2G3M6_NOVAD/97-259--------------------------------------------------------------------------------

PF14606

Q7US24_RHOBA/217-394--------------------------------------------------------------------------------
A4APA9_MARSH/176-358--------------------------------------------------------------------------------
Q01R43_SOLUE/183-360--------------------------------------------------------------------------------
C6XT40_PEDHD/174-351--------------------------------------------------------------------------------
F0SBL3_PSESL/182-361--------------------------------------------------------------------------------
D3IDS0_9BACT/151-329--------------------------------------------------------------------------------
C6CUH9_PAESJ/158-340--------------------------------------------------------------------------------
D6D291_9BACE/177-350--------------------------------------------------------------------------------
D6D414_9BACE/177-354--------------------------------------------------------------------------------
Q8A1R6_BACTN/176-353--------------------------------------------------------------------------------
R7EPR9_9BACE/173-349--------------------------------------------------------------------------------

PF04311

W6REB0_9RHIZ/75-346RKAAPK.......................................................AAAAPRPAAP.........
Q98H53_RHILO/33-310QKAKPK.......................................................PRKPRIPRAP.........
O83576_TREPA/55-376RHKSVKNIYLAFVDPLMHTAEQWGIDTVFPLLRESFLHATGLIQHPEWEDTFYHCEQRSYEPAAALAESVPSPVLQEAVA

PF16255

A6L182_BACV8/24-226--------------------------------------------------------------------------------
D6D1C7_9BACE/24-224--------------------------------------------------------------------------------
R7ECW1_9BACE/24-225--------------------------------------------------------------------------------

PF17182

OSKA_DROME/405-606--------------------------------------------------------------------------------
E2A7I8_CAMFO/169-388--------------------------------------------------------------------------------
F4WQN7_ACREC/168-384--------------------------------------------------------------------------------
K7JUZ2_NASVI/160-378--------------------------------------------------------------------------------
B4LXK5_DROVI/393-594--------------------------------------------------------------------------------
B3LZ06_DROAN/400-602--------------------------------------------------------------------------------
B4GFV0_DROPE/417-619--------------------------------------------------------------------------------
W5JJ85_ANODA/179-355--------------------------------------------------------------------------------
F5HLA0_ANOGA/236-431--------------------------------------------------------------------------------
Q17PB4_AEDAE/276-474--------------------------------------------------------------------------------
B0WIV7_CULQU/203-401--------------------------------------------------------------------------------

PF08885

T2KQ07_9FLAO/22-260--------------------------------------------------------------------------------
C0QCX9_DESAH/46-310--------------------------------------------------------------------------------
R5EPC9_9BACE/21-255--------------------------------------------------------------------------------
A5VDH6_SPHWW/41-313--------------------------------------------------------------------------------
R6YAM1_9BACE/32-267--------------------------------------------------------------------------------
R7HNG1_9BACT/21-257--------------------------------------------------------------------------------
G2PK85_MURRD/21-260--------------------------------------------------------------------------------
I2EY90_EMTOG/21-257--------------------------------------------------------------------------------
B8IP12_METNO/42-312--------------------------------------------------------------------------------
A4YK23_BRASO/229-462--------------------------------------------------------------------------------
G8TR03_NIAKG/21-267--------------------------------------------------------------------------------
B1M3F5_METRJ/42-313--------------------------------------------------------------------------------
R5M3J3_9BACE/21-258--------------------------------------------------------------------------------
R7EUS3_9BACT/13-248--------------------------------------------------------------------------------
D5MM94_9BACT/76-315--------------------------------------------------------------------------------
R6Y730_9PORP/28-264--------------------------------------------------------------------------------
R7J1F8_9BACT/24-253--------------------------------------------------------------------------------
F0P1S2_WEEVC/21-257--------------------------------------------------------------------------------
B9J8F4_AGRRK/41-310--------------------------------------------------------------------------------
F8EN95_RUNSL/21-257--------------------------------------------------------------------------------
G0IXU2_CYCMS/22-258--------------------------------------------------------------------------------
E8RMP0_ASTEC/39-308--------------------------------------------------------------------------------
C5AUI8_METEA/49-319--------------------------------------------------------------------------------
L0G2R2_ECHVK/22-255--------------------------------------------------------------------------------
G2Z7S8_FLABF/21-259--------------------------------------------------------------------------------
G8X6A0_FLACA/17-254--------------------------------------------------------------------------------
G8ULQ0_TANFA/21-258--------------------------------------------------------------------------------
G8PQJ6_PSEUV/51-307--------------------------------------------------------------------------------
C7PMX6_CHIPD/22-258--------------------------------------------------------------------------------
A6LHC4_PARD8/21-258--------------------------------------------------------------------------------
R7LF46_9BACT/50-294--------------------------------------------------------------------------------
A0LXX4_GRAFK/22-257--------------------------------------------------------------------------------
F0R195_BACSH/21-257--------------------------------------------------------------------------------
F8JMP9_STREN/40-309--------------------------------------------------------------------------------
E4T1X0_PALPW/20-256--------------------------------------------------------------------------------
R6X342_9BACT/24-260--------------------------------------------------------------------------------
A6L176_BACV8/21-257--------------------------------------------------------------------------------
M9RBE9_9RHOB/323-562--------------------------------------------------------------------------------
R6L892_9BACE/21-258--------------------------------------------------------------------------------
T2GGB5_DESGI/40-310--------------------------------------------------------------------------------
Q11RW7_CYTH3/21-254--------------------------------------------------------------------------------
F4B2J3_DOKS4/22-257--------------------------------------------------------------------------------
R6FFG9_9BACE/21-258--------------------------------------------------------------------------------
R5RV25_9BACE/22-258--------------------------------------------------------------------------------
A1S3K5_SHEAM/44-301--------------------------------------------------------------------------------
F4L6L3_HALH1/23-258--------------------------------------------------------------------------------
R5NCX1_9BACT/22-258--------------------------------------------------------------------------------
R7D323_9BACE/32-279--------------------------------------------------------------------------------
H6L5M5_SAPGL/25-259--------------------------------------------------------------------------------
E6XET3_CELAD/21-258--------------------------------------------------------------------------------
C3KQN9_RHISN/57-328--------------------------------------------------------------------------------
F4KMJ5_PORAD/29-267--------------------------------------------------------------------------------
E4TT54_MARTH/21-257--------------------------------------------------------------------------------
D6D188_9BACE/31-268--------------------------------------------------------------------------------
A6H0Z4_FLAPJ/21-258--------------------------------------------------------------------------------
H1ZDZ1_MYROD/21-259--------------------------------------------------------------------------------
C4XP38_DESMR/33-276--------------------------------------------------------------------------------
W0EN83_9PORP/21-255--------------------------------------------------------------------------------
W0EYV8_9SPHI/21-264--------------------------------------------------------------------------------
R5VH21_9PORP/22-257--------------------------------------------------------------------------------
I4AP67_FLELS/21-272--------------------------------------------------------------------------------
I0KF94_9BACT/21-257--------------------------------------------------------------------------------
D4IN95_9BACT/21-252--------------------------------------------------------------------------------
A3U798_CROAH/21-257--------------------------------------------------------------------------------
R5GUT3_9BACT/21-259--------------------------------------------------------------------------------
F0RBR0_CELLC/21-260--------------------------------------------------------------------------------
A1B3U8_PARDP/64-333--------------------------------------------------------------------------------
I4C880_DESTA/46-310--------------------------------------------------------------------------------
Q121I3_POLSJ/60-298--------------------------------------------------------------------------------
R6CLT6_9BACE/22-257--------------------------------------------------------------------------------
X5DG71_9BACT/26-262--------------------------------------------------------------------------------
D5ATP2_RHOCB/41-310--------------------------------------------------------------------------------
R5YHQ3_9BACE/21-258--------------------------------------------------------------------------------
R6SA44_9BACE/21-257--------------------------------------------------------------------------------
S5XTM4_PARAH/50-309--------------------------------------------------------------------------------
J7QVY3_METSZ/42-313--------------------------------------------------------------------------------
R7JRE2_9BACT/59-292--------------------------------------------------------------------------------
A4AUF0_MARSH/21-260--------------------------------------------------------------------------------
R6EUG1_9BACE/22-258--------------------------------------------------------------------------------
Q5LH25_BACFN/21-258--------------------------------------------------------------------------------
C6X454_FLAB3/21-258--------------------------------------------------------------------------------
I3Z6K2_BELBD/21-257--------------------------------------------------------------------------------
G0L2J8_ZOBGA/21-255--------------------------------------------------------------------------------
I3YP53_ALIFI/21-252--------------------------------------------------------------------------------
F9Z2U7_ODOSD/27-263--------------------------------------------------------------------------------
R5JB51_9BACE/21-258--------------------------------------------------------------------------------
D3HQS8_LEGLN/335-604--------------------------------------------------------------------------------
F9YS98_CAPCC/21-256--------------------------------------------------------------------------------
R7PCY6_9BACT/23-264--------------------------------------------------------------------------------
Q28TN8_JANSC/41-309--------------------------------------------------------------------------------
L0FZB4_ECHVK/21-257--------------------------------------------------------------------------------
S5XXU5_PARAH/13-280--------------------------------------------------------------------------------
H2JZH7_STRHJ/41-311--------------------------------------------------------------------------------
R7NWR5_9BACE/21-257--------------------------------------------------------------------------------
D2QBX3_SPILD/37-300--------------------------------------------------------------------------------
H8XPR8_FLAIG/21-258--------------------------------------------------------------------------------
T0U393_9STRE/22-259--------------------------------------------------------------------------------
D2QK40_SPILD/21-257--------------------------------------------------------------------------------
R5CG89_9BACE/13-250--------------------------------------------------------------------------------
R5WEX8_9BACT/23-254--------------------------------------------------------------------------------
A5FIN8_FLAJ1/21-261--------------------------------------------------------------------------------
R6AYA1_9BACT/21-266--------------------------------------------------------------------------------
E4RZ72_LEAB4/28-259--------------------------------------------------------------------------------
K4IFD9_PSYTT/21-259--------------------------------------------------------------------------------
R5B7Q4_9BACE/21-258--------------------------------------------------------------------------------
F3ZNK8_9BACE/22-259--------------------------------------------------------------------------------
L7W558_NONDD/21-252--------------------------------------------------------------------------------
I3ZZB3_ORNRL/21-258--------------------------------------------------------------------------------
A3HZZ3_9BACT/21-256--------------------------------------------------------------------------------
R5BJ82_9BACE/23-256--------------------------------------------------------------------------------
R6E4B6_9BACE/21-258--------------------------------------------------------------------------------
R5IRK1_9PORP/21-258--------------------------------------------------------------------------------
B0UMN0_METS4/39-306--------------------------------------------------------------------------------
R5PD70_9PORP/21-257--------------------------------------------------------------------------------
W0AHI1_9SPHN/141-410--------------------------------------------------------------------------------
I3YWC9_AEQSU/21-270--------------------------------------------------------------------------------
A2TZ06_9FLAO/22-258--------------------------------------------------------------------------------
D8LTE6_ECTSI/26-281--------------------------------------------------------------------------------
E6SU26_BACT6/22-259--------------------------------------------------------------------------------
C7M4J9_CAPOD/21-255--------------------------------------------------------------------------------
R5IIF1_9BACT/9-264--------------------------------------------------------------------------------
R5GFU6_9PORP/21-256--------------------------------------------------------------------------------
R6M862_9BACE/23-259--------------------------------------------------------------------------------
C5AW44_METEA/40-311--------------------------------------------------------------------------------
R5W2G8_9BACE/21-257--------------------------------------------------------------------------------
A8LP01_DINSH/55-319--------------------------------------------------------------------------------
S5Y059_PARAH/41-311--------------------------------------------------------------------------------
B0T687_CAUSK/47-313--------------------------------------------------------------------------------
R7DF91_9PORP/21-258--------------------------------------------------------------------------------
C6W6S3_DYAFD/24-261--------------------------------------------------------------------------------
U5Q7D6_9BACT/21-253--------------------------------------------------------------------------------
W8FAI7_9BACT/20-256--------------------------------------------------------------------------------
S5YTU2_PARAH/50-305--------------------------------------------------------------------------------
F2IKK3_FLUTR/21-251--------------------------------------------------------------------------------
F6GCA5_LACS5/22-256--------------------------------------------------------------------------------
H1XPK2_9BACT/21-257--------------------------------------------------------------------------------
J9R834_RIEAN/21-258--------------------------------------------------------------------------------
Q7MVG8_PORGI/56-293--------------------------------------------------------------------------------
D5BGH9_ZUNPS/21-262--------------------------------------------------------------------------------
K4KIG2_SIMAS/57-326--------------------------------------------------------------------------------
R5V0S4_9BACE/23-258--------------------------------------------------------------------------------
D9SAD6_FIBSS/55-314--------------------------------------------------------------------------------
R7EIY0_9BACE/21-258--------------------------------------------------------------------------------

PF13839

I1HDA2_BRADI/102-372--------------------------------------------------------------------------------
K3XJ04_SETIT/101-367--------------------------------------------------------------------------------
M0THE4_MUSAM/79-345--------------------------------------------------------------------------------
M0THE2_MUSAM/56-320--------------------------------------------------------------------------------
C5XF85_SORBI/132-395--------------------------------------------------------------------------------
I1GVZ4_BRADI/91-367--------------------------------------------------------------------------------
M0TKC9_MUSAM/51-316--------------------------------------------------------------------------------
M4CML9_BRARP/114-379--------------------------------------------------------------------------------
B9S988_RICCO/104-367--------------------------------------------------------------------------------
C6TI78_SOYBN/87-350--------------------------------------------------------------------------------
B9IQP8_POPTR/104-368--------------------------------------------------------------------------------
K4CXY0_SOLLC/88-351--------------------------------------------------------------------------------
M4DK39_BRARP/125-389--------------------------------------------------------------------------------
TBL42_ARATH/89-355--------------------------------------------------------------------------------
C6TK47_SOYBN/81-338--------------------------------------------------------------------------------
K4DFD3_SOLLC/78-342--------------------------------------------------------------------------------
F6H2L0_VITVI/98-365--------------------------------------------------------------------------------
M0SCP2_MUSAM/297-583--------------------------------------------------------------------------------
M1BMX4_SOLTU/366-654--------------------------------------------------------------------------------
K7LM44_SOYBN/227-512--------------------------------------------------------------------------------
U5CQX8_AMBTC/232-517--------------------------------------------------------------------------------
M1AC79_SOLTU/163-445--------------------------------------------------------------------------------
B9HIR8_POPTR/76-359--------------------------------------------------------------------------------
M0SI10_MUSAM/109-391--------------------------------------------------------------------------------
I1KXD0_SOYBN/236-521--------------------------------------------------------------------------------
W1P591_AMBTC/203-489--------------------------------------------------------------------------------
Q7X6G0_ORYSJ/413-700--------------------------------------------------------------------------------
M0SIF6_MUSAM/183-467--------------------------------------------------------------------------------
K4AXI5_SOLLC/252-530--------------------------------------------------------------------------------
C5WMG8_SORBI/351-631--------------------------------------------------------------------------------
W5BBK9_WHEAT/132-430--------------------------------------------------------------------------------
W5AB85_WHEAT/213-502--------------------------------------------------------------------------------
I1MR80_SOYBN/147-438--------------------------------------------------------------------------------
M4CAF3_BRARP/147-437--------------------------------------------------------------------------------
I1N9G3_SOYBN/163-450--------------------------------------------------------------------------------
F6HQ78_VITVI/143-437--------------------------------------------------------------------------------
M0ZL21_SOLTU/154-444--------------------------------------------------------------------------------
M0TJF1_MUSAM/129-419--------------------------------------------------------------------------------
W5B4Y8_WHEAT/143-430--------------------------------------------------------------------------------
K4A1F0_SETIT/150-440--------------------------------------------------------------------------------
J3N1N8_ORYBR/106-392--------------------------------------------------------------------------------
W1NUJ3_AMBTC/132-416--------------------------------------------------------------------------------
TBL9_ARATH/120-404--------------------------------------------------------------------------------
B9IIQ9_POPTR/103-386--------------------------------------------------------------------------------
K7LHY5_SOYBN/61-344--------------------------------------------------------------------------------
M1DJ85_SOLTU/15-299--------------------------------------------------------------------------------
F6HKN5_VITVI/126-408--------------------------------------------------------------------------------
A9S967_PHYPA/55-345--------------------------------------------------------------------------------
A9U250_PHYPA/57-347--------------------------------------------------------------------------------
M0SUQ6_MUSAM/134-407--------------------------------------------------------------------------------
K3Z645_SETIT/169-442--------------------------------------------------------------------------------
I1K4Y2_SOYBN/144-417--------------------------------------------------------------------------------
M1CSM4_SOLTU/140-413--------------------------------------------------------------------------------
B9SJJ2_RICCO/84-357--------------------------------------------------------------------------------
M1CBA4_SOLTU/136-409--------------------------------------------------------------------------------
U5DES1_AMBTC/141-415--------------------------------------------------------------------------------
D8T689_SELML/59-325--------------------------------------------------------------------------------
D8SDV9_SELML/53-333--------------------------------------------------------------------------------
D8RQZ2_SELML/54-331--------------------------------------------------------------------------------
J3MCR3_ORYBR/203-494--------------------------------------------------------------------------------
I1GZG6_BRADI/206-499--------------------------------------------------------------------------------
I1PII0_ORYGL/153-443--------------------------------------------------------------------------------
I1Q103_ORYGL/148-445--------------------------------------------------------------------------------
M0RMZ7_MUSAM/423-709--------------------------------------------------------------------------------
I1LWD8_SOYBN/156-450--------------------------------------------------------------------------------
M4EW55_BRARP/637-924--------------------------------------------------------------------------------
D7TWT7_VITVI/127-413--------------------------------------------------------------------------------
B9IJP0_POPTR/130-415--------------------------------------------------------------------------------
B9RI54_RICCO/59-345--------------------------------------------------------------------------------
B9I0J9_POPTR/100-385--------------------------------------------------------------------------------
K4BBL9_SOLLC/134-420--------------------------------------------------------------------------------
W1NWB0_AMBTC/122-407--------------------------------------------------------------------------------
D7UCM0_VITVI/124-416--------------------------------------------------------------------------------
M0ZGG7_SOLTU/151-439--------------------------------------------------------------------------------
D7M912_ARALL/132-426--------------------------------------------------------------------------------
I1K6B0_SOYBN/159-450--------------------------------------------------------------------------------
M1AWR7_SOLTU/134-425--------------------------------------------------------------------------------
K3Z6J9_SETIT/118-413--------------------------------------------------------------------------------
J3MEM3_ORYBR/155-447--------------------------------------------------------------------------------
M0S3U1_MUSAM/58-337--------------------------------------------------------------------------------
M4F8H3_BRARP/144-428--------------------------------------------------------------------------------
D8QPP4_SELML/53-341--------------------------------------------------------------------------------
D8QY23_SELML/56-332--------------------------------------------------------------------------------
D8S752_SELML/53-346--------------------------------------------------------------------------------
D8QVF2_SELML/145-434--------------------------------------------------------------------------------
M1CIT6_SOLTU/156-442--------------------------------------------------------------------------------
I1KWP7_SOYBN/46-334--------------------------------------------------------------------------------
F6GVS1_VITVI/148-436--------------------------------------------------------------------------------
W1PE31_AMBTC/138-426--------------------------------------------------------------------------------
TBL19_ARATH/121-408--------------------------------------------------------------------------------
M1BM92_SOLTU/126-414--------------------------------------------------------------------------------
M4CWR7_BRARP/160-445--------------------------------------------------------------------------------
M4DY63_BRARP/187-476--------------------------------------------------------------------------------
M0SKW8_MUSAM/22-279--------------------------------------------------------------------------------
B9H3S4_POPTR/77-365--------------------------------------------------------------------------------
B9H3S3_POPTR/118-408--------------------------------------------------------------------------------
K7MV65_SOYBN/266-551--------------------------------------------------------------------------------
I1N6M2_SOYBN/120-414--------------------------------------------------------------------------------
M1AMU2_SOLTU/134-422--------------------------------------------------------------------------------
F6GVR8_VITVI/123-410--------------------------------------------------------------------------------
I1M1U0_SOYBN/101-388--------------------------------------------------------------------------------
K7M1C5_SOYBN/8-281--------------------------------------------------------------------------------
K7M1C7_SOYBN/113-405--------------------------------------------------------------------------------
C5X1E7_SORBI/126-425--------------------------------------------------------------------------------
K7W7X5_MAIZE/110-392--------------------------------------------------------------------------------
Q5VQ32_ORYSJ/137-426--------------------------------------------------------------------------------
K7VC90_MAIZE/144-434--------------------------------------------------------------------------------
K3XPR1_SETIT/109-393--------------------------------------------------------------------------------
J3L2F0_ORYBR/105-384--------------------------------------------------------------------------------
M0TJ44_MUSAM/411-699--------------------------------------------------------------------------------
W5D5E6_WHEAT/111-401--------------------------------------------------------------------------------
W5GC88_WHEAT/151-449--------------------------------------------------------------------------------
K3YZH9_SETIT/111-390--------------------------------------------------------------------------------
M0V430_HORVD/125-422--------------------------------------------------------------------------------
M0SC88_MUSAM/22-282--------------------------------------------------------------------------------
I1JBZ5_SOYBN/127-420--------------------------------------------------------------------------------
I1JC00_SOYBN/141-430--------------------------------------------------------------------------------
B9SZI4_RICCO/127-420--------------------------------------------------------------------------------
I1KXJ6_SOYBN/126-419--------------------------------------------------------------------------------
K7K1K6_SOYBN/132-426--------------------------------------------------------------------------------
W1NRF5_AMBTC/170-460--------------------------------------------------------------------------------
K4AT03_SOLLC/117-409--------------------------------------------------------------------------------
M4DIA2_BRARP/125-407--------------------------------------------------------------------------------
I1Q108_ORYGL/129-421--------------------------------------------------------------------------------
K3Y1Z2_SETIT/140-439--------------------------------------------------------------------------------
K3Y282_SETIT/134-432--------------------------------------------------------------------------------
C5Z7G1_SORBI/142-449--------------------------------------------------------------------------------
C7J578_ORYSJ/132-443--------------------------------------------------------------------------------
A0A096PT38_MAIZE/142-436--------------------------------------------------------------------------------
K3Y133_SETIT/133-427--------------------------------------------------------------------------------
K3Y1R7_SETIT/136-428--------------------------------------------------------------------------------
C5Z7G4_SORBI/137-447--------------------------------------------------------------------------------
K3Y271_SETIT/119-417--------------------------------------------------------------------------------
M0WKW0_HORVD/22-313--------------------------------------------------------------------------------
J3MCR7_ORYBR/158-436--------------------------------------------------------------------------------
C5Y8L0_SORBI/170-474--------------------------------------------------------------------------------
K4A0P2_SETIT/140-454--------------------------------------------------------------------------------
J3L729_ORYBR/203-496--------------------------------------------------------------------------------
M4E1A8_BRARP/167-464--------------------------------------------------------------------------------
A9U1Q5_PHYPA/72-365--------------------------------------------------------------------------------
D8TDQ5_SELML/57-342--------------------------------------------------------------------------------
A9RCM6_PHYPA/75-367--------------------------------------------------------------------------------
A9RAV2_PHYPA/82-371--------------------------------------------------------------------------------
A9SR73_PHYPA/53-347--------------------------------------------------------------------------------
A9T2B6_PHYPA/55-349--------------------------------------------------------------------------------
TBL15_ARATH/196-481--------------------------------------------------------------------------------
K3YHK2_SETIT/167-452--------------------------------------------------------------------------------
I1QNR6_ORYGL/127-414--------------------------------------------------------------------------------
M0TGY1_MUSAM/172-456--------------------------------------------------------------------------------
K4CC01_SOLLC/175-460--------------------------------------------------------------------------------
D7SWD4_VITVI/26-311--------------------------------------------------------------------------------
D8SC44_SELML/54-340--------------------------------------------------------------------------------
M8A9I0_TRIUA/109-389--------------------------------------------------------------------------------
D8RRK5_SELML/82-355--------------------------------------------------------------------------------
A9SPN8_PHYPA/96-373--------------------------------------------------------------------------------
F1M6L4_RAT/16-261--------------------------------------------------------------------------------
U9U904_RHIID/150-390--------------------------------------------------------------------------------
Q69RQ8_ORYSJ/119-407--------------------------------------------------------------------------------
M4D9G5_BRARP/115-404--------------------------------------------------------------------------------
M0ZU12_SOLTU/99-389--------------------------------------------------------------------------------
W1PYJ8_AMBTC/16-304--------------------------------------------------------------------------------
K3YY82_SETIT/119-411--------------------------------------------------------------------------------
Q6ZGL3_ORYSJ/102-393--------------------------------------------------------------------------------
D8SXV0_SELML/102-392--------------------------------------------------------------------------------
K4DCV5_SOLLC/118-401--------------------------------------------------------------------------------
W1Q0I9_AMBTC/106-389--------------------------------------------------------------------------------
M0S885_MUSAM/110-392--------------------------------------------------------------------------------
M0THU3_MUSAM/141-429--------------------------------------------------------------------------------
I1JLD0_SOYBN/139-426--------------------------------------------------------------------------------
I1PAA6_ORYGL/149-437--------------------------------------------------------------------------------
C5Y301_SORBI/145-439--------------------------------------------------------------------------------
M0TD12_MUSAM/111-411--------------------------------------------------------------------------------
I1PGR4_ORYGL/161-470--------------------------------------------------------------------------------
D7SR66_VITVI/138-427--------------------------------------------------------------------------------
M0SQ34_MUSAM/112-401--------------------------------------------------------------------------------
W1NJX9_AMBTC/132-421--------------------------------------------------------------------------------
K4BAG2_SOLLC/179-468--------------------------------------------------------------------------------
K4D1Y2_SOLLC/112-402--------------------------------------------------------------------------------
K4C1S4_SOLLC/130-418--------------------------------------------------------------------------------
I1HKA3_BRADI/160-454--------------------------------------------------------------------------------
TBL33_ARATH/134-421--------------------------------------------------------------------------------
K4AA04_SETIT/154-441--------------------------------------------------------------------------------
M0WSV3_HORVD/72-360--------------------------------------------------------------------------------
K3Z5C2_SETIT/219-510--------------------------------------------------------------------------------
M0RV56_MUSAM/187-469--------------------------------------------------------------------------------
W5E472_WHEAT/268-562--------------------------------------------------------------------------------
K3Y728_SETIT/157-446--------------------------------------------------------------------------------
J3L5H2_ORYBR/219-509--------------------------------------------------------------------------------
M0SQ51_MUSAM/141-429--------------------------------------------------------------------------------
W1P5Y9_AMBTC/302-591--------------------------------------------------------------------------------
B9HSM4_POPTR/91-381--------------------------------------------------------------------------------
B9SQN5_RICCO/140-431--------------------------------------------------------------------------------
M4C7J4_BRARP/120-408--------------------------------------------------------------------------------
B9SQN8_RICCO/130-417--------------------------------------------------------------------------------
M1BTU0_SOLTU/92-365--------------------------------------------------------------------------------
W1Q0A2_AMBTC/151-425--------------------------------------------------------------------------------
M0U878_MUSAM/186-462--------------------------------------------------------------------------------
E0CTP6_VITVI/133-402--------------------------------------------------------------------------------
B9IQP7_POPTR/134-413--------------------------------------------------------------------------------
F6H506_VITVI/250-519--------------------------------------------------------------------------------
B9HKQ5_POPTR/113-383--------------------------------------------------------------------------------
W1PIY7_AMBTC/113-391--------------------------------------------------------------------------------
C5WNJ2_SORBI/113-390--------------------------------------------------------------------------------
M0RKN4_MUSAM/133-408--------------------------------------------------------------------------------
TBL45_ARATH/110-395--------------------------------------------------------------------------------
B9GGP4_POPTR/139-413--------------------------------------------------------------------------------
K7MQ86_SOYBN/103-385--------------------------------------------------------------------------------
K4C3A0_SOLLC/144-425--------------------------------------------------------------------------------
K4CA66_SOLLC/111-390--------------------------------------------------------------------------------
M4CEK3_BRARP/117-396--------------------------------------------------------------------------------
K4CGB3_SOLLC/96-345--------------------------------------------------------------------------------
B9RSU2_RICCO/86-352--------------------------------------------------------------------------------
F6H553_VITVI/82-349--------------------------------------------------------------------------------
K4CGB1_SOLLC/85-347--------------------------------------------------------------------------------
D7MX51_ARALL/93-362--------------------------------------------------------------------------------
K7MSD8_SOYBN/91-357--------------------------------------------------------------------------------
F6H554_VITVI/91-356--------------------------------------------------------------------------------
E0CS20_VITVI/95-361--------------------------------------------------------------------------------
B9I1Q9_POPTR/96-363--------------------------------------------------------------------------------
TBL41_ARATH/86-353--------------------------------------------------------------------------------
K4CGQ5_SOLLC/96-362--------------------------------------------------------------------------------
K4AX90_SOLLC/122-387--------------------------------------------------------------------------------
K4AX88_SOLLC/96-362--------------------------------------------------------------------------------
D7SQ07_VITVI/99-364--------------------------------------------------------------------------------
I1LI62_SOYBN/97-361--------------------------------------------------------------------------------
U7DUW0_POPTR/79-343--------------------------------------------------------------------------------
W1Q0A5_AMBTC/91-355--------------------------------------------------------------------------------
W1Q0A9_AMBTC/165-429--------------------------------------------------------------------------------

PF03996

HEMA_CVMA5/9-391-----------------------------------------------------------------------------TLL
HEMA_INCAA/19-420-----------------------------------------------------------------------------ICL
HEMA_BRV1/2-378-----------------------------------------------------------------------------LSL

PF03629

A0ZZI1_BIFAA/132-445--------------------------------------------------------------------------------
A3HTJ4_9BACT/102-524--------------------------------------------------------------------------------
A4AN28_MARSH/117-413--------------------------------------------------------------------------------
A4XG19_CALS8/84-518--------------------------------------------------------------------------------
A5FA09_FLAJ1/103-353--------------------------------------------------------------------------------
A5FC32_FLAJ1/109-397--------------------------------------------------------------------------------
A5FCG2_FLAJ1/104-366--------------------------------------------------------------------------------
A5FLW6_FLAJ1/100-526--------------------------------------------------------------------------------
A6KYD0_BACV8/104-544--------------------------------------------------------------------------------
A6L7S8_BACV8/301-581--------------------------------------------------------------------------------
A6L837_PARD8/106-365--------------------------------------------------------------------------------
A6LG42_PARD8/302-584--------------------------------------------------------------------------------
A9KN08_CLOPH/81-525--------------------------------------------------------------------------------
A9UY79_MONBE/110-371--------------------------------------------------------------------------------
A9UYV9_MONBE/183-446--------------------------------------------------------------------------------
B0SVR2_CAUSK/105-536--------------------------------------------------------------------------------
B0SYV3_CAUSK/103-536--------------------------------------------------------------------------------
B1ZN38_OPITP/124-558--------------------------------------------------------------------------------
B1ZRD5_OPITP/111-543--------------------------------------------------------------------------------
B2UNI0_AKKM8/105-396--------------------------------------------------------------------------------
B3PDW1_CELJU/103-559--------------------------------------------------------------------------------
B8DTK8_BIFA0/83-504--------------------------------------------------------------------------------
B8DVE1_BIFA0/120-432--------------------------------------------------------------------------------
B8I0P3_CLOCE/95-527--------------------------------------------------------------------------------
C1F347_ACIC5/141-569--------------------------------------------------------------------------------
C1F9V4_ACIC5/112-403--------------------------------------------------------------------------------
C3Y8H9_BRAFL/120-404--------------------------------------------------------------------------------
C3Z127_BRAFL/109-390--------------------------------------------------------------------------------
C3Z129_BRAFL/93-393--------------------------------------------------------------------------------
C3ZBF5_BRAFL/95-370--------------------------------------------------------------------------------
C5BNV0_TERTT/112-545--------------------------------------------------------------------------------
C6VYA3_DYAFD/101-531--------------------------------------------------------------------------------
C6W5L8_DYAFD/109-390--------------------------------------------------------------------------------
C6X165_FLAB3/103-532--------------------------------------------------------------------------------
C6XSG1_PEDHD/103-356--------------------------------------------------------------------------------
C6XSW9_PEDHD/104-358--------------------------------------------------------------------------------
C6XUV3_PEDHD/100-352--------------------------------------------------------------------------------
C6XXZ6_PEDHD/106-358--------------------------------------------------------------------------------
C6XYN0_PEDHD/106-369--------------------------------------------------------------------------------
C6Y155_PEDHD/105-361--------------------------------------------------------------------------------
C6Y1K6_PEDHD/105-533--------------------------------------------------------------------------------
C6Y404_PEDHD/303-583--------------------------------------------------------------------------------
C7M404_CAPOD/302-582--------------------------------------------------------------------------------
C7PN71_CHIPD/105-526--------------------------------------------------------------------------------
C7PT40_CHIPD/107-370--------------------------------------------------------------------------------
D0MJ56_RHOM4/105-565--------------------------------------------------------------------------------
D2QQ30_SPILD/101-534--------------------------------------------------------------------------------
D2QX68_PIRSD/107-360--------------------------------------------------------------------------------
D2QYI9_PIRSD/142-409--------------------------------------------------------------------------------
D2R7J4_PIRSD/115-431--------------------------------------------------------------------------------
D2U910_XANAP/119-550--------------------------------------------------------------------------------
D2U9U1_XANAP/109-532--------------------------------------------------------------------------------
D4INS5_9BACT/103-361--------------------------------------------------------------------------------
D4JVY2_9FIRM/84-395--------------------------------------------------------------------------------
D4Z7X6_SPHJU/109-541--------------------------------------------------------------------------------
D5BHF0_ZUNPS/98-525--------------------------------------------------------------------------------
D5EN53_CORAD/103-390--------------------------------------------------------------------------------
D5ER35_CORAD/101-350--------------------------------------------------------------------------------
D5EXD4_PRER2/104-368--------------------------------------------------------------------------------
D6CYE8_9BACE/85-509--------------------------------------------------------------------------------
D6CYV5_9BACE/104-362--------------------------------------------------------------------------------
D6D068_9BACE/96-526--------------------------------------------------------------------------------
D6D180_9BACE/73-515--------------------------------------------------------------------------------
D6D411_9BACE/118-376--------------------------------------------------------------------------------
D9SLS9_CLOC7/541-802--------------------------------------------------------------------------------
D9SWK5_CLOC7/539-800--------------------------------------------------------------------------------
E4RWD7_LEAB4/99-523--------------------------------------------------------------------------------
E4T5G4_PALPW/145-396--------------------------------------------------------------------------------
E4T6U6_PALPW/106-547--------------------------------------------------------------------------------
E6SN70_BACT6/301-581--------------------------------------------------------------------------------
E6U3H5_ETHHY/86-401--------------------------------------------------------------------------------
E6UDX2_RUMA7/82-393--------------------------------------------------------------------------------
E6UGH2_RUMA7/87-510--------------------------------------------------------------------------------
E6WRU5_PSEUU/108-538--------------------------------------------------------------------------------
E6WX51_PSEUU/113-546--------------------------------------------------------------------------------
E8RKP4_ASTEC/107-546--------------------------------------------------------------------------------
E8RP08_ASTEC/110-381--------------------------------------------------------------------------------
E8RR55_ASTEC/105-537--------------------------------------------------------------------------------
E8RVJ6_ASTEC/120-557--------------------------------------------------------------------------------
E8V0Q2_TERSS/105-396--------------------------------------------------------------------------------
E8WX56_GRATM/104-394--------------------------------------------------------------------------------
F0RXK6_SPHGB/84-395--------------------------------------------------------------------------------
F0S4E8_PSESL/102-363--------------------------------------------------------------------------------
F0SBL8_PSESL/106-542--------------------------------------------------------------------------------
F0SE55_PSESL/103-355--------------------------------------------------------------------------------
F0SEX3_PSESL/110-362--------------------------------------------------------------------------------
F0SLB2_RUBBR/105-401--------------------------------------------------------------------------------
F0XZG5_AURAN/371-703--------------------------------------------------------------------------------
F1N0F2_BOVIN/129-405--------------------------------------------------------------------------------
F2JM57_CELLD/90-525--------------------------------------------------------------------------------
F2KZ29_PREDF/320-601--------------------------------------------------------------------------------
F2NB41_CORGP/85-397--------------------------------------------------------------------------------
F2NBE0_CORGP/105-528--------------------------------------------------------------------------------
F4C1D3_SPHS2/119-545--------------------------------------------------------------------------------
F4C667_SPHS2/102-358--------------------------------------------------------------------------------
F4CDE6_SPHS2/103-363--------------------------------------------------------------------------------
F4KXA6_HALH1/110-541--------------------------------------------------------------------------------
F6RRT5_CIOIN/110-408--------------------------------------------------------------------------------
F7AJJ3_HORSE/118-419--------------------------------------------------------------------------------
F7CPG9_XENTR/116-394--------------------------------------------------------------------------------
F8EA22_RUNSL/103-354--------------------------------------------------------------------------------
F8EJ62_RUNSL/102-531--------------------------------------------------------------------------------
F8EQW5_RUNSL/101-532--------------------------------------------------------------------------------
F9D4M3_PREDD/105-362--------------------------------------------------------------------------------
F9Z647_ODOSD/105-527--------------------------------------------------------------------------------
G0GB30_SPITZ/129-404--------------------------------------------------------------------------------
G0GBV2_SPITZ/85-515--------------------------------------------------------------------------------
G0IZQ4_CYCMS/102-365--------------------------------------------------------------------------------
G0L160_ZOBGA/108-362--------------------------------------------------------------------------------
G0L7C6_ZOBGA/106-357--------------------------------------------------------------------------------
G1SIW9_RABIT/119-395--------------------------------------------------------------------------------
G3IIB1_CRIGR/119-418--------------------------------------------------------------------------------
G3NT91_GASAC/117-395--------------------------------------------------------------------------------
G3TGM8_LOXAF/118-419--------------------------------------------------------------------------------
G3WPG6_SARHA/128-405--------------------------------------------------------------------------------
G8NUG1_GRAMM/104-394--------------------------------------------------------------------------------
G8TBM5_NIAKG/101-532--------------------------------------------------------------------------------
G8TEA3_NIAKG/104-360--------------------------------------------------------------------------------
G8TGS0_NIAKG/106-355--------------------------------------------------------------------------------
G8TLW6_NIAKG/105-533--------------------------------------------------------------------------------
G8TN45_NIAKG/114-379--------------------------------------------------------------------------------
G8TQU6_NIAKG/101-533--------------------------------------------------------------------------------
G8UJ84_TANFA/302-584--------------------------------------------------------------------------------
H0XDV1_OTOGA/118-421--------------------------------------------------------------------------------
H1Y7E7_9SPHI/107-370--------------------------------------------------------------------------------
H1YEP3_9SPHI/107-377--------------------------------------------------------------------------------
H1YFU1_9SPHI/105-542--------------------------------------------------------------------------------
H1YHR5_9SPHI/103-534--------------------------------------------------------------------------------
H2MHU5_ORYLA/110-406--------------------------------------------------------------------------------
H2NFQ7_PONAB/118-394--------------------------------------------------------------------------------
H2T5J8_TAKRU/109-378--------------------------------------------------------------------------------
H8KVR3_SOLCM/112-540--------------------------------------------------------------------------------
H9G3E2_ANOCA/113-390--------------------------------------------------------------------------------
I0IFA8_PHYMF/116-371--------------------------------------------------------------------------------
I0IGP0_PHYMF/113-573--------------------------------------------------------------------------------
I0K882_9BACT/102-533--------------------------------------------------------------------------------
I0KDZ4_9BACT/80-507--------------------------------------------------------------------------------
I2F010_EMTOG/101-530--------------------------------------------------------------------------------
I3JCR3_ORENI/107-370--------------------------------------------------------------------------------
I3NAW5_SPETR/119-428--------------------------------------------------------------------------------
I3YNK6_ALIFI/103-360--------------------------------------------------------------------------------
I3Z657_BELBD/107-540--------------------------------------------------------------------------------
I6ZXF8_MELRP/103-560--------------------------------------------------------------------------------
I7A330_MELRP/101-533--------------------------------------------------------------------------------
K1PIG0_CRAGI/75-338--------------------------------------------------------------------------------
L0DNV4_SINAD/113-408--------------------------------------------------------------------------------
L0FZA4_ECHVK/103-365--------------------------------------------------------------------------------
L0G4D5_ECHVK/108-537--------------------------------------------------------------------------------
L0G5F4_ECHVK/309-586--------------------------------------------------------------------------------
L0G6Q7_ECHVK/110-371--------------------------------------------------------------------------------
M3VYU4_FELCA/118-393--------------------------------------------------------------------------------
M3XHL6_LATCH/120-399--------------------------------------------------------------------------------
M3ZH48_XIPMA/107-384--------------------------------------------------------------------------------
SIAE_MOUSE/118-420--------------------------------------------------------------------------------
Q022C5_SOLUE/94-383--------------------------------------------------------------------------------
Q15XN0_PSEA6/106-529--------------------------------------------------------------------------------
Q1IR02_KORVE/102-394--------------------------------------------------------------------------------
Q1LUX8_DANRE/112-383--------------------------------------------------------------------------------
Q21HS7_SACD2/109-546--------------------------------------------------------------------------------
Q5LA76_BACFN/104-538--------------------------------------------------------------------------------
Q7UKM9_RHOBA/136-425--------------------------------------------------------------------------------
Q7UL92_RHOBA/160-428--------------------------------------------------------------------------------
Q7UPP2_RHOBA/115-412--------------------------------------------------------------------------------
Q8A0D0_BACTN/104-546--------------------------------------------------------------------------------
Q8A1R2_BACTN/105-365--------------------------------------------------------------------------------
Q8A2Y4_BACTN/104-362--------------------------------------------------------------------------------
Q8A323_BACTN/103-546--------------------------------------------------------------------------------
Q8A331_BACTN/104-369--------------------------------------------------------------------------------
Q8A6U7_BACTN/107-449--------------------------------------------------------------------------------
Q8AAK7_BACTN/303-583--------------------------------------------------------------------------------
Q8P3G8_XANCP/110-540--------------------------------------------------------------------------------
Q8P9U4_XANCP/106-528--------------------------------------------------------------------------------
Q9AA13_CAUCR/103-537--------------------------------------------------------------------------------
R5ATT9_9BACT/97-358--------------------------------------------------------------------------------
R5C0U7_9BACE/106-371--------------------------------------------------------------------------------
R5CMH4_9FIRM/112-544--------------------------------------------------------------------------------
R5CR26_9BACT/106-368--------------------------------------------------------------------------------
R5CRW3_9BACT/103-359--------------------------------------------------------------------------------
R5CVR0_9BACT/37-472--------------------------------------------------------------------------------
R5CVU7_9BACT/105-371--------------------------------------------------------------------------------
R5FQG9_9BACT/98-360--------------------------------------------------------------------------------
R5GQ73_9FIRM/87-396--------------------------------------------------------------------------------
R5I3U1_9PORP/108-543--------------------------------------------------------------------------------
R5I599_9PORP/104-370--------------------------------------------------------------------------------
R5I8Z5_9PORP/109-398--------------------------------------------------------------------------------
R5I9A4_9PORP/110-550--------------------------------------------------------------------------------
R5ICE3_9PORP/106-356--------------------------------------------------------------------------------
R5IPA1_9PORP/103-532--------------------------------------------------------------------------------
R5J8I9_9BACE/107-548--------------------------------------------------------------------------------
R5J9D0_9BACE/301-581--------------------------------------------------------------------------------
R5JB68_9BACE/94-354--------------------------------------------------------------------------------
R5JE70_9BACE/106-367--------------------------------------------------------------------------------
R5JUI1_9BACE/107-546--------------------------------------------------------------------------------
R5JY84_9CLOT/86-397--------------------------------------------------------------------------------
R5KDD9_9BACT/106-367--------------------------------------------------------------------------------
R5KI40_9BACT/107-545--------------------------------------------------------------------------------
R5KI88_9BACT/106-368--------------------------------------------------------------------------------
R5M4F3_9BACE/103-392--------------------------------------------------------------------------------
R5M9T3_9BACE/100-533--------------------------------------------------------------------------------
R5MCJ4_9BACE/107-370--------------------------------------------------------------------------------
R5MCV5_9BACE/117-382--------------------------------------------------------------------------------
R5NAN5_9BACT/95-508--------------------------------------------------------------------------------
R5NWA0_9PORP/104-366--------------------------------------------------------------------------------
R5PFV8_9BACT/95-546--------------------------------------------------------------------------------
R5RU50_9BACE/106-368--------------------------------------------------------------------------------
R5S363_9BACE/112-377--------------------------------------------------------------------------------
R5U9L2_9BACE/103-366--------------------------------------------------------------------------------
R5UQU2_9PORP/301-581--------------------------------------------------------------------------------
R5XXY6_9FIRM/83-407--------------------------------------------------------------------------------
R6BWP4_9CLOT/125-575--------------------------------------------------------------------------------
R6CBR0_9FIRM/90-402--------------------------------------------------------------------------------
R6CT48_9BACE/308-588--------------------------------------------------------------------------------
R6CZR7_9BACE/103-360--------------------------------------------------------------------------------
R6DIJ1_9BACE/99-533--------------------------------------------------------------------------------
R6DJ41_9BACE/303-583--------------------------------------------------------------------------------
R6DWQ0_9BACT/104-366--------------------------------------------------------------------------------
R6E989_9BACE/963-1241--------------------------------------------------------------------------------
R6EGK2_9FIRM/83-401--------------------------------------------------------------------------------
R6F527_9BACT/343-624--------------------------------------------------------------------------------
R6FK85_9BACE/101-514--------------------------------------------------------------------------------
R6GA32_9BACE/128-565--------------------------------------------------------------------------------
R6K607_9BACE/105-361--------------------------------------------------------------------------------
R6KHE9_9BACE/106-368--------------------------------------------------------------------------------
R6KHK2_9BACE/100-362--------------------------------------------------------------------------------
R6KJ37_9BACE/119-553--------------------------------------------------------------------------------
R6KNC4_9BACE/104-538--------------------------------------------------------------------------------
R6KU81_9BACE/100-533--------------------------------------------------------------------------------
R6L845_9BACE/106-539--------------------------------------------------------------------------------
R6L914_9BACE/107-368--------------------------------------------------------------------------------
R6LEJ2_9BACE/109-369--------------------------------------------------------------------------------
R6M7W6_9BACE/104-365--------------------------------------------------------------------------------
R6MBW6_9BACE/104-365--------------------------------------------------------------------------------
R6MD77_9BACE/131-411--------------------------------------------------------------------------------
R6MGF8_9BACE/106-368--------------------------------------------------------------------------------
R6MRS7_9FIRM/84-393--------------------------------------------------------------------------------
R6NFL1_9BACE/103-361--------------------------------------------------------------------------------
R6QQ52_9BACT/103-365--------------------------------------------------------------------------------
R6SZ03_9FIRM/82-394--------------------------------------------------------------------------------
R6TMT5_9FIRM/79-326--------------------------------------------------------------------------------
R6TYL3_9FIRM/88-372--------------------------------------------------------------------------------
R6VGA6_9FIRM/87-503--------------------------------------------------------------------------------
R6VGP4_9BACT/119-542--------------------------------------------------------------------------------
R6VYK5_9BACT/95-522--------------------------------------------------------------------------------
R6W3N6_9BACT/103-360--------------------------------------------------------------------------------
R6WVP4_9BACT/103-358--------------------------------------------------------------------------------
R6X6R9_9PORP/299-581--------------------------------------------------------------------------------
R6X8A0_9BACT/104-361--------------------------------------------------------------------------------
R6XDK3_9BACT/111-376--------------------------------------------------------------------------------
R6XW57_9BACT/105-369--------------------------------------------------------------------------------
R6YB86_9BACE/303-583--------------------------------------------------------------------------------
R6YLG6_9BACE/106-367--------------------------------------------------------------------------------
R6ZQY5_9FIRM/86-518--------------------------------------------------------------------------------
R7D1U4_9BACE/101-514--------------------------------------------------------------------------------
R7DGQ2_9PORP/109-450--------------------------------------------------------------------------------
R7DHQ3_9PORP/103-362--------------------------------------------------------------------------------
R7EBZ9_9BACE/116-365--------------------------------------------------------------------------------
R7ELJ2_9BACE/104-363--------------------------------------------------------------------------------
R7FDG6_9FIRM/85-396--------------------------------------------------------------------------------
R7HK49_9BACT/112-371--------------------------------------------------------------------------------
R7IBZ1_9FIRM/91-402--------------------------------------------------------------------------------
R7KXY0_9FIRM/78-504--------------------------------------------------------------------------------
R7L392_9BACT/141-439--------------------------------------------------------------------------------
R7L457_9BACT/106-408--------------------------------------------------------------------------------
R7L551_9BACT/107-409--------------------------------------------------------------------------------
R7LBC9_9BACT/106-408--------------------------------------------------------------------------------
R7LCZ4_9BACT/117-400--------------------------------------------------------------------------------
R7LEI0_9BACT/104-413--------------------------------------------------------------------------------
R7N8V0_9FIRM/86-515--------------------------------------------------------------------------------
R7NVJ4_9BACE/94-536--------------------------------------------------------------------------------
S0ET71_CHTCT/118-391--------------------------------------------------------------------------------
T2KJY6_9FLAO/72-379--------------------------------------------------------------------------------
T2KKF3_9FLAO/106-399--------------------------------------------------------------------------------
T2KL42_9FLAO/108-425--------------------------------------------------------------------------------
U3JRM3_FICAL/110-387--------------------------------------------------------------------------------
U5Q6R0_9BACT/120-374--------------------------------------------------------------------------------
V8NYK2_OPHHA/82-359--------------------------------------------------------------------------------
W0ETR7_9SPHI/108-546--------------------------------------------------------------------------------
W0ETZ4_9SPHI/87-339--------------------------------------------------------------------------------
W0EW65_9PORP/114-543--------------------------------------------------------------------------------
W0EXJ4_9SPHI/101-529--------------------------------------------------------------------------------
W0EYF1_9SPHI/303-584--------------------------------------------------------------------------------
W0F205_9SPHI/104-389--------------------------------------------------------------------------------
W0F686_9SPHI/73-335--------------------------------------------------------------------------------
W0IV69_9BACT/122-573--------------------------------------------------------------------------------
W0IY28_9BACT/102-398--------------------------------------------------------------------------------
W0IZR9_9BACT/107-406--------------------------------------------------------------------------------
W0J089_9BACT/113-554--------------------------------------------------------------------------------
W0J126_9BACT/103-396--------------------------------------------------------------------------------
W0J1D8_9BACT/103-397--------------------------------------------------------------------------------
W0J1I7_9BACT/127-575--------------------------------------------------------------------------------
W0J1Z1_9BACT/122-573--------------------------------------------------------------------------------
W0J1Z2_9BACT/111-557--------------------------------------------------------------------------------
W0J268_9BACT/121-368--------------------------------------------------------------------------------
W0J4T5_9BACT/111-561--------------------------------------------------------------------------------
W0J8X3_9BACT/103-397--------------------------------------------------------------------------------
W0JAS2_9BACT/114-570--------------------------------------------------------------------------------
W0RMP1_9BACT/123-554--------------------------------------------------------------------------------
W4XVQ4_STRPU/82-385--------------------------------------------------------------------------------
W4XVQ5_STRPU/118-400--------------------------------------------------------------------------------
W5M5G7_LEPOC/114-388--------------------------------------------------------------------------------
A0A068NY38_9BACT/100-533--------------------------------------------------------------------------------
A0A068NWA0_9BACT/96-545--------------------------------------------------------------------------------
W8EWI8_9BACT/105-543--------------------------------------------------------------------------------
W8F2B5_9BACT/111-544--------------------------------------------------------------------------------
X5DC27_9BACT/316-598--------------------------------------------------------------------------------

PF14286

D4LDC0_RUMC1/65-436ENRNLAKFPSFSWSDYISGKYTADIANYYNDTVPK-RE------------------------------------------
C4Z3Y8_EUBE2/59-440EKRKLSSFPQFSMESFLDGTYFSGVDTWFSDTFPG-RD------------------------------------------
R6N2Z9_9CLOT/53-417EKRELTKFPEFSFQALADGSYFKQVDLWFSDTFPF-RD------------------------------------------

PF16822

M4X2G9_PSEDE/89-360-------------------------------VVLG.KD------------------------------------------
D9SK13_GALCS/90-349-------------------------------VRPG.CA------------------------------------------
D7CVL9_TRURR/113-377-------------------------------VLIG.ED------------------------------------------
A4XSW9_PSEMY/87-346-------------------------------VVLG.RD------------------------------------------
A7IG51_XANP2/41-300-------------------------------LIIG.KD------------------------------------------
Q0VSK8_ALCBS/79-348-------------------------------LVAG.EP------------------------------------------
D9SC65_GALCS/39-314-------------------------------VLVG.RD------------------------------------------
Q2KWS4_BORA1/105-364-------------------------------VRQG.CP------------------------------------------
A4XSW7_PSEMY/65-332-------------------------------IVPG.RD------------------------------------------
A8LND2_DINSH/79-327-------------------------------AIKG.RD------------------------------------------
C4LEL0_TOLAT/54-306-------------------------------LQEG.RD------------------------------------------
Q0VSL0_ALCBS/86-342-------------------------------VLVG.ED------------------------------------------
D7CSL0_TRURR/51-309-------------------------------LQEG.PD------------------------------------------
F6AHE0_PSEF1/87-346-------------------------------VVLG.KD------------------------------------------
A9BZH9_DELAS/53-312-------------------------------VLRG.KD------------------------------------------
A7IG52_XANP2/88-341-------------------------------VRAG.CP------------------------------------------
A8ICK2_AZOC5/86-338-------------------------------VRAG.CP------------------------------------------
H9UGT7_SPIAZ/108-374-------------------------------VVVG.SR------------------------------------------
F6AHE2_PSEF1/62-330-------------------------------ITPG.ED------------------------------------------
A8ICK4_AZOC5/30-289-------------------------------IIMG.KN------------------------------------------
A4XR24_PSEMY/81-343-------------------------------LVIG.ED------------------------------------------
A4XR27_PSEMY/64-322-------------------------------...A.EE------------------------------------------
A9BZH8_DELAS/91-352-------------------------------VALG.CP------------------------------------------
C1DP87_AZOVD/81-346-------------------------------VVIG.AN------------------------------------------
C1DP90_AZOVD/67-327-------------------------------.VQGNES------------------------------------------
F2KL48_PSEBN/64-330-------------------------------LVQA.QG------------------------------------------
ALGX_PSEAE/64-325-------------------------------LVQA.QD------------------------------------------
ALGJ_PSEAE/85-355-------------------------------VVIG.KD------------------------------------------
Q6N6N6_RHOPA/99-362-------------------------------VVFG.KD------------------------------------------
ALGJ_PSESM/81-346-------------------------------VVLG.KD------------------------------------------
Q888J0_PSESM/99-365-------------------------------VRQG.CP------------------------------------------
ALGJ_PSEPK/81-346-------------------------------VVLG.RD------------------------------------------

PF00657

O04702_DAUCA/33-364------------------------------IFNFG-DA-NSDTGAFAAWFFGNPPFFGQSYFNGSAGRVSD.........
Q39308_BRANA/36-320------------------------------LFTFG-DS-NFDAGNRMFLAGTRFPQNFWPYGKSRDDPTGKFS.......
AOAH_HUMAN/257-543------------------------------IILLG-DS-A........................................
GDL49_ARATH/37-365------------------------------VFNFG-DS-NSDTGELSSGLGFLPQPSYEITFFRSPTSGRFCN.......
Q9A6E2_CAUCR/200-399------------------------------IVAFG-DS-ITD......................................
Q97ET2_CLOAB/64-257------------------------------ILVMG-DS-LAK......................................
A5FND2_FLAJ1/74-458------------------------------IVHIG-DS-HIQ......................................
Q9HZ99_PSEAE/215-418------------------------------LVTLG-DS-ITD......................................
YQEF_BACSU/25-235------------------------------VVAFG-DS-NTR......................................
YPMR_BACSU/43-243------------------------------IAAVG-DS-LTE......................................
Q9RDP5_STRCO/66-296------------------------------VAAVG-DS-ITR......................................
Q9LHY3_ORYSJ/5-203------------------------------LVLFG-DS-ITELSF...................................
Q98E95_RHILO/55-223------------------------------IVGFG-DS-LTA......................................
H0H5K0_RHIRD/5-204------------------------------VLCFG-DS-LTW......................................
RHA1_ASPAC/20-225------------------------------VYLAG-DS-TMAKNGG..................................
Q40317_MEDSA/37-362------------------------------IFSFG-AS-NVDTGGLAAAFRAPPSPYGQTYFNRSTGRFSD.........
Q9KZR1_STRCO/239-441------------------------------VVAFG-DS-ITD......................................
IAH1_YEAST/6-203------------------------------FLLFG-DS-ITEFAFNT.................................
APG_ARATH/205-524------------------------------VFFFG-DS-VFDTGNNNNLETKIKSNYRPYGMDFKFRVATGRFSN.....
GDL88_ARATH/5-204------------------------------IVLFG-DS-ITAQSF...................................
Q7AQI8_MYCLE/42-222------------------------------YVAIG-DS-QTE......................................
Q97DM5_CLOAB/3-182------------------------------LVCIG-DS-LTY......................................
Q9XIY6_ORYSJ/32-357------------------------------VFNFG-DS-NSDTGGFWAAFPAQQAPFGMTYFRRPAGRASD.........
Q55601_SYNY3/103-399------------------------------IVVLG-DS-FSEAIQVDEDETYW...........................
RHGT2_BACSU/5-198------------------------------IYLAG-DS-TVQTYGD..................................
GCAT_AERHY/28-322------------------------------IVMFG-DS-LSDTGKM..................................
APG_BRANA/126-441------------------------------VFFFG-DS-IFDTGNNNNLDTKLKCNYRPYGMDFPMGVATGRFSNGRVAS
GUNE_CLOTM/606-804------------------------------IEFIG-DS-ITC......................................
GDL20_ARATH/34-330------------------------------LFTFG-DS-NFDAGNKKFLTSAPLPQNFWPYGKSRDDPKGKFS.......
PLB1_RABIT/741-1015------------------------------VAALG-DS-LTA......................................
O13496_NEOPA/166-382------------------------------IEFIG-DS-ITC......................................
Q9KZ70_STRCO/75-262------------------------------LMMLG-DS-TAA......................................
GDL17_ARATH/35-352------------------------------LFIFG-DS-LVDNGNNNRLLSLARANYRPYGIDFPQGTTGRFT.......
GDL14_ARATH/33-344------------------------------YFIFG-DS-LVDNGNNNRLRSIARADYFPYGIDFGGPTGRFSN.......
ESM1_ARATH/37-340------------------------------LFTFG-DS-YYDAGNKVFLSQRKDLPQTYWPYGKSRDYPNGKFS......
GDL84_ARATH/6-205------------------------------IFLFG-DS-ITEESF...................................
IAH1_MOUSE/18-213------------------------------VLLFG-DS-ITQFSF...................................
Q4A932_MYCHJ/42-337------------------------------YLALG-DS-LTA......................................
Q9AYM5_VIGUN/9-201------------------------------IVLFG-SS-IIQMSF...................................
Q9AUZ9_ORYSJ/6-205------------------------------MVLFG-DS-ITEQSF...................................
LIP4_ARATH/41-355------------------------------IFNFG-DS-NSDTGGLVAGLGYPIGFPNGRLFFRRSTGRLSD........
LIP1_PHOLU/28-343------------------------------LYVFG-DS-LSD......................................
PLB1_RABIT/394-668------------------------------IGAMG-DS-LTA......................................
HLT_VIBPA/147-406------------------------------VVALG-DS-LSDTGNIFNASQWRFPNPNSWFL..................
O05695_RHILE/46-219------------------------------IVAFG-TS-LTAR.....................................
Q9Y7C6_ASPTE/61-245------------------------------ILPLG-AS-ITW......................................
Q9A5J3_CAUCR/136-332------------------------------IEFIG-DS-HTV......................................
GDL2_ARATH/38-352------------------------------IFNFG-DS-NSDTGGLVAGLGYSIGLPNGRSFFQRSTGRLSD........
LIPC_BACSU/5-202------------------------------YTALG-DS-LTT......................................
IAH1_SCHPO/40-217------------------------------LTIIG-DS-ITQKGF...................................
TESA_ECOLI/30-196------------------------------LLILG-DS-LSA......................................
P74310_SYNY3/108-371------------------------------VVFVG-DS-FTA......................................
P72634_SYNY3/22-217------------------------------VLAMG-DS-LVY......................................
Q98EU1_RHILO/215-418------------------------------VIAIG-DS-ITD......................................
GDL61_ARATH/35-364------------------------------IFNFG-DS-NSDTGGFWAAFPAQSGPWGMTYFKKPAGRASD.........
Q9X7W9_STRCO/5-186------------------------------YVAVG-DS-FTE......................................
Q98FI8_RHILO/49-230------------------------------LLVLG-DS-SAASVGI..................................
PLB1_RABIT/1097-1363------------------------------VAALG-DS-LT.......................................
A0A0D1GQ15_VIBPH/23-192------------------------------LLVLG-DS-LSA......................................
Q9FCB4_STRCO/10-188------------------------------LVAVG-DS-FTE......................................
Q97FV7_CLOAB/81-259------------------------------YIAVG-DS-VTA......................................
O82681_DIGLA/36-364------------------------------IFNFG-DS-NSDTGGFWAAFPAENPPNGMTYFKRPAGRVTD.........
GDL51_ARATH/33-334------------------------------LFTFG-DS-SYDVGNTKFFSSEFDPATTWPYGDSIDDPSGRWS.......
Q9N4P5_CAEEL/105-346------------------------------VGAMG-DS-LAS......................................
O13497_NEOPA/65-271------------------------------IMPMG-DS-ITF......................................
Q9RLB8_RUMFL/46-256------------------------------IMPLG-DS-ITY......................................

PF13472

G2LGZ8_CHLTF/6-185--------------------------------ALG-DS.YTI.......-------------------------------
F9ZYV1_METMM/34-186--------------------------------AFG-DS.LTY.......-------------------------------
K9VZK4_9CYAN/24-214--------------------------------VIG-DS.IVY.......-------------------------------
E7Q9P0_YEASB/8-198--------------------------------LFG-DS.ITEF....AF-------------------------------
Q0C8V3_ASPTN/19-227--------------------------------LFG-DS.ITQ.......-------------------------------
K0F6Y4_9NOCA/25-257--------------------------------ALG-SS.YAS.......-------------------------------
G2MGQ8_9ARCH/46-224--------------------------------ALG-DS.YTI.......-------------------------------
W5TFJ6_9NOCA/8-180--------------------------------ALG-DS.FVE.......-------------------------------
K0I3M2_9BURK/62-234--------------------------------VVG-DS.TAV.......-------------------------------
R7NK93_9BACE/47-209--------------------------------FLG-NS.ITN.......-------------------------------
G8TQQ3_NIAKG/29-211--------------------------------FFG-DS.ITA......A-------------------------------
M7UUV3_BOTF1/27-206--------------------------------CLG-DS.LTE.......-------------------------------
W5WAN1_9PSEU/47-277--------------------------------ALG-SS.YAA.......-------------------------------
B1VMZ9_STRGG/190-372--------------------------------VFG-DS.IAE.......-------------------------------
G8LWX2_CLOCD/190-376--------------------------------ALG-DS.ITD.......-------------------------------
R6Z4P1_9FIRM/217-388--------------------------------YIG-GS.ITQ.......-------------------------------
Q99YY1_STRP1/58-268--------------------------------AIG-DS.LTE.......-------------------------------
A0A0D1CT64_USTMA/5-263--------------------------------AIG-SS.FAA.......-------------------------------
D2QLR8_SPILD/53-227--------------------------------FHG-HS.VPA.......-------------------------------
E0W141_PEDHC/39-199--------------------------------FIG-DS.LIQ.......-------------------------------
D3KGI8_GIAIC/11-195--------------------------------IYG-DS.NGA.......-------------------------------
C0NLZ7_AJECG/25-255--------------------------------IFG-DS.ITQ.......-------------------------------
Q01UG4_SOLUE/29-210--------------------------------LVG-DS.TVN.......-------------------------------
C6W2P5_DYAFD/419-583--------------------------------VIG-NS.ITHF.....W-------------------------------
B1MDW2_MYCA9/39-269--------------------------------AIG-DS.FMA......A-------------------------------
B1XKZ4_SYNP2/23-212--------------------------------AFG-DS.LVY.......-------------------------------
Q4FPU8_PSYA2/77-239--------------------------------ALG-DS.LTE.......-------------------------------
H1YA85_9SPHI/544-727--------------------------------LIG-NS.ITH.......-------------------------------
I4EU60_MODMB/15-192--------------------------------ALG-DS.FTE.......-------------------------------
A9WQ20_RENSM/91-269--------------------------------VLG-DS.IAA.......-------------------------------
I3WJV1_BIFBI/52-230--------------------------------CVG-DS.LTD.......-------------------------------
V4I0K6_9ACTN/63-286--------------------------------AVG-DS.ITR.......-------------------------------
B6IVX9_RHOCS/64-225--------------------------------VLG-DS.LSA.......-------------------------------
H6LH44_ACEWD/195-425--------------------------------ALG-DS.IAY.......-------------------------------
Q47RM5_THEFY/14-185--------------------------------AIG-DS.FTE.......-------------------------------
F5XHG7_MICPN/9-183--------------------------------AIG-DS.STE.......-------------------------------
G3AIA7_SPAPN/11-222--------------------------------LFG-DS.ITQF.....S-------------------------------
D4IL07_9BACT/44-208--------------------------------FMG-NS.ITD.......-------------------------------
S5XQR0_PARAH/29-196--------------------------------AFG-DS.ITE.......-------------------------------
R7R449_9FIRM/38-202--------------------------------FLG-GS.ITQ.......-------------------------------
C7Q6B9_CATAD/41-283--------------------------------ALG-DS.MAS.......-------------------------------
R6QP90_9FIRM/6-201--------------------------------CYG-DS.NTY.......-------------------------------
Q1IT33_KORVE/202-395--------------------------------ILG-DS.ITD.......-------------------------------
D7C8R3_STRBB/220-415--------------------------------AFG-DS.ITD.......-------------------------------
I7E542_PHAIB/29-200--------------------------------IVG-DS.SAA.......-------------------------------
B9HCW5_POPTR/11-197--------------------------------LFG-SS.IVQ.......-------------------------------
R7EM00_9FIRM/12-234--------------------------------FLG-DS.ITE.......-------------------------------
J7QEQ8_METSZ/35-196--------------------------------IFG-DS.LTS.......-------------------------------
F5YS39_MYCSD/49-220--------------------------------VIG-DS.YTS.......-------------------------------
A1RB28_ARTAT/9-183--------------------------------ALG-DS.FTE.......-------------------------------
D5BWK2_NITHN/13-175--------------------------------VLG-DS.LSA.......-------------------------------
R5HE58_9FIRM/156-328--------------------------------FIG-DS.RTQ.......-------------------------------
H6NB59_9BACL/165-326--------------------------------CYG-SS.ITH.......-------------------------------
Q813K9_BACCR/21-195--------------------------------AIG-DS.FTE.......-------------------------------
H2MKJ0_ORYLA/14-203--------------------------------LFG-DS.ITQ......F-------------------------------
K0F6E7_9NOCA/83-262--------------------------------VFG-DS.TAA.......-------------------------------
Q01NA0_SOLUE/52-213--------------------------------VFG-DS.ISA.......-------------------------------
D6ZFQ3_SEGRD/129-368--------------------------------ALG-DS.YAS.......-------------------------------
A0A098DVS0_GIBZA/10-226--------------------------------LFG-DS.LFQ.......-------------------------------
A6W6W8_KINRD/62-234--------------------------------FLG-DS.YVQ.......-------------------------------
W0EF85_9FIRM/4-192--------------------------------ALG-DS.ITT.......-------------------------------
Q3A0X5_PELCD/10-171--------------------------------AFG-DS.LTA.......-------------------------------
Q7MI76_VIBVY/123-275--------------------------------MYG-DS.ITE......W-------------------------------
G0FS27_AMYMS/50-289--------------------------------ALG-DS.YTS.......-------------------------------
B0U7X0_METS4/37-231--------------------------------FVG-DS.LAD.......-------------------------------
R7GXG0_9FIRM/17-225--------------------------------VFG-DS.ISK.......-------------------------------
D7BXS4_STRBB/226-417--------------------------------VIG-DS.ITD.......-------------------------------
D7C0R4_STRBB/190-361--------------------------------FVG-DS.ITA.......-------------------------------
Q47MP1_THEFY/158-409--------------------------------ALG-DS.YSS.......-------------------------------
I3Z927_BELBD/30-207--------------------------------CIG-DS.VTF.......-------------------------------
C4XJ93_DESMR/5-180--------------------------------FVG-DS.LTV.......-------------------------------
D2BFK8_STRRD/36-259--------------------------------AMG-DS.ITR.......-------------------------------
F8JNB8_STREN/215-410--------------------------------LFG-DS.ITD.......-------------------------------
V6JFF1_STRNV/209-394--------------------------------ALG-DS.ITD.......-------------------------------
A0M409_GRAFK/37-216--------------------------------ALG-DS.YTI.......-------------------------------
B9E790_MACCJ/42-216--------------------------------FIG-DS.ITD.......-------------------------------
U5W125_9ACTN/5-181--------------------------------AVG-DS.FTE.......-------------------------------
W0JAF8_9BACT/24-221--------------------------------AFG-DS.VTQ.......-------------------------------
E6K1M3_PARDN/179-354--------------------------------IAG-DS.MTV.......-------------------------------
G0L4M3_ZOBGA/50-213--------------------------------FMG-NS.ITI.......-------------------------------
K0KD71_SACES/32-274--------------------------------ALG-DS.YAS.......-------------------------------
R6YJR8_9FIRM/72-238--------------------------------YLG-GS.ITE.......-------------------------------
B0SYS7_CAUSK/39-200--------------------------------VLG-DS.ITA.......-------------------------------
C4XUC8_DESMR/132-313--------------------------------VVG-DS.LAV.......-------------------------------
F6FTU7_ISOV2/41-229--------------------------------AVG-DS.FTE.......-------------------------------
B3E7P1_GEOLS/36-187--------------------------------AFG-DS.LTA.......-------------------------------
W1NXM8_AMBTC/8-198--------------------------------LFG-DS.ITQ.......-------------------------------
C5D2B2_GEOSW/60-247--------------------------------ALG-DS.LTR.......-------------------------------
R6C2Q7_9CLOT/80-250--------------------------------CIG-GS.ITQ.......-------------------------------
G0FM14_AMYMS/156-328--------------------------------FVG-DS.ITA.......-------------------------------
C7MV43_SACVD/7-181--------------------------------ALG-DS.FTE.......-------------------------------
Q28L10_JANSC/41-209--------------------------------ALG-DS.LTA.......-------------------------------
D1BAN3_SANKS/13-204--------------------------------FIG-DS.ITE.......-------------------------------
F4L671_HALH1/418-583--------------------------------FIG-NS.ITH.......-------------------------------
D0MEZ1_RHOM4/64-227--------------------------------VLG-NS.LAA.......-------------------------------
I0JR57_HALH3/6-174--------------------------------CFG-DS.LTA.......-------------------------------
I0H891_ACTM4/29-215--------------------------------TLG-DS.VPA.......-------------------------------
F8EG49_RUNSL/341-505--------------------------------FLG-NS.ITE.......-------------------------------
M4SL10_9SPHN/105-292--------------------------------VFG-DS...........-------------------------------
Q984F4_RHILO/76-269--------------------------------CFG-DS.TEN.......-------------------------------
A5MZI3_CLOK5/7-181--------------------------------CLG-DS.LTY.......-------------------------------
A7T1B4_NEMVE/280-473--------------------------------CFG-DS.LTT.......-------------------------------
I0GPP6_SELRL/261-430--------------------------------VLG-DS.ISH.......-------------------------------
C6WBG5_ACTMD/47-259--------------------------------ALG-DS.FAS.......-------------------------------
R6QFZ7_9FIRM/97-267--------------------------------FIG-DS.RMV.......-------------------------------
B2UPK1_AKKM8/70-228--------------------------------FLG-SS.TME.......-------------------------------
G0AEJ9_COLFT/82-263--------------------------------TIG-ES.PVA.......-------------------------------
M0V6E2_HORVD/7-199--------------------------------LFG-DS.ITE.......-------------------------------
C0ZWX3_RHOE4/10-184--------------------------------ALG-DS.FTE.......-------------------------------
H2ME21_ORYLA/44-204--------------------------------FVG-DS.LIQ.......-------------------------------
Q63PZ5_BURPS/212-408--------------------------------AVG-DS.ITD.......-------------------------------
R6V1Y1_9FIRM/6-194--------------------------------CFG-DS.NTY.......-------------------------------
A0JR03_ARTS2/36-210--------------------------------ALG-DS.FTE.......-------------------------------
W0J7T0_9BACT/65-240--------------------------------FIG-DS.ITQ.......-------------------------------
R7NKF5_9BACE/27-204--------------------------------CVG-NS.ITY.......-------------------------------
E6UDP6_RUMA7/641-806--------------------------------FLG-DS.ITA.......-------------------------------
F8GFH2_NITSI/28-190--------------------------------VFG-DS.LSA.......-------------------------------
F9F2R2_FUSOF/1277-1464--------------------------------LLG-DS.ITD.......-------------------------------
K0K2E0_SACES/203-395--------------------------------AFG-DS.ITD.......-------------------------------
F0SWM2_SYNGF/60-221--------------------------------CIG-DS.YTS.......-------------------------------
R7C788_9CLOT/25-185--------------------------------FLG-GS.LSK.......-------------------------------
W0AIR7_9SPHN/199-388--------------------------------TLG-DS.ITD.......-------------------------------
D2PP87_KRIFD/69-245--------------------------------MIG-DS.SAA.......-------------------------------
F4AWM3_DOKS4/68-232--------------------------------FFG-DS.ITA.......-------------------------------
B1VVX0_STRGG/223-407--------------------------------ALG-DS.LTA.......-------------------------------
U7Q2W9_SPOS1/220-402--------------------------------ILG-DS.ITD.......-------------------------------
A6M2F1_CLOB8/61-248--------------------------------VLG-DS.LAK.......-------------------------------
R5KXB7_9BACT/63-283--------------------------------FIG-DS.MTD.......-------------------------------
K3XZ16_SETIT/8-196--------------------------------LFG-DS.ITEE....AF-------------------------------
E6S752_INTC7/87-258--------------------------------FVG-AS.TTA.......-------------------------------
W5WIW8_9PSEU/205-397--------------------------------AFG-DS.ITD.......-------------------------------
Q5LWA7_RUEPO/26-193--------------------------------ALG-DS.LTQ.......-------------------------------
A4XHL3_CALS8/11-203--------------------------------FIG-DS.ITD.......-------------------------------
C6C0K9_DESAD/5-174--------------------------------FIG-DS.LTS.......-------------------------------
B2ATA5_PODAN/25-209--------------------------------LLG-DS.ITE......I-------------------------------
J7ISV3_DESMD/58-224--------------------------------ILG-DS.IAV.......-------------------------------
H2K4A1_STRHJ/39-278--------------------------------ALG-DS.YSA.......-------------------------------
Q2G976_NOVAD/44-208--------------------------------AFG-DS.LYA.......-------------------------------
G4SUG0_META2/35-187--------------------------------AFG-DS.LTY.......-------------------------------
H2K4Z9_STRHJ/15-186--------------------------------AVG-DS.FTE.......-------------------------------
W0J432_9BACT/44-236--------------------------------FYG-DS.ITD.......-------------------------------
D3VJU5_XENNA/169-356--------------------------------FAG-DS.MMQ.......-------------------------------
C5AYG7_METEA/74-249--------------------------------AFG-SS.STE.......-------------------------------
E6U6E7_ETHHY/40-256--------------------------------ALG-DS.IAS.......-------------------------------
Q5LD72_BACFN/407-572--------------------------------MIG-NS.ITHF....WG-------------------------------
S3DDW3_GLAL2/10-191--------------------------------CFG-DS.LSA.......-------------------------------
E3J9G5_FRASU/58-281--------------------------------ALG-SS.IAS.......-------------------------------
R5QR45_9FIRM/96-249--------------------------------FLG-DS.ITA.......-------------------------------
K0F878_9NOCA/13-210--------------------------------FTG-DS.ITD.......-------------------------------
K4R9L2_9ACTN/231-426--------------------------------VLG-DS.LTD.......-------------------------------
A3DDK3_CLOTH/608-799--------------------------------FIG-DS.ITC.......-------------------------------
T0UH59_9STRE/46-208--------------------------------FAG-DS.ITE.......-------------------------------
J7IXJ3_DESMD/9-200--------------------------------ALG-DS.ITA.......-------------------------------
R7PCH8_9BACT/46-205--------------------------------FLG-NS.ITD.......-------------------------------
G2XB74_VERDV/55-232--------------------------------CVG-DS.ITV.......-------------------------------
R5FUC6_9FIRM/6-196--------------------------------FIG-DS.ITDMK..RNR-------------------------------
R8BFZ6_TOGMI/64-246--------------------------------SLG-AS.IMS.......-------------------------------
F7V8U7_CLOSS/9-188--------------------------------CYG-DS.NTY.......-------------------------------
R6T7B3_9BACE/46-211--------------------------------LYG-DS.ITD.......-------------------------------
W5W593_9PSEU/19-191--------------------------------VLG-DS.TSV.......-------------------------------
I0GS99_SELRL/183-349--------------------------------IYG-DS.ITA.......-------------------------------
Q65H30_BACLD/28-229--------------------------------AFG-DS.NTR.......-------------------------------
R7D037_9BACE/44-258--------------------------------FLG-DS.ITD.......-------------------------------
E1ZCH1_CHLVA/857-1058--------------------------------FFG-DS.ITE.......-------------------------------
U5LBE1_9BACI/9-207--------------------------------IAG-DS.TAA.......-------------------------------
E4NAV6_KITSK/55-306--------------------------------ALG-DS.YTS.......-------------------------------
Q0ABE5_ALKEH/37-188--------------------------------AFG-DS.LTY.......-------------------------------
S7ZFH0_PENO1/20-225--------------------------------LFG-DS.ITE.......-------------------------------
I4B2X9_TURPD/40-194--------------------------------ALG-DS.ITW.......-------------------------------
B9L4V0_THERP/33-227--------------------------------AVG-DS.LAA.......-------------------------------
D6Y3T6_THEBD/234-419--------------------------------AFG-DS.LTD.......-------------------------------
G7Z6X1_AZOL4/17-178--------------------------------ALG-DS.LTA.......-------------------------------
R6AQE2_9CLOT/122-304--------------------------------FIG-DS.ITI.......-------------------------------
L0DI14_SINAD/69-237--------------------------------FLG-DS.ITN.......-------------------------------
M9LYA1_PSEA3/5-259--------------------------------ALG-SS.FAA.......-------------------------------
D6X6Z3_STRPR/78-346--------------------------------SLG-DS.EIS.......-------------------------------
D2B3J3_STRRD/19-192--------------------------------ALG-DS.QTE.......-------------------------------
R5FJF8_9ACTN/33-236--------------------------------VLG-SS.TAA.......-------------------------------
C8WJI0_EGGLE/6-233--------------------------------ILG-DS.ISTF.....D-------------------------------
D9QEV2_CORP2/42-283--------------------------------IFG-DS.VVA.......-------------------------------
L0FBT6_DESDL/12-200--------------------------------ALG-DS.LTT.......-------------------------------
Q827I8_STRAW/8-184--------------------------------ALG-DS.LTE.......-------------------------------
G8SIP9_ACTS5/82-259--------------------------------VLG-DS.SAA.......-------------------------------
Q5L832_BACFN/496-664--------------------------------FLG-GS.ITEM.....K-------------------------------
W5TVY7_9NOCA/81-260--------------------------------IFG-DS.TAA.......-------------------------------
K9UCV4_9CHRO/139-310--------------------------------VIG-SS.VAV.......-------------------------------
B7GHZ1_ANOFW/71-259--------------------------------ALG-DS.LTR.......-------------------------------
E8R2J2_ISOPI/71-259--------------------------------FLG-NS.LAE.......-------------------------------
H2JL95_STRHJ/34-272--------------------------------ALG-DS.YAS.......-------------------------------
F3Z6T3_9ACTN/29-204--------------------------------AVG-DS.FTE.......-------------------------------
W5WIB8_9PSEU/47-222--------------------------------VLG-DS.IME.......-------------------------------
C4L1B0_EXISA/56-239--------------------------------ALG-DS.LTR.......-------------------------------
B2HQ03_MYCMM/13-256--------------------------------ALG-SS.MAA.......-------------------------------
H8KZ14_FRAAD/10-187--------------------------------ALG-DS.YTI.......-------------------------------
B2KBC9_ELUMP/39-189--------------------------------AFG-DS.LTY.......-------------------------------
A0K1Y5_ARTS2/18-192--------------------------------ALG-DS.FTE.......-------------------------------
G4UPA5_NEUT9/10-218--------------------------------LFG-DS.LFQ.......-------------------------------
I6S3G7_ENTHA/9-180--------------------------------LFG-DS.IAA.......-------------------------------
G2TP44_BACCO/5-211--------------------------------CFG-DS.ITR.......-------------------------------
X4ZEZ6_9BACL/185-371--------------------------------AIG-DS.LTD.......-------------------------------
F2F9R1_SOLSS/29-226--------------------------------ALG-DS.LAA.......-------------------------------
D8LR17_ECTSI/140-327--------------------------------VLG-DS.ITEE....LL-------------------------------
F0XSC4_GROCL/10-192--------------------------------CLG-DS.LTA.......-------------------------------
W5WU70_BDEBC/25-187--------------------------------VLG-DS.LTE.......-------------------------------
Q30ZF8_DESAG/9-172--------------------------------ALG-DS.LTE.......-------------------------------
E6U3Z0_ETHHY/13-221--------------------------------VCG-DS.IAA.......-------------------------------
K9Z576_CYAAP/133-304--------------------------------VIG-SS.VAM.......-------------------------------
R6QD03_9BACT/279-453--------------------------------CIG-NS.ITD.......-------------------------------
U5VVT9_9ACTN/94-270--------------------------------AVG-DS.ITAD....RL-------------------------------
A6W7C6_KINRD/11-181--------------------------------LVG-DE.FVT.......-------------------------------
G2NBW0_STREK/62-285--------------------------------AVG-DS.ITR.......-------------------------------
G9N929_HYPVG/206-405--------------------------------CIG-DS.ITD.......-------------------------------
J7IVY1_DESMD/124-291--------------------------------VFG-DA.VAA.......-------------------------------
R6CR61_9CLOT/153-322--------------------------------FVG-DS.ITE.......-------------------------------
G0VN30_MEGEL/280-449--------------------------------IFG-DS.ISH.......-------------------------------
Q741R5_MYCPA/80-259--------------------------------IFG-DS.TAA.......-------------------------------
N1SAZ9_FUSC4/198-391--------------------------------LLG-DS.ITD.......-------------------------------
C0QFP2_DESAH/32-194--------------------------------FVG-DS.ITA.......-------------------------------
B2GLV0_KOCRD/10-179--------------------------------AVG-DE.LLA.......-------------------------------
G0J2G6_CYCMS/26-199--------------------------------CVG-NS.ITQ.......-------------------------------
B7JX19_CYAP8/85-295--------------------------------LLG-DS.IAN.......-------------------------------
G0N3A6_CAEBE/128-371--------------------------------AIG-DS.FSS.......-------------------------------
A0ZJZ9_NODSP/82-300--------------------------------IIG-DS.IAN.......-------------------------------
F4H6M1_CELFA/18-186--------------------------------VVG-DE.LAA.......-------------------------------
I1N2X5_SOYBN/12-196--------------------------------MFG-SS.IVQ......Y-------------------------------
K9G952_PEND2/13-237--------------------------------SLG-SS.FAA.......-------------------------------
R5HM64_9FIRM/189-382--------------------------------CYG-DS.ITA.......-------------------------------
Q6AS77_DESPS/6-158--------------------------------FIG-DS.LIE.......-------------------------------
D4ILH5_9BACT/164-325--------------------------------VFG-SS.VTH.......-------------------------------
A7RJR6_NEMVE/10-191--------------------------------AFG-DS.LTE.......-------------------------------
R6RA51_9FIRM/215-387--------------------------------FIG-GS.ITQ.......-------------------------------
D8PRB9_SCHCM/27-228--------------------------------LAG-DS.TMA.......-------------------------------
F2R6G0_STRVP/238-432--------------------------------TFG-DS.ITD.......-------------------------------
F8DDA0_HALXS/10-205--------------------------------LIG-DS.TAA.......-------------------------------
W0RQX1_9BACT/215-404--------------------------------AVG-NS.ITD.......-------------------------------
R5PNX1_9BACT/61-237--------------------------------CIG-NS.ITD.......-------------------------------
G8TBC2_NIAKG/518-690--------------------------------LLG-NS.ITQ.......-------------------------------
R7F7N4_9CLOT/10-189--------------------------------ILG-DS.IVY.......-------------------------------
R6SAU8_9BACE/30-207--------------------------------CIG-NS.ITF.......-------------------------------
A4F857_SACEN/77-254--------------------------------VLG-DS.AAA.......-------------------------------
F6EJ21_AMYSD/11-256--------------------------------ALG-SS.FAS.......-------------------------------
Q4WIS4_ASPFU/228-426--------------------------------IIG-DS.ITD.......-------------------------------
F2R494_STRVP/11-189--------------------------------FIG-DS.VTD......T-------------------------------
Q5L832_BACFN/29-203--------------------------------CIG-NS.ITY.......-------------------------------
F4GLH5_SPHCD/33-199--------------------------------FLG-DS.LTR.......-------------------------------
K0JNT7_SACES/54-226--------------------------------ALG-DS.FTE.......-------------------------------
C7PW60_CATAD/592-784--------------------------------ALG-DS.ITD.......-------------------------------
A9WPA1_RENSM/70-249--------------------------------LIG-DS.QSD.......-------------------------------
B5H390_STRC2/231-417--------------------------------AVG-DS.LTD.......-------------------------------
R6MYM2_9BACE/51-216--------------------------------FMG-NS.ITE.......-------------------------------
I4F3W7_MODMB/5-181--------------------------------AIG-DS.FTE.......-------------------------------
Q38WY1_LACSS/61-282--------------------------------AVG-DS.LTH.......-------------------------------
V2XCK0_MONRO/11-210--------------------------------LFG-DS.ITQ.......-------------------------------
B2WI22_PYRTR/182-379--------------------------------IIG-DS.ITD.......-------------------------------
B5Y4J5_PHATC/14-211--------------------------------LFG-DS.ITE.......-------------------------------
D7BPT6_STRBB/218-404--------------------------------TLG-DS.ITD.......-------------------------------
J7Q741_METSZ/49-211--------------------------------AFG-DS.LTA.......-------------------------------
W0AKN6_9SPHN/107-270--------------------------------FMG-DS.ITE.......-------------------------------
G0VNQ9_MEGEL/5-178--------------------------------CLG-DS.LTY.......-------------------------------
Q11JW6_CHESB/159-347--------------------------------VIG-DS.ISA.......-------------------------------
D7C830_STRBB/124-301--------------------------------ALG-DS.LSE.......-------------------------------
F8JN95_STREN/61-302--------------------------------ALG-DS.YAA.......-------------------------------
F2KZ29_PREDF/46-223--------------------------------CVG-NS.VTW.......-------------------------------
K9S6S4_9CYAN/29-219--------------------------------ALG-DS.LIY.......-------------------------------
Q6AE96_LEIXX/18-179--------------------------------VIG-DS.IES.......-------------------------------
F6B5J1_DESCC/53-207--------------------------------FLG-DS.LTE.......-------------------------------
W0EUS0_9SPHI/181-343--------------------------------VYG-SS.VTQ.......-------------------------------
R6T524_9FIRM/110-271--------------------------------FIG-DS.ITA.......-------------------------------
J7IWI7_DESMD/59-219--------------------------------ALG-DS.FTL.......-------------------------------
A8IXQ3_CHLRE/5-169--------------------------------AFG-DS.LTE.......-------------------------------
C5AQE3_METEA/66-244--------------------------------AFG-SS.STE.......-------------------------------
F8DAN2_HALXS/162-326--------------------------------AYG-TS.ITE.......-------------------------------
F3Y895_MELPT/6-178--------------------------------LFG-DS.ITA.......-------------------------------
C6D6S5_PAESJ/43-220--------------------------------LIG-DS.ITH.......-------------------------------
K8E6E4_CARML/7-174--------------------------------LFG-DS.ITA.......-------------------------------
A5FD35_FLAJ1/213-403--------------------------------CLG-NS.IID.......-------------------------------
G3Y471_ASPNA/215-415--------------------------------IIG-DS.ITD.......-------------------------------
D4IKZ7_9BACT/176-338--------------------------------IFG-SS.FTH.......-------------------------------
W0J141_9BACT/53-225--------------------------------FFG-DS.LTA.......-------------------------------
L0GVE5_9GAMM/38-189--------------------------------AFG-NS.LTR.......-------------------------------
D2B805_STRRD/33-196--------------------------------IVG-DS.FTV.......-------------------------------
Q7UYW6_RHOBA/44-227--------------------------------FLG-NS.ITL......H-------------------------------
H1Y5L1_9SPHI/67-232--------------------------------FFG-DS.LTA.......-------------------------------
R5UKQ6_9BACE/276-450--------------------------------CIG-NS.ITY.......-------------------------------
D2VNU3_NAEGR/47-259--------------------------------ALG-DS.ITK.......-------------------------------
K0J7V1_AMPXN/8-193--------------------------------FIG-DS.ITE......W-------------------------------
R6TJ61_9FIRM/115-284--------------------------------FLG-DS.RTE.......-------------------------------
Q3AES5_CARHZ/6-166--------------------------------FLG-DS.LTY.......-------------------------------
F5Y754_TREAZ/51-226--------------------------------CLG-DS.LTE.......-------------------------------
I2EW44_EMTOG/30-213--------------------------------FFG-DS.ITQ......A-------------------------------
Q2KC63_RHIEC/16-181--------------------------------VLG-DS.IIE.......-------------------------------
G2Q479_THIHA/11-200--------------------------------CFG-DS.LTA.......-------------------------------
F4CX93_PSEUX/44-288--------------------------------ALG-DS.YTA.......-------------------------------
F2K441_MARM1/39-201--------------------------------IMG-DS.LSA.......-------------------------------
G0SCK7_CHATD/220-415--------------------------------IIG-DS.ITD.......-------------------------------
E2SDW1_9ACTN/295-492--------------------------------VLG-DS.YAQPS...VM-------------------------------
W8S2P1_9RHOB/29-199--------------------------------ALG-DS.LTQ.......-------------------------------
D5QBC4_KOMHA/27-197--------------------------------LFG-SS.TIE.......-------------------------------
R6VZ51_9FIRM/5-211--------------------------------VLG-DS.ITK.......-------------------------------
C9SBJ5_VERA1/56-239--------------------------------CVG-DS.VTV.......-------------------------------
R5HMF9_9FIRM/10-201--------------------------------VLG-DS.ISTF.....Q-------------------------------
C7QIT4_CATAD/174-342--------------------------------CYG-DS.IAE.......-------------------------------
C7NEU8_KYTSD/77-256--------------------------------VMG-DS.VAN.......-------------------------------
L0EDP3_THECK/52-222--------------------------------FIG-GS.ITD.......-------------------------------
A3I0B5_9BACT/411-576--------------------------------IFG-NS.IVN.......-------------------------------
C6Y2G7_PEDHD/17-213--------------------------------FLG-NS.ITY......A-------------------------------
A0A068NQ24_9BACT/304-475--------------------------------LLG-DS.ITQ.......-------------------------------
W0F2F1_9SPHI/300-469--------------------------------FLG-GS.ITNM.....T-------------------------------
Q0AXT3_SYNWW/9-171--------------------------------CLG-DS.ITY.......-------------------------------
G0IW62_CYCMS/53-216--------------------------------FYG-NS.LTA.......-------------------------------
R6GYU7_9FIRM/5-176--------------------------------CLG-DS.LTT.......-------------------------------
C7PXM1_CATAD/208-402--------------------------------AFG-DS.ITD.......-------------------------------
D1A6Y3_THECD/85-332--------------------------------ALG-DS.YSA.......-------------------------------
D5ET48_PRER2/169-360--------------------------------CYG-DS.ITA.......-------------------------------
C6D1K9_PAESJ/68-265--------------------------------AIG-DS.LTK.......-------------------------------
R5RKB7_9FIRM/11-201--------------------------------MIG-DS.VTD.......-------------------------------
Q8PE64_XANCP/207-406--------------------------------AFG-DS.ITD.......-------------------------------
R5UQU2_9PORP/27-204--------------------------------CVG-NS.VTY.......-------------------------------
C4LIB2_CORK4/94-340--------------------------------ALG-DS.YAS......V-------------------------------
L8FS37_PSED2/8-238--------------------------------ALG-SS.VAA.......-------------------------------
R5NYB5_9CLOT/6-194--------------------------------CYG-DS.NTY.......-------------------------------
Q28MK4_JANSC/6-192--------------------------------IFG-DS.NSH.......-------------------------------
F4D1F9_PSEUX/9-182--------------------------------AIG-DS.FTE.......-------------------------------
F6DPQ3_DESRL/121-297--------------------------------CLG-DS.ITY.......-------------------------------
Q08RB4_STIAD/156-336--------------------------------FIG-DS.ITA.......-------------------------------
Q4A638_MYCS5/67-329--------------------------------AFG-DS.ITA.......-------------------------------
G2Q2N0_THIHA/215-412--------------------------------IVG-DS.ITD.......-------------------------------
D4Z883_SPHJU/203-400--------------------------------ALG-DS.ITD.......-------------------------------
C7MTG5_SACVD/41-279--------------------------------ALG-DS.YTAA.....P-------------------------------
W5WRL6_9CORY/35-268--------------------------------VLG-DS.LAA.......-------------------------------
G0FQT7_AMYMS/216-401--------------------------------ALG-DS.ITD.......-------------------------------
K1WT60_MARBU/219-416--------------------------------IVG-DS.ITD.......-------------------------------
Q2IJI2_ANADE/217-376--------------------------------FLG-DS.IGA.......-------------------------------
B5HGC9_STRPR/286-467--------------------------------AVG-DS.ITD.......-------------------------------
C5C9F6_MICLC/56-217--------------------------------VYG-DS.IAVA.....D-------------------------------
K9SEF6_9CYAN/68-250--------------------------------VIG-DS.TSL.......-------------------------------
Q6AEG4_LEIXX/39-217--------------------------------ALG-DS.ITE.......-------------------------------
M1NU08_9CORY/51-286--------------------------------ALG-DS.YAA......L-------------------------------
W8FDN5_9BACT/6-181--------------------------------FFG-DS.LTA.......-------------------------------
I2ERE8_EMTOG/36-233--------------------------------LIG-DS.TCA.......-------------------------------
A7H6E3_ANADF/41-216--------------------------------AMG-DS.TAV.......-------------------------------
Q0RYP1_RHOJR/26-263--------------------------------ALG-DS.RAA.......-------------------------------
F8EDQ7_RUNSL/37-216--------------------------------SLG-DS.YTI.......-------------------------------
G0FJD1_AMYMS/206-390--------------------------------VIG-DS.ISD.......-------------------------------
R6NCV8_9FIRM/6-193--------------------------------FLG-DS.ITD......A-------------------------------
R6PG94_9CLOT/121-280--------------------------------FYG-SS.ITE.......-------------------------------
Q82UM7_NITEU/30-192--------------------------------VLG-DS.LSA.......-------------------------------
C6WRE5_ACTMD/217-404--------------------------------VFG-DS.ITD.......-------------------------------
L0DHA9_SINAD/127-277--------------------------------IIG-DS.VTA.......-------------------------------
A5V0A0_ROSS1/41-245--------------------------------ALG-NS.LGF.......-------------------------------
D2NPI4_ROTMD/21-195--------------------------------AIG-DS.FTE.......-------------------------------
B0TE03_HELMI/9-186--------------------------------AVG-DS.LTW.......-------------------------------
Q8A4H8_BACTN/225-425--------------------------------FVG-NS.ITE.......-------------------------------
G0IUF5_CYCMS/53-234--------------------------------ALG-DS.YTI.......-------------------------------
D4ZHS5_SHEVD/49-220--------------------------------VIG-DS.AAA.......-------------------------------
Q5YZY5_NOCFA/37-212--------------------------------VLG-DS.IAQ.......-------------------------------
D6ZHH5_MOBCV/133-302--------------------------------ALG-DS.AAQ.......-------------------------------
K0SZ26_THAOC/9-209--------------------------------LFG-DS.ITE......L-------------------------------
Q2H5R4_CHAGB/11-199--------------------------------CFG-DS.LTA.......-------------------------------
R4SGZ1_AMYOR/48-219--------------------------------VLG-ES.TVD.......-------------------------------
R7DDH5_9FIRM/7-189--------------------------------CYG-DS.NTY.......-------------------------------
Q8Y9N1_LISMO/6-187--------------------------------FLG-DS.VTD......A-------------------------------
F8JTD2_STREN/229-421--------------------------------ALG-DS.ITD.......-------------------------------
E3Q6Q5_COLGM/11-186--------------------------------CFG-DS.LTA.......-------------------------------
H6N4I8_GORPV/55-221--------------------------------AYG-DS.ITQ.......-------------------------------
A4J6W7_DESRM/116-292--------------------------------CLG-DS.ITY.......-------------------------------
Q039F3_LACC3/51-264--------------------------------AVG-DS.LTY.......-------------------------------
D4IPK2_9BACT/148-338--------------------------------FIG-DS.HTC.......-------------------------------
K5Y4R4_AGABU/11-211--------------------------------LFG-DS.ITQ.......-------------------------------
G2P709_STRVO/96-318--------------------------------SLG-DS.ITR.......-------------------------------
W5XQ30_9CORY/32-259--------------------------------AFG-DS.ILA.......-------------------------------
R6EI94_9FIRM/48-212--------------------------------FIG-GS.ITQ.......-------------------------------
C9YVQ8_STRSW/12-185--------------------------------AIG-DS.MTE.......-------------------------------
B5ECT5_GEOBB/43-204--------------------------------AVG-DS.LTA.......-------------------------------
L0IZI7_MYCSM/42-213--------------------------------VVG-DS.YTT.......-------------------------------
G8TMV1_NIAKG/60-223--------------------------------FFG-NS.LTA.......-------------------------------
D5CUL0_SIDLE/53-210--------------------------------ALG-DS.LTA.......-------------------------------
R7DJG6_9PORP/55-219--------------------------------FMG-NS.ITE.......-------------------------------
Q47RM4_THEFY/15-193--------------------------------AVG-DS.FTE.......-------------------------------
F0SHA0_RUBBR/63-240--------------------------------YLG-GS.ITAA.....N-------------------------------
E2PZZ8_STRC2/8-209--------------------------------FVG-DS.MTI.......-------------------------------
R5H640_9FIRM/141-306--------------------------------FLG-GS.ITQ.......-------------------------------
I6Y6F5_PROPF/50-219--------------------------------ALG-DS.AAQ.......-------------------------------
T5AQ29_OPHSC/11-176--------------------------------CFG-DS.LTS.......-------------------------------
R6V294_9FIRM/69-258--------------------------------VMG-DS.ITY.......-------------------------------
W0IX57_9BACT/13-200--------------------------------FYG-DS.ITD......C-------------------------------
S0DLQ3_GIBF5/10-185--------------------------------CFG-DS.LTS.......-------------------------------
K4L7W0_9FIRM/82-241--------------------------------CLG-DS.FTY.......-------------------------------
G2T4L0_ROSHA/46-226--------------------------------CIG-DS.ITY.......-------------------------------
R6AWH7_9BACT/279-454--------------------------------CIG-NS.ITD.......-------------------------------
G7WK40_METH6/28-202--------------------------------LFG-DS.ITA.......-------------------------------
R5GWK8_9FIRM/31-258--------------------------------VLG-DS.ITT.......-------------------------------
V6KNE3_STRNV/37-209--------------------------------VAG-DS.LAA.......-------------------------------
R7ETW3_9FIRM/179-369--------------------------------AFG-DS.ITA.......-------------------------------
R5GTV3_9FIRM/170-363--------------------------------CYG-DS.ITA.......-------------------------------
V6JZS2_STRRC/975-1284--------------------------------AMG-DS.FSS.......-------------------------------
G3XVI5_ASPNA/22-227--------------------------------LFG-DS.ITE.......-------------------------------
F0Y8S6_AURAN/6-192--------------------------------LLG-DS.LTQ......Y-------------------------------
M3J465_CANMX/8-216--------------------------------LFG-DS.ITQF.....S-------------------------------
D4K508_9FIRM/7-199--------------------------------CLG-DS.NTH.......-------------------------------
Q8YU46_NOSS1/82-300--------------------------------LLG-DS.IIN.......-------------------------------
R7BJR6_9FIRM/40-204--------------------------------FIG-GS.ITQ.......-------------------------------
F9FZ25_FUSOF/61-245--------------------------------CVG-DS.ITE.......-------------------------------
R5FF96_9FIRM/37-265--------------------------------YLG-DS.IGEA....VA-------------------------------
B9IG91_POPTR/11-195--------------------------------LFG-SS.IVQ.......-------------------------------
B9LZW9_GEODF/33-184--------------------------------AFG-DS.ITY.......-------------------------------
C6W7W0_ACTMD/17-192--------------------------------AIG-DS.FTE.......-------------------------------
R6QBA2_9FIRM/141-316--------------------------------FLG-DS.LTV.......-------------------------------
K9SJM4_9CYAN/133-375--------------------------------CLG-DS.VTF.......-------------------------------
R6MI53_9BACE/31-206--------------------------------CVG-NS.ITE.......-------------------------------
C6VYJ9_DYAFD/51-229--------------------------------ALG-DS.YTI.......-------------------------------
E4N364_KITSK/7-181--------------------------------ALG-DS.LTE.......-------------------------------
K4L2F9_9FIRM/16-224--------------------------------IVG-DS.ISK.......-------------------------------
E3HK46_ACHXA/219-415--------------------------------AFG-DS.LTD.......-------------------------------
H6MZH3_GORPV/43-278--------------------------------ALG-DS.RAS.......-------------------------------
E0SNG4_IGNAA/16-203--------------------------------FVG-DS.ITE......S-------------------------------
B2FLV5_STRMK/36-208--------------------------------AFG-HS.VPA.......-------------------------------
A6L9E6_PARD8/406-571--------------------------------ILG-NS.ITH.......-------------------------------
A5N0W3_CLOK5/50-280--------------------------------ALG-DS.ISC.......-------------------------------
R5V256_9FIRM/2373-2581--------------------------------AFG-DS.ITD.......-------------------------------
C7QHD3_CATAD/45-285--------------------------------ALG-DS.LGA.......-------------------------------
W5W8K9_9PSEU/13-210--------------------------------FTG-DS.ITD.......-------------------------------
I0H5M1_ACTM4/180-370--------------------------------AFG-DS.VVD.......-------------------------------
D5UM11_TSUPD/42-279--------------------------------SMG-DS.YAA......S-------------------------------
Q6BXY7_DEBHA/10-210--------------------------------LFG-DS.ITQ......H-------------------------------
R7L8L2_9BACT/27-201--------------------------------CVG-DS.ITY.......-------------------------------
G8TKW5_NIAKG/416-581--------------------------------FFG-NS.IIH.......-------------------------------
B1ZMB2_OPITP/56-221--------------------------------FFG-DS.LTA.......-------------------------------
E4RYV2_LEAB4/25-222--------------------------------LIG-DS.TMA.......-------------------------------
Q2J4R6_FRASC/59-291--------------------------------VLG-DS.YSS.......-------------------------------
B1LTZ6_METRJ/11-172--------------------------------FIG-DS.ITA.......-------------------------------
C7YKB0_NECH7/63-247--------------------------------CAG-DS.ITS.......-------------------------------
D4IKA2_9BACT/180-341--------------------------------VIG-SS.ITH.......-------------------------------
F6FXF1_ISOV2/50-264--------------------------------ALG-DS.YAS.......-------------------------------
D2QSD1_SPILD/28-207--------------------------------SLG-DS.YTI.......-------------------------------
E9T017_RHOHA/12-185--------------------------------AIG-DS.QSE.......-------------------------------
F6EG43_AMYSD/49-298--------------------------------SLG-DS.FTS.......-------------------------------
D9QE05_CORP2/33-261--------------------------------VLG-DS.IIA.......-------------------------------
W5TIF4_9NOCA/14-188--------------------------------AMG-DS.QTE.......-------------------------------
A1AK13_PELPD/35-186--------------------------------AYG-DS.LTF.......-------------------------------
C6WRZ7_ACTMD/45-317--------------------------------SLG-DS.TLS.......-------------------------------
W0RP45_9BACT/63-226--------------------------------FIG-TS.LTA.......-------------------------------
A7HAV9_ANADF/46-221--------------------------------FFG-SS.TVA.......-------------------------------
A8MBU5_CALMQ/14-202--------------------------------FIG-DS.ITD......S-------------------------------
K9UBB8_9CHRO/31-266--------------------------------VYG-DS.LSD......V-------------------------------
J3NZ99_GAGT3/233-426--------------------------------VLG-DS.ITD.......-------------------------------
D2B220_STRRD/9-190--------------------------------ALG-DS.FTE.......-------------------------------
A4X5Q2_SALTO/46-271--------------------------------ALG-DS.IST.......-------------------------------
M3A1S9_PSEFD/40-254--------------------------------LFG-DS.ITQ.......-------------------------------
R6S0J7_9BACE/51-225--------------------------------CVG-NS.ITE.......-------------------------------
D6YAB7_THEBD/194-387--------------------------------CVG-DS.LTD.......-------------------------------
K9XU50_STAC7/82-299--------------------------------LLG-DS.IVN.......-------------------------------
E8UXT2_TERSS/206-412--------------------------------AFG-DS.ITE.......-------------------------------
E3RHX5_PYRTT/204-397--------------------------------TLG-DS.ITD.......-------------------------------
Q6LG08_PHOPR/49-220--------------------------------LIG-DS.AAA.......-------------------------------
X2GTY0_9GAMM/243-493--------------------------------ILG-DS.TAS.......-------------------------------
W0EFL6_9FIRM/61-220--------------------------------ALG-DS.FTY.......-------------------------------
E6UBD0_RUMA7/94-255--------------------------------YLG-GS.ITE.......-------------------------------
H8MKT4_CORCM/238-410--------------------------------AIG-DS.ITE.......-------------------------------
F8B3H7_FRADG/102-290--------------------------------ALG-DS.ITA.......-------------------------------
D2SFR9_GEOOG/10-185--------------------------------LIG-DS.LAY.......-------------------------------
H6R5S6_NOCCG/225-420--------------------------------TFG-DS.ITD.......-------------------------------
Q6ACS0_LEIXX/65-230--------------------------------AIG-GR.AAQ.......-------------------------------
X2GLQ8_9BACI/91-283--------------------------------ALG-DS.LTD.......-------------------------------
R5TIV7_9CLOT/6-187--------------------------------IYG-DS.IST.......-------------------------------
N4UMB5_FUSC1/35-233--------------------------------LFG-DS.ITQ.......-------------------------------
H6MSH0_GORPV/85-264--------------------------------VFG-DS.TAA.......-------------------------------
J7ISJ6_DESMD/43-209--------------------------------ILG-ES.IAV.......-------------------------------
A7E806_SCLS1/11-186--------------------------------CFG-NS.LTQ.......-------------------------------
A3QG84_SHELP/34-204--------------------------------ILG-DS.AAA.......-------------------------------
K1Y1R1_MARBU/11-192--------------------------------CFG-NS.ITA.......-------------------------------
E4TNS7_MARTH/50-214--------------------------------FFG-NS.LTA.......-------------------------------
B7GI34_ANOFW/42-229--------------------------------ALG-DS.LTE.......-------------------------------
T1L096_TETUR/43-222--------------------------------LIG-DS.ITQ.......-------------------------------
W0J1J6_9BACT/50-222--------------------------------ILG-DS.ISI.......-------------------------------
I4ET37_MODMB/5-180--------------------------------VLG-DS.LAF.......-------------------------------
X2GSK3_9BACI/31-228--------------------------------ALG-DS.LAA.......-------------------------------
V5G6S2_BYSSN/231-429--------------------------------IIG-DS.ITD.......-------------------------------
B7GCS4_PHATC/222-406--------------------------------LLG-DS.ITE.......-------------------------------
D8PWM2_SCHCM/11-212--------------------------------LFG-DS.ITQ.......-------------------------------
A3HWF5_9BACT/52-227--------------------------------FHG-HS.VPS.......-------------------------------
B2AU74_PODAN/11-194--------------------------------CFG-DS.LTA.......-------------------------------
Q82LC7_STRAW/221-407--------------------------------ALG-DS.LTD.......-------------------------------
G4RC97_PELHB/88-269--------------------------------VFG-DS.LAV.......-------------------------------
R5V8J1_9BACE/37-214--------------------------------VIG-DS.YVR.......-------------------------------
L0FX57_ECHVK/54-236--------------------------------ALG-DS.YTI.......-------------------------------
H6RW39_BLASD/35-273--------------------------------ALG-DS.YSAA.....S-------------------------------
R5QDP9_9FIRM/35-241--------------------------------AFG-DS.VMK.......-------------------------------
Q9F2Z1_STRCO/6-203--------------------------------FVG-DS.MTI.......-------------------------------
E1VUZ0_ARTAR/38-207--------------------------------AIG-DE.LLA.......-------------------------------
H1VDB1_COLHI/28-214--------------------------------CVG-DS.ITV.......-------------------------------
E4N961_KITSK/9-187--------------------------------AVG-DS.FTE.......-------------------------------
Q63PL7_BURPS/72-243--------------------------------VLG-DS.AAA.......-------------------------------
Q01A18_OSTTA/135-339--------------------------------LFG-DS.LTERS..FEV-------------------------------
B8ET23_METSB/91-262--------------------------------AIG-SS.STA.......-------------------------------
M2XH33_DOTSN/21-233--------------------------------AFG-DS.LTE.......-------------------------------
E9DZN0_METAQ/10-185--------------------------------CFG-DS.LTS.......-------------------------------
Q8DU46_STRMU/21-182--------------------------------FAG-DS.ITE.......-------------------------------
Q46LN4_PROMT/10-197--------------------------------ILG-DS.GVY.......-------------------------------
A6WER1_KINRD/11-184--------------------------------LLG-DS.LAA.......-------------------------------
D7B0X9_NOCDD/25-198--------------------------------AIG-DS.ITE.......-------------------------------
L0FTR2_ECHVK/52-227--------------------------------FHG-HS.VPA.......-------------------------------
R6SKX4_9CLOT/10-205--------------------------------IIG-DS.ITE.......-------------------------------
L0RUM6_MYCC1/103-370--------------------------------ALG-DS.ISA.......-------------------------------
R7FCL5_9FIRM/197-361--------------------------------FLG-DS.ITA.......-------------------------------
B1ZNN8_OPITP/84-244--------------------------------FVG-DS.IFE.......-------------------------------
G0HFZ3_CORVD/69-287--------------------------------VFG-DS.YYS.......-------------------------------
U9SUF4_RHIID/7-187--------------------------------LLG-DS.LTE.......-------------------------------
R6X2A1_9BACT/277-446--------------------------------MIG-NS.ITH.......-------------------------------
H6C8Z7_EXODN/226-426--------------------------------ILG-DS.ITD.......-------------------------------
R4TFY0_AMYOR/8-182--------------------------------ALG-DS.CAE.......-------------------------------
A4CMT0_ROBBH/52-215--------------------------------FFG-DS.LTA.......-------------------------------
S8EH10_FOMPI/156-349--------------------------------FIG-DS.LSA.......-------------------------------
B3PBS6_CELJU/890-1055--------------------------------FIG-DS.ITQ.......-------------------------------
R5VR65_9FIRM/9-214--------------------------------IFG-DS.ISK.......-------------------------------
G2QV43_THITE/247-448--------------------------------VLG-DS.ISD.......-------------------------------
K0RH82_THAOC/57-262--------------------------------LLG-DS.ITQ.......-------------------------------
Q9CEW1_LACLA/11-179--------------------------------IFG-DS.ITN.......-------------------------------
D6D175_9BACE/34-224--------------------------------FVG-NS.ITH.......-------------------------------
A6LQD3_CLOB8/9-178--------------------------------FFG-DS.LTL.......-------------------------------
B5HV00_9ACTN/172-361--------------------------------LFG-DS.VTD.......-------------------------------
W0J5S6_9BACT/184-351--------------------------------AFG-DS.VTH.......-------------------------------
B8LXC2_TALSN/172-366--------------------------------AFG-SS.TTD.......-------------------------------
B5Y584_PHATC/141-329--------------------------------FLG-DS.ITER....MM-------------------------------
K1WTL0_MARBU/815-989--------------------------------CFG-DS.LTD.......-------------------------------
F2RCI5_STRVP/147-314--------------------------------VHG-DS.ITE.......-------------------------------
Q89X56_BRADU/70-231--------------------------------VLG-DS.LSA.......-------------------------------
H6NTM1_9BACL/1012-1217--------------------------------ALG-DS.LAA.......-------------------------------
A7SDI5_NEMVE/12-202--------------------------------AFG-DS.LTQ.......-------------------------------
D2ARC6_STRRD/35-218--------------------------------ALG-DS.ITGS.....P-------------------------------
R5AQH7_9FIRM/9-215--------------------------------VFG-DS.LMK.......-------------------------------
C7R0X4_JONDD/29-208--------------------------------AIG-DS.FSE.......-------------------------------
F3ZF62_9ACTN/11-212--------------------------------LVG-DS.QTI.......-------------------------------
S6AI95_PSERE/58-229--------------------------------LIG-ES.TVA.......-------------------------------
R7GGE4_9CLOT/174-327--------------------------------FIG-DS.ITE.......-------------------------------
D9T465_MICAI/8-182--------------------------------AVG-DS.FTE.......-------------------------------
R6I9F2_9FIRM/75-243--------------------------------FIG-DS.RMV.......-------------------------------
B7K022_CYAP8/137-308--------------------------------VIG-SS.VAE.......-------------------------------
K2RQT3_MACPH/254-460--------------------------------LVG-DS.ITD.......-------------------------------
G0FWK7_AMYMS/34-271--------------------------------AMG-DS.YSS.......-------------------------------
C2X2M1_BACCE/57-245--------------------------------VLG-DS.LAK.......-------------------------------
D6XC24_9ACTN/201-386--------------------------------ALG-DS.ITD.......-------------------------------
R4LPL8_9ACTN/5-178--------------------------------AVG-DS.FTE.......-------------------------------
A4XXU1_PSEMY/56-227--------------------------------LIG-ES.TVA.......-------------------------------
C5B3G4_METEA/36-229--------------------------------FVG-DS.LSD.......-------------------------------
E3FI96_STIAD/7-182--------------------------------ALG-DS.SAV.......-------------------------------
C7Q166_CATAD/207-386--------------------------------AVG-DS.ITD.......-------------------------------
Q0RH78_FRAAA/18-203--------------------------------ALG-DS.ITV.......-------------------------------
G4L5Q0_TETHN/52-229--------------------------------AVG-DS.ITY.......-------------------------------
A8LCM3_FRASN/78-310--------------------------------ALG-DS.YSS.......-------------------------------
M1P8N9_9CORY/171-338--------------------------------VLG-DS.TGA.......-------------------------------
G8RZH6_ACTS5/15-191--------------------------------FYG-DS.IVT.......-------------------------------
E1STC6_FERBD/38-189--------------------------------AFG-DS.LTR.......-------------------------------
I3ZLP4_TERRK/91-256--------------------------------FYG-DS.ITD.......-------------------------------
D4LF09_RUMC1/40-277--------------------------------MLG-DS.IAS.......-------------------------------
Q8PE29_XANCP/18-208--------------------------------IAG-DS.TAA.......-------------------------------
R6FKM3_9BACE/45-260--------------------------------FLG-DS.ITD.......-------------------------------
R5IBD6_9PORP/52-216--------------------------------FIG-NS.ITE.......-------------------------------
D3Q5A1_STANL/37-279--------------------------------ALG-DS.FTS.......-------------------------------
A1SQ25_NOCSJ/8-182--------------------------------ALG-DS.FTE.......-------------------------------
L0G5F4_ECHVK/35-212--------------------------------CIG-NS.VTY.......-------------------------------
Q839J6_ENTFA/6-177--------------------------------LFG-DS.ITA.......-------------------------------
K0EVN5_9NOCA/37-290--------------------------------SLG-DS.FTA.......-------------------------------
Q10VH9_TRIEI/82-295--------------------------------LLG-DS.VAN.......-------------------------------
R6C9R5_9FIRM/45-206--------------------------------FLG-DS.ITA.......-------------------------------
D9TB24_MICAI/66-244--------------------------------LLG-DS.SAL.......-------------------------------
D5ELH5_CORAD/13-199--------------------------------FVG-DS.ITD......C-------------------------------
C6WNW7_ACTMD/47-323--------------------------------SLG-DS.AMA.......-------------------------------
K9WLU5_9CYAN/84-307--------------------------------FIG-DS.IIN.......-------------------------------
D3E715_GEOS4/8-197--------------------------------AVG-DS.LTF.......-------------------------------
D3FEM1_CONWI/415-592--------------------------------ALG-DS.ITD.......-------------------------------
D5SU16_PLAL2/85-244--------------------------------LYG-DS.ITQ.......-------------------------------
G8RLC6_MYCRN/60-234--------------------------------ALG-DS.LSQ.......-------------------------------
F0YPY0_AURAN/182-368--------------------------------FVG-DS.ITE.......-------------------------------
D4KX07_9FIRM/201-394--------------------------------CYG-DS.ITA.......-------------------------------
Q4K496_PSEF5/169-357--------------------------------FVG-DS.LMQ.......-------------------------------
F6FRQ0_ISOV2/49-238--------------------------------IAG-DS.TAA.......-------------------------------
A0K019_ARTS2/43-282--------------------------------AVG-DS.YTA.......-------------------------------
R6PJS4_9FIRM/86-266--------------------------------FVG-DS.IMA.......-------------------------------
S8FIW6_FOMPI/11-210--------------------------------LLG-DS.ITQ......D-------------------------------
A3QHA7_SHELP/37-188--------------------------------AFG-DS.LTQ.......-------------------------------
B0RG54_CLAMS/57-217--------------------------------VMG-DS.NTN.......-------------------------------
R7EUZ9_9FIRM/269-454--------------------------------FLG-DS.YFA.......-------------------------------
Q74HT7_LACJO/6-172--------------------------------LFG-DS.LLA.......-------------------------------
B8I7W3_CLOCE/42-205--------------------------------YLG-GS.ITE.......-------------------------------
D4LAZ2_RUMC1/46-210--------------------------------FLG-GS.VTA.......-------------------------------
Q7VBS0_PROMA/10-197--------------------------------IIG-DS.SVY.......-------------------------------
G4UBG4_NEUT9/10-196--------------------------------CFG-DS.LTE.......-------------------------------
J3KHS7_COCIM/25-230--------------------------------IFG-DS.ITQ.......-------------------------------
Q7UQP2_RHOBA/74-262--------------------------------IIG-DS.ITE.......-------------------------------
C7MDV1_BRAFD/20-196--------------------------------ALG-DE.LLA.......-------------------------------
G8T838_NIAKG/9-190--------------------------------ALG-DS.YTI.......-------------------------------
C5CN33_VARPS/214-410--------------------------------AFG-DS.ITA.......-------------------------------
R7K7T0_9FIRM/11-224--------------------------------VFG-DS.VSK.......-------------------------------
W0EZN1_9SPHI/65-230--------------------------------IMG-NS.IIH.......-------------------------------
M3CID9_SPHMS/13-237--------------------------------LFG-DS.ITQ.......-------------------------------
R6SBW2_9BACE/34-225--------------------------------FLG-NS.ITD.......-------------------------------
C9A9E6_ENTCA/11-200--------------------------------FLG-DS.ITD.......-------------------------------
M7XMK5_RHOT1/11-211--------------------------------CVG-DS.LTE.......-------------------------------
W4XYX6_STRPU/23-183--------------------------------FVG-DS.LIQ.......-------------------------------
C4XN11_DESMR/68-257--------------------------------LVG-DS.LSI.......-------------------------------
W0J3X9_9BACT/160-327--------------------------------AYG-SS.ITH.......-------------------------------
Q8PAG8_XANCP/48-225--------------------------------LIG-DS.ITQ.......-------------------------------
B2FKH3_STRMK/82-246--------------------------------FFG-DS.ITE.......-------------------------------
R5M563_9BACE/30-204--------------------------------CVG-NS.ITY.......-------------------------------
C8XK01_NAKMY/7-181--------------------------------AIG-DS.FTE.......-------------------------------
R7J6X0_9PORP/29-206--------------------------------CVG-NS.ITY.......-------------------------------
F0Y9D3_AURAN/33-215--------------------------------CVG-DS.ITY.......-------------------------------
Q6AS67_DESPS/32-193--------------------------------AVG-DS.LTA.......-------------------------------
B2HRK1_MYCMM/57-228--------------------------------VIG-DS.YTT.......-------------------------------
D3EBN6_GEOS4/195-386--------------------------------ALG-DS.ITE.......-------------------------------
H1ZF87_MYROD/168-331--------------------------------IYG-SS.IAQ.......-------------------------------
J3NIZ3_GAGT3/10-186--------------------------------CFG-DS.LTA.......-------------------------------
A0K1Y0_ARTS2/9-183--------------------------------ALG-DS.FTE.......-------------------------------
R4SXF6_AMYOR/58-298--------------------------------ALG-DS.YTAS.....P-------------------------------
G0AG80_COLFT/214-410--------------------------------AFG-DS.ITD.......-------------------------------
R5VAM2_9FIRM/35-199--------------------------------FLG-GS.ITQ.......-------------------------------
Q2JBR1_FRASC/12-197--------------------------------ALG-DS.ITV.......-------------------------------
R6CUV2_9CLOT/6-194--------------------------------CFG-DS.NTY.......-------------------------------
H6NN37_9BACL/149-345--------------------------------LVG-DS.TVT.......-------------------------------
E8RJ13_DESPD/29-191--------------------------------FLG-DS.LTA.......-------------------------------
A9KK54_CLOPH/37-201--------------------------------FIG-GS.ITQ.......-------------------------------
K0JVB8_SACES/62-239--------------------------------VLG-DS.MAA.......-------------------------------
R7FB09_9FIRM/6-191--------------------------------CFG-DS.NTW.......-------------------------------
D1B186_SULD5/43-196--------------------------------AFG-DS.LTL.......-------------------------------
M2UZE9_COCH5/10-222--------------------------------LLG-DS.ITQ.......-------------------------------
N1JLC8_BLUG1/21-196--------------------------------CFG-DS.LTE.......-------------------------------
R5JET5_9FIRM/100-320--------------------------------ALG-DS.LTH.......-------------------------------
A5E6K3_LODEL/8-219--------------------------------LFG-DS.ITQ.......-------------------------------
Q03D66_PEDPA/141-305--------------------------------FIG-DS.ITA.......-------------------------------
D2UC74_XANAP/13-194--------------------------------ALG-DS.YSI.......-------------------------------
V4IY07_9ACTN/384-578--------------------------------VLG-DS.ITE.......-------------------------------
R5QH07_9FIRM/8-208--------------------------------FLG-DS.ITE.......-------------------------------
F8QC87_SERL3/87-292--------------------------------LIG-DS.ISC.......-------------------------------
I0JI92_HALH3/207-394--------------------------------VIG-SS.IAN.......-------------------------------
Q1WRY6_LACS1/6-170--------------------------------LFG-DS.ITA.......-------------------------------
A9B0D3_HERA2/8-175--------------------------------CIG-DS.QTF.......-------------------------------
R7C524_9CLOT/6-191--------------------------------CYG-DS.NTH.......-------------------------------
G4U649_NEUT9/225-421--------------------------------IVG-DS.ITD.......-------------------------------
Q4A5V3_MYCS5/113-381--------------------------------ALG-DS.IAA.......-------------------------------
C5E1V3_ZYGRC/8-200--------------------------------MFG-DS.ITE......F-------------------------------
A3U4E6_CROAH/37-216--------------------------------ALG-DS.YTI.......-------------------------------
E6UHY0_RUMA7/43-275--------------------------------FLG-DS.IAA.......-------------------------------
I1JLE8_SOYBN/11-198--------------------------------LFG-SS.IVE.......-------------------------------
D7C0R4_STRBB/523-694--------------------------------FIG-DS.ITV.......-------------------------------
Q5WKP5_BACSK/26-209--------------------------------AIG-DS.LVT.......-------------------------------
E3J4T5_FRASU/61-294--------------------------------ALG-DS.YSS.......-------------------------------
G2Z5A6_FLABF/51-214--------------------------------FMG-DS.ITE.......-------------------------------
L0J5A7_MYCSM/7-181--------------------------------ALG-DS.FTE.......-------------------------------
D1A8A5_THECD/36-245--------------------------------AMG-DS.YSS.......-------------------------------
D3F514_CONWI/33-210--------------------------------VLG-DS.VAA.......-------------------------------
H5X671_9PSEU/34-273--------------------------------ALG-DS.YTS.......-------------------------------
K4IJV6_BIFAP/15-210--------------------------------CFG-DS.TTW.......-------------------------------
R6ZTW7_9FIRM/37-201--------------------------------FLG-GS.ITQ.......-------------------------------
Q5KZ32_GEOKA/49-238--------------------------------ALG-DS.LTE.......-------------------------------
B1XWT3_LEPCP/48-231--------------------------------VVG-DS.AAA.......-------------------------------
M9RH72_9RHOB/66-237--------------------------------ILG-DS.SAA.......-------------------------------
R7CS48_9FIRM/33-203--------------------------------CFG-DS.LTE.......-------------------------------
Q8Y638_LISMO/41-241--------------------------------AMG-DS.LTE.......-------------------------------
G0G4C2_AMYMS/9-181--------------------------------ALG-DS.FTE.......-------------------------------
Q21DI0_SACD2/47-242--------------------------------IVG-DS.ISA.......-------------------------------
D4JTJ1_9FIRM/124-289--------------------------------FIG-DS.ITT.......-------------------------------
R7NSU5_9FIRM/32-237--------------------------------VIG-DS.IAY.......-------------------------------
S8DZS0_FOMPI/85-290--------------------------------AIG-DS.ITA.......-------------------------------
R5B6L2_9CLOT/9-216--------------------------------IYG-DS.IMK.......-------------------------------
C1A9H7_GEMAT/28-191--------------------------------FLG-TS.LTA.......-------------------------------
M1P5I2_DESSD/53-214--------------------------------AVG-DS.LTA.......-------------------------------
R4LI70_9ACTN/160-332--------------------------------FVG-DS.ITA.......-------------------------------
D7AZC7_NOCDD/435-633--------------------------------AFG-DS.ITD.......-------------------------------
M1NQ10_9CORY/42-278--------------------------------AMG-DS.FPA.......-------------------------------
D3E8J1_GEOS4/76-273--------------------------------AIG-DS.LAK.......-------------------------------
C6XV53_PEDHD/54-229--------------------------------FHG-HS.VPT.......-------------------------------
T0JK18_COLGC/72-249--------------------------------ALG-AS.IVF.......-------------------------------
Q5NG41_FRATT/43-193--------------------------------AFG-DS.LTA.......-------------------------------
D9SXV4_MICAI/221-424--------------------------------VLG-DS.ISD.......-------------------------------
D0IXP8_COMT2/50-207--------------------------------ALG-DS.LTQ.......-------------------------------
G8S0V3_ACTS5/17-192--------------------------------VLG-DS.IAY.......-------------------------------
G8NYD6_GRAMM/53-214--------------------------------CFG-DS.LTA.......-------------------------------
M0SBH1_MUSAM/7-197--------------------------------LFG-DS.ITE.......-------------------------------
Q977Y6_CLOAB/158-350--------------------------------FIG-DS.ITC.......-------------------------------
U5LEA4_9BACI/5-218--------------------------------CFG-DS.LTR.......-------------------------------
C4XUC5_DESMR/100-277--------------------------------IVG-DS.FAV.......-------------------------------
R6XCS9_9PORP/32-243--------------------------------FIG-NS.ITQ.......-------------------------------
E8V6W2_TERSS/196-388--------------------------------TLG-DS.ITD.......-------------------------------
B1MBB4_MYCA9/7-244--------------------------------ALG-SS.MAA.......-------------------------------
I4DC15_DESAJ/821-1051--------------------------------SLG-DS.IAC.......-------------------------------
A0A088ABE4_APIME/112-301--------------------------------FAG-DS.LMQ.......-------------------------------
D1ARS6_SEBTE/79-246--------------------------------FIG-DS.ITE.......-------------------------------
C4Y266_CLAL4/10-202--------------------------------LFG-DS.ITE.......-------------------------------
C8WTT5_ALIAD/5-198--------------------------------ALG-DS.ITY.......-------------------------------
J4UX24_BEAB2/13-189--------------------------------CFG-DS.LTQ.......-------------------------------
G2RF40_THITE/219-412--------------------------------VVG-DS.ITD.......-------------------------------
R7FDT6_9FIRM/41-279--------------------------------AMG-DS.ITD.......-------------------------------
C7NJR7_KYTSD/36-206--------------------------------FVG-DG.SVS.......-------------------------------
R5PWA8_9FIRM/30-247--------------------------------IFG-DS.ITT.......-------------------------------
Q8Y8Y7_LISMO/61-248--------------------------------ALG-DS.LTY.......-------------------------------
H6MYJ2_GORPV/2-233--------------------------------ALG-SS.YAA.......-------------------------------
D5B9W5_ZUNPS/55-218--------------------------------FFG-TS.LTA.......-------------------------------
D7MSP9_ARALL/8-200--------------------------------LFG-DS.ITE.......-------------------------------
G8QV54_SPHPG/8-201--------------------------------ILG-DS.ISTF.....A-------------------------------
H6CB89_EXODN/83-280--------------------------------LFG-DS.ITQ.......-------------------------------
R5BHF6_9FIRM/12-184--------------------------------FIG-DS.LTR.......-------------------------------
R4KAJ0_CLOPA/5-177--------------------------------CIG-DS.LTY.......-------------------------------
A1R9P0_ARTAT/43-277--------------------------------ALG-DS.YTA.......-------------------------------
I3TMC9_TISMK/92-265--------------------------------AIG-SS.STQ.......-------------------------------
M1MWR4_9CLOT/40-203--------------------------------FLG-GS.ITQ.......-------------------------------
U7PNF6_SPOS1/10-232--------------------------------LFG-DS.LLQ.......-------------------------------
A1CMI9_ASPCL/9-179--------------------------------CFG-NS.LTA.......-------------------------------
R5AFJ6_9FIRM/8-200--------------------------------AFG-DS.LTY.......-------------------------------
A9WMI8_RENSM/43-217--------------------------------AMG-DS.FTE.......-------------------------------
A8J1E2_CHLRE/29-239--------------------------------LFG-DS.LTE.......-------------------------------
C5AYH8_METEA/19-260--------------------------------ALG-DS.LAY.......-------------------------------
B9DS11_STRU0/34-195--------------------------------FAG-DS.IIE.......-------------------------------
R7Y0Z2_9ACTN/69-247--------------------------------VLG-DS.IAA.......-------------------------------
B7KG25_CYAP7/24-214--------------------------------ALG-DS.LVY.......-------------------------------
R5JW71_9CLOT/118-285--------------------------------FIG-DS.RTE.......-------------------------------
G2P3G1_STRVO/12-183--------------------------------AVG-DS.FTE.......-------------------------------
I4ESS0_MODMB/71-247--------------------------------VLG-DS.SAV.......-------------------------------
G2LJ66_CHLTF/58-219--------------------------------VLG-DS.LTA.......-------------------------------
Q8A4H8_BACTN/25-198--------------------------------CVG-NS.ITE.......-------------------------------
W0EZI2_9SPHI/55-233--------------------------------FTG-DS.ITA.......-------------------------------
R5MPX6_9BACE/47-222--------------------------------FHG-HS.VPS.......-------------------------------
D5DJH7_BACMD/62-254--------------------------------AIG-DS.LTE.......-------------------------------
C6WW20_METML/34-196--------------------------------ALG-DS.LTY.......-------------------------------
D9QNG5_BRESC/186-375--------------------------------ALG-DS.ITE.......-------------------------------
J7IY22_DESMD/66-253--------------------------------ILG-DS.VAK.......-------------------------------
I0H330_ACTM4/6-182--------------------------------AIG-DS.FTE.......-------------------------------
A0A0C4DWB2_MAGP6/181-372--------------------------------IVG-DS.ISD.......-------------------------------
L0DCW1_SINAD/35-220--------------------------------LLG-DS.ITL.......-------------------------------
Q81JQ1_BACAN/60-248--------------------------------SLG-DS.LTR.......-------------------------------
R6L2K6_9FIRM/7-189--------------------------------CYG-DS.NTY.......-------------------------------
E2Q5Y8_STRC2/48-287--------------------------------SLG-DS.LAS.......-------------------------------
R5CCG2_9FIRM/189-363--------------------------------FIG-DS.RTD.......-------------------------------
W0J2A5_9BACT/77-251--------------------------------FLG-GS.ITAA.....N-------------------------------
R7YS62_CONA1/10-219--------------------------------LFG-DS.ITE.......-------------------------------
M1MR22_9CLOT/220-395--------------------------------YIG-GS.ITQ.......-------------------------------
G1XET3_ARTOA/217-415--------------------------------IVG-DS.ITD.......-------------------------------
E0RWQ1_BUTPB/139-308--------------------------------FLG-DS.RTVA....MV-------------------------------
C7PM41_CHIPD/32-222--------------------------------FVG-NS.ITE......A-------------------------------
D3IBV9_9BACT/28-205--------------------------------CVG-NS.ITF.......-------------------------------
A4VWX6_STRSY/62-269--------------------------------ALG-DS.LTE.......-------------------------------
R6TL15_9FIRM/5-201--------------------------------FLG-DS.ITQ.......-------------------------------
V6F7L3_9PROT/35-196--------------------------------ALG-DS.LTV.......-------------------------------
D0L3H8_GORB4/60-295--------------------------------SLG-SS.YAA.......-------------------------------
Q7V7G3_PROMM/10-197--------------------------------VIG-DS.GVY.......-------------------------------
X5EBR8_9CORY/45-280--------------------------------TFG-DS.FTA.......-------------------------------
R7QXV4_9FIRM/37-201--------------------------------FIG-GS.ITM.......-------------------------------
Q1DA77_MYXXD/212-426--------------------------------FVG-DS.VTC.......-------------------------------
Q1AUI1_RUBXD/35-225--------------------------------SLG-DS.LAV.......-------------------------------
A5I5D4_CLOBH/10-175--------------------------------FLG-GS.ITE.......-------------------------------
Q01S84_SOLUE/31-287--------------------------------ALG-DS.IPF.......-------------------------------
D6CZJ5_9BACE/168-330--------------------------------VYG-SS.ILQ.......-------------------------------
D3UGN5_HELM1/81-260--------------------------------LIG-DS.MMQ.......-------------------------------
D8LJK3_ECTSI/97-284--------------------------------VLG-GS.VTY.......-------------------------------
F2JR77_CELLD/23-187--------------------------------FLG-GS.ITQ.......-------------------------------
E1ZCH2_CHLVA/62-274--------------------------------LYG-DS.LAE.......-------------------------------
M4VED3_9DELT/39-200--------------------------------FLG-DS.LTE.......-------------------------------
R8BYB3_TOGMI/185-378--------------------------------IVG-DS.ITD.......-------------------------------
W6RHN6_9RHIZ/17-209--------------------------------VFG-DS.ITA.......-------------------------------
R6DQS4_9BACE/183-345--------------------------------VYG-SS.ILQ.......-------------------------------
G4TQV6_PIRID/222-418--------------------------------VVG-DS.ITD.......-------------------------------
H5WK90_9BURK/212-407--------------------------------AVG-DS.ITD.......-------------------------------
W0E9D7_9FIRM/58-245--------------------------------ILG-DS.IAK.......-------------------------------
R5PV31_9FIRM/180-339--------------------------------FYG-SS.ITQ.......-------------------------------
D5DHH7_BACMD/65-253--------------------------------ALG-DS.LTR.......-------------------------------
G8RTL2_MYCRN/61-232--------------------------------VMG-DD.YAS.......-------------------------------
W5WI34_9PSEU/17-193--------------------------------ALG-DS.LTE.......-------------------------------
R7MQT7_9FIRM/41-205--------------------------------FLG-DS.ITA.......-------------------------------
A5GVJ4_SYNR3/11-198--------------------------------ALG-DS.GVF.......-------------------------------
E8UXS9_TERSS/207-406--------------------------------TFG-DS.ITD.......-------------------------------
A0LCN0_MAGMM/6-177--------------------------------FVG-DR.FVA.......-------------------------------
Q0C8G8_ASPTN/29-216--------------------------------LAG-DS.TTA.......-------------------------------
K0JYN3_SACES/16-188--------------------------------VLG-DS.TTV.......-------------------------------
S3CLA2_OPHP1/10-232--------------------------------LFG-DS.LFQ.......-------------------------------
D5URZ7_TSUPD/38-213--------------------------------VVG-DS.FTA.......-------------------------------
E2SEE8_9ACTN/52-274--------------------------------ALG-DS.FTA.......-------------------------------
E1QVU1_OLSUV/197-360--------------------------------VLG-DS.IAQ.......-------------------------------
F0YK74_AURAN/169-368--------------------------------FVG-DS.ITA.......-------------------------------
W0J0T3_9BACT/49-239--------------------------------LVG-DS.TVC.......-------------------------------
Q11X58_CYTH3/164-372--------------------------------FIG-NS.ITC.......-------------------------------
L0IWL1_MYCSM/9-182--------------------------------AIG-DS.QTE.......-------------------------------
K9XBL6_9CHRO/101-294--------------------------------LLG-DS.ITH.......-------------------------------
S5RL76_9STRE/46-208--------------------------------FAG-DS.ITE.......-------------------------------
G0S779_CHATD/201-393--------------------------------ILG-DS.ITD.......-------------------------------
R6S4H2_9FIRM/11-202--------------------------------FAG-DS.VTD......M-------------------------------
F4PCR4_BATDJ/100-300--------------------------------IIG-DD.FAA.......-------------------------------
Q0VS26_ALCBS/88-261--------------------------------VVG-ES.TAA.......-------------------------------
E2SCC7_9ACTN/39-277--------------------------------AMG-DS.FSS.......-------------------------------
U1M2Z6_ASCSU/140-398--------------------------------AIG-DS.FAS.......-------------------------------
G9MUE7_HYPVG/6-203--------------------------------IIG-DS.LTE.......-------------------------------
W5TJM1_9NOCA/42-271--------------------------------AIG-DS.YIA......T-------------------------------
R5HMY0_9FIRM/7-196--------------------------------CIG-DS.NTW.......-------------------------------
B9SQ29_RICCO/11-195--------------------------------LFG-SS.IVQ.......-------------------------------
J7S4W9_KAZNA/10-194--------------------------------LFG-DS.ITE.......-------------------------------
D2B037_STRRD/82-260--------------------------------AVG-ES..TT.......-------------------------------
LIPC_BACLD/7-197--------------------------------ALG-DS.LTV.......-------------------------------
K9VPA6_9CYAN/82-311--------------------------------LLG-DS.VAN.......-------------------------------
U5RX39_9CLOT/5-180--------------------------------CIG-DS.LTA.......-------------------------------
C5BSD1_TERTT/883-1048--------------------------------MIG-DS.ITH.......-------------------------------
A3I2P8_9BACT/38-227--------------------------------FLG-NS.ITY.......-------------------------------
Q15Q96_PSEA6/48-274--------------------------------VFG-DS.LSD......T-------------------------------
D7B873_NOCDD/49-285--------------------------------SLG-DS.FVA.......-------------------------------
B1M205_METRJ/18-181--------------------------------FFG-DS.VTA.......-------------------------------
R4L459_9ACTN/11-196--------------------------------FIG-DS.ITD......C-------------------------------
B8IR64_METNO/59-220--------------------------------ALG-DS.LTA.......-------------------------------
D1A4M6_THECD/44-217--------------------------------MLG-DS.YTA.......-------------------------------
B7VT44_VIBTL/112-264--------------------------------MFG-DS.ITE.......-------------------------------
R7IHP6_9FIRM/169-362--------------------------------CYG-DS.ITA.......-------------------------------
B6QSJ8_PENMQ/7-195--------------------------------CFG-NS.LTA.......-------------------------------
Q0BTT4_GRABC/71-247--------------------------------FYG-DS.ITQ.......-------------------------------
S5TFU8_9CORY/39-277--------------------------------VFG-DS.VIA.......-------------------------------
U5LHY6_9BACI/37-223--------------------------------ALG-DS.LTY.......-------------------------------
F6IGQ3_9SPHN/59-301--------------------------------AIG-SS.YAA.......-------------------------------
C6D766_PAESJ/55-230--------------------------------FIG-GS.ITH.......-------------------------------
Q128U7_POLSJ/23-188--------------------------------IVG-DS.LSA.......-------------------------------
A8FFF8_BACP2/27-228--------------------------------AFG-DS.NTK.......-------------------------------
R5JVL3_9FIRM/199-367--------------------------------FIG-DS.RVE.......-------------------------------
C4Z845_EUBR3/318-505--------------------------------VIG-DS.YAS.......-------------------------------
A7HUI9_PARL1/82-267--------------------------------VLG-DS...........-------------------------------
V9XA96_9NOCA/22-236--------------------------------VIG-DS.LSY.......-------------------------------
F2JXL5_MARM1/6-193--------------------------------CYG-DS.LTW.......-------------------------------
F0Y861_AURAN/24-215--------------------------------CLG-DS.ITK.......-------------------------------
I3YMQ8_ALIFI/43-207--------------------------------FLG-NS.ITD.......-------------------------------
R6TKI3_9FIRM/67-257--------------------------------FTG-DS.ITD.......-------------------------------
D9SNT7_CLOC7/192-384--------------------------------FIG-DS.ITC.......-------------------------------
D4IYQ5_BUTFI/6-179--------------------------------LFG-DS.NTY.......-------------------------------
F4C1U8_SPHS2/54-215--------------------------------FLG-NS.ITA.......-------------------------------
M4EZC7_BRARP/11-198--------------------------------LFG-SS.IVQ.......-------------------------------
B8DQP4_DESVM/33-194--------------------------------VLG-DS.LVA.......-------------------------------
Q8PAG8_XANCP/290-467--------------------------------MIG-DS.ITH.......-------------------------------
Q24RD6_DESHY/72-226--------------------------------FIG-DS.LTE.......-------------------------------
E8NG61_MICTS/8-183--------------------------------AIG-DS.FTE.......-------------------------------
H6R6Z0_NOCCG/175-377--------------------------------AFG-DS.ITD.......-------------------------------
M2YIH9_DOTSN/82-270--------------------------------ALG-DS.ITA.......-------------------------------
W0EQU7_9PORP/53-218--------------------------------FIG-NS.ITA.......-------------------------------
W0EZ82_9SPHI/28-211--------------------------------FFG-DS.ITQ......Q-------------------------------
C1DDE2_LARHH/16-209--------------------------------FFG-DS.TCV.......-------------------------------
K9SYE0_9SYNE/72-251--------------------------------VLG-DS.TSV.......-------------------------------
R6AUR3_9FIRM/13-183--------------------------------CFG-DS.LTA.......-------------------------------
D3Q6I6_STANL/34-248--------------------------------ALG-DS.YAS.......-------------------------------
B2GKW8_KOCRD/3-177--------------------------------SIG-DS.FTE.......-------------------------------
A5FWG0_ACICJ/57-235--------------------------------WLG-DS.ITE.......-------------------------------
E6SCR0_INTC7/73-252--------------------------------VLG-DS.TGA.......-------------------------------
R7XTG0_9ACTN/60-210--------------------------------VIG-DS.WTV.......-------------------------------
Q7UYD1_RHOBA/70-245--------------------------------FHG-HS.VPA.......-------------------------------
R7NMQ0_9BACE/523-696--------------------------------LLG-NS.ITQ.......-------------------------------
S3DGQ2_GLAL2/30-213--------------------------------ALG-DS.ITGS.....P-------------------------------
H6RTH8_BLASD/10-184--------------------------------FFG-DS.LTA.......-------------------------------
W0F2D5_9SPHI/29-219--------------------------------TFG-NS.TTA.......-------------------------------
B2UQW3_AKKM8/129-304--------------------------------FIG-DS.ITHF....WG-------------------------------
F2F4U6_SOLSS/85-277--------------------------------ALG-DS.LTR.......-------------------------------
M7XM87_RHOT1/30-228--------------------------------MFG-DS.ITQ.......-------------------------------
Q1D3N6_MYXXD/182-352--------------------------------AIG-DS.ITE.......-------------------------------
R7G1X0_9PROT/10-205--------------------------------FLG-DS.ITQ.......-------------------------------
D8TLC4_VOLCA/28-233--------------------------------LFG-DS.LTE.......-------------------------------
F4CQN5_PSEUX/229-416--------------------------------LVG-DS.ITD.......-------------------------------
D1BPP2_VEIPT/5-170--------------------------------CFG-DS.ITR.......-------------------------------
Q1G7V0_LACDA/5-178--------------------------------LLG-DS.IFA......R-------------------------------
D9SWK7_CLOC7/43-206--------------------------------YLG-AS.ITE.......-------------------------------
H3G4Z4_PHYRM/7-200--------------------------------FTG-DS.ITE.......-------------------------------
D5VD77_MORCR/165-352--------------------------------FAG-DS.MMQ.......-------------------------------
F3ZRM4_9BACE/425-588--------------------------------FLG-DS.HIE.......-------------------------------
B2FTV1_STRMK/7-188--------------------------------ALG-DS.YTI.......-------------------------------
F4CEW5_SPHS2/42-235--------------------------------FLG-NS.ITY......G-------------------------------
F6DQC0_DESRL/38-192--------------------------------FMG-DS.ITE.......-------------------------------
F2KWZ0_PREDF/198-391--------------------------------ILG-NS.ITD.......-------------------------------
B0RD91_CLAMS/81-245--------------------------------MFG-DS.FIL.......-------------------------------
M2LUW8_BAUCO/247-443--------------------------------IVG-DS.ITD.......-------------------------------
D4IPK1_9BACT/47-210--------------------------------LMG-NS.ITE.......-------------------------------
E0UE35_CYAP2/82-295--------------------------------LVG-DS.LAN.......-------------------------------
K0F563_9NOCA/35-207--------------------------------VIG-DS.LSV.......-------------------------------
D2AQL6_STRRD/216-411--------------------------------AFG-DS.LTD.......-------------------------------
A0B5L6_METTP/22-192--------------------------------AFG-DS.ITA.......-------------------------------
W1QGK1_OGAPD/11-207--------------------------------LFG-DS.ITQ.......-------------------------------
D7B7I6_NOCDD/212-414--------------------------------ALG-DS.ITD.......-------------------------------
R6PIT1_9FIRM/9-197--------------------------------CFG-DS.NTY.......-------------------------------
K9WJ28_9CYAN/75-233--------------------------------FLG-DS.ITD.......-------------------------------
A0A068NM23_9BACT/41-216--------------------------------CHG-HS.VPA.......-------------------------------
D5DGY9_BACMD/72-229--------------------------------FLG-DS.ITQ.......-------------------------------
L0EBK8_THECK/11-202--------------------------------FIG-DS.ITD.......-------------------------------
G8SHF1_ACTS5/212-401--------------------------------IIG-DS.LTD.......-------------------------------
F4L672_HALH1/674-843--------------------------------FLG-GS.ITH.......-------------------------------
B8BV65_THAPS/8-209--------------------------------LFG-DS.ITQ.......-------------------------------
J7IV45_DESMD/5-167--------------------------------AIG-DS.ITE.......-------------------------------
R6YJ43_9CLOT/182-348--------------------------------FLG-DS.ITN.......-------------------------------
R6TR66_9FIRM/14-206--------------------------------FYG-DS.ITY.......-------------------------------
F3Z1W7_DESAF/11-172--------------------------------ALG-DS.LTA.......-------------------------------
Q7UMZ8_RHOBA/185-346--------------------------------CLG-DS.LTD.......-------------------------------
H3HE43_PHYRM/341-538--------------------------------LVG-DS.LTE.......-------------------------------
R5M4L7_9MOLU/65-231--------------------------------FIG-DS.ITD.......-------------------------------
U4LCB5_PYROM/8-204--------------------------------LFG-DS.LTE.......-------------------------------
D4K9Y7_9FIRM/21-212--------------------------------VAG-DS.IAY.......-------------------------------
D3RSH4_ALLVD/28-190--------------------------------VLG-DS.LSA.......-------------------------------
K9RFS6_9CYAN/8-182--------------------------------FVG-ES.HIN.......-------------------------------
R6TRC3_9STAP/11-192--------------------------------FLG-DC.ITG.......-------------------------------
D6Z9B1_SEGRD/46-286--------------------------------ALG-DS.FAA.......-------------------------------
F8EFQ5_RUNSL/32-224--------------------------------FQG-DS.ITD.......-------------------------------
Q2S860_HAHCH/15-195--------------------------------LVG-DS.IFD.......-------------------------------
R6TET1_9FIRM/9-216--------------------------------LLG-DS.ILK.......-------------------------------
R5U2Z5_9CLOT/7-200--------------------------------CYG-DS.NTH.......-------------------------------
A0A068NUF3_9BACT/63-234--------------------------------LVG-DS.ITH.......-------------------------------
V6L0F8_STRRC/201-383--------------------------------AFG-DS.LTD.......-------------------------------
C7ZB38_NECH7/10-215--------------------------------LFG-DS.LLQ.......-------------------------------
A0A068NT01_9BACT/58-229--------------------------------MIG-DS.ITQ.......-------------------------------
D0MRI1_PHYIT/69-266--------------------------------LAG-DS.LTE.......-------------------------------
B2IGP8_BEII9/56-227--------------------------------AIG-SS.ASS.......-------------------------------
E1V8Y0_HALED/214-409--------------------------------AFG-DS.ITD.......-------------------------------
U5VZI7_9ACTN/176-359--------------------------------ALG-DS.ITGS.....P-------------------------------
C6WMZ3_ACTMD/152-321--------------------------------FIG-DS.ITV.......-------------------------------
C6WAW0_ACTMD/28-211--------------------------------ALG-DS.IT........-------------------------------
K9XRJ0_STAC7/56-208--------------------------------VFG-DS.ITA.......-------------------------------
B3QTC5_CHLT3/38-201--------------------------------FFG-NS.ITA.......-------------------------------
R6SZ18_9FIRM/34-198--------------------------------YLG-GS.ITM.......-------------------------------
Q9HXP4_PSEAE/58-229--------------------------------LFG-ES.TVA.......-------------------------------
Q3XYR5_ENTFC/7-197--------------------------------FIG-DS.ITD......A-------------------------------
R4T3K4_AMYOR/31-207--------------------------------VLG-DS.TAV.......-------------------------------
Q9CI67_LACLA/61-273--------------------------------ALG-DS.LTE.......-------------------------------
F9D3P4_PREDD/208-404--------------------------------ILG-NS.ITD.......-------------------------------
L0DFM0_SINAD/189-389--------------------------------FFG-DS.ILG.......-------------------------------
Q896W5_CLOTE/5-178--------------------------------CIG-DS.ITF.......-------------------------------
F8JNS4_STREN/225-411--------------------------------ALG-DS.ITD.......-------------------------------
W0EXI5_9PORP/22-180--------------------------------FVG-DS.LVA.......-------------------------------
R4T4K1_AMYOR/209-394--------------------------------TFG-DS.ITD.......-------------------------------
B8NBN0_ASPFN/17-222--------------------------------LFG-DS.ITQ.......-------------------------------
J3NRB8_GAGT3/45-230--------------------------------ALG-AS.ITY.......-------------------------------
F8ELT2_RUNSL/47-238--------------------------------FIG-NS.ITY......G-------------------------------
G0G3V8_AMYMS/32-270--------------------------------ALG-DS.AAA.......-------------------------------
I4DBB4_DESAJ/52-218--------------------------------ILG-DS.IAV.......-------------------------------
X5DV85_9BACT/48-227--------------------------------ALG-DS.YTI.......-------------------------------
J7SJM3_MORMO/177-372--------------------------------VIG-DS.MVD.......-------------------------------
Q0JY79_CUPNH/212-408--------------------------------AIG-DS.ITE.......-------------------------------
R6RJJ3_9FIRM/37-217--------------------------------CVG-DS.ITY.......-------------------------------
R5WGA5_9CLOT/41-248--------------------------------ALG-DS.ICR.......-------------------------------
E1ZFS5_CHLVA/124-330--------------------------------TLG-GS.VTK.......-------------------------------
R7FDY7_9FIRM/178-371--------------------------------CFG-DS.ITA.......-------------------------------
E1VYY3_ARTAR/2-175--------------------------------ALG-DS.FTE.......-------------------------------
H6NGP4_9BACL/65-253--------------------------------ALG-DS.LTR.......-------------------------------
T0JKW9_COLGC/10-226--------------------------------LFG-DS.LFQ.......-------------------------------
E8NDF4_MICTS/61-224--------------------------------TVG-DS.LMS.......-------------------------------
G1XRV7_ARTOA/69-246--------------------------------FIG-DS.MLE.......-------------------------------
W0IYI0_9BACT/178-371--------------------------------VLG-DS.IST.......-------------------------------
A9WTS0_RENSM/9-183--------------------------------ALG-DS.FTE.......-------------------------------
D2U9P1_XANAP/8-173--------------------------------FYG-DS.ITD.......-------------------------------
Q01ZF8_SOLUE/79-242--------------------------------FMG-DS.ITD.......-------------------------------
S8FBV4_FOMPI/11-210--------------------------------LIG-DS.ITQ.......-------------------------------
E6TTI1_BACCJ/8-196--------------------------------ALG-DS.LTV.......-------------------------------
F6ELE1_AMYSD/184-385--------------------------------AFG-DS.ITD.......-------------------------------
V9XHS4_9NOCA/38-275--------------------------------ALG-DS.RAA.......-------------------------------
C4XUC6_DESMR/167-355--------------------------------VVG-DS.LAI.......-------------------------------
G8ZT92_TORDC/8-198--------------------------------LFG-DS.ITE......F-------------------------------
R5V9J5_9FIRM/184-349--------------------------------VYG-TS.ITQ.......-------------------------------
L0DQ13_SINAD/145-355--------------------------------FVG-DS.IGA.......-------------------------------
D7SHQ7_VITVI/7-199--------------------------------LFG-DS.ITE.......-------------------------------
C7QJH0_CATAD/16-190--------------------------------SVG-DS.FTE.......-------------------------------
A9F9E9_SORC5/53-230--------------------------------ALG-DS.FTA.......-------------------------------
F9VBT4_LACGL/53-261--------------------------------ALG-DS.LTE.......-------------------------------
D2SC17_GEOOG/46-294--------------------------------ALG-SS.FAA.......-------------------------------
H6R4L3_NOCCG/12-204--------------------------------CYG-DS.NTF.......-------------------------------
B1ZU86_OPITP/72-243--------------------------------FVG-DS.IAR.......-------------------------------
G8TBC2_NIAKG/31-206--------------------------------CVG-NS.ITF.......-------------------------------
E1W079_ARTAR/7-183--------------------------------AIG-DS.FTE.......-------------------------------
W0IWB1_9BACT/47-219--------------------------------CAG-DG.LTS.......-------------------------------
Q825X9_STRAW/245-442--------------------------------VFG-DS.LVD.......-------------------------------
R6RVB6_9FIRM/22-210--------------------------------FLG-DS.ITE.......-------------------------------
F8EL35_RUNSL/142-329--------------------------------LIG-NS.FTQ.......-------------------------------
R7I2W2_9CLOT/6-194--------------------------------CFG-DS.NTY.......-------------------------------
R5SCZ7_9BACE/7-223--------------------------------SFG-DS.VMKGI...IT-------------------------------
C8XDX0_NAKMY/9-184--------------------------------FVG-DS.FVA.......-------------------------------
D2QGG8_SPILD/26-205--------------------------------FFG-DS.ITQ......A-------------------------------
C8W9U3_ATOPD/186-344--------------------------------VFG-DS.IAQ.......-------------------------------
D5UVA7_TSUPD/9-183--------------------------------AIG-DS.FTE.......-------------------------------
N0B1S0_9BACI/62-254--------------------------------LVG-DS.LTE.......-------------------------------
R6TA56_9FIRM/39-273--------------------------------VLG-DS.IAA.......-------------------------------
H6NLK8_9BACL/11-196--------------------------------FIG-DS.ITD......K-------------------------------
D9SQS3_CLOC7/207-373--------------------------------ILG-DS.ITA.......-------------------------------
K9UBE7_9CHRO/47-225--------------------------------FFG-SS.STV.......-------------------------------
R6PPW1_9BACT/194-387--------------------------------IIG-NS.ITD.......-------------------------------
E8NCY2_MICTS/84-261--------------------------------ALG-DS.ITD.......-------------------------------
E0S190_BUTPB/91-246--------------------------------VVG-DS.IGA.......-------------------------------
H1YA85_9SPHI/311-483--------------------------------MLG-NS.ITN.......-------------------------------
I3VS17_THESW/14-222--------------------------------VCG-DS.ISK.......-------------------------------
C7QAZ6_CATAD/33-274--------------------------------ALG-DS.YTA......V-------------------------------
F6B7I7_DESCC/118-294--------------------------------CLG-DS.ITY.......-------------------------------
R5RJI0_9FIRM/39-220--------------------------------CVG-DS.ITY.......-------------------------------
S3D6H9_GLAL2/226-423--------------------------------LIG-DS.ITD.......-------------------------------
G0FIF1_AMYMS/207-400--------------------------------ALG-DS.ITD.......-------------------------------
R5R0C2_9FIRM/39-207--------------------------------FYG-DS.ITE.......-------------------------------
G8S363_ACTS5/8-183--------------------------------AMG-DS.FTE.......-------------------------------
D8P8Y5_9BACT/70-235--------------------------------FIG-DS.ITQ.......-------------------------------
D4ZRN4_ARTPN/83-297--------------------------------LLG-DS.IAN.......-------------------------------
E3E7V0_PAEPS/81-275--------------------------------AIG-DS.LAK.......-------------------------------
D2Q1M6_KRIFD/42-286--------------------------------ALG-DS.YTS.......-------------------------------
L0DZM5_THIND/51-203--------------------------------AFG-DS.LTA.......-------------------------------
K5WAB2_PHACS/2-204--------------------------------LLG-DS.LTQ.......-------------------------------
E8NA60_MICTS/422-597--------------------------------ALG-DS.LTE.......-------------------------------
B9DUT2_STRU0/52-262--------------------------------AIG-DS.LTE.......-------------------------------
R7K8F0_9FIRM/61-222--------------------------------FVG-DS.ITD.......-------------------------------
C6D221_PAESJ/11-202--------------------------------MIG-DS.ITD.......-------------------------------
R5GT16_9FIRM/101-270--------------------------------FIG-DS.IAV.......-------------------------------
R7L7H8_9BACT/44-208--------------------------------LLG-DS.ITD.......-------------------------------
G2IPF8_9SPHN/199-400--------------------------------VLG-DS.ISD.......-------------------------------
A6VT95_MARMS/598-841--------------------------------IIG-DS.TAS.......-------------------------------
G8SAJ2_ACTS5/29-248--------------------------------ALG-DS.YAA.......-------------------------------
D0MG26_RHOM4/171-362--------------------------------TLG-NS.ITD.......-------------------------------
G4Q7A0_ACIIR/299-467--------------------------------TLG-DS.IYH.......-------------------------------
N0AVY9_9BACI/33-222--------------------------------ALG-DS.ITY.......-------------------------------
R6V823_9FIRM/6-190--------------------------------FLG-DS.ITD......A-------------------------------
L0DME4_SINAD/55-259--------------------------------FLG-DS.ITY......S-------------------------------
D4LAQ7_RUMC1/127-297--------------------------------FVG-DS.ITV.......-------------------------------
K1QNQ0_CRAGI/39-200--------------------------------FIG-DS.LIQ.......-------------------------------
F3YVV9_DESAF/5-180--------------------------------FIG-DS.LVL.......-------------------------------
R7C837_9CLOT/355-530--------------------------------YIG-GS.ITE.......-------------------------------
C1DC01_LARHH/5-181--------------------------------FFG-DS.FTH.......-------------------------------
C7MXV0_SACVD/37-254--------------------------------ALG-DS.YSS.......-------------------------------
C5CA01_MICLC/10-180--------------------------------AVG-DH.LLA.......-------------------------------
A0A0C4E6U9_MAGP6/10-189--------------------------------CLG-DS.LTA.......-------------------------------
G2TMF8_BACCO/50-242--------------------------------SIG-DS.LTE.......-------------------------------
Q15YL1_PSEA6/49-221--------------------------------IIG-DS.AAA.......-------------------------------
R5PFH0_9BACT/54-219--------------------------------FMG-NS.ITE.......-------------------------------
F7PG88_9EURY/160-324--------------------------------TYG-TS.ITE.......-------------------------------
R5CWS2_9BACT/198-383--------------------------------VLG-NS.ITD.......-------------------------------
C7PM89_CHIPD/42-221--------------------------------ALG-DS.YTI.......-------------------------------
R7HMG2_9BACT/46-208--------------------------------FLG-DS.QTN.......-------------------------------
I3YVQ5_AEQSU/35-215--------------------------------ALG-DS.YTI.......-------------------------------
C7QAL8_CATAD/12-198--------------------------------AFG-DS.LTK.......-------------------------------
F9YVE2_CAPCC/46-207--------------------------------FLG-NS.ITN.......-------------------------------
S5VAB4_STRCU/40-259--------------------------------ALG-DS.YSA.......-------------------------------
A0A016Q6L5_GIBZA/10-185--------------------------------CFG-DS.LTS.......-------------------------------
R6LIN1_9FIRM/5-193--------------------------------CFG-DS.NTY.......-------------------------------
R6CBN0_9CLOT/6-203--------------------------------CMG-DS.ITE.......-------------------------------
K0NF06_DESTT/39-189--------------------------------CFG-DS.LTY.......-------------------------------
H6NAM6_9BACL/69-264--------------------------------AIG-DS.LTA.......-------------------------------
K0F740_9NOCA/184-371--------------------------------AFG-DS.WFE.......-------------------------------
B3PIB1_CELJU/26-188--------------------------------FIG-DS.ITA.......-------------------------------
F9D671_PREDD/277-454--------------------------------CIG-NS.ITD.......-------------------------------
A4FQW5_SACEN/17-252--------------------------------ALG-DS.AAA.......-------------------------------
C1F1E1_ACIC5/207-404--------------------------------ALG-DS.ITD.......-------------------------------
K4D3V1_SOLLC/15-198--------------------------------LFG-SS.IVQ......L-------------------------------
R6NZ78_9FIRM/113-282--------------------------------FIG-DS.RTV.......-------------------------------
R6ZDG3_9CLOT/52-215--------------------------------FLG-DS.ITS.......-------------------------------
F6IIE7_9SPHN/9-173--------------------------------AFG-DS.LLA.......-------------------------------
D4K7J8_9FIRM/113-288--------------------------------FVG-DS.LTQ.......-------------------------------
I0H913_ACTM4/207-395--------------------------------LLG-DS.LTD.......-------------------------------
D5EI22_CORAD/39-232--------------------------------HIG-DS.ITH.......-------------------------------
V5UBD6_9BURK/209-405--------------------------------AIG-DS.ITD.......-------------------------------
R7L2X7_9FIRM/85-248--------------------------------YIG-GS.ITR.......-------------------------------
D7CMJ9_SYNLT/6-167--------------------------------CLG-DS.LTY.......-------------------------------
R7FXK7_9PROT/11-229--------------------------------FLG-DS.ITF.......-------------------------------
C6WQF9_ACTMD/45-280--------------------------------ALG-SS.FAA.......-------------------------------
K4IRB9_BIFAP/46-220--------------------------------VVG-DS.MAV.......-------------------------------
E2SF75_9ACTN/61-215--------------------------------VLG-DS.MAQ.......-------------------------------
Q3ID43_PSEHT/7-195--------------------------------CFG-DS.NTW.......-------------------------------
Q2JLM7_SYNJB/147-318--------------------------------ILG-SS.VAL.......-------------------------------
R7E8T9_9BACE/120-299--------------------------------YVG-DS.HIR.......-------------------------------
R5UZG2_9FIRM/6-192--------------------------------CFG-DS.NTY.......-------------------------------
D5UV22_TSUPD/80-259--------------------------------VFG-DS.TAA.......-------------------------------
H2JR61_STRHJ/34-271--------------------------------ALG-DS.YTS.......-------------------------------
U9TNM8_RHIID/101-284--------------------------------LFG-DN.LTA.......-------------------------------
G8NQY9_GRAMM/203-395--------------------------------TFG-DS.ITD.......-------------------------------
G4NCX4_MAGO7/11-185--------------------------------CFG-DS.LTS.......-------------------------------
Q3JBY8_NITOC/45-198--------------------------------AFG-DS.LTY.......-------------------------------
D1APC7_SEBTE/35-209--------------------------------FYG-DS.ITE.......-------------------------------
B1ZZ20_OPITP/203-397--------------------------------VVG-DS.ITD.......-------------------------------
B1ZRF4_OPITP/60-271--------------------------------IAG-DS.TAA.......-------------------------------
H6LIN8_ACEWD/13-219--------------------------------VFG-DS.IGK.......-------------------------------
R6RYZ5_9CLOT/54-282--------------------------------ALG-DS.ITR.......-------------------------------
E6WWL2_PSEUU/7-192--------------------------------ALG-DS.YTI.......-------------------------------
I4EW73_MODMB/6-248--------------------------------ALG-SS.FAA.......-------------------------------
H8KS67_SOLCM/30-212--------------------------------FFG-DS.ITQ......L-------------------------------
Q3SGZ1_THIDA/37-188--------------------------------AFG-DS.LTF.......-------------------------------
L0DBK1_SINAD/641-814--------------------------------CFG-DS.VTG.......-------------------------------
Q9A7G3_CAUCR/35-196--------------------------------VLG-DS.ITA.......-------------------------------
A1S8X6_SHEAM/32-183--------------------------------AFG-DS.LTF.......-------------------------------
E3HBW7_ILYPC/41-201--------------------------------CFG-DS.LTA.......-------------------------------
R6D7T5_9BACE/37-210--------------------------------CVG-NS.ITA.......-------------------------------
R6E9V5_9BACT/211-400--------------------------------IIG-NS.ITD.......-------------------------------
R7GLU6_9FIRM/5-165--------------------------------CYG-DS.NTY.......-------------------------------
E2Q2V2_STRC2/101-326--------------------------------AVG-DS.ITR.......-------------------------------
D7BYZ0_STRBB/7-190--------------------------------AIG-DS.FTE.......-------------------------------
G0L3B5_ZOBGA/44-240--------------------------------CFG-DS.ITF.......-------------------------------
F8QHB9_SERL3/156-349--------------------------------FIG-DS.LSA.......-------------------------------
D5BHE7_ZUNPS/221-411--------------------------------ILG-NS.ITD.......-------------------------------
B5HNT3_9ACTN/253-448--------------------------------AFG-DS.LTD.......-------------------------------
K9YKP4_CYASC/74-235--------------------------------FLG-DS.LTQ.......-------------------------------
F3ZT72_9BACE/50-214--------------------------------FIG-NS.ITE.......-------------------------------
C6WMZ2_ACTMD/150-318--------------------------------FVG-DS.ITA.......-------------------------------
Q8RDJ0_CALS4/10-218--------------------------------LAG-DS.ISR.......-------------------------------
R6CU74_9BACE/44-259--------------------------------FLG-DS.ITD.......-------------------------------
E1ZG79_CHLVA/58-212--------------------------------FLG-DS.ITE.......-------------------------------
R7PBV3_9BACT/15-192--------------------------------CVG-NS.ITY.......-------------------------------
Q5K8F3_CRYNJ/13-212--------------------------------LIG-DS.LTQ.......-------------------------------
C7R907_KANKD/39-190--------------------------------AFG-DS.LTE.......-------------------------------
A6Q4Y8_NITSB/4-201--------------------------------ALG-DC.NVK.......-------------------------------
R5UFU1_9BACE/33-252--------------------------------MIG-DS.TMA.......-------------------------------
B5HEJ4_STRPR/58-266--------------------------------AFG-DS.ITD.......-------------------------------
R6XI62_9BACT/47-212--------------------------------LFG-DS.ITE.......-------------------------------
B4RGH4_PHEZH/212-409--------------------------------TFG-DS.ITD.......-------------------------------
G7E8B7_MIXOS/54-272--------------------------------LFG-DS.ITQ.......-------------------------------
I0JSX5_HALH3/31-222--------------------------------AIG-DS.IPF.......-------------------------------
K9VEU6_9CYAN/67-260--------------------------------TVG-DS.ITE......A-------------------------------
R7KTB2_9FIRM/97-260--------------------------------VIG-GS.ITQ.......-------------------------------
G8UJ84_TANFA/28-205--------------------------------CVG-NS.VTY.......-------------------------------
D5SQT1_PLAL2/71-275--------------------------------FYG-DS.ITQ.......-------------------------------
E8RUM8_ASTEC/207-403--------------------------------AFG-DS.ITD.......-------------------------------
B0SW94_CAUSK/234-427--------------------------------AFG-DS.ITD.......-------------------------------
H6LBV1_ACEWD/6-201--------------------------------IFG-DS.NTW.......-------------------------------
B8FJ19_DESAA/45-273--------------------------------VLG-DS.FTE.......-------------------------------
H5X006_9PSEU/9-181--------------------------------AIG-DS.FTE.......-------------------------------
F0Y3N1_AURAN/25-203--------------------------------CAG-DS.ITA.......-------------------------------
F0R7Z2_BACSH/52-267--------------------------------FLG-DS.ITD.......-------------------------------
G8UQE7_TANFA/401-564--------------------------------IMG-NS.ITH.......-------------------------------
R8BU19_TOGMI/22-237--------------------------------LFG-DS.LFQ.......-------------------------------
A4X7S7_SALTO/237-438--------------------------------VFG-DS.IAD.......-------------------------------
C7PZ23_CATAD/76-258--------------------------------VLG-DS.SAA.......-------------------------------
U4LWA4_PYROM/131-377--------------------------------TFG-DS.YTD......T-------------------------------
C7NJL5_KYTSD/224-410--------------------------------AVG-ES.VTV.......-------------------------------
D2QIP1_SPILD/416-581--------------------------------FMG-NS.ITH.......-------------------------------
R6ZBU7_9FIRM/220-411--------------------------------CLG-DS.ITE.......-------------------------------
G2NPZ2_STREK/230-407--------------------------------FTG-DS.ITH.......-------------------------------
B2UL80_AKKM8/55-222--------------------------------FLG-DS.ITD.......-------------------------------
D9QH71_BRESC/81-267--------------------------------VFG-DS.MGD.......-------------------------------
B1M3V4_METRJ/7-172--------------------------------FVG-DS.ITEL.....W-------------------------------
M7SUI5_EUTLA/10-193--------------------------------CFG-DS.LTA.......-------------------------------
U5ML33_CLOSA/9-179--------------------------------FFG-DS.LTV.......-------------------------------
K9SBI9_9CYAN/84-304--------------------------------LLG-DS.IAN.......-------------------------------
R7BC63_9FIRM/205-376--------------------------------FIG-DS.RIE.......-------------------------------
I3ZD38_TERRK/237-427--------------------------------LLG-DS.ITD.......-------------------------------
V6F8X5_9PROT/9-181--------------------------------FFG-DS.FIN.......-------------------------------
I6XMY0_PROPF/10-186--------------------------------FAG-DS.ITD......T-------------------------------
W0ISM4_9BACT/151-323--------------------------------LLG-DS.ISA.......-------------------------------
A6KWZ2_BACV8/112-309--------------------------------HIG-DS.HVR.......-------------------------------
E8RV16_ASTEC/208-405--------------------------------ALG-DS.ITD.......-------------------------------
D4JRT2_9FIRM/122-286--------------------------------FIG-GS.ITQ.......-------------------------------
R6VWP7_9FIRM/105-284--------------------------------FCG-DS.ITY.......-------------------------------
W0J500_9BACT/60-244--------------------------------YLG-GS.ITAA.....S-------------------------------
F2R8E8_STRVP/46-240--------------------------------VLG-DS..TA.......-------------------------------
B2ULS5_AKKM8/68-235--------------------------------FIG-DS.ITH.......-------------------------------
U5LHI2_9BACI/56-241--------------------------------ALG-DS.LTR.......-------------------------------
D6Y065_BACIE/81-269--------------------------------ALG-DS.LTR.......-------------------------------
A4RWW2_OSTLU/6-219--------------------------------LFG-DS.LTERSF.EDG-------------------------------
E8UX12_TERSS/71-232--------------------------------CFG-DS.LTA.......-------------------------------
L0IZT1_MYCSM/7-244--------------------------------ALG-SA.MAA.......-------------------------------
N4TW03_FUSC1/29-191--------------------------------VLG-DS.LFE.......-------------------------------
R5HTW8_9FIRM/69-252--------------------------------FVG-DS.VSVM....LE-------------------------------
B8DPD7_DESVM/9-194--------------------------------ALG-DS.LTE.......-------------------------------
F7E4T5_XENTR/18-204--------------------------------LFG-DS.ITQ.......-------------------------------
G3QAJ4_GASAC/44-204--------------------------------FIG-DS.MIQ.......-------------------------------
Q482D4_COLP3/194-365--------------------------------VMG-DS.ISH.......-------------------------------
A1SNE8_NOCSJ/72-224--------------------------------VIG-DS.WSA.......-------------------------------
V5GFN7_PSEBG/6-263--------------------------------SLG-SS.FAA.......-------------------------------
D5A2C4_ARTPN/62-249--------------------------------VVG-DS.ITQ......A-------------------------------
D7FM38_ECTSI/53-240--------------------------------CFG-DS.LTQ......F-------------------------------
E4T286_PALPW/221-411--------------------------------ILG-NS.IAD.......-------------------------------
A0A068NP31_9BACT/31-219--------------------------------FYG-DS.ITD.......-------------------------------
R5HSH6_9FIRM/6-191--------------------------------CFG-DS.ITD......C-------------------------------
I4F3A0_MODMB/3-165--------------------------------FLG-DS.YTV.......-------------------------------
R7R963_9FIRM/96-280--------------------------------FVG-DS.LTV.......-------------------------------
A5GLS9_SYNPW/9-196--------------------------------VIG-DS.GVV.......-------------------------------
R5ZSR5_9BACT/27-204--------------------------------CVG-NS.VTF.......-------------------------------
U5LEB3_9BACI/12-202--------------------------------AVG-DS.ITA.......-------------------------------
I4D6J4_DESAJ/67-254--------------------------------ILG-DS.IAK.......-------------------------------
I0HJK1_ACTM4/61-238--------------------------------ILG-DS.FAA.......-------------------------------
C7NLH5_KYTSD/41-233--------------------------------AIG-DS.FTE.......-------------------------------
H2YVJ4_CIOSA/9-197--------------------------------LFG-DS.LTQ......F-------------------------------
E0S1T9_BUTPB/6-194--------------------------------AFG-DS.NTW.......-------------------------------
D6D0F6_9BACE/180-341--------------------------------FFG-SS.FTQ.......-------------------------------
D2PZ80_KRIFD/167-334--------------------------------FYG-DS.ITQ.......-------------------------------
R7D434_9ACTN/6-204--------------------------------FFG-DS.NTY.......-------------------------------
W5VY75_9PSEU/9-181--------------------------------AIG-DS.FTE.......-------------------------------
Q026I9_SOLUE/144-335--------------------------------ALG-DS.ITD.......-------------------------------
D2R5K2_PIRSD/56-220--------------------------------LIG-DS.ISI.......-------------------------------
R5EZB3_9CLOT/164-328--------------------------------VYG-SS.ITH.......-------------------------------
G4TPN4_PIRID/142-334--------------------------------FIG-DS.LSA.......-------------------------------
M4RGN9_9BIFI/43-217--------------------------------AVG-DS.MIA.......-------------------------------
K9YIS9_CYASC/82-298--------------------------------LLG-DS.IVN.......-------------------------------
R7BE44_9FIRM/49-226--------------------------------CVG-DS.ITY.......-------------------------------
D4JYD0_9FIRM/112-285--------------------------------FLG-DS.LTQ.......-------------------------------
A1U2I7_MARHV/52-225--------------------------------VIG-ES.TAA.......-------------------------------
F9ULR4_LACPL/132-315--------------------------------VIG-DS.VAA.......-------------------------------
R6WF41_9FIRM/426-590--------------------------------MLG-DS.ITE.......-------------------------------
R5KWS5_9BACT/186-371--------------------------------VIG-NS.ITD.......-------------------------------
R6MJG2_9FIRM/38-237--------------------------------FIG-DS.ISY.......-------------------------------
I0H537_ACTM4/30-201--------------------------------VFG-DS.LSL.......-------------------------------
U5LEW5_9BACI/55-247--------------------------------SVG-DS.LTE.......-------------------------------
K5W9N6_PHACS/11-202--------------------------------LLG-DS.ITE.......-------------------------------
R5NF46_9BACT/298-473--------------------------------CVG-NS.ITD.......-------------------------------
N4VB34_COLOR/219-412--------------------------------VVG-DS.ISD.......-------------------------------
B2AV39_PODAN/51-239--------------------------------LIG-DS.MIERML.TTA-------------------------------
G0FLK0_AMYMS/13-188--------------------------------VLG-DS.LAA.......-------------------------------
R5SUL3_9CLOT/30-214--------------------------------TLG-DS.LSK.......-------------------------------
Q5WLH6_BACSK/7-176--------------------------------CFG-DS.ITA.......-------------------------------
Q21HS2_SACD2/892-1057--------------------------------MIG-DS.ITH.......-------------------------------
R4TAL2_AMYOR/210-393--------------------------------AIG-DS.ITD.......-------------------------------
G8RSA8_MYCRN/9-182--------------------------------AIG-DS.QTE.......-------------------------------
E4XM23_OIKDI/8-191--------------------------------CLG-DS.ITQ......Q-------------------------------
G0J5D5_CYCMS/91-275--------------------------------LIG-NS.ITHF.....W-------------------------------
B5I5M7_9ACTN/11-184--------------------------------ALG-DS.HTE.......-------------------------------
K0R8S4_THAOC/39-228--------------------------------CAG-DS.NTN......K-------------------------------
C7ZQC4_NECH7/200-387--------------------------------LLG-DS.ITD.......-------------------------------
E3IWT2_FRASU/5-181--------------------------------ALG-DS.FTE.......-------------------------------
R6EWN4_9BACT/196-378--------------------------------CLG-NS.ITD.......-------------------------------
L0J8J4_MYCSM/36-198--------------------------------FLG-DS.YTA.......-------------------------------
R5B674_9CLOT/6-196--------------------------------CYG-DS.NTW.......-------------------------------
C1F7Y4_ACIC5/203-398--------------------------------AFG-DS.ITD.......-------------------------------
I1M034_SOYBN/7-201--------------------------------LFG-DS.ITQ.......-------------------------------
U5VYD0_9ACTN/246-502--------------------------------ALG-DS.FSS.......-------------------------------
D2VPA0_NAEGR/184-377--------------------------------FIG-DS.ITCKP...PC-------------------------------
W0A6S8_9SPHN/211-403--------------------------------ALG-DS.ITD.......-------------------------------
Q2S0H3_SALRD/389-553--------------------------------VLG-NS.IAA.......-------------------------------
I4DBQ8_DESAJ/64-224--------------------------------ALG-DS.FTL.......-------------------------------
D7BMF1_ARCHD/25-193--------------------------------FIG-DE.LVA.......-------------------------------
B2FMY0_STRMK/197-393--------------------------------VIG-DS.ITD.......-------------------------------
C5MI95_CANTT/8-213--------------------------------LFG-DS.ITQF.....S-------------------------------
H6LGP1_ACEWD/5-176--------------------------------CLG-DS.LTF.......-------------------------------
R7L7H6_9CLOT/90-266--------------------------------FIG-DS.RTV.......-------------------------------
A9FSD2_SORC5/241-433--------------------------------TLG-DS.ITD.......-------------------------------
R7H8W5_9FIRM/6-194--------------------------------CFG-DS.NTY.......-------------------------------
C1F1E2_ACIC5/217-415--------------------------------AFG-DS.ITD.......-------------------------------
R1GXC4_BOTPV/10-212--------------------------------LFG-DS.ITQ.......-------------------------------
R7C5Q6_9CLOT/40-247--------------------------------ALG-DS.IAY.......-------------------------------
R5HIJ0_9FIRM/274-454--------------------------------FIG-DS..IS.......-------------------------------
Q24SF9_DESHY/58-218--------------------------------AIG-DS.FTF.......-------------------------------
Q7UPK6_RHOBA/125-364--------------------------------VIG-DS.CSF.......-------------------------------
R7FW59_9FIRM/107-263--------------------------------ILG-DS.ITQ.......-------------------------------
D6DLD3_CLOSC/6-185--------------------------------CFG-DS.NTY.......-------------------------------
A6L2S7_BACV8/309-488--------------------------------IIG-DS.YVK.......-------------------------------
A0K069_ARTS2/5-197--------------------------------LAG-DS.TVA.......-------------------------------
R4KGW4_9FIRM/7-182--------------------------------CLG-DS.ITF.......-------------------------------
C6CUK6_PAESJ/42-214--------------------------------FVG-DS.ITH.......-------------------------------
D5WQL7_KYRT2/10-193--------------------------------ALG-DS.ITA.......-------------------------------
Q5HMH9_STAEQ/313-501--------------------------------FIG-DS.ITE.......-------------------------------
W5WJN0_9PSEU/34-249--------------------------------ALG-DS.YAS.......-------------------------------
N1PRM3_DOTSN/13-227--------------------------------LFG-DS.ITQ.......-------------------------------
R6LLM9_9FIRM/11-202--------------------------------FAG-DS.VTD......M-------------------------------
C1N3W6_MICPC/12-210--------------------------------IFG-DS.LTQ.......-------------------------------
Q7US11_RHOBA/99-286--------------------------------VVG-DS.ITQ.......-------------------------------
A1K7D5_AZOSB/34-191--------------------------------AFG-DS.VTW.......-------------------------------
K4IHM2_PSYTT/14-194--------------------------------ALG-DS.YSI.......-------------------------------
Q026K7_SOLUE/83-246--------------------------------FMG-DS.ITD.......-------------------------------
G4NFX8_MAGO7/80-245--------------------------------CAG-DS.ITV.......-------------------------------
H6LIA9_ACEWD/61-245--------------------------------VLG-DS.IGY.......-------------------------------
C9ZBE8_STRSW/347-534--------------------------------AIG-DS.ITD.......-------------------------------
R7L9V8_9BACT/46-260--------------------------------FLG-DS.ITD.......-------------------------------
R4LL64_9ACTN/175-355--------------------------------ALG-DS.ITGS.....P-------------------------------
Q11WA7_CYTH3/37-215--------------------------------ALG-DS.YTI.......-------------------------------
B2ULI0_AKKM8/65-236--------------------------------MIG-DS.ITH.......-------------------------------
A5VJU1_LACRD/6-187--------------------------------AFG-DS.IFA.......-------------------------------
C0ZSP2_RHOE4/41-281--------------------------------ALG-DS.AAA.......-------------------------------
R5C084_9FIRM/6-190--------------------------------CLG-DS.LTD......C-------------------------------
D2R5J9_PIRSD/329-531--------------------------------FFG-DS.ITWQ.....D-------------------------------
C6VTV7_DYAFD/307-476--------------------------------FLG-GS.ITH.......-------------------------------
W8KUA7_HALHR/42-194--------------------------------AFG-DS.LTY.......-------------------------------
I6ZPV1_MELRP/57-221--------------------------------FLG-NS.LTA.......-------------------------------
R6FU80_9CLOT/6-177--------------------------------FLG-DS.LTF.......-------------------------------
A7RN27_NEMVE/410-598--------------------------------SFG-DS.LTA.......-------------------------------
E6VQW5_DESAO/9-170--------------------------------CFG-DS.LTE.......-------------------------------
A1SQA2_NOCSJ/51-289--------------------------------ALG-DS.YTA.......-------------------------------
K4QTH4_9ACTN/381-574--------------------------------LLG-DS.ITD.......-------------------------------
E3J726_FRASU/31-259--------------------------------AMG-SS.FAA.......-------------------------------
Q75BS0_ASHGO/8-198--------------------------------MFG-DS.ITEF....AF-------------------------------
Q5YZU8_NOCFA/41-300--------------------------------VLG-DS.FTA......N-------------------------------
A8LEU2_FRASN/146-313--------------------------------AYG-DS.IVE.......-------------------------------
U5RZI1_9CLOT/68-258--------------------------------VMG-DS.LAR.......-------------------------------
E0U859_CYAP2/24-214--------------------------------AIG-DS.LIY.......-------------------------------
E1RCI1_SPISS/6-194--------------------------------CYG-DS.NTW.......-------------------------------
B2UMX7_AKKM8/63-230--------------------------------FVG-DS.ITE.......-------------------------------
R5Y3G7_9BACE/28-201--------------------------------CIG-NS.ITY.......-------------------------------
B2UNI1_AKKM8/29-223--------------------------------CVG-DS.ITF.......-------------------------------
C0ZNQ8_RHOE4/49-286--------------------------------ALG-DS.RAS.......-------------------------------
R5VJB4_9FIRM/42-279--------------------------------VLG-DS.IST.......-------------------------------
W8EV81_9BACT/28-220--------------------------------LVG-DS.TMS.......-------------------------------
C0Q8S6_DESAH/50-221--------------------------------ILG-DS.AAA.......-------------------------------
K9FYE8_PEND2/21-226--------------------------------LFG-DS.ITQ......M-------------------------------
W0J2U2_9BACT/150-343--------------------------------VIG-DS.ISC.......-------------------------------
B0CGA4_ACAM1/255-419--------------------------------FLG-DS.ITR.......-------------------------------
R5IGK7_9BACT/37-235--------------------------------LIG-DS.TMA......P-------------------------------
B0RDH5_CLAMS/19-179--------------------------------LLG-DS.LTG.......-------------------------------
D4LED5_RUMC1/79-242--------------------------------FIG-GS.ITE.......-------------------------------
H6N001_GORPV/2-177--------------------------------AVG-DS.FTE.......-------------------------------
Q8EM12_OCEIH/105-297--------------------------------AVG-DS.LTQ.......-------------------------------
A6L8L4_PARD8/57-246--------------------------------FVG-NS.ITC.......-------------------------------
Q3A7F4_PELCD/44-195--------------------------------AFG-DS.ITA.......-------------------------------
D1C8L4_SPHTD/42-242--------------------------------ALG-DS.IAA.......-------------------------------
F0LZR5_VIBFN/587-830--------------------------------IVG-DS.TAS.......-------------------------------
R5VCX5_9FIRM/31-199--------------------------------FVG-DS.ITQ.......-------------------------------
D7AYJ1_NOCDD/17-190--------------------------------SVG-DS.FTE.......-------------------------------
K9RC41_9CYAN/83-304--------------------------------LLG-DS.IAN.......-------------------------------
C9YU70_STRSW/227-421--------------------------------VLG-DS.LTD.......-------------------------------
D7DVG6_NOSA0/78-294--------------------------------LLG-DS.IAN...