Sequence alignment for CL0264

PF00657

O04702_DAUCA/33-364--------------------------------------------------------------------------------
Q39308_BRANA/36-320--------------------------------------------------------------------------------
AOAH_HUMAN/257-543--------------------------------------------------------------------------------
GDL49_ARATH/37-365--------------------------------------------------------------------------------
Q9A6E2_CAUCR/200-399--------------------------------------------------------------------------------
F0K6Q8_CLOAE/64-257--------------------------------------------------------------------------------
A5FND2_FLAJ1/74-458--------------------------------------------------------------------------------
A0A030Y1E2_PSEAI/215-418--------------------------------------------------------------------------------
D4FZ14_BACNB/25-235--------------------------------------------------------------------------------
D4FXT7_BACNB/43-243--------------------------------------------------------------------------------
D6EFV3_STRLI/66-296--------------------------------------------------------------------------------
Q9LHY3_ORYSJ/5-203--------------------------------------------------------------------------------
Q98E95_RHILO/55-223--------------------------------------------------------------------------------
H0H5K0_RHIRD/5-204--------------------------------------------------------------------------------
RHA1_ASPAC/20-225--------------------------------------------------------------------------------
Q40317_MEDSA/37-362--------------------------------------------------------------------------------
Q9KZR1_STRCO/239-441--------------------------------------------------------------------------------
A6ZNX3_YEAS7/6-203--------------------------------------------------------------------------------
APG_ARATH/205-524--------------------------------------------------------------------------------
GDL88_ARATH/5-204--------------------------------------------------------------------------------
B8ZUH2_MYCLB/42-222--------------------------------------------------------------------------------
F0KA74_CLOAE/3-182--------------------------------------------------------------------------------
Q9XIY6_ORYSJ/32-357--------------------------------------------------------------------------------
F7URY0_SYNYG/103-399--------------------------------------------------------------------------------
L8ADB1_BACIU/5-198--------------------------------------------------------------------------------
GCAT_AERHY/28-322--------------------------------------------------------------------------------
APG_BRANA/126-441--------------------------------------------------------------------------------
GUNE_CLOTM/606-804--------------------------------------------------------------------------------
GDL20_ARATH/34-330--------------------------------------------------------------------------------
PLB1_RABIT/741-1015--------------------------------------------------------------------------------
O13496_NEOPA/166-382--------------------------------------------------------------------------------
D6ETP1_STRLI/75-262--------------------------------------------------------------------------------
GDL17_ARATH/35-352--------------------------------------------------------------------------------
GDL14_ARATH/33-344--------------------------------------------------------------------------------
ESM1_ARATH/37-340--------------------------------------------------------------------------------
GDL84_ARATH/6-205--------------------------------------------------------------------------------
IAH1_MOUSE/18-213--------------------------------------------------------------------------------
O30643_MYCHY/42-337--------------------------------------------------------------------------------
Q9AYM5_VIGUN/9-201--------------------------------------------------------------------------------
Q9AUZ9_ORYSJ/6-205--------------------------------------------------------------------------------
LIP4_ARATH/41-355--------------------------------------------------------------------------------
LIP1_PHOLU/28-343--------------------------------------------------------------------------------
PLB1_RABIT/394-668--------------------------------------------------------------------------------
E1CZP1_VIBPH/147-406--------------------------------------------------------------------------------
O05695_RHILE/46-219--------------------------------------------------------------------------------
Q9Y7C6_ASPTE/61-245--------------------------------------------------------------------------------
B8GZL4_CAUCN/136-332--------------------------------------------------------------------------------
GDL2_ARATH/38-352--------------------------------------------------------------------------------
E8V9H4_BACST/5-202--------------------------------------------------------------------------------
IAH1_SCHPO/40-217--------------------------------------------------------------------------------
A0A023YSK5_ECOLX/30-196--------------------------------------------------------------------------------
F7UR16_SYNYG/108-371--------------------------------------------------------------------------------
F7UTB4_SYNYG/22-217--------------------------------------------------------------------------------
Q98EU1_RHILO/215-418--------------------------------------------------------------------------------
GDL61_ARATH/35-364--------------------------------------------------------------------------------
D6EF39_STRLI/5-186--------------------------------------------------------------------------------
Q98FI8_RHILO/49-230--------------------------------------------------------------------------------
PLB1_RABIT/1097-1363--------------------------------------------------------------------------------
A0A011SWS0_VIBPH/23-192--------------------------------------------------------------------------------
D6ESA2_STRLI/10-188--------------------------------------------------------------------------------
F0KDL5_CLOAE/81-259--------------------------------------------------------------------------------
O82681_DIGLA/36-364--------------------------------------------------------------------------------
GDL51_ARATH/33-334--------------------------------------------------------------------------------
Q9N4P5_CAEEL/105-346--------------------------------------------------------------------------------
O13497_NEOPA/65-271--------------------------------------------------------------------------------
Q9RLB8_RUMFL/46-256--------------------------------------------------------------------------------

PF13472

A6CB21_9PLAN/150-378--------------------------------------------------------------------------------
D1PUP8_9BACT/35-254--------------------------------------------------------------------------------
B3ZRE8_BACCE/94-261--------------------------------------------------------------------------------
B3JF97_9BACE/27-230--------------------------------------------------------------------------------
D3I0Q9_9BACT/27-262--------------------------------------------------------------------------------
D9ST65_CLOC7/48-258--------------------------------------------------------------------------------
C9P7F5_VIBME/587-832--------------------------------------------------------------------------------
D0KJY6_PECWW/280-526--------------------------------------------------------------------------------
A6VT95_MARMS/597-842--------------------------------------------------------------------------------
C7PCM7_CHIPD/56-238--------------------------------------------------------------------------------
A0A015V9G1_BACFG/26-237--------------------------------------------------------------------------------
A0L6K4_MAGSM/99-344--------------------------------------------------------------------------------
A6CFV6_9PLAN/46-231--------------------------------------------------------------------------------
Q5WDC0_BACSK/80-245--------------------------------------------------------------------------------
B9XGI8_PEDPL/55-242--------------------------------------------------------------------------------
Q55JQ6_CRYNB/163-345--------------------------------------------------------------------------------
A0R4U0_MYCS2/44-205--------------------------------------------------------------------------------
A4AUT7_MARSH/28-205--------------------------------------------------------------------------------
A6DGK9_9BACT/47-216--------------------------------------------------------------------------------
A6DN56_9BACT/46-229--------------------------------------------------------------------------------
A6DFI9_9BACT/47-227--------------------------------------------------------------------------------
A6C0R7_9PLAN/137-294--------------------------------------------------------------------------------
B4DAN0_9BACT/47-221--------------------------------------------------------------------------------
C9RLP9_FIBSS/29-241--------------------------------------------------------------------------------
B8HEE5_ARTCA/19-203--------------------------------------------------------------------------------
D4P7Z6_9CAUD/47-228--------------------------------------------------------------------------------
Q26FJ0_FLABB/320-507--------------------------------------------------------------------------------
D4LAZ2_RUMC1/45-211--------------------------------------------------------------------------------
A6DGG0_9BACT/306-477--------------------------------------------------------------------------------
A6C1A5_9PLAN/64-235--------------------------------------------------------------------------------
C6VTV7_DYAFD/306-477--------------------------------------------------------------------------------
Q024D6_SOLUE/343-514--------------------------------------------------------------------------------
C6XTK4_PEDHD/89-262--------------------------------------------------------------------------------
A6CD84_9PLAN/59-238--------------------------------------------------------------------------------
B1QLA1_CLOBO/9-176--------------------------------------------------------------------------------
B1QZ80_CLOBU/39-204--------------------------------------------------------------------------------
D1PQR9_9FIRM/213-389--------------------------------------------------------------------------------
D4J178_BUTFI/214-387--------------------------------------------------------------------------------
C7GE42_9FIRM/218-391--------------------------------------------------------------------------------
C6D766_PAESJ/54-231--------------------------------------------------------------------------------
A4F260_9BACL/79-256--------------------------------------------------------------------------------
D4LBB7_RUMC1/90-255--------------------------------------------------------------------------------
B0MNZ3_9FIRM/121-287--------------------------------------------------------------------------------
A9KK54_CLOPH/36-202--------------------------------------------------------------------------------
A8SWK4_9FIRM/25-191--------------------------------------------------------------------------------
D4CMI8_9FIRM/24-190--------------------------------------------------------------------------------
D4JWU9_9FIRM/107-271--------------------------------------------------------------------------------
F1TIB6_9CLOT/41-206--------------------------------------------------------------------------------
D9SWK7_CLOC7/42-207--------------------------------------------------------------------------------
I8IAV0_ASPO3/31-220--------------------------------------------------------------------------------
Q9NET4_CAEEL/135-382--------------------------------------------------------------------------------
D4K132_9FIRM/101-367--------------------------------------------------------------------------------
C7NNZ0_HALUD/159-325--------------------------------------------------------------------------------
C7MWU0_SACVD/42-317--------------------------------------------------------------------------------
C6WNW7_ACTMD/46-324--------------------------------------------------------------------------------
Q2JSP6_SYNJA/145-318--------------------------------------------------------------------------------
B7K022_CYAP8/136-309--------------------------------------------------------------------------------
Q7NG29_GLOVI/223-396--------------------------------------------------------------------------------
C8WV25_ALIAD/4-203--------------------------------------------------------------------------------
A2SLH8_METPP/326-507--------------------------------------------------------------------------------
D1YEJ8_PROAA/217-485--------------------------------------------------------------------------------
D4H968_PROAS/4-269--------------------------------------------------------------------------------
C7QHD3_CATAD/44-286--------------------------------------------------------------------------------
D2SC17_GEOOG/45-295--------------------------------------------------------------------------------
B0R7G2_HALS3/8-179--------------------------------------------------------------------------------
C7Q7I2_CATAD/34-215--------------------------------------------------------------------------------
C5AYH8_METEA/18-261--------------------------------------------------------------------------------
C4LKI0_CORK4/42-288--------------------------------------------------------------------------------
C4LIB2_CORK4/93-341--------------------------------------------------------------------------------
C8NQ69_COREF/53-285--------------------------------------------------------------------------------
C6R8G3_9CORY/32-256--------------------------------------------------------------------------------
C2CL07_CORST/42-274--------------------------------------------------------------------------------
C0E4P4_9CORY/59-301--------------------------------------------------------------------------------
C7Q9F9_CATAD/192-424--------------------------------------------------------------------------------
C8NR28_COREF/64-307--------------------------------------------------------------------------------
Q4PCC7_USTMA/4-264--------------------------------------------------------------------------------
B0RD91_CLAMS/80-246--------------------------------------------------------------------------------
D0WS14_9ACTO/82-334--------------------------------------------------------------------------------
Q2J4R6_FRASC/58-292--------------------------------------------------------------------------------
Q2JGN4_FRASC/87-354--------------------------------------------------------------------------------
D3Q6I6_STANL/33-249--------------------------------------------------------------------------------
C6WBG5_ACTMD/46-260--------------------------------------------------------------------------------
C7Q4A1_CATAD/38-331--------------------------------------------------------------------------------
C6WEE8_ACTMD/40-312--------------------------------------------------------------------------------
Q59837_9ACTO/42-313--------------------------------------------------------------------------------
B0RDF3_CLAMS/61-325--------------------------------------------------------------------------------
E3J726_FRASU/30-260--------------------------------------------------------------------------------
D0L3H8_GORB4/59-296--------------------------------------------------------------------------------
Q2G7C8_NOVAD/37-269--------------------------------------------------------------------------------
B1MBB4_MYCA9/6-245--------------------------------------------------------------------------------
A0A049DM81_MYCTX/5-247--------------------------------------------------------------------------------
Q1BEL5_MYCSS/5-240--------------------------------------------------------------------------------
C8X8C1_NAKMY/4-247--------------------------------------------------------------------------------
D5UYZ9_TSUPD/8-250--------------------------------------------------------------------------------
C3JHG1_RHOER/48-287--------------------------------------------------------------------------------
I0WS61_9NOCA/25-264--------------------------------------------------------------------------------
Q0SDG5_RHOSR/112-351--------------------------------------------------------------------------------
Q5YWR3_NOCFA/42-272--------------------------------------------------------------------------------
C7MPN1_SACVD/36-282--------------------------------------------------------------------------------
A3KIR8_STRAM/40-281--------------------------------------------------------------------------------
A4FQW5_SACEN/16-253--------------------------------------------------------------------------------
C7Q6B9_CATAD/40-284--------------------------------------------------------------------------------
C6WQR1_ACTMD/40-279--------------------------------------------------------------------------------
A0ACN1_STRAM/56-294--------------------------------------------------------------------------------
B5GK11_STRSH/58-296--------------------------------------------------------------------------------
E8RZ59_MICSL/43-287--------------------------------------------------------------------------------
D3Q5A1_STANL/36-280--------------------------------------------------------------------------------
D7B873_NOCDD/48-286--------------------------------------------------------------------------------
C7QAZ6_CATAD/32-275--------------------------------------------------------------------------------
C6W714_DYAFD/85-374--------------------------------------------------------------------------------
D6SU72_9DELT/52-277--------------------------------------------------------------------------------
B7FQA7_PHATC/284-494--------------------------------------------------------------------------------
Q7UHB8_RHOBA/116-390--------------------------------------------------------------------------------
A3IGT7_9CHRO/5-189--------------------------------------------------------------------------------
A9W7C8_METEP/41-224--------------------------------------------------------------------------------
D2VPA0_NAEGR/183-378--------------------------------------------------------------------------------
A0A059FZA4_9RHOB/45-228--------------------------------------------------------------------------------
A0M4R3_GRAFK/29-191--------------------------------------------------------------------------------
A1ZSQ7_9BACT/37-218--------------------------------------------------------------------------------
C7N6X3_SLAHD/4-173--------------------------------------------------------------------------------
B0PGN9_9FIRM/4-174--------------------------------------------------------------------------------
A6C7M7_9PLAN/118-270--------------------------------------------------------------------------------
A9DZV2_9RHOB/29-212--------------------------------------------------------------------------------
A3TT74_9RHOB/30-207--------------------------------------------------------------------------------
Q1GDU1_RUEST/29-214--------------------------------------------------------------------------------
A3X495_9RHOB/37-223--------------------------------------------------------------------------------
Q0FN89_PELBH/30-215--------------------------------------------------------------------------------
A3SQH4_9RHOB/29-214--------------------------------------------------------------------------------
B5JQV4_9BACT/5-178--------------------------------------------------------------------------------
Q98QP8_MYCPU/123-384--------------------------------------------------------------------------------
Q4A5V3_MYCS5/112-382--------------------------------------------------------------------------------
C5J6Z9_MYCCR/63-342--------------------------------------------------------------------------------
Q4A638_MYCS5/66-330--------------------------------------------------------------------------------
C7HER8_CLOTM/72-237--------------------------------------------------------------------------------
B1V222_CLOPF/89-252--------------------------------------------------------------------------------
C6JH48_9FIRM/175-357--------------------------------------------------------------------------------
C6JEJ0_9FIRM/144-325--------------------------------------------------------------------------------
C0CUW9_9CLOT/13-215--------------------------------------------------------------------------------
B6WR90_9DELT/11-187--------------------------------------------------------------------------------
A0LCN0_MAGSM/5-178--------------------------------------------------------------------------------
Q3I1P3_NOSCO/11-184--------------------------------------------------------------------------------
A6SVS4_JANMA/15-191--------------------------------------------------------------------------------
Q9WX72_KOMXY/391-555--------------------------------------------------------------------------------
C7NJR7_KYTSD/35-207--------------------------------------------------------------------------------
C6R448_9MICC/9-180--------------------------------------------------------------------------------
C7MDV1_BRAFD/19-197--------------------------------------------------------------------------------
C0VZX9_9ACTO/7-177--------------------------------------------------------------------------------
D0WRR1_9ACTO/4-174--------------------------------------------------------------------------------
C0W8N0_9ACTO/7-176--------------------------------------------------------------------------------
A7BEA0_9ACTO/4-180--------------------------------------------------------------------------------
B4VFY0_9ACTO/4-206--------------------------------------------------------------------------------
D6EIK2_STRLI/5-204--------------------------------------------------------------------------------
C9YTJ8_STRSW/23-224--------------------------------------------------------------------------------
D1JW12_9BACE/105-286--------------------------------------------------------------------------------
D4LCL4_RUMC1/194-360--------------------------------------------------------------------------------
A9ERQ8_SORC5/256-427--------------------------------------------------------------------------------
Q2IJI2_ANADE/216-377--------------------------------------------------------------------------------
C7CE49_METED/90-259--------------------------------------------------------------------------------
B1LYU8_METRJ/69-238--------------------------------------------------------------------------------
Q08RB4_STIAD/155-337--------------------------------------------------------------------------------
Q09AA0_STIAD/808-992--------------------------------------------------------------------------------
A1TPP3_ACIAC/38-217--------------------------------------------------------------------------------
D9QH72_BRESC/63-251--------------------------------------------------------------------------------
C1JGV8_OENOE/138-305--------------------------------------------------------------------------------
D2EH32_PEDAC/143-309--------------------------------------------------------------------------------
A3TNT3_9MICO/8-226--------------------------------------------------------------------------------
A1R9P0_ARTAT/42-278--------------------------------------------------------------------------------
A0K019_ARTS2/42-283--------------------------------------------------------------------------------
D5US67_TSUPD/127-286--------------------------------------------------------------------------------
A0R4U1_MYCS2/55-233--------------------------------------------------------------------------------
A1T9E0_MYCVP/41-214--------------------------------------------------------------------------------
A0A038FFY2_MYCTX/41-217--------------------------------------------------------------------------------
C0FVT0_9FIRM/128-299--------------------------------------------------------------------------------
A6NRB4_9FIRM/119-293--------------------------------------------------------------------------------
D4KZ95_9FIRM/94-264--------------------------------------------------------------------------------
C0D9S1_9CLOT/121-291--------------------------------------------------------------------------------
A8RNE1_CLOBW/141-311--------------------------------------------------------------------------------
A6BEQ0_9FIRM/72-271--------------------------------------------------------------------------------
A9W7Z7_METEP/562-744--------------------------------------------------------------------------------
C2L1C0_9FIRM/5-187--------------------------------------------------------------------------------
C3Q1I0_9BACE/291-472--------------------------------------------------------------------------------
D1PYA2_9BACT/87-263--------------------------------------------------------------------------------
B9CP22_9ACTN/198-361--------------------------------------------------------------------------------
B2AV39_PODAN/50-240--------------------------------------------------------------------------------
D4KBN7_9FIRM/161-338--------------------------------------------------------------------------------
A8SEI6_9FIRM/112-289--------------------------------------------------------------------------------
D2VNU3_NAEGR/46-260--------------------------------------------------------------------------------
A1DLF9_NEOFI/8-203--------------------------------------------------------------------------------
C7YGY2_NECH7/9-186--------------------------------------------------------------------------------
Q2H5R4_CHAGB/10-200--------------------------------------------------------------------------------
B2AU74_PODAN/10-195--------------------------------------------------------------------------------
A7E7J9_SCLS1/25-195--------------------------------------------------------------------------------
A7E806_SCLS1/10-187--------------------------------------------------------------------------------
C9KK96_9FIRM/165-368--------------------------------------------------------------------------------
A6GTH0_9BURK/185-361--------------------------------------------------------------------------------
Q10VH9_TRIEI/81-296--------------------------------------------------------------------------------
E0UE35_CYAP2/81-296--------------------------------------------------------------------------------
A8YLF5_MICAE/88-300--------------------------------------------------------------------------------
B7JX19_CYAP8/84-296--------------------------------------------------------------------------------
B4VXI7_9CYAN/89-309--------------------------------------------------------------------------------
Q3MG18_ANAVT/81-301--------------------------------------------------------------------------------
A0ZJZ9_NODSP/81-301--------------------------------------------------------------------------------
A0YZ06_LYNSP/76-298--------------------------------------------------------------------------------
B5W630_ARTMA/82-298--------------------------------------------------------------------------------
D3I482_9BACT/84-226--------------------------------------------------------------------------------
C5EAN0_BIFLI/201-341--------------------------------------------------------------------------------
A5CSX8_CLAM3/17-179--------------------------------------------------------------------------------
D1NVJ1_9BIFI/473-610--------------------------------------------------------------------------------
B5AX52_9CAUD/256-434--------------------------------------------------------------------------------
B8I9G0_CLOCE/36-210--------------------------------------------------------------------------------
C2Y714_BACCE/497-690--------------------------------------------------------------------------------
B6XSY2_9BIFI/34-205--------------------------------------------------------------------------------
Q8EVG3_MYCPE/337-526--------------------------------------------------------------------------------
B3T8L1_9ARCH/173-373--------------------------------------------------------------------------------
D5SSJ8_PLAL2/90-278--------------------------------------------------------------------------------
B4D083_9BACT/413-601--------------------------------------------------------------------------------
A8SBH6_9FIRM/98-270--------------------------------------------------------------------------------
D1XVL9_9BACT/196-391--------------------------------------------------------------------------------
D2QQH5_SPILD/51-232--------------------------------------------------------------------------------
A3ZLZ7_9PLAN/28-215--------------------------------------------------------------------------------
B4CVC8_9BACT/32-238--------------------------------------------------------------------------------
B9XFH7_PEDPL/48-240--------------------------------------------------------------------------------
A5FWG0_ACICJ/56-236--------------------------------------------------------------------------------
D5X549_THIK1/78-259--------------------------------------------------------------------------------
Q0BTT4_GRABC/70-248--------------------------------------------------------------------------------
A9HI78_GLUDA/63-245--------------------------------------------------------------------------------
B2UPK1_AKKM8/69-229--------------------------------------------------------------------------------
B7B7T9_9PORP/404-572--------------------------------------------------------------------------------
A7SUP9_NEMVE/21-188--------------------------------------------------------------------------------
C1C4W0_LITCT/43-205--------------------------------------------------------------------------------
B4R5I2_DROSI/38-200--------------------------------------------------------------------------------
C4WWV9_ACYPI/38-200--------------------------------------------------------------------------------
C8ZKR7_9CAUD/443-631--------------------------------------------------------------------------------
C2E6W6_LACJH/678-859--------------------------------------------------------------------------------
B8KGJ7_9GAMM/47-224--------------------------------------------------------------------------------
Q2Z0S4_9CAUD/77-253--------------------------------------------------------------------------------
Q47SW9_THEFY/34-291--------------------------------------------------------------------------------
D7B7J6_NOCDD/40-317--------------------------------------------------------------------------------
A6F4N9_9ALTE/13-215--------------------------------------------------------------------------------
C3QEU7_9BACE/179-342--------------------------------------------------------------------------------
D4IKA2_9BACT/179-342--------------------------------------------------------------------------------
D4INC2_9BACT/183-346--------------------------------------------------------------------------------
A6DPU9_9BACT/162-332--------------------------------------------------------------------------------
D1W609_9BACT/162-327--------------------------------------------------------------------------------
D3EGN9_GEOS4/190-357--------------------------------------------------------------------------------
D3AB80_9CLOT/163-328--------------------------------------------------------------------------------
A8RI04_CLOBW/163-329--------------------------------------------------------------------------------
D3EIH1_GEOS4/143-315--------------------------------------------------------------------------------
B8H9Y5_ARTCA/179-369--------------------------------------------------------------------------------
D2PQC5_KRIFD/166-336--------------------------------------------------------------------------------
D2KRC2_9CAUD/5-188--------------------------------------------------------------------------------
B8CFB8_THAPS/190-460--------------------------------------------------------------------------------
C6LX44_GIAIB/39-225--------------------------------------------------------------------------------
B1N3Y2_ENTHI/8-201--------------------------------------------------------------------------------
D4J5M8_9FIRM/6-186--------------------------------------------------------------------------------
C0D1G8_9CLOT/6-194--------------------------------------------------------------------------------
B0P4K6_9CLOT/5-202--------------------------------------------------------------------------------
Q28MK4_JANSC/5-193--------------------------------------------------------------------------------
Q39HJ5_BURS3/9-204--------------------------------------------------------------------------------
A8W013_AGRRH/14-208--------------------------------------------------------------------------------
A4U1B6_9PROT/100-344--------------------------------------------------------------------------------
A7K9Z4_9PHYC/41-196--------------------------------------------------------------------------------
B2FLV5_STRMK/35-209--------------------------------------------------------------------------------
D2QLR8_SPILD/52-228--------------------------------------------------------------------------------
B3C7M6_9BACE/46-223--------------------------------------------------------------------------------
C6XV53_PEDHD/53-230--------------------------------------------------------------------------------
A5CNW4_CLAM3/55-217--------------------------------------------------------------------------------
C9LYN9_SELS3/296-469--------------------------------------------------------------------------------
C9KKD3_9FIRM/276-447--------------------------------------------------------------------------------
B7KL00_CYAP7/104-265--------------------------------------------------------------------------------
C5US72_CLOBO/411-600--------------------------------------------------------------------------------
A3I2P8_9BACT/37-228--------------------------------------------------------------------------------
D2R3I8_PIRSD/56-262--------------------------------------------------------------------------------
Q1YPD0_9GAMM/318-501--------------------------------------------------------------------------------
A3TL07_9MICO/62-234--------------------------------------------------------------------------------
A7HAV9_ANADF/45-222--------------------------------------------------------------------------------
Q8KP08_9BACT/54-230--------------------------------------------------------------------------------
A4S546_OSTLU/12-245--------------------------------------------------------------------------------
C1FIK9_MICSR/186-403--------------------------------------------------------------------------------
Q6AE96_LEIXX/17-180--------------------------------------------------------------------------------
B1M205_METRJ/17-182--------------------------------------------------------------------------------
B1M3V4_METRJ/6-173--------------------------------------------------------------------------------
B1LTZ6_METRJ/10-173--------------------------------------------------------------------------------
B0U7X0_METS4/36-232--------------------------------------------------------------------------------
Q6ACS0_LEIXX/64-231--------------------------------------------------------------------------------
C4XUC8_DESMR/131-314--------------------------------------------------------------------------------
A7IVK2_PBCVM/122-270--------------------------------------------------------------------------------
C7Q7D8_CATAD/157-343--------------------------------------------------------------------------------
A5VBY8_SPHWW/103-291--------------------------------------------------------------------------------
C6RHF9_9PROT/168-353--------------------------------------------------------------------------------
C8PHJ9_9PROT/240-425--------------------------------------------------------------------------------
D2PRA6_KRIFD/46-221--------------------------------------------------------------------------------
Q1YKL3_MOBAS/54-228--------------------------------------------------------------------------------
Q0VS26_ALCBS/87-262--------------------------------------------------------------------------------
A0A030RMR7_PSEAI/57-230--------------------------------------------------------------------------------
A4XXU1_PSEMY/55-228--------------------------------------------------------------------------------
B1XWT3_LEPCP/47-232--------------------------------------------------------------------------------
Q6LG08_PHOPR/48-221--------------------------------------------------------------------------------
Q0F8N5_9RHOB/51-224--------------------------------------------------------------------------------
B7RN26_9RHOB/48-221--------------------------------------------------------------------------------
C0Q8S6_DESAH/49-222--------------------------------------------------------------------------------
A4F1H2_9RHOB/50-223--------------------------------------------------------------------------------
Q5LN18_RUEPO/38-210--------------------------------------------------------------------------------
A4BHN8_9GAMM/48-221--------------------------------------------------------------------------------
A6FTW8_9RHOB/64-237--------------------------------------------------------------------------------
A4JA74_BURVG/48-221--------------------------------------------------------------------------------
C8XKQ3_NAKMY/142-320--------------------------------------------------------------------------------
A8M302_SALAI/68-248--------------------------------------------------------------------------------
D2PP87_KRIFD/68-246--------------------------------------------------------------------------------
A1SF76_NOCSJ/69-248--------------------------------------------------------------------------------
C0W3H8_9ACTO/21-199--------------------------------------------------------------------------------
C4XN11_DESMR/67-258--------------------------------------------------------------------------------
A1SNE8_NOCSJ/71-225--------------------------------------------------------------------------------
A4AKB0_9ACTN/42-210--------------------------------------------------------------------------------

PF14606

Q7US24_RHOBA/217-394--------------------------------------------------------------------------------
A4APA9_MARSH/176-358--------------------------------------------------------------------------------
Q01R43_SOLUE/183-360--------------------------------------------------------------------------------
C6XT40_PEDHD/174-351--------------------------------------------------------------------------------
F0SBL3_PEDSD/182-361--------------------------------------------------------------------------------
D3IDS0_9BACT/151-329--------------------------------------------------------------------------------
C6CUH9_PAESJ/158-340--------------------------------------------------------------------------------
D6D291_9BACE/177-350--------------------------------------------------------------------------------
D6D414_9BACE/177-354--------------------------------------------------------------------------------
Q8A1R6_BACTN/176-353--------------------------------------------------------------------------------
R7EPR9_9BACE/173-349--------------------------------------------------------------------------------

PF04311

W6REB0_9RHIZ/75-346RKAAPK.......................................................AAAAPRPAAP.........
Q98H53_RHILO/33-310QKAKPK.......................................................PRKPRIPRAP.........
O83576_TREPA/55-376RHKSVKNIYLAFVDPLMHTAEQWGIDTVFPLLRESFLHATGLIQHPEWEDTFYHCEQRSYEPAAALAESVPSPVLQEAVA

PF16255

A6L182_BACV8/24-226--------------------------------------------------------------------------------
D6D1C7_9BACE/24-224--------------------------------------------------------------------------------
R7ECW1_9BACE/24-225--------------------------------------------------------------------------------

PF08885

T2KQ07_9FLAO/22-260--------------------------------------------------------------------------------
C0QCX9_DESAH/46-310--------------------------------------------------------------------------------
R5EPC9_9BACE/21-255--------------------------------------------------------------------------------
A5VDH6_SPHWW/41-313--------------------------------------------------------------------------------
R6YAM1_9BACE/32-267--------------------------------------------------------------------------------
R7HNG1_9BACT/21-257--------------------------------------------------------------------------------
G2PK85_MURRD/21-260--------------------------------------------------------------------------------
I2EY90_EMTOG/21-257--------------------------------------------------------------------------------
B8IP12_METNO/42-312--------------------------------------------------------------------------------
A4YK23_BRASO/229-462--------------------------------------------------------------------------------
G8TR03_NIAKG/21-267--------------------------------------------------------------------------------
B1M3F5_METRJ/42-313--------------------------------------------------------------------------------
R5M3J3_9BACE/21-258--------------------------------------------------------------------------------
R7EUS3_9BACT/13-248--------------------------------------------------------------------------------
D5MM94_9BACT/76-315--------------------------------------------------------------------------------
R6Y730_9PORP/28-264--------------------------------------------------------------------------------
R7J1F8_9BACT/24-253--------------------------------------------------------------------------------
F0P1S2_WEEVC/21-257--------------------------------------------------------------------------------
B9J8F4_AGRRK/41-310--------------------------------------------------------------------------------
F8EN95_RUNSL/21-257--------------------------------------------------------------------------------
G0IXU2_CYCMS/22-258--------------------------------------------------------------------------------
E8RMP0_ASTEC/39-308--------------------------------------------------------------------------------
C5AUI8_METEA/49-319--------------------------------------------------------------------------------
L0G2R2_ECHVK/22-255--------------------------------------------------------------------------------
G2Z7S8_FLABF/21-259--------------------------------------------------------------------------------
G8X6A0_FLACA/17-254--------------------------------------------------------------------------------
G8ULQ0_TANFA/21-258--------------------------------------------------------------------------------
G8PQJ6_PSEUV/51-307--------------------------------------------------------------------------------
C7PMX6_CHIPD/22-258--------------------------------------------------------------------------------
A6LHC4_PARD8/21-258--------------------------------------------------------------------------------
R7LF46_9BACT/50-294--------------------------------------------------------------------------------
A0LXX4_GRAFK/22-257--------------------------------------------------------------------------------
F0R195_BACSH/21-257--------------------------------------------------------------------------------
F8JMP9_STREN/40-309--------------------------------------------------------------------------------
E4T1X0_PALPW/20-256--------------------------------------------------------------------------------
R6X342_9BACT/24-260--------------------------------------------------------------------------------
A6L176_BACV8/21-257--------------------------------------------------------------------------------
M9RBE9_9RHOB/323-562--------------------------------------------------------------------------------
R6L892_9BACE/21-258--------------------------------------------------------------------------------
T2GGB5_DESGI/40-310--------------------------------------------------------------------------------
Q11RW7_CYTH3/21-254--------------------------------------------------------------------------------
F4B2J3_KROS4/22-257--------------------------------------------------------------------------------
R6FFG9_9BACE/21-258--------------------------------------------------------------------------------
R5RV25_9BACE/22-258--------------------------------------------------------------------------------
A1S3K5_SHEAM/44-301--------------------------------------------------------------------------------
F4L6L3_HALH1/23-258--------------------------------------------------------------------------------
R5NCX1_9BACT/22-258--------------------------------------------------------------------------------
R7D323_9BACE/32-279--------------------------------------------------------------------------------
H6L5M5_SAPGL/25-259--------------------------------------------------------------------------------
E6XET3_CELAD/21-258--------------------------------------------------------------------------------
C3KQN9_RHISN/57-328--------------------------------------------------------------------------------
F4KMJ5_PORAD/29-267--------------------------------------------------------------------------------
E4TT54_MARTH/21-257--------------------------------------------------------------------------------
D6D188_9BACE/31-268--------------------------------------------------------------------------------
A6H0Z4_FLAPJ/21-258--------------------------------------------------------------------------------
H1ZDZ1_MYROD/21-259--------------------------------------------------------------------------------
C4XP38_DESMR/33-276--------------------------------------------------------------------------------
W0EN83_9PORP/21-255--------------------------------------------------------------------------------
W0EYV8_9SPHI/21-264--------------------------------------------------------------------------------
R5VH21_9PORP/22-257--------------------------------------------------------------------------------
I4AP67_FLELS/21-272--------------------------------------------------------------------------------
I0KF94_9BACT/21-257--------------------------------------------------------------------------------
D4IN95_9BACT/21-252--------------------------------------------------------------------------------
A3U798_CROAH/21-257--------------------------------------------------------------------------------
R5GUT3_9BACT/21-259--------------------------------------------------------------------------------
F0RBR0_CELLC/21-260--------------------------------------------------------------------------------
A1B3U8_PARDP/64-333--------------------------------------------------------------------------------
I4C880_DESTA/46-310--------------------------------------------------------------------------------
Q121I3_POLSJ/60-298--------------------------------------------------------------------------------
R6CLT6_9BACE/22-257--------------------------------------------------------------------------------
X5DG71_9BACT/26-262--------------------------------------------------------------------------------
D5ATP2_RHOCB/41-310--------------------------------------------------------------------------------
R5YHQ3_9BACE/21-258--------------------------------------------------------------------------------
R6SA44_9BACE/21-257--------------------------------------------------------------------------------
S5XTM4_PARAH/50-309--------------------------------------------------------------------------------
J7QVY3_METSZ/42-313--------------------------------------------------------------------------------
R7JRE2_9BACT/59-292--------------------------------------------------------------------------------
A4AUF0_MARSH/21-260--------------------------------------------------------------------------------
R6EUG1_9BACE/22-258--------------------------------------------------------------------------------
Q5LH25_BACFN/21-258--------------------------------------------------------------------------------
C6X454_FLAB3/21-258--------------------------------------------------------------------------------
I3Z6K2_BELBD/21-257--------------------------------------------------------------------------------
G0L2J8_ZOBGA/21-255--------------------------------------------------------------------------------
I3YP53_ALIFI/21-252--------------------------------------------------------------------------------
F9Z2U7_ODOSD/27-263--------------------------------------------------------------------------------
R5JB51_9BACE/21-258--------------------------------------------------------------------------------
D3HQS8_LEGLN/335-604--------------------------------------------------------------------------------
F9YS98_CAPCC/21-256--------------------------------------------------------------------------------
R7PCY6_9BACT/23-264--------------------------------------------------------------------------------
Q28TN8_JANSC/41-309--------------------------------------------------------------------------------
L0FZB4_ECHVK/21-257--------------------------------------------------------------------------------
S5XXU5_PARAH/13-280--------------------------------------------------------------------------------
H2JZH7_STRHJ/41-311--------------------------------------------------------------------------------
R7NWR5_9BACE/21-257--------------------------------------------------------------------------------
D2QBX3_SPILD/37-300--------------------------------------------------------------------------------
H8XPR8_FLAIG/21-258--------------------------------------------------------------------------------
T0U393_9STRE/22-259--------------------------------------------------------------------------------
D2QK40_SPILD/21-257--------------------------------------------------------------------------------
R5CG89_9BACE/13-250--------------------------------------------------------------------------------
R5WEX8_9BACT/23-254--------------------------------------------------------------------------------
A5FIN8_FLAJ1/21-261--------------------------------------------------------------------------------
R6AYA1_9BACT/21-266--------------------------------------------------------------------------------
E4RZ72_LEAB4/28-259--------------------------------------------------------------------------------
K4IFD9_PSYTT/21-259--------------------------------------------------------------------------------
R5B7Q4_9BACE/21-258--------------------------------------------------------------------------------
F3ZNK8_9BACE/22-259--------------------------------------------------------------------------------
L7W558_NONDD/21-252--------------------------------------------------------------------------------
I3ZZB3_ORNRL/21-258--------------------------------------------------------------------------------
A3HZZ3_9BACT/21-256--------------------------------------------------------------------------------
R5BJ82_9BACE/23-256--------------------------------------------------------------------------------
R6E4B6_9BACE/21-258--------------------------------------------------------------------------------
R5IRK1_9PORP/21-258--------------------------------------------------------------------------------
B0UMN0_METS4/39-306--------------------------------------------------------------------------------
R5PD70_9PORP/21-257--------------------------------------------------------------------------------
W0AHI1_9SPHN/141-410--------------------------------------------------------------------------------
I3YWC9_AEQSU/21-270--------------------------------------------------------------------------------
A2TZ06_9FLAO/22-258--------------------------------------------------------------------------------
D8LTE6_ECTSI/26-281--------------------------------------------------------------------------------
E6SU26_BACT6/22-259--------------------------------------------------------------------------------
C7M4J9_CAPOD/21-255--------------------------------------------------------------------------------
R5IIF1_9BACT/9-264--------------------------------------------------------------------------------
R5GFU6_9PORP/21-256--------------------------------------------------------------------------------
R6M862_9BACE/23-259--------------------------------------------------------------------------------
C5AW44_METEA/40-311--------------------------------------------------------------------------------
R5W2G8_9BACE/21-257--------------------------------------------------------------------------------
A8LP01_DINSH/55-319--------------------------------------------------------------------------------
S5Y059_PARAH/41-311--------------------------------------------------------------------------------
B0T687_CAUSK/47-313--------------------------------------------------------------------------------
R7DF91_9PORP/21-258--------------------------------------------------------------------------------
C6W6S3_DYAFD/24-261--------------------------------------------------------------------------------
U5Q7D6_9BACT/21-253--------------------------------------------------------------------------------
W8FAI7_9BACT/20-256--------------------------------------------------------------------------------
S5YTU2_PARAH/50-305--------------------------------------------------------------------------------
F2IKK3_FLUTR/21-251--------------------------------------------------------------------------------
F6GCA5_LACS5/22-256--------------------------------------------------------------------------------
H1XPK2_9BACT/21-257--------------------------------------------------------------------------------
J9R834_RIEAN/21-258--------------------------------------------------------------------------------
Q7MVG8_PORGI/56-293--------------------------------------------------------------------------------
D5BGH9_ZUNPS/21-262--------------------------------------------------------------------------------
K4KIG2_SIMAS/57-326--------------------------------------------------------------------------------
R5V0S4_9BACE/23-258--------------------------------------------------------------------------------
D9SAD6_FIBSS/55-314--------------------------------------------------------------------------------
R7EIY0_9BACE/21-258--------------------------------------------------------------------------------

PF13839

CPED1_HUMAN/757-1021-----------------------------------------------------------...LTKPQLQ.QCLGG.....
A9U1Q5_PHYPA/72-368-----------------------------------------------------------LTRFDGLAFL.ELMRG.....
TBL18_ARATH/227-526-----------------------------------------------------------LPRFDARKFL.ELMKG.....
TBL17_ARATH/190-490-----------------------------------------------------------LPRFDAKKFL.ELMRG.....
TBL22_ARATH/122-412-----------------------------------------------------------LPRFNPKAFL.SMVRG.....
TBL19_ARATH/121-411-----------------------------------------------------------LPVFDPVRFL.EIVRG.....
A9RCM6_PHYPA/75-370-----------------------------------------------------------LPKIDAPSFL.TAMRN.....
A9RAV2_PHYPA/82-374-----------------------------------------------------------LPRIDPAKFL.NAMRN.....
A9T2B6_PHYPA/55-352-----------------------------------------------------------LPRIDARAFL.STMRG.....
A9TUK8_PHYPA/53-350-----------------------------------------------------------LPRIDAQAFL.IAMRN.....
TBL27_ARATH/131-413-----------------------------------------------------------IPRFDSNRFL.DLMRD.....
TBL24_ARATH/132-429-----------------------------------------------------------LPRFDPRRFL.QLMRH.....
TBL23_ARATH/132-427-----------------------------------------------------------LPRFDSLRFL.QLMRN.....
TBL25_ARATH/151-449-----------------------------------------------------------LPRFNPEQFL.DNMRN.....
TBL26_ARATH/143-432-----------------------------------------------------------LPRFSPSQFL.ASVKN.....
A5C5G9_VITVI/125-419-----------------------------------------------------------LPQFDPYRFL.ELMRN.....
A5BFA6_VITVI/191-485-----------------------------------------------------------LPRFNPERFL.DLMRN.....
A9SPN8_PHYPA/96-376-----------------------------------------------------------MPPFNASRVL.ETLRN.....
TBL30_ARATH/130-425-----------------------------------------------------------LPRFDSKLLL.EKLRG.....
TBL28_ARATH/124-422-----------------------------------------------------------LPKFNARVLL.EKLRN.....
TBL31_ARATH/120-407-----------------------------------------------------------LPRFNALKLL.DVLRN.....
A5ADJ7_VITVI/123-409-----------------------------------------------------------LPRFNPKKVL.EILRG.....
TBL33_ARATH/134-424-----------------------------------------------------------LPSFNASLML.ETLRG.....
TBL32_ARATH/159-450-----------------------------------------------------------LPSFNATVML.ESLRG.....
D7SR66_VITVI/138-430-----------------------------------------------------------LPRFNATALL.ERLRG.....
TBL34_ARATH/112-406-----------------------------------------------------------LPRFNGTKLL.ERLRN.....
D7SSF9_VITVI/114-388-----------------------------------------------------------IPRFDALHFL.GRMRR.....
TBL36_ARATH/102-376-----------------------------------------------------------LPRFDALKFL.GKMRG.....
TBL7_ARATH/167-441-----------------------------------------------------------VPRFEVRDVL.KRLRG.....
E0CQN6_VITVI/163-439-----------------------------------------------------------IPRFRVHGVL.EKLRG.....
TBL43_ARATH/95-367-----------------------------------------------------------LPRFNGLDFLGRIMKG.....
TBL44_ARATH/119-402-----------------------------------------------------------LPTFNGAQFL.LKMKG.....
D7SJV7_VITVI/21-302-----------------------------------------------------------LPRFNGLEFL.LRMKG.....
TBL37_ARATH/117-385-----------------------------------------------------------VPRFDGEAFL.KKWRG.....
TBL40_ARATH/97-364-----------------------------------------------------------LPRFDGANFM.RRMRG.....
TBL39_ARATH/99-366-----------------------------------------------------------LPRFNGLYFL.RRMRG.....
TBL41_ARATH/86-356-----------------------------------------------------------LARFNGLQFL.KKNKG.....
TBL42_ARATH/89-358-----------------------------------------------------------IPRFNGRDFL.TRFKG.....
E0CS20_VITVI/95-364-----------------------------------------------------------LPRFNGVEFL.ARYKG.....
E0CTP6_VITVI/133-405-----------------------------------------------------------IPRFNATDML.ERLRG.....
TBL9_ARATH/120-407-----------------------------------------------------------LPRFNASDLL.ERSRN.....
D7T6S6_VITVI/145-435-----------------------------------------------------------LPRFNATLML.ERLRN.....
TBL10_ARATH/155-447-----------------------------------------------------------LPRFDAKLML.EKLRD.....
TBL11_ARATH/151-446-----------------------------------------------------------LPRFDAKLML.EKLRN.....
TBL5_ARATH/194-481-----------------------------------------------------------LPRFNATDFL.VKLRG.....
TBL6_ARATH/190-473-----------------------------------------------------------APRFNATKML.EMIRG.....
D7SY59_VITVI/169-450-----------------------------------------------------------IPRFDGRKML.KMLRG.....
TBR_ARATH/307-596-----------------------------------------------------------LPRLNGAILL.EMLRG.....
TBL2_ARATH/244-534-----------------------------------------------------------IPRLNGTDFL.EKLRG.....
P90793_CAEEL/44-306-----------------------------------------------------------...YNRQTAR.ALLKD.....
A8XEN8_CAEBR/12-234-----------------------------------------------------------...YNSQIAR.ALLRD.....
A7SCU9_NEMVE/11-255-----------------------------------------------------------...FMNEDVR.EILHN.....
A4IHH2_XENTR/4-243-----------------------------------------------------------...FSTEHAQ.QLLHN.....
PED1B_MOUSE/4-254-----------------------------------------------------------...LLASEVQ.QLLHN.....
F1M6L4_RAT/19-264-----------------------------------------------------------...LRAHEVQ.QLLHN.....
PED1A_MOUSE/21-267-----------------------------------------------------------...FHASEVQ.QLLHN.....
PED1B_BOVIN/4-250-----------------------------------------------------------...LLASEVR.QLLHN.....
F1PVW1_CANFA/4-250-----------------------------------------------------------...LQASEVQ.QLLHN.....
A0A024R115_HUMAN/4-250-----------------------------------------------------------...LRASEVR.QLLHN.....
B0W8N6_CULQU/74-300-----------------------------------------------------------...YTETDTR.KCFRYLAFWG
Q8T3H4_DROME/119-348-----------------------------------------------------------...YSLTDTR.RCLRYLAFFD
Q6CDI8_YARLI/64-294-----------------------------------------------------------...FDRASTA.QCLTN.....
A7RI69_NEMVE/99-327-----------------------------------------------------------...YIPSEAR.TCLQN.....
B2RAS9_HUMAN/74-292-----------------------------------------------------------...YKISEAK.NCLVD.....
A7F4H3_SCLS1/82-326-----------------------------------------------------------...YKQKDIQ.ECFKD.....
CAS1_CRYNJ/90-372-----------------------------------------------------------SPTVNTHQALHSSYYD.....
A8N197_COPC7/69-295-----------------------------------------------------------...YGPKDGA.TCLAS.....

PF03629

A0ZZI1_BIFAA/132-445--------------------------------------------------------------------------------
A3HTJ4_9BACT/102-524--------------------------------------------------------------------------------
A4AN28_MARSH/117-413--------------------------------------------------------------------------------
A4XG19_CALS8/84-518--------------------------------------------------------------------------------
A5FA09_FLAJ1/103-353--------------------------------------------------------------------------------
A5FC32_FLAJ1/109-397--------------------------------------------------------------------------------
A5FCG2_FLAJ1/104-366--------------------------------------------------------------------------------
A5FLW6_FLAJ1/100-526--------------------------------------------------------------------------------
A6KYD0_BACV8/104-544--------------------------------------------------------------------------------
A6L7S8_BACV8/301-581--------------------------------------------------------------------------------
A6L837_PARD8/106-365--------------------------------------------------------------------------------
A6LG42_PARD8/302-584--------------------------------------------------------------------------------
A9KN08_CLOPH/81-525--------------------------------------------------------------------------------
A9UY79_MONBE/110-371--------------------------------------------------------------------------------
A9UYV9_MONBE/183-446--------------------------------------------------------------------------------
B0SVR2_CAUSK/105-536--------------------------------------------------------------------------------
B0SYV3_CAUSK/103-536--------------------------------------------------------------------------------
B1ZN38_OPITP/124-558--------------------------------------------------------------------------------
B1ZRD5_OPITP/111-543--------------------------------------------------------------------------------
B2UNI0_AKKM8/105-396--------------------------------------------------------------------------------
B3PDW1_CELJU/103-559--------------------------------------------------------------------------------
B8DTK8_BIFA0/83-504--------------------------------------------------------------------------------
B8DVE1_BIFA0/120-432--------------------------------------------------------------------------------
B8I0P3_CLOCE/95-527--------------------------------------------------------------------------------
C1F347_ACIC5/141-569--------------------------------------------------------------------------------
C1F9V4_ACIC5/112-403--------------------------------------------------------------------------------
C3Y8H9_BRAFL/120-404--------------------------------------------------------------------------------
C3Z127_BRAFL/109-390--------------------------------------------------------------------------------
C3Z129_BRAFL/93-393--------------------------------------------------------------------------------
C3ZBF5_BRAFL/95-370--------------------------------------------------------------------------------
C5BNV0_TERTT/112-545--------------------------------------------------------------------------------
C6VYA3_DYAFD/101-531--------------------------------------------------------------------------------
C6W5L8_DYAFD/109-390--------------------------------------------------------------------------------
C6X165_FLAB3/103-532--------------------------------------------------------------------------------
C6XSG1_PEDHD/103-356--------------------------------------------------------------------------------
C6XSW9_PEDHD/104-358--------------------------------------------------------------------------------
C6XUV3_PEDHD/100-352--------------------------------------------------------------------------------
C6XXZ6_PEDHD/106-358--------------------------------------------------------------------------------
C6XYN0_PEDHD/106-369--------------------------------------------------------------------------------
C6Y155_PEDHD/105-361--------------------------------------------------------------------------------
C6Y1K6_PEDHD/105-533--------------------------------------------------------------------------------
C6Y404_PEDHD/303-583--------------------------------------------------------------------------------
C7M404_CAPOD/302-582--------------------------------------------------------------------------------
C7PN71_CHIPD/105-526--------------------------------------------------------------------------------
C7PT40_CHIPD/107-370--------------------------------------------------------------------------------
D0MJ56_RHOM4/105-565--------------------------------------------------------------------------------
D2QQ30_SPILD/101-534--------------------------------------------------------------------------------
D2QX68_PIRSD/107-360--------------------------------------------------------------------------------
D2QYI9_PIRSD/142-409--------------------------------------------------------------------------------
D2R7J4_PIRSD/115-431--------------------------------------------------------------------------------
D2U910_XANAP/119-550--------------------------------------------------------------------------------
D2U9U1_XANAP/109-532--------------------------------------------------------------------------------
D4INS5_9BACT/103-361--------------------------------------------------------------------------------
D4JVY2_9FIRM/84-395--------------------------------------------------------------------------------
D4Z7X6_SPHJU/109-541--------------------------------------------------------------------------------
D5BHF0_ZUNPS/98-525--------------------------------------------------------------------------------
D5EN53_CORAD/103-390--------------------------------------------------------------------------------
D5ER35_CORAD/101-350--------------------------------------------------------------------------------
D5EXD4_PRER2/104-368--------------------------------------------------------------------------------
D6CYE8_9BACE/85-509--------------------------------------------------------------------------------
D6CYV5_9BACE/104-362--------------------------------------------------------------------------------
D6D068_9BACE/96-526--------------------------------------------------------------------------------
D6D180_9BACE/73-515--------------------------------------------------------------------------------
D6D411_9BACE/118-376--------------------------------------------------------------------------------
D9SLS9_CLOC7/541-802--------------------------------------------------------------------------------
D9SWK5_CLOC7/539-800--------------------------------------------------------------------------------
E4RWD7_LEAB4/99-523--------------------------------------------------------------------------------
E4T5G4_PALPW/145-396--------------------------------------------------------------------------------
E4T6U6_PALPW/106-547--------------------------------------------------------------------------------
E6SN70_BACT6/301-581--------------------------------------------------------------------------------
E6U3H5_ETHHY/86-401--------------------------------------------------------------------------------
E6UDX2_RUMA7/82-393--------------------------------------------------------------------------------
E6UGH2_RUMA7/87-510--------------------------------------------------------------------------------
E6WRU5_PSEUU/108-538--------------------------------------------------------------------------------
E6WX51_PSEUU/113-546--------------------------------------------------------------------------------
E8RKP4_ASTEC/107-546--------------------------------------------------------------------------------
E8RP08_ASTEC/110-381--------------------------------------------------------------------------------
E8RR55_ASTEC/105-537--------------------------------------------------------------------------------
E8RVJ6_ASTEC/120-557--------------------------------------------------------------------------------
E8V0Q2_TERSS/105-396--------------------------------------------------------------------------------
E8WX56_ACISM/104-394--------------------------------------------------------------------------------
F0RXK6_SPHGB/84-395--------------------------------------------------------------------------------
F0S4E8_PEDSD/102-363--------------------------------------------------------------------------------
F0SBL8_PEDSD/106-542--------------------------------------------------------------------------------
F0SE55_PEDSD/103-355--------------------------------------------------------------------------------
F0SEX3_PEDSD/110-362--------------------------------------------------------------------------------
F0SLB2_PLABD/105-401--------------------------------------------------------------------------------
F0XZG5_AURAN/371-703--------------------------------------------------------------------------------
F1N0F2_BOVIN/129-405--------------------------------------------------------------------------------
F2JM57_CELLD/90-525--------------------------------------------------------------------------------
F2KZ29_PREDF/320-601--------------------------------------------------------------------------------
F2NB41_CORGP/85-397--------------------------------------------------------------------------------
F2NBE0_CORGP/105-528--------------------------------------------------------------------------------
F4C1D3_SPHS2/119-545--------------------------------------------------------------------------------
F4C667_SPHS2/102-358--------------------------------------------------------------------------------
F4CDE6_SPHS2/103-363--------------------------------------------------------------------------------
F4KXA6_HALH1/110-541--------------------------------------------------------------------------------
F6RRT5_CIOIN/110-408--------------------------------------------------------------------------------
F7AJJ3_HORSE/118-419--------------------------------------------------------------------------------
F7CPG9_XENTR/116-394--------------------------------------------------------------------------------
F8EA22_RUNSL/103-354--------------------------------------------------------------------------------
F8EJ62_RUNSL/102-531--------------------------------------------------------------------------------
F8EQW5_RUNSL/101-532--------------------------------------------------------------------------------
F9D4M3_PREDD/105-362--------------------------------------------------------------------------------
F9Z647_ODOSD/105-527--------------------------------------------------------------------------------
G0GB30_SPITZ/129-404--------------------------------------------------------------------------------
G0GBV2_SPITZ/85-515--------------------------------------------------------------------------------
G0IZQ4_CYCMS/102-365--------------------------------------------------------------------------------
G0L160_ZOBGA/108-362--------------------------------------------------------------------------------
G0L7C6_ZOBGA/106-357--------------------------------------------------------------------------------
G1SIW9_RABIT/119-395--------------------------------------------------------------------------------
G3IIB1_CRIGR/119-418--------------------------------------------------------------------------------
G3NT91_GASAC/117-395--------------------------------------------------------------------------------
G3TGM8_LOXAF/118-419--------------------------------------------------------------------------------
G3WPG6_SARHA/128-405--------------------------------------------------------------------------------
G8NUG1_GRAMM/104-394--------------------------------------------------------------------------------
G8TBM5_NIAKG/101-532--------------------------------------------------------------------------------
G8TEA3_NIAKG/104-360--------------------------------------------------------------------------------
G8TGS0_NIAKG/106-355--------------------------------------------------------------------------------
G8TLW6_NIAKG/105-533--------------------------------------------------------------------------------
G8TN45_NIAKG/114-379--------------------------------------------------------------------------------
G8TQU6_NIAKG/101-533--------------------------------------------------------------------------------
G8UJ84_TANFA/302-584--------------------------------------------------------------------------------
H0XDV1_OTOGA/118-421--------------------------------------------------------------------------------
H1Y7E7_9SPHI/107-370--------------------------------------------------------------------------------
H1YEP3_9SPHI/107-377--------------------------------------------------------------------------------
H1YFU1_9SPHI/105-542--------------------------------------------------------------------------------
H1YHR5_9SPHI/103-534--------------------------------------------------------------------------------
H2MHU5_ORYLA/110-406--------------------------------------------------------------------------------
H2NFQ7_PONAB/118-394--------------------------------------------------------------------------------
H2T5J8_TAKRU/109-378--------------------------------------------------------------------------------
H8KVR3_SOLCM/112-540--------------------------------------------------------------------------------
H9G3E2_ANOCA/113-390--------------------------------------------------------------------------------
I0IFA8_PHYMF/116-371--------------------------------------------------------------------------------
I0IGP0_PHYMF/113-573--------------------------------------------------------------------------------
I0K882_9BACT/102-533--------------------------------------------------------------------------------
I0KDZ4_9BACT/80-507--------------------------------------------------------------------------------
I2F010_EMTOG/101-530--------------------------------------------------------------------------------
I3JCR3_ORENI/107-370--------------------------------------------------------------------------------
I3NAW5_SPETR/119-428--------------------------------------------------------------------------------
I3YNK6_ALIFI/103-360--------------------------------------------------------------------------------
I3Z657_BELBD/107-540--------------------------------------------------------------------------------
I6ZXF8_MELRP/103-560--------------------------------------------------------------------------------
I7A330_MELRP/101-533--------------------------------------------------------------------------------
K1PIG0_CRAGI/75-338--------------------------------------------------------------------------------
L0DNV4_SINAD/113-408--------------------------------------------------------------------------------
L0FZA4_ECHVK/103-365--------------------------------------------------------------------------------
L0G4D5_ECHVK/108-537--------------------------------------------------------------------------------
L0G5F4_ECHVK/309-586--------------------------------------------------------------------------------
L0G6Q7_ECHVK/110-371--------------------------------------------------------------------------------
M3VYU4_FELCA/118-393--------------------------------------------------------------------------------
M3XHL6_LATCH/120-399--------------------------------------------------------------------------------
M3ZH48_XIPMA/107-384--------------------------------------------------------------------------------
SIAE_MOUSE/118-420--------------------------------------------------------------------------------
Q022C5_SOLUE/94-383--------------------------------------------------------------------------------
Q15XN0_PSEA6/106-529--------------------------------------------------------------------------------
Q1IR02_KORVE/102-394--------------------------------------------------------------------------------
Q1LUX8_DANRE/112-383--------------------------------------------------------------------------------
Q21HS7_SACD2/109-546--------------------------------------------------------------------------------
Q5LA76_BACFN/104-538--------------------------------------------------------------------------------
Q7UKM9_RHOBA/136-425--------------------------------------------------------------------------------
Q7UL92_RHOBA/160-428--------------------------------------------------------------------------------
Q7UPP2_RHOBA/115-412--------------------------------------------------------------------------------
Q8A0D0_BACTN/104-546--------------------------------------------------------------------------------
Q8A1R2_BACTN/105-365--------------------------------------------------------------------------------
Q8A2Y4_BACTN/104-362--------------------------------------------------------------------------------
Q8A323_BACTN/103-546--------------------------------------------------------------------------------
Q8A331_BACTN/104-369--------------------------------------------------------------------------------
Q8A6U7_BACTN/107-449--------------------------------------------------------------------------------
Q8AAK7_BACTN/303-583--------------------------------------------------------------------------------
Q8P3G8_XANCP/110-540--------------------------------------------------------------------------------
Q8P9U4_XANCP/106-528--------------------------------------------------------------------------------
Q9AA13_CAUCR/103-537--------------------------------------------------------------------------------
R5ATT9_9BACT/97-358--------------------------------------------------------------------------------
R5C0U7_9BACE/106-371--------------------------------------------------------------------------------
R5CMH4_9FIRM/112-544--------------------------------------------------------------------------------
R5CR26_9BACT/106-368--------------------------------------------------------------------------------
R5CRW3_9BACT/103-359--------------------------------------------------------------------------------
R5CVR0_9BACT/37-472--------------------------------------------------------------------------------
R5CVU7_9BACT/105-371--------------------------------------------------------------------------------
R5FQG9_9BACT/98-360--------------------------------------------------------------------------------
R5GQ73_9FIRM/87-396--------------------------------------------------------------------------------
R5I3U1_9PORP/108-543--------------------------------------------------------------------------------
R5I599_9PORP/104-370--------------------------------------------------------------------------------
R5I8Z5_9PORP/109-398--------------------------------------------------------------------------------
R5I9A4_9PORP/110-550--------------------------------------------------------------------------------
R5ICE3_9PORP/106-356--------------------------------------------------------------------------------
R5IPA1_9PORP/103-532--------------------------------------------------------------------------------
R5J8I9_9BACE/107-548--------------------------------------------------------------------------------
R5J9D0_9BACE/301-581--------------------------------------------------------------------------------
R5JB68_9BACE/94-354--------------------------------------------------------------------------------
R5JE70_9BACE/106-367--------------------------------------------------------------------------------
R5JUI1_9BACE/107-546--------------------------------------------------------------------------------
R5JY84_9CLOT/86-397--------------------------------------------------------------------------------
R5KDD9_9BACT/106-367--------------------------------------------------------------------------------
R5KI40_9BACT/107-545--------------------------------------------------------------------------------
R5KI88_9BACT/106-368--------------------------------------------------------------------------------
R5M4F3_9BACE/103-392--------------------------------------------------------------------------------
R5M9T3_9BACE/100-533--------------------------------------------------------------------------------
R5MCJ4_9BACE/107-370--------------------------------------------------------------------------------
R5MCV5_9BACE/117-382--------------------------------------------------------------------------------
R5NAN5_9BACT/95-508--------------------------------------------------------------------------------
R5NWA0_9PORP/104-366--------------------------------------------------------------------------------
R5PFV8_9BACT/95-546--------------------------------------------------------------------------------
R5RU50_9BACE/106-368--------------------------------------------------------------------------------
R5S363_9BACE/112-377--------------------------------------------------------------------------------
R5U9L2_9BACE/103-366--------------------------------------------------------------------------------
R5UQU2_9PORP/301-581--------------------------------------------------------------------------------
R5XXY6_9FIRM/83-407--------------------------------------------------------------------------------
R6BWP4_9CLOT/125-575--------------------------------------------------------------------------------
R6CBR0_9FIRM/90-402--------------------------------------------------------------------------------
R6CT48_9BACE/308-588--------------------------------------------------------------------------------
R6CZR7_9BACE/103-360--------------------------------------------------------------------------------
R6DIJ1_9BACE/99-533--------------------------------------------------------------------------------
R6DJ41_9BACE/303-583--------------------------------------------------------------------------------
R6DWQ0_9BACT/104-366--------------------------------------------------------------------------------
R6E989_9BACE/963-1241--------------------------------------------------------------------------------
R6EGK2_9FIRM/83-401--------------------------------------------------------------------------------
R6F527_9BACT/343-624--------------------------------------------------------------------------------
R6FK85_9BACE/101-514--------------------------------------------------------------------------------
R6GA32_9BACE/128-565--------------------------------------------------------------------------------
R6K607_9BACE/105-361--------------------------------------------------------------------------------
R6KHE9_9BACE/106-368--------------------------------------------------------------------------------
R6KHK2_9BACE/100-362--------------------------------------------------------------------------------
R6KJ37_9BACE/119-553--------------------------------------------------------------------------------
R6KNC4_9BACE/104-538--------------------------------------------------------------------------------
R6KU81_9BACE/100-533--------------------------------------------------------------------------------
R6L845_9BACE/106-539--------------------------------------------------------------------------------
R6L914_9BACE/107-368--------------------------------------------------------------------------------
R6LEJ2_9BACE/109-369--------------------------------------------------------------------------------
R6M7W6_9BACE/104-365--------------------------------------------------------------------------------
R6MBW6_9BACE/104-365--------------------------------------------------------------------------------
R6MD77_9BACE/131-411--------------------------------------------------------------------------------
R6MGF8_9BACE/106-368--------------------------------------------------------------------------------
R6MRS7_9FIRM/84-393--------------------------------------------------------------------------------
R6NFL1_9BACE/103-361--------------------------------------------------------------------------------
R6QQ52_9BACT/103-365--------------------------------------------------------------------------------
R6SZ03_9FIRM/82-394--------------------------------------------------------------------------------
R6TMT5_9FIRM/79-326--------------------------------------------------------------------------------
R6TYL3_9FIRM/88-372--------------------------------------------------------------------------------
R6VGA6_9FIRM/87-503--------------------------------------------------------------------------------
R6VGP4_9BACT/119-542--------------------------------------------------------------------------------
R6VYK5_9BACT/95-522--------------------------------------------------------------------------------
R6W3N6_9BACT/103-360--------------------------------------------------------------------------------
R6WVP4_9BACT/103-358--------------------------------------------------------------------------------
R6X6R9_9PORP/299-581--------------------------------------------------------------------------------
R6X8A0_9BACT/104-361--------------------------------------------------------------------------------
R6XDK3_9BACT/111-376--------------------------------------------------------------------------------
R6XW57_9BACT/105-369--------------------------------------------------------------------------------
R6YB86_9BACE/303-583--------------------------------------------------------------------------------
R6YLG6_9BACE/106-367--------------------------------------------------------------------------------
R6ZQY5_9FIRM/86-518--------------------------------------------------------------------------------
R7D1U4_9BACE/101-514--------------------------------------------------------------------------------
R7DGQ2_9PORP/109-450--------------------------------------------------------------------------------
R7DHQ3_9PORP/103-362--------------------------------------------------------------------------------
R7EBZ9_9BACE/116-365--------------------------------------------------------------------------------
R7ELJ2_9BACE/104-363--------------------------------------------------------------------------------
R7FDG6_9FIRM/85-396--------------------------------------------------------------------------------
R7HK49_9BACT/112-371--------------------------------------------------------------------------------
R7IBZ1_9FIRM/91-402--------------------------------------------------------------------------------
R7KXY0_9FIRM/78-504--------------------------------------------------------------------------------
R7L392_9BACT/141-439--------------------------------------------------------------------------------
R7L457_9BACT/106-408--------------------------------------------------------------------------------
R7L551_9BACT/107-409--------------------------------------------------------------------------------
R7LBC9_9BACT/106-408--------------------------------------------------------------------------------
R7LCZ4_9BACT/117-400--------------------------------------------------------------------------------
R7LEI0_9BACT/104-413--------------------------------------------------------------------------------
R7N8V0_9FIRM/86-515--------------------------------------------------------------------------------
R7NVJ4_9BACE/94-536--------------------------------------------------------------------------------
S0ET71_CHTCT/118-391--------------------------------------------------------------------------------
T2KJY6_9FLAO/72-379--------------------------------------------------------------------------------
T2KKF3_9FLAO/106-399--------------------------------------------------------------------------------
T2KL42_9FLAO/108-425--------------------------------------------------------------------------------
U3JRM3_FICAL/110-387--------------------------------------------------------------------------------
U5Q6R0_9BACT/120-374--------------------------------------------------------------------------------
V8NYK2_OPHHA/82-359--------------------------------------------------------------------------------
W0ETR7_9SPHI/108-546--------------------------------------------------------------------------------
W0ETZ4_9SPHI/87-339--------------------------------------------------------------------------------
W0EW65_9PORP/114-543--------------------------------------------------------------------------------
W0EXJ4_9SPHI/101-529--------------------------------------------------------------------------------
W0EYF1_9SPHI/303-584--------------------------------------------------------------------------------
W0F205_9SPHI/104-389--------------------------------------------------------------------------------
W0F686_9SPHI/73-335--------------------------------------------------------------------------------
W0IV69_9BACT/122-573--------------------------------------------------------------------------------
W0IY28_9BACT/102-398--------------------------------------------------------------------------------
W0IZR9_9BACT/107-406--------------------------------------------------------------------------------
W0J089_9BACT/113-554--------------------------------------------------------------------------------
W0J126_9BACT/103-396--------------------------------------------------------------------------------
W0J1D8_9BACT/103-397--------------------------------------------------------------------------------
W0J1I7_9BACT/127-575--------------------------------------------------------------------------------
W0J1Z1_9BACT/122-573--------------------------------------------------------------------------------
W0J1Z2_9BACT/111-557--------------------------------------------------------------------------------
W0J268_9BACT/121-368--------------------------------------------------------------------------------
W0J4T5_9BACT/111-561--------------------------------------------------------------------------------
W0J8X3_9BACT/103-397--------------------------------------------------------------------------------
W0JAS2_9BACT/114-570--------------------------------------------------------------------------------
W0RMP1_9BACT/123-554--------------------------------------------------------------------------------
W4XVQ4_STRPU/82-385--------------------------------------------------------------------------------
W4XVQ5_STRPU/118-400--------------------------------------------------------------------------------
W5M5G7_LEPOC/114-388--------------------------------------------------------------------------------
W5X997_9BACT/100-533--------------------------------------------------------------------------------
W5XA59_9BACT/96-545--------------------------------------------------------------------------------
W8EWI8_9BACT/105-543--------------------------------------------------------------------------------
W8F2B5_9BACT/111-544--------------------------------------------------------------------------------
X5DC27_9BACT/316-598--------------------------------------------------------------------------------

PF03996

HEMA_CVMA5/9-391--------------------------------------TLLL................LIXCQLVFGFN..EPLNIVSHL
HEMA_INCAA/19-420--------------------------------------ICLQKQVNSSFSLHNGFGGNLYATEEKRMFELVKPKAGASVL
HEMA_BRV1/2-378--------------------------------------LSLI................LFFPSFAFAATPVTPYYGPGHI

PF14286

D4LDC0_RUMC1/65-436------------------------------------------------------ENRNLAKFPSFSWSDYISGKYTADIA
C4Z3Y8_EUBE2/59-440------------------------------------------------------EKRKLSSFPQFSMESFLDGTYFSGVD
R6N2Z9_9CLOT/53-417------------------------------------------------------EKRELTKFPEFSFQALADGSYFKQVD

PF16822

M4X2G9_PSEDE/89-360--------------------------------------------------------------------------------
D9SK13_GALCS/90-349--------------------------------------------------------------------------------
D7CVL9_TRURR/113-377--------------------------------------------------------------------------------
A4XSW9_PSEMY/87-346--------------------------------------------------------------------------------
A7IG51_XANP2/41-300--------------------------------------------------------------------------------
Q0VSK8_ALCBS/79-348--------------------------------------------------------------------------------
D9SC65_GALCS/39-314--------------------------------------------------------------------------------
Q2KWS4_BORA1/105-364--------------------------------------------------------------------------------
A4XSW7_PSEMY/65-332--------------------------------------------------------------------------------
A8LND2_DINSH/79-327--------------------------------------------------------------------------------
C4LEL0_TOLAT/54-306--------------------------------------------------------------------------------
Q0VSL0_ALCBS/86-342--------------------------------------------------------------------------------
D7CSL0_TRURR/51-309--------------------------------------------------------------------------------
F6AHE0_PSEF1/87-346--------------------------------------------------------------------------------
A9BZH9_DELAS/53-312--------------------------------------------------------------------------------
A7IG52_XANP2/88-341--------------------------------------------------------------------------------
A8ICK2_AZOC5/86-338--------------------------------------------------------------------------------
H9UGT7_SPIAZ/108-374--------------------------------------------------------------------------------
F6AHE2_PSEF1/62-330--------------------------------------------------------------------------------
A8ICK4_AZOC5/30-289--------------------------------------------------------------------------------
A4XR24_PSEMY/81-343--------------------------------------------------------------------------------
A4XR27_PSEMY/64-322--------------------------------------------------------------------------------
A9BZH8_DELAS/91-352--------------------------------------------------------------------------------
C1DP87_AZOVD/81-346--------------------------------------------------------------------------------
C1DP90_AZOVD/67-327--------------------------------------------------------------------------------
F2KL48_PSEBN/64-330--------------------------------------------------------------------------------
ALGX_PSEAE/64-325--------------------------------------------------------------------------------
ALGJ_PSEAE/85-355--------------------------------------------------------------------------------
Q6N6N6_RHOPA/99-362--------------------------------------------------------------------------------
ALGJ_PSESM/81-346--------------------------------------------------------------------------------
Q888J0_PSESM/99-365--------------------------------------------------------------------------------
ALGJ_PSEPK/81-346--------------------------------------------------------------------------------

PF00657

O04702_DAUCA/33-364----IFNFG-DA------------NS--------------------------DTGAFAAWFFGNPPFFGQSYFNGSAGRV
Q39308_BRANA/36-320----LFTFG-DS------------NF--------------------------DAGNRMFLAGTRFPQNFWPYGKSRDDPT
AOAH_HUMAN/257-543----IILLG-DS------------A.--------------------------............................
GDL49_ARATH/37-365----VFNFG-DS------------NS--------------------------DTGELSSGLGFLPQPSYEITFFRSPTSG
Q9A6E2_CAUCR/200-399----IVAFG-DS------------IT--------------------------D...........................
F0K6Q8_CLOAE/64-257----ILVMG-DS------------LA--------------------------K...........................
A5FND2_FLAJ1/74-458----IVHIG-DS------------HI--------------------------Q...........................
A0A030Y1E2_PSEAI/215-418----LVTLG-DS------------IT--------------------------D...........................
D4FZ14_BACNB/25-235----VVAFG-DS------------NT--------------------------R...........................
D4FXT7_BACNB/43-243----IAAVG-DS------------LT--------------------------E...........................
D6EFV3_STRLI/66-296----VAAVG-DS------------IT--------------------------R...........................
Q9LHY3_ORYSJ/5-203----LVLFG-DS------------IT--------------------------ELSF........................
Q98E95_RHILO/55-223----IVGFG-DS------------LT--------------------------A...........................
H0H5K0_RHIRD/5-204----VLCFG-DS------------LT--------------------------W...........................
RHA1_ASPAC/20-225----VYLAG-DS------------TM--------------------------AKNGG.......................
Q40317_MEDSA/37-362----IFSFG-AS------------NV--------------------------DTGGLAAAFRAPPSPYGQTYFNRSTGRF
Q9KZR1_STRCO/239-441----VVAFG-DS------------IT--------------------------D...........................
A6ZNX3_YEAS7/6-203----FLLFG-DS------------IT--------------------------EFAFNT......................
APG_ARATH/205-524----VFFFG-DS------------VF--------------------------DTGNNNNLETKIKSNYRPYGMDFKFRVA
GDL88_ARATH/5-204----IVLFG-DS------------IT--------------------------AQSF........................
B8ZUH2_MYCLB/42-222----YVAIG-DS------------QT--------------------------E...........................
F0KA74_CLOAE/3-182----LVCIG-DS------------LT--------------------------Y...........................
Q9XIY6_ORYSJ/32-357----VFNFG-DS------------NS--------------------------DTGGFWAAFPAQQAPFGMTYFRRPAGRA
F7URY0_SYNYG/103-399----IVVLG-DS------------FS--------------------------EAIQVDEDETYW................
L8ADB1_BACIU/5-198----IYLAG-DS------------TV--------------------------QTYGD.......................
GCAT_AERHY/28-322----IVMFG-DS------------LS--------------------------DTGKM.......................
APG_BRANA/126-441----VFFFG-DS------------IF--------------------------DTGNNNNLDTKLKCNYRPYGMDFPMGVA
GUNE_CLOTM/606-804----IEFIG-DS------------IT--------------------------C...........................
GDL20_ARATH/34-330----LFTFG-DS------------NF--------------------------DAGNKKFLTSAPLPQNFWPYGKSRDDPK
PLB1_RABIT/741-1015----VAALG-DS------------LT--------------------------A...........................
O13496_NEOPA/166-382----IEFIG-DS------------IT--------------------------C...........................
D6ETP1_STRLI/75-262----LMMLG-DS------------TA--------------------------A...........................
GDL17_ARATH/35-352----LFIFG-DS------------LV--------------------------DNGNNNRLLSLARANYRPYGIDFPQGTT
GDL14_ARATH/33-344----YFIFG-DS------------LV--------------------------DNGNNNRLRSIARADYFPYGIDFGGPTG
ESM1_ARATH/37-340----LFTFG-DS------------YY--------------------------DAGNKVFLSQRKDLPQTYWPYGKSRDYP
GDL84_ARATH/6-205----IFLFG-DS------------IT--------------------------EESF........................
IAH1_MOUSE/18-213----VLLFG-DS------------IT--------------------------QFSF........................
O30643_MYCHY/42-337----YLALG-DS------------LT--------------------------A...........................
Q9AYM5_VIGUN/9-201----IVLFG-SS------------II--------------------------QMSF........................
Q9AUZ9_ORYSJ/6-205----MVLFG-DS------------IT--------------------------EQSF........................
LIP4_ARATH/41-355----IFNFG-DS------------NS--------------------------DTGGLVAGLGYPIGFPNGRLFFRRSTGR
LIP1_PHOLU/28-343----LYVFG-DS------------LS--------------------------D...........................
PLB1_RABIT/394-668----IGAMG-DS------------LT--------------------------A...........................
E1CZP1_VIBPH/147-406----VVALG-DS------------LS--------------------------DTGNIFNASQWRFPNPNSWFL.......
O05695_RHILE/46-219----IVAFG-TS------------LT--------------------------AR..........................
Q9Y7C6_ASPTE/61-245----ILPLG-AS------------IT--------------------------W...........................
B8GZL4_CAUCN/136-332----IEFIG-DS------------HT--------------------------V...........................
GDL2_ARATH/38-352----IFNFG-DS------------NS--------------------------DTGGLVAGLGYSIGLPNGRSFFQRSTGR
E8V9H4_BACST/5-202----YTALG-DS------------LT--------------------------T...........................
IAH1_SCHPO/40-217----LTIIG-DS------------IT--------------------------QKGF........................
A0A023YSK5_ECOLX/30-196----LLILG-DS------------LS--------------------------A...........................
F7UR16_SYNYG/108-371----VVFVG-DS------------FT--------------------------A...........................
F7UTB4_SYNYG/22-217----VLAMG-DS------------LV--------------------------Y...........................
Q98EU1_RHILO/215-418----VIAIG-DS------------IT--------------------------D...........................
GDL61_ARATH/35-364----IFNFG-DS------------NS--------------------------DTGGFWAAFPAQSGPWGMTYFKKPAGRA
D6EF39_STRLI/5-186----YVAVG-DS------------FT--------------------------E...........................
Q98FI8_RHILO/49-230----LLVLG-DS------------SA--------------------------ASVGI.......................
PLB1_RABIT/1097-1363----VAALG-DS------------LT--------------------------............................
A0A011SWS0_VIBPH/23-192----LLVLG-DS------------LS--------------------------A...........................
D6ESA2_STRLI/10-188----LVAVG-DS------------FT--------------------------E...........................
F0KDL5_CLOAE/81-259----YIAVG-DS------------VT--------------------------A...........................
O82681_DIGLA/36-364----IFNFG-DS------------NS--------------------------DTGGFWAAFPAENPPNGMTYFKRPAGRV
GDL51_ARATH/33-334----LFTFG-DS------------SY--------------------------DVGNTKFFSSEFDPATTWPYGDSIDDPS
Q9N4P5_CAEEL/105-346----VGAMG-DS------------LA--------------------------S...........................
O13497_NEOPA/65-271----IMPMG-DS------------IT--------------------------F...........................
Q9RLB8_RUMFL/46-256----IMPLG-DS------------IT--------------------------Y...........................

PF13472

A6CB21_9PLAN/150-378-----ACVG-DS.----.-----.FV--------------------------F---------------------------
D1PUP8_9BACT/35-254-----VYVG-NS.----.-----.IT--------------------------Y---------------------------
B3ZRE8_BACCE/94-261-----VIVG-DE.----.-----ASS--------------------------S---------------------------
B3JF97_9BACE/27-230-----HTIG-DS.----.-----.TM--------------------------A---------------------------
D3I0Q9_9BACT/27-262-----HTIG-DS.----.-----.TM--------------------------A---------------------------
D9ST65_CLOC7/48-258-----WIVG-DS.----.-----.TV--------------------------S---------------------------
C9P7F5_VIBME/587-832-----FIVG-DS.----.-----.TA--------------------------A---------------------------
D0KJY6_PECWW/280-526-----FLVG-DS.----.-----..T--------------------------A---------------------------
A6VT95_MARMS/597-842-----FIIG-DS.----.-----.TA--------------------------S---------------------------
C7PCM7_CHIPD/56-238-----GVIG-DS.----.-----.QG--------------------------T---------------------------
A0A015V9G1_BACFG/26-237-----VYIG-NS.----.-----.IT--------------------------Q---------------------------
A0L6K4_MAGSM/99-344-----LALG-DS.----.-----.HL--------------------------Y---------------------------
A6CFV6_9PLAN/46-231-----LFLG-NS.----.-----.IT--------------------------L---------------------------
Q5WDC0_BACSK/80-245-----VFFG-SS.----.-----SIE--------------------------N---------------------------
B9XGI8_PEDPL/55-242-----AICG-DS.----.-----.IT--------------------------E---------------------------
Q55JQ6_CRYNB/163-345-----GVLG-GS.----.-----.VS--------------------------A---------------------------
A0R4U0_MYCS2/44-205-----AVIG-DQ.----.-----.NT--------------------------A---------------------------
A4AUT7_MARSH/28-205-----LIIG-DS.----.-----.IS--------------------------I---------------------------
A6DGK9_9BACT/47-216-----LIIG-DS.----.-----.IS--------------------------I---------------------------
A6DN56_9BACT/46-229-----LILG-DS.----.-----.IS--------------------------I---------------------------
A6DFI9_9BACT/47-227-----LLVG-DS.----.-----.IS--------------------------I---------------------------
A6C0R7_9PLAN/137-294-----LLIG-DS.----.-----.VS--------------------------R---------------------------
B4DAN0_9BACT/47-221-----LLIG-DS.----.-----.IS--------------------------E---------------------------
C9RLP9_FIBSS/29-241-----YMLG-DS.----.-----.TM--------------------------Q---------------------------
B8HEE5_ARTCA/19-203-----VTLG-DS.----.-----.RT--------------------------Q---------------------------
D4P7Z6_9CAUD/47-228-----VTLG-DS.----.-----.RT--------------------------Q---------------------------
Q26FJ0_FLABB/320-507-----VVLG-SS.----.-----.TA--------------------------A---------------------------
D4LAZ2_RUMC1/45-211-----AFLG-GS.----.-----.VT--------------------------A---------------------------
A6DGG0_9BACT/306-477-----AFLG-GS.----.-----.IT--------------------------E---------------------------
A6C1A5_9PLAN/64-235-----AFLG-GS.----.-----.IT--------------------------E---------------------------
C6VTV7_DYAFD/306-477-----AFLG-GS.----.-----.IT--------------------------H---------------------------
Q024D6_SOLUE/343-514-----AFLG-GS.----.-----.IT--------------------------Q---------------------------
C6XTK4_PEDHD/89-262-----AFIG-GS.----.-----.IT--------------------------Q---------------------------
A6CD84_9PLAN/59-238-----AYLG-GS.----.-----ITA--------------------------A---------------------------
B1QLA1_CLOBO/9-176-----VFLG-GS.----.-----.IT--------------------------E---------------------------
B1QZ80_CLOBU/39-204-----AFLG-GS.----.-----.IT--------------------------Q---------------------------
D1PQR9_9FIRM/213-389-----AFLG-GS.----.-----.IT--------------------------Q---------------------------
D4J178_BUTFI/214-387-----CYIG-GS.----.-----.IT--------------------------Q---------------------------
C7GE42_9FIRM/218-391-----AYIG-GS.----.-----.IT--------------------------Q---------------------------
C6D766_PAESJ/54-231-----AFIG-GS.----.-----.IT--------------------------H---------------------------
A4F260_9BACL/79-256-----AYIG-GS.----.-----.IT--------------------------H---------------------------
D4LBB7_RUMC1/90-255-----GTIG-GS.----.-----.IT--------------------------Q---------------------------
B0MNZ3_9FIRM/121-287-----GFIG-GS.----.-----.IT--------------------------Q---------------------------
A9KK54_CLOPH/36-202-----GFIG-GS.----.-----.IT--------------------------Q---------------------------
A8SWK4_9FIRM/25-191-----GFLG-GS.----.-----.IT--------------------------Q---------------------------
D4CMI8_9FIRM/24-190-----GFFG-GS.----.-----.IT--------------------------Q---------------------------
D4JWU9_9FIRM/107-271-----AFIG-GS.----.-----.IT--------------------------E---------------------------
F1TIB6_9CLOT/41-206-----AYLG-GS.----.-----.IT--------------------------E---------------------------
D9SWK7_CLOC7/42-207-----VYLG-AS.----.-----.IT--------------------------E---------------------------
I8IAV0_ASPO3/31-220-----LLAG-DS.----.-----.TT--------------------------A---------------------------
Q9NET4_CAEEL/135-382-----AAIG-DS.----.-----.YS--------------------------S---------------------------
D4K132_9FIRM/101-367-----VALG-DS.----.-----.IV--------------------------S---------------------------
C7NNZ0_HALUD/159-325-----LAYG-TS.----.-----.IT--------------------------E---------------------------
C7MWU0_SACVD/42-317-----VSLG-DS.----.-----.TL--------------------------S---------------------------
C6WNW7_ACTMD/46-324-----VSLG-DS.----.-----.AM--------------------------A---------------------------
Q2JSP6_SYNJA/145-318-----VVLG-SS.----.-----.VA--------------------------L---------------------------
B7K022_CYAP8/136-309-----VVIG-SS.----.-----.VA--------------------------E---------------------------
Q7NG29_GLOVI/223-396-----VVIG-SS.----.-----.VA--------------------------L---------------------------
C8WV25_ALIAD/4-203-----LHLG-DS.----.-----.IA--------------------------Y---------------------------
A2SLH8_METPP/326-507-----VAMG-SS.----.-----.TA--------------------------E---------------------------
D1YEJ8_PROAA/217-485-----TVLG-DS.----.-----.YS--------------------------A---------------------------
D4H968_PROAS/4-269-----TVLG-DS.----.-----.YS--------------------------A---------------------------
C7QHD3_CATAD/44-286-----LALG-DS.----.-----.LG--------------------------A---------------------------
D2SC17_GEOOG/45-295-----VALG-SS.----.-----.FA--------------------------A---------------------------
B0R7G2_HALS3/8-179-----RVLG-DS.----.-----.VA--------------------------A---------------------------
C7Q7I2_CATAD/34-215-----AVLG-DS.----.-----.IA--------------------------E---------------------------
C5AYH8_METEA/18-261-----LALG-DS.----.-----.LA--------------------------Y---------------------------
C4LKI0_CORK4/42-288-----VALG-DS.----.-----.YA--------------------------S---------------------------
C4LIB2_CORK4/93-341-----VALG-DS.----.-----YAS--------------------------V---------------------------
C8NQ69_COREF/53-285-----IALG-DS.----.-----.YA--------------------------A---------------------------
C6R8G3_9CORY/32-256-----VALG-DS.----.-----YAA--------------------------M---------------------------
C2CL07_CORST/42-274-----VALG-DS.----.-----YAS--------------------------M---------------------------
C0E4P4_9CORY/59-301-----VAFG-DS.----.-----.FA--------------------------A---------------------------
C7Q9F9_CATAD/192-424-----VVIG-DS.----.-----.TA--------------------------A---------------------------
C8NR28_COREF/64-307-----VAFG-DS.----.-----.FA--------------------------A---------------------------
Q4PCC7_USTMA/4-264-----IAIG-SS.----.-----.FA--------------------------A---------------------------
B0RD91_CLAMS/80-246-----LMFG-DS.----.-----.FI--------------------------L---------------------------
D0WS14_9ACTO/82-334-----VALG-DS.----.-----.YA--------------------------S---------------------------
Q2J4R6_FRASC/58-292-----AVLG-DS.----.-----.YS--------------------------S---------------------------
Q2JGN4_FRASC/87-354-----VALG-DS.----.-----.YS--------------------------S---------------------------
D3Q6I6_STANL/33-249-----TALG-DS.----.-----.YA--------------------------S---------------------------
C6WBG5_ACTMD/46-260-----LALG-DS.----.-----.FA--------------------------S---------------------------
C7Q4A1_CATAD/38-331-----AALG-DS.----.-----.YT--------------------------A---------------------------
C6WEE8_ACTMD/40-312-----VALG-DS.----.-----.YT--------------------------A---------------------------
Q59837_9ACTO/42-313-----VALG-DS.----.-----YTA--------------------------G---------------------------
B0RDF3_CLAMS/61-325-----VSLG-DS.----.-----.YS--------------------------T---------------------------
E3J726_FRASU/30-260-----VAMG-SS.----.-----.FA--------------------------A---------------------------
D0L3H8_GORB4/59-296-----VSLG-SS.----.-----.YA--------------------------A---------------------------
Q2G7C8_NOVAD/37-269-----VALG-SS.----.-----.FA--------------------------A---------------------------
B1MBB4_MYCA9/6-245-----VALG-SS.----.-----.MA--------------------------A---------------------------
A0A049DM81_MYCTX/5-247-----VALG-SS.----.-----.MA--------------------------A---------------------------
Q1BEL5_MYCSS/5-240-----VALG-SS.----.-----.MA--------------------------A---------------------------
C8X8C1_NAKMY/4-247-----AALG-SS.----.-----.FA--------------------------A---------------------------
D5UYZ9_TSUPD/8-250-----AALG-SS.----.-----.YA--------------------------S---------------------------
C3JHG1_RHOER/48-287-----VALG-DS.----.-----.RA--------------------------S---------------------------
I0WS61_9NOCA/25-264-----VALG-DS.----.-----.RA--------------------------A---------------------------
Q0SDG5_RHOSR/112-351-----VALG-DS.----.-----.RA--------------------------T---------------------------
Q5YWR3_NOCFA/42-272-----VALG-DS.----.-----.GA--------------------------A---------------------------
C7MPN1_SACVD/36-282-----VALG-DS.----.-----.YT--------------------------S---------------------------
A3KIR8_STRAM/40-281-----VALG-DS.----.-----.YS--------------------------A---------------------------
A4FQW5_SACEN/16-253-----VALG-DS.----.-----.AA--------------------------A---------------------------
C7Q6B9_CATAD/40-284-----VALG-DS.----.-----.MA--------------------------S---------------------------
C6WQR1_ACTMD/40-279-----AALG-DS.----.-----.MA--------------------------S---------------------------
A0ACN1_STRAM/56-294-----VALG-DS.----.-----.FS--------------------------S---------------------------
B5GK11_STRSH/58-296-----AALG-DS.----.-----.YS--------------------------S---------------------------
E8RZ59_MICSL/43-287-----VALG-DS.----.-----.YT--------------------------S---------------------------
D3Q5A1_STANL/36-280-----VALG-DS.----.-----.FT--------------------------S---------------------------
D7B873_NOCDD/48-286-----VSLG-DS.----.-----.FV--------------------------A---------------------------
C7QAZ6_CATAD/32-275-----VALG-DS.----.-----YTA--------------------------V---------------------------
C6W714_DYAFD/85-374-----FVLG-ES.----.-----.TT--------------------------I---------------------------
D6SU72_9DELT/52-277-----MILG-GS.----.-----...--------------------------T---------------------------
B7FQA7_PHATC/284-494-----LVMG-GS.----.-----.VT--------------------------R---------------------------
Q7UHB8_RHOBA/116-390-----VALG-GS.----.-----..S--------------------------V---------------------------
A3IGT7_9CHRO/5-189-----ILVG-DS.----.-----.IF--------------------------D---------------------------
A9W7C8_METEP/41-224-----VLLG-DS.----.-----VFD--------------------------N---------------------------
D2VPA0_NAEGR/183-378-----EFIG-DS.----.-----.IT--------------------------C---------------------------
A0A059FZA4_9RHOB/45-228-----MVIG-DS.----.-----.IS--------------------------L---------------------------
A0M4R3_GRAFK/29-191-----LFVG-NS.----.-----.LT--------------------------Y---------------------------
A1ZSQ7_9BACT/37-218-----LFLG-NS.----.-----..Y--------------------------T---------------------------
C7N6X3_SLAHD/4-173-----LMLG-NS.----.-----.LT--------------------------T---------------------------
B0PGN9_9FIRM/4-174-----LMLG-NS.----.-----FTF--------------------------T---------------------------
A6C7M7_9PLAN/118-270-----TVIG-DS.----.-----.VT--------------------------A---------------------------
A9DZV2_9RHOB/29-212-----LVLG-DS.----.-----.IM--------------------------A---------------------------
A3TT74_9RHOB/30-207-----VVAG-DS.----.-----.VM--------------------------A---------------------------
Q1GDU1_RUEST/29-214-----LAIG-DS.----.-----.LM--------------------------A---------------------------
A3X495_9RHOB/37-223-----LVMG-DS.----.-----LLA--------------------------W---------------------------
Q0FN89_PELBH/30-215-----LMMG-DS.----.-----MLA--------------------------T---------------------------
A3SQH4_9RHOB/29-214-----LVMG-DS.----.-----.ML--------------------------A---------------------------
B5JQV4_9BACT/5-178-----VLIG-DQ.----.-----.IS--------------------------E---------------------------
Q98QP8_MYCPU/123-384-----VTFG-DS.----.-----.IA--------------------------A---------------------------
Q4A5V3_MYCS5/112-382-----IALG-DS.----.-----.IA--------------------------A---------------------------
C5J6Z9_MYCCR/63-342-----LAIG-DS.----.-----.VT--------------------------A---------------------------
Q4A638_MYCS5/66-330-----LAFG-DS.----.-----.IT--------------------------A---------------------------
C7HER8_CLOTM/72-237-----LIIG-DD.----.-----.IA--------------------------Q---------------------------
B1V222_CLOPF/89-252-----LVLG-NG.----.-----.VG--------------------------L---------------------------
C6JH48_9FIRM/175-357-----IFVG-DSR----T-----YFM--------------------------Q---------------------------
C6JEJ0_9FIRM/144-325-----IFVG-DS.----.-----.RT--------------------------A---------------------------
C0CUW9_9CLOT/13-215-----KIIG-DS.----.-----.IA--------------------------A---------------------------
B6WR90_9DELT/11-187-----FFFG-DS.----.-----.LT--------------------------L---------------------------
A0LCN0_MAGSM/5-178-----LFVG-DR.----.-----.FV--------------------------A---------------------------
Q3I1P3_NOSCO/11-184-----CFIG-ES.----.-----.FV--------------------------N---------------------------
A6SVS4_JANMA/15-191-----CFVG-DS.----.-----.FV--------------------------Q---------------------------
Q9WX72_KOMXY/391-555-----VTIG-DS.----.-----.RT--------------------------E---------------------------
C7NJR7_KYTSD/35-207-----CFVG-DG.----.-----.SV--------------------------S---------------------------
C6R448_9MICC/9-180-----VAVG-DD.----.-----.LL--------------------------A---------------------------
C7MDV1_BRAFD/19-197-----IALG-DE.----.-----.LL--------------------------A---------------------------
C0VZX9_9ACTO/7-177-----CVVG-DE.----.-----.LV--------------------------S---------------------------
D0WRR1_9ACTO/4-174-----FFIG-DE.----.-----.LV--------------------------A---------------------------
C0W8N0_9ACTO/7-176-----HFIG-DE.----.-----.LV--------------------------A---------------------------
A7BEA0_9ACTO/4-180-----CFIG-DE.----.-----.LV--------------------------A---------------------------
B4VFY0_9ACTO/4-206-----MFVG-DS.----.-----.MT--------------------------I---------------------------
D6EIK2_STRLI/5-204-----MFVG-DS.----.-----.MT--------------------------I---------------------------
C9YTJ8_STRSW/23-224-----MPVG-DS.----.-----.MT--------------------------I---------------------------
D1JW12_9BACE/105-286-----VHIG-DS.----.-----.HI--------------------------R---------------------------
D4LCL4_RUMC1/194-360-----IFYG-DS.----.-----.IT--------------------------A---------------------------
A9ERQ8_SORC5/256-427-----FFLG-DS.----.-----..I--------------------------T---------------------------
Q2IJI2_ANADE/216-377-----VFLG-DS.----.-----.IG--------------------------A---------------------------
C7CE49_METED/90-259-----LSIG-SS.----.-----..S--------------------------A---------------------------
B1LYU8_METRJ/69-238-----LAIG-GS.----.-----.AA--------------------------P---------------------------
Q08RB4_STIAD/155-337-----EFIG-DS.----.-----.IT--------------------------A---------------------------
Q09AA0_STIAD/808-992-----VQLG-AS.----.-----...--------------------------.---------------------------
A1TPP3_ACIAC/38-217-----EIFG-DS.----.-----.IA--------------------------R---------------------------
D9QH72_BRESC/63-251-----VQFG-DS.----.-----.HT--------------------------A---------------------------
C1JGV8_OENOE/138-305-----TWIG-DS.----.-----.LT--------------------------A---------------------------
D2EH32_PEDAC/143-309-----AWIG-DS.----.-----.IT--------------------------A---------------------------
A3TNT3_9MICO/8-226-----VALG-DS.----.-----.YA--------------------------A---------------------------
A1R9P0_ARTAT/42-278-----VALG-DS.----.-----..Y--------------------------T---------------------------
A0K019_ARTS2/42-283-----IAVG-DS.----.-----.YT--------------------------A---------------------------
D5US67_TSUPD/127-286-----VVIG-AS.----.-----.IS--------------------------T---------------------------
A0R4U1_MYCS2/55-233-----LFIG-DS.----.-----.YT--------------------------A---------------------------
A1T9E0_MYCVP/41-214-----AVVG-DS.----.-----.YT--------------------------T---------------------------
A0A038FFY2_MYCTX/41-217-----AVIG-DS.----.-----.YT--------------------------T---------------------------
C0FVT0_9FIRM/128-299-----VFIG-DS.----.-----.RT--------------------------V---------------------------
A6NRB4_9FIRM/119-293-----VFMG-DS.----.-----.RT--------------------------D---------------------------
D4KZ95_9FIRM/94-264-----LMIG-DS.----.-----.RT--------------------------V---------------------------
C0D9S1_9CLOT/121-291-----LFIG-DS.----.-----.RT--------------------------V---------------------------
A8RNE1_CLOBW/141-311-----LFIG-DS.----.-----.RT--------------------------V---------------------------
A6BEQ0_9FIRM/72-271-----VTLG-DS.----.-----..Y--------------------------T---------------------------
A9W7Z7_METEP/562-744-----LCIG-DS.----.-----...--------------------------.---------------------------
C2L1C0_9FIRM/5-187-----LIYG-DS.----.-----.IS--------------------------Y---------------------------
C3Q1I0_9BACE/291-472-----GIIG-DS.----.-----.YV--------------------------K---------------------------
D1PYA2_9BACT/87-263-----GVIG-DS.----.-----YVK--------------------------N---------------------------
B9CP22_9ACTN/198-361-----VVIG-DS.----.-----.IA--------------------------Q---------------------------
B2AV39_PODAN/50-240-----VLIG-DS.----.-----MIE--------------------------R---------------------------
D4KBN7_9FIRM/161-338-----AFLG-DS.----.-----.LT--------------------------V---------------------------
A8SEI6_9FIRM/112-289-----SFVG-DS.----.-----.LT--------------------------Q---------------------------
D2VNU3_NAEGR/46-260-----IALG-DS.----.-----.IT--------------------------K---------------------------
A1DLF9_NEOFI/8-203-----LCFG-AS.----.-----.LT--------------------------A---------------------------
C7YGY2_NECH7/9-186-----LCFG-DS.----.-----.LT--------------------------S---------------------------
Q2H5R4_CHAGB/10-200-----LCFG-DS.----.-----.LT--------------------------A---------------------------
B2AU74_PODAN/10-195-----LCFG-DS.----.-----.LT--------------------------A---------------------------
A7E7J9_SCLS1/25-195-----LCLG-DS.----.-----.LT--------------------------E---------------------------
A7E806_SCLS1/10-187-----LCFG-NS.----.-----.LT--------------------------Q---------------------------
C9KK96_9FIRM/165-368-----EFVG-DS.----.-----.IT--------------------------A---------------------------
A6GTH0_9BURK/185-361-----VFLG-SS.----.-----.SF--------------------------H---------------------------
Q10VH9_TRIEI/81-296-----LLLG-DS.----.-----.VA--------------------------N---------------------------
E0UE35_CYAP2/81-296-----FLVG-DS.----.-----..L--------------------------A---------------------------
A8YLF5_MICAE/88-300-----MLIG-DS.----.-----..I--------------------------A---------------------------
B7JX19_CYAP8/84-296-----FLLG-DS.----.-----.IA--------------------------N---------------------------
B4VXI7_9CYAN/89-309-----LLLG-DS.----.-----.IV--------------------------N---------------------------
Q3MG18_ANAVT/81-301-----LLLG-DS.----.-----.II--------------------------N---------------------------
A0ZJZ9_NODSP/81-301-----LIIG-DS.----.-----.IA--------------------------N---------------------------
A0YZ06_LYNSP/76-298-----LLLG-DS.----.-----..I--------------------------V---------------------------
B5W630_ARTMA/82-298-----MLLG-DS.----.-----.IA--------------------------N---------------------------
D3I482_9BACT/84-226-----LLIG-DS.----.-----.MA--------------------------D---------------------------
C5EAN0_BIFLI/201-341-----MMVG-DS.----.-----.VT--------------------------S---------------------------
A5CSX8_CLAM3/17-179-----VLLG-DS.----.-----.LT--------------------------G---------------------------
D1NVJ1_9BIFI/473-610-----LIVG-DS.----.-----.VT--------------------------E---------------------------
B5AX52_9CAUD/256-434-----CAMG-DS.----.-----.IT--------------------------N---------------------------
B8I9G0_CLOCE/36-210-----LVIG-DSF----L-----AMS--------------------------H---------------------------
C2Y714_BACCE/497-690-----ATFG-DS.----.-----.IT--------------------------W---------------------------
B6XSY2_9BIFI/34-205-----VIIG-DS.----.-----.LC--------------------------K---------------------------
Q8EVG3_MYCPE/337-526-----AFVG-DS.----.-----.LT--------------------------N---------------------------
B3T8L1_9ARCH/173-373-----FIVG-GS.----.-----.TT--------------------------Y---------------------------
D5SSJ8_PLAL2/90-278-----AFLG-NS.----.-----.FA--------------------------E---------------------------
B4D083_9BACT/413-601-----AFVG-NS.----.-----.LA--------------------------E---------------------------
A8SBH6_9FIRM/98-270-----LFIG-DS.----.-----NTV--------------------------R---------------------------
D1XVL9_9BACT/196-391-----AILG-NS.----.-----.IT--------------------------D---------------------------
D2QQH5_SPILD/51-232-----VFLG-NS.----.-----.LF--------------------------E---------------------------
A3ZLZ7_9PLAN/28-215-----VFLG-NT.----.-----.FI--------------------------E---------------------------
B4CVC8_9BACT/32-238-----LFLG-DT.----.-----.LL--------------------------E---------------------------
B9XFH7_PEDPL/48-240-----VLIG-DT.----.-----.LI--------------------------E---------------------------
A5FWG0_ACICJ/56-236-----VWLG-DS.----.-----.IT--------------------------E---------------------------
D5X549_THIK1/78-259-----VWLG-DS.----.-----.IT--------------------------Q---------------------------
Q0BTT4_GRABC/70-248-----VFYG-DS.----.-----.IT--------------------------Q---------------------------
A9HI78_GLUDA/63-245-----VWLG-DS.----.-----.IT--------------------------Q---------------------------
B2UPK1_AKKM8/69-229-----LFLG-SS.----.-----..T--------------------------M---------------------------
B7B7T9_9PORP/404-572-----VILG-NS.----.-----.IT--------------------------H---------------------------
A7SUP9_NEMVE/21-188-----LLVG-DS.----.-----.II--------------------------K---------------------------
C1C4W0_LITCT/43-205-----VFIG-DS.----.-----..N--------------------------V---------------------------
B4R5I2_DROSI/38-200-----IFLG-DC.----.-----.IF--------------------------E---------------------------
C4WWV9_ACYPI/38-200-----IMIG-DS.----.-----..I--------------------------I---------------------------
C8ZKR7_9CAUD/443-631-----ICYG-DS.----.-----.IA--------------------------A---------------------------
C2E6W6_LACJH/678-859-----VWLG-DS.----.-----.TF--------------------------E---------------------------
B8KGJ7_9GAMM/47-224-----LFVG-NSY----L-----YYN--------------------------D---------------------------
Q2Z0S4_9CAUD/77-253-----VVYG-DSR----A-----YQC--------------------------V---------------------------
Q47SW9_THEFY/34-291-----LSLG-DG.----.-----.LT--------------------------V---------------------------
D7B7J6_NOCDD/40-317-----LSLG-DS.----.-----.IS--------------------------V---------------------------
A6F4N9_9ALTE/13-215-----IAYG-DC.----.-----.NT--------------------------E---------------------------
C3QEU7_9BACE/179-342-----VFFG-SS.----.-----.FT--------------------------Q---------------------------
D4IKA2_9BACT/179-342-----VVIG-SS.----.-----.IT--------------------------H---------------------------
D4INC2_9BACT/183-346-----VVLG-SS.----.-----.IT--------------------------H---------------------------
A6DPU9_9BACT/162-332-----LFYG-SS.----.-----.IT--------------------------N---------------------------
D1W609_9BACT/162-327-----VVYG-TS.----.-----.IT--------------------------Q---------------------------
D3EGN9_GEOS4/190-357-----VIYG-TS.----.-----.IT--------------------------Q---------------------------
D3AB80_9CLOT/163-328-----LFYG-SS.----.-----.IT--------------------------H---------------------------
A8RI04_CLOBW/163-329-----LVYG-SS.----.-----.IT--------------------------H---------------------------
D3EIH1_GEOS4/143-315-----VTYG-SS.----.-----..I--------------------------T---------------------------
B8H9Y5_ARTCA/179-369-----VHYG-SS.----.-----.IS--------------------------Q---------------------------
D2PQC5_KRIFD/166-336-----ITYG-SS.----.-----.IT--------------------------Q---------------------------
D2KRC2_9CAUD/5-188-----IAFG-DS.----.-----.IF--------------------------A---------------------------
B8CFB8_THAPS/190-460-----VFFG-DS.----.-----.IT--------------------------E---------------------------
C6LX44_GIAIB/39-225-----LIYG-DS.----.-----.NG--------------------------A---------------------------
B1N3Y2_ENTHI/8-201-----FFYG-DS.----.-----.NL--------------------------Y---------------------------
D4J5M8_9FIRM/6-186-----ICYG-DS.----.-----.NT--------------------------Y---------------------------
C0D1G8_9CLOT/6-194-----LCYG-DS.----.-----.NT--------------------------W---------------------------
B0P4K6_9CLOT/5-202-----VCYG-DS.----.-----.NT--------------------------Y---------------------------
Q28MK4_JANSC/5-193-----LIFG-DS.----.-----.NS--------------------------H---------------------------
Q39HJ5_BURS3/9-204-----LCYG-DS.----.-----.NT--------------------------H---------------------------
A8W013_AGRRH/14-208-----LCYG-DS.----.-----.NT--------------------------H---------------------------
A4U1B6_9PROT/100-344-----LALG-DS.----.-----.QT--------------------------F---------------------------
A7K9Z4_9PHYC/41-196-----VLYG-DS.----.-----.IT--------------------------W---------------------------
B2FLV5_STRMK/35-209-----VAFG-HS.----.-----.VP--------------------------A---------------------------
D2QLR8_SPILD/52-228-----VFHG-HS.----.-----.VP--------------------------A---------------------------
B3C7M6_9BACE/46-223-----VFHG-HS.----.-----.VP--------------------------S---------------------------
C6XV53_PEDHD/53-230-----VFHG-HS.----.-----.VP--------------------------T---------------------------
A5CNW4_CLAM3/55-217-----VVMG-DS.----.-----.NT--------------------------N---------------------------
C9LYN9_SELS3/296-469-----AALG-DS.----.-----.IT--------------------------H---------------------------
C9KKD3_9FIRM/276-447-----AVLG-DS.----.-----.IS--------------------------H---------------------------
B7KL00_CYAP7/104-265-----LFYG-QS.----.-----.IT--------------------------R---------------------------
C5US72_CLOBO/411-600-----KILG-DS.----.-----.IG--------------------------A---------------------------
A3I2P8_9BACT/37-228-----LFLG-NS.----.-----..I--------------------------T---------------------------
D2R3I8_PIRSD/56-262-----VFLG-DS.----.-----ITY--------------------------G---------------------------
Q1YPD0_9GAMM/318-501-----LALG-DS.----.-----.YT--------------------------I---------------------------
A3TL07_9MICO/62-234-----VFLG-DS.----.-----.VA--------------------------E---------------------------
A7HAV9_ANADF/45-222-----LFFG-SS.----.-----.TV--------------------------A---------------------------
Q8KP08_9BACT/54-230-----LFVG-DS.----.-----.TG--------------------------Y---------------------------
A4S546_OSTLU/12-245-----VVAG-DS.----.-----.TA--------------------------C---------------------------
C1FIK9_MICSR/186-403-----VVVG-DS.----.-----.LV--------------------------T---------------------------
Q6AE96_LEIXX/17-180-----AVIG-DS.----.-----.IE--------------------------S---------------------------
B1M205_METRJ/17-182-----LFFG-DS.----.-----.VT--------------------------A---------------------------
B1M3V4_METRJ/6-173-----VFVG-DS.----.-----ITE--------------------------L---------------------------
B1LTZ6_METRJ/10-173-----VFIG-DS.----.-----ITA--------------------------A---------------------------
B0U7X0_METS4/36-232-----AFVG-DS.----.-----.LA--------------------------D---------------------------
Q6ACS0_LEIXX/64-231-----VAIG-GR.----.-----.AA--------------------------Q---------------------------
C4XUC8_DESMR/131-314-----AVVG-DS.----.-----.LA--------------------------V---------------------------
A7IVK2_PBCVM/122-270-----LMYG-DS.----.-----.IT--------------------------H---------------------------
C7Q7D8_CATAD/157-343-----LVTG-DS.----.-----.LS--------------------------D---------------------------
A5VBY8_SPHWW/103-291-----GVFG-DS.----.-----.FG--------------------------D---------------------------
C6RHF9_9PROT/168-353-----ILIG-DS.----.-----.IM--------------------------Q---------------------------
C8PHJ9_9PROT/240-425-----LFMG-DS.----.-----.LM--------------------------Q---------------------------
D2PRA6_KRIFD/46-221-----GVLG-ES.----.-----.TA--------------------------A---------------------------
Q1YKL3_MOBAS/54-228-----LVIG-DS.----.-----.SA--------------------------A---------------------------
Q0VS26_ALCBS/87-262-----LVVG-ES.----.-----.TA--------------------------A---------------------------
A0A030RMR7_PSEAI/57-230-----LLFG-ES.----.-----.TV--------------------------A---------------------------
A4XXU1_PSEMY/55-228-----LLIG-ES.----.-----.TV--------------------------A---------------------------
B1XWT3_LEPCP/47-232-----LVVG-DS.----.-----.AA--------------------------A---------------------------
Q6LG08_PHOPR/48-221-----LLIG-DS.----.-----.AA--------------------------A---------------------------
Q0F8N5_9RHOB/51-224-----LVLG-DS.----.-----.SA--------------------------A---------------------------
B7RN26_9RHOB/48-221-----LILG-DS.----.-----.SA--------------------------A---------------------------
C0Q8S6_DESAH/49-222-----LILG-DS.----.-----.AA--------------------------A---------------------------
A4F1H2_9RHOB/50-223-----LIAG-DS.----.-----.SA--------------------------A---------------------------
Q5LN18_RUEPO/38-210-----LIAG-DS.----.-----.SA--------------------------A---------------------------
A4BHN8_9GAMM/48-221-----LVIG-DS.----.-----.AA--------------------------A---------------------------
A6FTW8_9RHOB/64-237-----LVLG-DS.----.-----.SA--------------------------A---------------------------
A4JA74_BURVG/48-221-----LVVG-DS.----.-----.AA--------------------------A---------------------------
C8XKQ3_NAKMY/142-320-----VFLG-DS.----.-----.TS--------------------------V---------------------------
A8M302_SALAI/68-248-----VLLG-DS.----.-----.SA--------------------------L---------------------------
D2PP87_KRIFD/68-246-----AMIG-DS.----.-----.SA--------------------------A---------------------------
A1SF76_NOCSJ/69-248-----ALLG-DS.----.-----.SA--------------------------A---------------------------
C0W3H8_9ACTO/21-199-----VFLG-DA.----.-----.IT--------------------------T---------------------------
C4XN11_DESMR/67-258-----LLVG-DS.----.-----.LS--------------------------I---------------------------
A1SNE8_NOCSJ/71-225-----VVIG-DS.----.-----.WS--------------------------A---------------------------
A4AKB0_9ACTN/42-210-----AFYG-DS.----.-----.YT--------------------------L---------------------------

PF14606

Q7US24_RHOBA/217-394-EKPIVFYG-TS------------IT--------------------------H---------------------------
A4APA9_MARSH/176-358-QKPIVVYG-TS------------IA--------------------------Q---------------------------
Q01R43_SOLUE/183-360-SKPIVFYG-TS------------IT--------------------------H---------------------------
C6XT40_PEDHD/174-351-KKRIAVYG-SS------------VT--------------------------Q---------------------------
F0SBL3_PEDSD/182-361-TKPIIVYG-TS------------IA--------------------------Q---------------------------
D3IDS0_9BACT/151-329-EKAVVIYG-SS------------IV--------------------------Q---------------------------
C6CUH9_PAESJ/158-340-ERKMLLYG-SS------------IS--------------------------S---------------------------
D6D291_9BACE/177-350-.HRIAVYG-SS------------FT--------------------------Q---------------------------
D6D414_9BACE/177-354-KRPVVFYG-TS------------IL--------------------------Q---------------------------
Q8A1R6_BACTN/176-353-TKPIVFYG-TS------------IL--------------------------Q---------------------------
R7EPR9_9BACE/173-349-EKPVVFYG-TS------------IL--------------------------Q---------------------------

PF04311

W6REB0_9RHIZ/75-346.....VVVE-EK------------VV--------------------------E---------------------------
Q98H53_RHILO/33-310.....VEPQ-TP------------IA--------------------------E---------------------------
O83576_TREPA/55-376VSPPGVAVN-DS------------VA--------------------------E---------------------------

PF16255

A6L182_BACV8/24-226--KSVSILG-DS------------YS--------------------------T---------------------------
D6D1C7_9BACE/24-224--KSISILG-DS------------YS--------------------------T---------------------------
R7ECW1_9BACE/24-225--KKVSILG-DS------------YS--------------------------T---------------------------

PF08885

T2KQ07_9FLAO/22-260---KVLLLG-SC------------FV--------------------------E---------------------------
C0QCX9_DESAH/46-310---PIASMG-SC------------FA--------------------------R---------------------------
R5EPC9_9BACE/21-255---QILLLG-SC------------FA--------------------------E---------------------------
A5VDH6_SPHWW/41-313---KVATAG-SC------------FA--------------------------Q---------------------------
R6YAM1_9BACE/32-267---.MMLWG-SC------------FA--------------------------E---------------------------
R7HNG1_9BACT/21-257---AVMMLG-SC------------FA--------------------------E---------------------------
G2PK85_MURRD/21-260---KLMLLG-SC------------FV--------------------------E---------------------------
I2EY90_EMTOG/21-257---KIMTVG-SC------------FS--------------------------E---------------------------
B8IP12_METNO/42-312---RVATAG-SC------------FA--------------------------Q---------------------------
A4YK23_BRASO/229-462---RFFTMG-SC------------FA--------------------------R---------------------------
G8TR03_NIAKG/21-267---NILLMG-SC------------FT--------------------------E---------------------------
B1M3F5_METRJ/42-313---KVATGG-SC------------FA--------------------------Q---------------------------
R5M3J3_9BACE/21-258---NLLLMG-SC------------FA--------------------------T---------------------------
R7EUS3_9BACT/13-248---PLVLLG-SC------------FA--------------------------D---------------------------
D5MM94_9BACT/76-315---RVLAIG-SC------------FA--------------------------R---------------------------
R6Y730_9PORP/28-264---.TVLLG-SC------------FA--------------------------E---------------------------
R7J1F8_9BACT/24-253---RITMLG-SC------------FT--------------------------D---------------------------
F0P1S2_WEEVC/21-257---KIVSIG-SC------------FA--------------------------Q---------------------------
B9J8F4_AGRRK/41-310---KVATAG-SC------------FA--------------------------Q---------------------------
F8EN95_RUNSL/21-257---PVLTIG-SC------------FA--------------------------E---------------------------
G0IXU2_CYCMS/22-258---NIITIG-SC------------FS--------------------------E---------------------------
E8RMP0_ASTEC/39-308---KVVTIG-SC------------FA--------------------------Q---------------------------
C5AUI8_METEA/49-319---RIATAG-SC------------FA--------------------------Q---------------------------
L0G2R2_ECHVK/22-255---KIMSLG-SG------------FS--------------------------S---------------------------
G2Z7S8_FLABF/21-259---NLLLLG-SC------------FA--------------------------Q---------------------------
G8X6A0_FLACA/17-254---DLLLLG-SC------------FS--------------------------E---------------------------
G8ULQ0_TANFA/21-258---RTMLFG-SC------------FA--------------------------E---------------------------
G8PQJ6_PSEUV/51-307---RIFTVG-SC------------FA--------------------------R---------------------------
C7PMX6_CHIPD/22-258---KILMVG-SC------------FA--------------------------E---------------------------
A6LHC4_PARD8/21-258---RVVMMG-SC------------FA--------------------------E---------------------------
R7LF46_9BACT/50-294---RVMTIG-SC------------FA--------------------------E---------------------------
A0LXX4_GRAFK/22-257---.VFLIG-SC------------FV--------------------------E---------------------------
F0R195_BACSH/21-257---RLMLWG-SC------------FA--------------------------E---------------------------
F8JMP9_STREN/40-309---PVLTAG-SC------------FA--------------------------A---------------------------
E4T1X0_PALPW/20-256---AILTLG-SC------------FA--------------------------E---------------------------
R6X342_9BACT/24-260---KIVILG-SC------------FA--------------------------D---------------------------
A6L176_BACV8/21-257---RIMLFG-SC------------FA--------------------------E---------------------------
M9RBE9_9RHOB/323-562---RITAFG-SC------------FA--------------------------A---------------------------
R6L892_9BACE/21-258---RLLLLG-SC------------FA--------------------------T---------------------------
T2GGB5_DESGI/40-310---KIAAAG-SC------------FA--------------------------Q---------------------------
Q11RW7_CYTH3/21-254---TVVTIG-SC------------FS--------------------------D---------------------------
F4B2J3_KROS4/22-257---TLLLLG-SC------------FS--------------------------E---------------------------
R6FFG9_9BACE/21-258---HLMLMG-SC------------FA--------------------------S---------------------------
R5RV25_9BACE/22-258---SILLLG-SC------------FS--------------------------D---------------------------
A1S3K5_SHEAM/44-301---RISSAG-SC------------FA--------------------------Q---------------------------
F4L6L3_HALH1/23-258---.FLGIG-SC------------FV--------------------------E---------------------------
R5NCX1_9BACT/22-258---.LTLLG-SC------------FA--------------------------D---------------------------
R7D323_9BACE/32-279---RLMSLG-SC------------FS--------------------------E---------------------------
H6L5M5_SAPGL/25-259---RLMALG-SC------------FA--------------------------Q---------------------------
E6XET3_CELAD/21-258---QLLLLG-SC------------FV--------------------------E---------------------------
C3KQN9_RHISN/57-328---RIATAG-SC------------FA--------------------------Q---------------------------
F4KMJ5_PORAD/29-267---RILTLG-SC------------FS--------------------------E---------------------------
E4TT54_MARTH/21-257---RITSIG-SC------------FA--------------------------D---------------------------
D6D188_9BACE/31-268---HILLMG-SC------------FA--------------------------E---------------------------
A6H0Z4_FLAPJ/21-258---KIVSLG-SC------------FA--------------------------E---------------------------
H1ZDZ1_MYROD/21-259---KILCLG-SC------------FA--------------------------V---------------------------
C4XP38_DESMR/33-276---PVVHFG-SC------------FG--------------------------E---------------------------
W0EN83_9PORP/21-255---HLLLLG-SC------------FV--------------------------E---------------------------
W0EYV8_9SPHI/21-264---KILLIG-SC------------FT--------------------------E---------------------------
R5VH21_9PORP/22-257---.MLLVG-SC------------FT--------------------------E---------------------------
I4AP67_FLELS/21-272---KVFLMG-SC------------FS--------------------------E---------------------------
I0KF94_9BACT/21-257---RFVTVG-SC------------FA--------------------------E---------------------------
D4IN95_9BACT/21-252---RVLALG-SC------------FA--------------------------A---------------------------
A3U798_CROAH/21-257---SLVLLG-SC------------FV--------------------------E---------------------------
R5GUT3_9BACT/21-259---HVLMLG-SC------------FA--------------------------E---------------------------
F0RBR0_CELLC/21-260---KLLLLG-SC------------FA--------------------------E---------------------------
A1B3U8_PARDP/64-333---AIATAG-SC------------FA--------------------------Q---------------------------
I4C880_DESTA/46-310---PVASMG-SC------------FA--------------------------R---------------------------
Q121I3_POLSJ/60-298---PLVAFG-SC------------FA--------------------------S---------------------------
R6CLT6_9BACE/22-257---.IMSWG-SC------------FA--------------------------D---------------------------
X5DG71_9BACT/26-262---..LFMG-SC------------FT--------------------------E---------------------------
D5ATP2_RHOCB/41-310---RIVTAG-SC------------FA--------------------------Q---------------------------
R5YHQ3_9BACE/21-258---RMMLFG-SC------------FA--------------------------E---------------------------
R6SA44_9BACE/21-257---RLMLWG-SC------------FS--------------------------E---------------------------
S5XTM4_PARAH/50-309---PVFTIG-SC------------FA--------------------------R---------------------------
J7QVY3_METSZ/42-313---KVATGG-SC------------FA--------------------------Q---------------------------
R7JRE2_9BACT/59-292---RLLALG-SC------------FA--------------------------E---------------------------
A4AUF0_MARSH/21-260---NLLLLG-SC------------FV--------------------------E---------------------------
R6EUG1_9BACE/22-258---NIMLLG-SC------------FA--------------------------D---------------------------
Q5LH25_BACFN/21-258---QLLIMG-SC------------FA--------------------------E---------------------------
C6X454_FLAB3/21-258---QVFSVG-SC------------FA--------------------------T---------------------------
I3Z6K2_BELBD/21-257---SLYAIG-SC------------FS--------------------------T---------------------------
G0L2J8_ZOBGA/21-255---RLVFLG-SC------------FS--------------------------E---------------------------
I3YP53_ALIFI/21-252---RILALG-SC------------FA--------------------------E---------------------------
F9Z2U7_ODOSD/27-263---RLMMLG-SC------------FV--------------------------E---------------------------
R5JB51_9BACE/21-258---RLLLMG-SC------------FA--------------------------E---------------------------
D3HQS8_LEGLN/335-604---KIATAG-SC------------FA--------------------------Q---------------------------
F9YS98_CAPCC/21-256---KLVCLG-SC------------FA--------------------------D---------------------------
R7PCY6_9BACT/23-264---..GAIG-SC------------FA--------------------------Q---------------------------
Q28TN8_JANSC/41-309---KVFTAG-SC------------FA--------------------------Q---------------------------
L0FZB4_ECHVK/21-257---PILSIG-SC------------FS--------------------------A---------------------------
S5XXU5_PARAH/13-280---..VTAG-SC------------FA--------------------------Q---------------------------
H2JZH7_STRHJ/41-311---PVITAG-SC------------FA--------------------------R---------------------------
R7NWR5_9BACE/21-257---RIMLFG-SC------------FA--------------------------E---------------------------
D2QBX3_SPILD/37-300---.IFTIG-SC------------FA--------------------------R---------------------------
H8XPR8_FLAIG/21-258---KILLLG-SC------------FS--------------------------E---------------------------
T0U393_9STRE/22-259---KICFLG-AC------------TA--------------------------R---------------------------
D2QK40_SPILD/21-257---RIVTIG-SC------------FA--------------------------D---------------------------
R5CG89_9BACE/13-250---RLLLMG-SC------------FA--------------------------T---------------------------
R5WEX8_9BACT/23-254---.FLA.G-SC------------FS--------------------------E---------------------------
A5FIN8_FLAJ1/21-261---KILSVG-SC------------FA--------------------------E---------------------------
R6AYA1_9BACT/21-266---RVMFIG-SC------------FA--------------------------D---------------------------
E4RZ72_LEAB4/28-259---.IITMG-SC------------FS--------------------------E---------------------------
K4IFD9_PSYTT/21-259---KLLSLG-SC------------FA--------------------------E---------------------------
R5B7Q4_9BACE/21-258---RIIMLG-SC------------FT--------------------------D---------------------------
F3ZNK8_9BACE/22-259---SILSLG-SC------------FS--------------------------E---------------------------
L7W558_NONDD/21-252---KVVLLG-SC------------FT--------------------------E---------------------------
I3ZZB3_ORNRL/21-258---PLFSMG-SC------------FA--------------------------E---------------------------
A3HZZ3_9BACT/21-256---KFFSIG-SC------------FA--------------------------E---------------------------
R5BJ82_9BACE/23-256---RIVMLG-SC------------FS--------------------------D---------------------------
R6E4B6_9BACE/21-258---HILLIG-SC------------FA--------------------------E---------------------------
R5IRK1_9PORP/21-258---KIMMLG-SC------------FA--------------------------E---------------------------
B0UMN0_METS4/39-306---RVATAG-SC------------FA--------------------------Q---------------------------
R5PD70_9PORP/21-257---RICMLG-SC------------FA--------------------------E---------------------------
W0AHI1_9SPHN/141-410---RVGTAG-SC------------FA--------------------------Q---------------------------
I3YWC9_AEQSU/21-270---KILLLG-SC------------FS--------------------------E---------------------------
A2TZ06_9FLAO/22-258---KILLLG-SC------------FS--------------------------E---------------------------
D8LTE6_ECTSI/26-281---SFLLLG-SC------------FS--------------------------D---------------------------
E6SU26_BACT6/22-259---RLLSLG-SC------------FA--------------------------A---------------------------
C7M4J9_CAPOD/21-255---QILSIG-SC------------FA--------------------------V---------------------------
R5IIF1_9BACT/9-264---.VLSLG-SC------------FS--------------------------A---------------------------
R5GFU6_9PORP/21-256---AITLWG-SC------------FA--------------------------D---------------------------
R6M862_9BACE/23-259---PILLWG-SC------------FA--------------------------E---------------------------
C5AW44_METEA/40-311---RVATAG-SC------------FA--------------------------Q---------------------------
R5W2G8_9BACE/21-257---RLMIWG-SC------------FS--------------------------E---------------------------
A8LP01_DINSH/55-319---TVFALG-SC------------FA--------------------------R---------------------------
S5Y059_PARAH/41-311---KIITAG-SC------------FA--------------------------Q---------------------------
B0T687_CAUSK/47-313---KVFTIG-SC------------FA--------------------------R---------------------------
R7DF91_9PORP/21-258---KILLLG-SC------------FA--------------------------E---------------------------
C6W6S3_DYAFD/24-261---KILTIG-SC------------FA--------------------------E---------------------------
U5Q7D6_9BACT/21-253---NIISLG-SC------------FS--------------------------D---------------------------
W8FAI7_9BACT/20-256---RVLTIG-SC------------FS--------------------------D---------------------------
S5YTU2_PARAH/50-305---KVFTIG-SC------------FA--------------------------R---------------------------
F2IKK3_FLUTR/21-251---SIVQLG-SC------------FS--------------------------T---------------------------
F6GCA5_LACS5/22-256---KLLLLG-SC------------FS--------------------------E---------------------------
H1XPK2_9BACT/21-257---PIITLG-SC------------FA--------------------------E---------------------------
J9R834_RIEAN/21-258---QVFSIG-SC------------FA--------------------------S---------------------------
Q7MVG8_PORGI/56-293---KLFFVG-SC------------FS--------------------------L---------------------------
D5BGH9_ZUNPS/21-262---NIALFG-SC------------FV--------------------------E---------------------------
K4KIG2_SIMAS/57-326---SVYTVG-SC------------FA--------------------------R---------------------------
R5V0S4_9BACE/23-258---..LLLG-SC------------FA--------------------------E---------------------------
D9SAD6_FIBSS/55-314---RLAFFG-SC------------FA--------------------------D---------------------------
R7EIY0_9BACE/21-258---NLLLMG-SC------------FA--------------------------S---------------------------

PF13839

CPED1_HUMAN/757-1021..RKILFIG-DS------------TN--------------------------R---------------------------
A9U1Q5_PHYPA/72-368..KTLAFIG-DS------------VT--------------------------R---------------------------
TBL18_ARATH/227-526..KTLAFIG-DS------------VA--------------------------R---------------------------
TBL17_ARATH/190-490..KTLAFIG-DS------------VA--------------------------R---------------------------
TBL22_ARATH/122-412..KKMNFIG-DS------------VA--------------------------R---------------------------
TBL19_ARATH/121-411..KTMAFVG-DS------------VS--------------------------R---------------------------
A9RCM6_PHYPA/75-370..RSMVFAG-DS------------IA--------------------------R---------------------------
A9RAV2_PHYPA/82-374..RSIVFAG-DS------------IA--------------------------R---------------------------
A9T2B6_PHYPA/55-352..RSVVFAG-DS------------IS--------------------------R---------------------------
A9TUK8_PHYPA/53-350..RSMTFAG-DS------------IA--------------------------R---------------------------
TBL27_ARATH/131-413..KHLAFIG-DS------------MA--------------------------R---------------------------
TBL24_ARATH/132-429..KSWAFIG-DS------------IS--------------------------R---------------------------
TBL23_ARATH/132-427..KSWAIIG-DS------------IA--------------------------R---------------------------
TBL25_ARATH/151-449..KWLAFIG-DS------------IS--------------------------R---------------------------
TBL26_ARATH/143-432..KWWAFIG-DS------------IA--------------------------R---------------------------
A5C5G9_VITVI/125-419..KAWALIG-DS------------IT--------------------------R---------------------------
A5BFA6_VITVI/191-485..KSWAFIG-DS------------IS--------------------------R---------------------------
A9SPN8_PHYPA/96-376..KVIAFVG-DS------------LG--------------------------R---------------------------
TBL30_ARATH/130-425..KKLMFIG-DS------------IH--------------------------Y---------------------------
TBL28_ARATH/124-422..KRLMFVG-DS------------LN--------------------------R---------------------------
TBL31_ARATH/120-407..KRLMFIG-DS------------VQ--------------------------R---------------------------
A5ADJ7_VITVI/123-409..KRLMFVG-DS------------IQ--------------------------R---------------------------
TBL33_ARATH/134-424..KRMMYVG-DS------------LN--------------------------R---------------------------
TBL32_ARATH/159-450..KKMMFVG-DS------------LN--------------------------R---------------------------
D7SR66_VITVI/138-430..KRLVFVG-DS------------LN--------------------------R---------------------------
TBL34_ARATH/112-406..KRMVYVG-DS------------LN--------------------------R---------------------------
D7SSF9_VITVI/114-388..KRIMLVG-DS------------IM--------------------------R---------------------------
TBL36_ARATH/102-376..KRIMLVG-DS------------MM--------------------------R---------------------------
TBL7_ARATH/167-441..KRIVFVG-DS------------MS--------------------------R---------------------------
E0CQN6_VITVI/163-439..KRVVFIG-DS------------MS--------------------------R---------------------------
TBL43_ARATH/95-367..KKLMFVG-DS------------LS--------------------------L---------------------------
TBL44_ARATH/119-402..KTIMFAG-DS------------LG--------------------------K---------------------------
D7SJV7_VITVI/21-302..KTVMFVG-DS------------LG--------------------------R---------------------------
TBL37_ARATH/117-385..KRVMFVG-DS------------LS--------------------------L---------------------------
TBL40_ARATH/97-364..KKIMMVG-DS------------LS--------------------------L---------------------------
TBL39_ARATH/99-366..KKIMFVG-DS------------LS--------------------------T---------------------------
TBL41_ARATH/86-356..KKIMFVG-DS------------LS--------------------------L---------------------------
TBL42_ARATH/89-358..KKILFVG-DS------------LS--------------------------N---------------------------
E0CS20_VITVI/95-364..KRIMFVG-DS------------LS--------------------------L---------------------------
E0CTP6_VITVI/133-405..KRVIIVG-DS------------LN--------------------------R---------------------------
TBL9_ARATH/120-407..GRIVFVG-DS------------IG--------------------------R---------------------------
D7T6S6_VITVI/145-435..KRLAFVG-DS------------IG--------------------------R---------------------------
TBL10_ARATH/155-447..KRLVFVG-DS------------IG--------------------------R---------------------------
TBL11_ARATH/151-446..KRLVFVG-DS------------IG--------------------------R---------------------------
TBL5_ARATH/194-481..KSLMLVG-DS------------MN--------------------------R---------------------------
TBL6_ARATH/190-473..KRLVFVG-DS------------IN--------------------------R---------------------------
D7SY59_VITVI/169-450..KRLMFVG-DS------------LN--------------------------R---------------------------
TBR_ARATH/307-596..RRLVFVG-DS------------LN--------------------------R---------------------------
TBL2_ARATH/244-534..KKLVFVG-DS------------IN--------------------------R---------------------------
P90793_CAEEL/44-306..KHVMFIG-DS------------LI--------------------------R---------------------------
A8XEN8_CAEBR/12-234..KHVMFIG-DS------------LV--------------------------R---------------------------
A7SCU9_NEMVE/11-255..RIVIVLG-DS------------IQ--------------------------R---------------------------
A4IHH2_XENTR/4-243..KYVAILG-DS------------IQ--------------------------R---------------------------
PED1B_MOUSE/4-254..KFVVVLG-DS------------VH--------------------------R---------------------------
F1M6L4_RAT/19-264..KFVVVLG-DS------------IQ--------------------------R---------------------------
PED1A_MOUSE/21-267..KFVVILG-DS------------IQ--------------------------R---------------------------
PED1B_BOVIN/4-250..KFVVILG-DS------------VQ--------------------------R---------------------------
F1PVW1_CANFA/4-250..KFVVILG-DS------------VQ--------------------------R---------------------------
A0A024R115_HUMAN/4-250..KFVVILG-DS------------VH--------------------------R---------------------------
B0W8N6_CULQU/74-300TQNHFVFIG-DV------------RI--------------------------R---------------------------
Q8T3H4_DROME/119-348NKNNFVFIG-DE------------SI--------------------------R---------------------------
Q6CDI8_YARLI/64-294..ETSLFIG-DS------------HA--------------------------R---------------------------
A7RI69_NEMVE/99-327..HPVAFVG-DS------------RI--------------------------R---------------------------
B2RAS9_HUMAN/74-292..KHIAFIG-DS------------RI--------------------------R---------------------------
A7F4H3_SCLS1/82-326..RRLVFIG-DS------------TT--------------------------R---------------------------
CAS1_CRYNJ/90-372.KRTALFVG-DS------------TV--------------------------R---------------------------
A8N197_COPC7/69-295..RDVAFVG-DS------------VT--------------------------R---------------------------

PF03629

A0ZZI1_BIFAA/132-445-GEVWLAGG-QSN....M.....ELE.L...............RNSEH....A---------------------------
A3HTJ4_9BACT/102-524-GDVWLAGG-QSN....M.....EWA.L..............KSDVIG....A---------------------------
A4AN28_MARSH/117-413-GDVWLCAG-QSN....M.....EWS.M...............EREMH....F---------------------------
A4XG19_CALS8/84-518-GDVWVCSG-QSN....M.....VVP.MER..........VIDI........Y---------------------------
A5FA09_FLAJ1/103-353-GEVWVCSG-QSN....M.....EMS.A..............SWGIEN....G---------------------------
A5FC32_FLAJ1/109-397-GEVWLCSG-QSN....M.....FFP.VGREE.......GTWKTGVKN....Y---------------------------
A5FCG2_FLAJ1/104-366-GEVWLCSG-QSN....M.....EMP.LKG..........FQGQPVKN....G---------------------------
A5FLW6_FLAJ1/100-526-GEVWICSG-QSN....M.....EFQ.V...............FKTMN....A---------------------------
A6KYD0_BACV8/104-544-GEVWFCSG-QSN....M.....EMP.VA............GWGKVMN....Y---------------------------
A6L7S8_BACV8/301-581-GEVWLCSG-QSN....M.....EFY.L...............NWSAT....A---------------------------
A6L837_PARD8/106-365-GEVWFGSG-QSN....M.....EMP.LRG..........FWHCPIEG....G---------------------------
A6LG42_PARD8/302-584-GEVWLCSG-QSN....M.....AFR.V...............NESVK....E---------------------------
A9KN08_CLOPH/81-525-GDVYLLSG-QSN....M.....VLP.ISRTINKNKLNWQADSLFINN....N---------------------------
A9UY79_MONBE/110-371-GEVFLCSG-QSN....M.....VFP.V...............ALSLN....S---------------------------
A9UYV9_MONBE/183-446-GEVYLCSG-QSN....M.....EFP.L...............NIATN....G---------------------------
B0SVR2_CAUSK/105-536-GDVFLCSG-QSN....M.....ELS.A...............EQAQN....S---------------------------
B0SYV3_CAUSK/103-536-GDVWLCSG-QSN....M.....EYP.L...............RRALG....G---------------------------
B1ZN38_OPITP/124-558-GDVWLCGG-QSN....M.....EMA.L...............VDARN....G---------------------------
B1ZRD5_OPITP/111-543-GEVWLCGG-QSN....M.....ERQ.LGLR.........PGQKPIVG....W---------------------------
B2UNI0_AKKM8/105-396-GEVWLASG-QSN....M.....LFR.L...............NQTTT....A---------------------------
B3PDW1_CELJU/103-559-GDVWIAAG-QSN....M.....EQP.LNR..........VRYR........Y---------------------------
B8DTK8_BIFA0/83-504-GEVFLCSG-QSN....M.....ELS.MQW..........VHPY........Y---------------------------
B8DVE1_BIFA0/120-432-GEVWLAGG-QSN....I.....EFE.L...............HNSEF....G---------------------------
B8I0P3_CLOCE/95-527-GDVWLCSG-QSN....M.....EMK.MDS..........VKDT........Y---------------------------
C1F347_ACIC5/141-569-GDVWICGG-QSN....M.....ELP.L...............RFTDN....A---------------------------
C1F9V4_ACIC5/112-403-GDVWFASG-QSN....M.....QIP.LIGF.........PGSAVIRN....A---------------------------
C3Y8H9_BRAFL/120-404-GDVWVCSG-QSN....M.....QFT.V...............MMGFN....S---------------------------
C3Z127_BRAFL/109-390-GDVWVCSG-QSN....M.....EFT.V...............RQAFN....A---------------------------
C3Z129_BRAFL/93-393-GDVWVCSG-QSN....M.....EFT.V...............SQAFN....A---------------------------
C3ZBF5_BRAFL/95-370-GDVWLCSG-QSN....M.....VFT.M...............KYTTN....A---------------------------
C5BNV0_TERTT/112-545-GDVWVASG-QSN....M.....QTT.LNR..........IEER........Y---------------------------
C6VYA3_DYAFD/101-531-GEVWLCSG-QSN....M.....EWP.V...............SAAKN....Y---------------------------
C6W5L8_DYAFD/109-390-GDVWLCSG-QSN....M.....DFP.L...............KAAQT....G---------------------------
C6X165_FLAB3/103-532-GDVWLVSG-QSN....M.....ELP.MYR..........VKPL........Y---------------------------
C6XSG1_PEDHD/103-356-GEVWLCSG-QSN....M.....EMA.LRG...........NSSPILN....A---------------------------
C6XSW9_PEDHD/104-358-GEVWICSG-QSN....M.....SMT.MRG..........FPKQPILN....A---------------------------
C6XUV3_PEDHD/100-352-GELWLCSG-QSN....M.....QWN..........................A---------------------------
C6XXZ6_PEDHD/106-358-GEVWLCSG-QSN....M.....EMP.VKG..........FGNQPITN....S---------------------------
C6XYN0_PEDHD/106-369-GEVWLCSG-QSN....M.....EMP.LA............GWGKIKD....Y---------------------------
C6Y155_PEDHD/105-361-GEVWLCSG-QSN....M.....EYA.MHKLKTMKKPLNEKLGF........P---------------------------
C6Y1K6_PEDHD/105-533-GDVWICGG-QSN....M.....QYT.L...................NQIGYT---------------------------
C6Y404_PEDHD/303-583-GDVWLCSG-QSN....M.....AFT.L...............SASET....G---------------------------
C7M404_CAPOD/302-582-GEVWLCSG-QSN....M.....EFY.M...............NQTST....G---------------------------
C7PN71_CHIPD/105-526-GDVWLCAG-QSN....M.....VHQ.MTL..........HSER........Y---------------------------
C7PT40_CHIPD/107-370-GEVWIASG-QSN....M.....EMP.LK............GWGKILN....H---------------------------
D0MJ56_RHOM4/105-565-GEVWVASG-QSN....M.....EMPLMPRLA......GWSPGDSVYG....A---------------------------
D2QQ30_SPILD/101-534-GDVWFCSG-QSN....M.....VHQ.LNI..........HDVT........Y---------------------------
D2QX68_PIRSD/107-360-GEVWICSG-QSN....M.....EWS.V...............AASDN....P---------------------------
D2QYI9_PIRSD/142-409-GEVWLASG-QSN....M.....AMT.L...............KSVADRLTQA---------------------------
D2R7J4_PIRSD/115-431-GDVWVMYG-QSN....M.....AFP.L...............KNVLN....K---------------------------
D2U910_XANAP/119-550-GDVWLCSG-QSN....M.....ELP.V...............QRTLD....T---------------------------
D2U9U1_XANAP/109-532-GDVWLASG-QSN....M.....EMP.L...............VMARD....G---------------------------
D4INS5_9BACT/103-361-GEVWLCSG-QSN....M.....EMP.VHG..........FPNQPVEG....S---------------------------
D4JVY2_9FIRM/84-395-GEVWLAGG-QSN....M.....ELE.L...............QNCMG....G---------------------------
D4Z7X6_SPHJU/109-541-GDVFLCSG-QSN....M.....ELE.V...............RNAQD....A---------------------------
D5BHF0_ZUNPS/98-525-GDVWLCSG-QSN....M.....ELP.MSR..........VAPK........Y---------------------------
D5EN53_CORAD/103-390-GEVWMCSG-QSN....M.....AWV.V...............ASSNH....A---------------------------
D5ER35_CORAD/101-350-GEVWLCSG-QSN....M.....QMA.LKG..........YPNEPIIG....S---------------------------
D5EXD4_PRER2/104-368-GEVWVCAG-QSN....M.....EMP.VKG..........FWMCPVKD....Y---------------------------
D6CYE8_9BACE/85-509-GEVWICSG-QSN....M.....EFR.L...............RSANH....A---------------------------
D6CYV5_9BACE/104-362-GEVWICSG-QSN....M.....EMR.MMG..........NAAQPIDH....S---------------------------
D6D068_9BACE/96-526-GEVWLCSG-QSN....M.....QMP.VE............GWGKVKN....Y---------------------------
D6D180_9BACE/73-515-GEVWVCSG-QSN....M.....EMQ.VE............GWGKVMN....Y---------------------------
D6D411_9BACE/118-376-GEVWFCSG-QSN....M.....EMP.VKG..........FRGQPVFG....S---------------------------
D9SLS9_CLOC7/541-802-GDVWLCSG-QSN....M.....AFQ.L...............TGTLD....S---------------------------
D9SWK5_CLOC7/539-800-GDVWLCSG-QSN....M.....AFT.L...............KEAAE....A---------------------------
E4RWD7_LEAB4/99-523-GDVWLCSG-QSN....M.....VHQ.LDI..........HDVT........Y---------------------------
E4T5G4_PALPW/145-396-GEVWLCSG-QSN....M.....EYA.FN............WESKPID....V---------------------------
E4T6U6_PALPW/106-547-GEVWLCSG-QSN....M.....EMP.VD............GWGRIMN....Y---------------------------
E6SN70_BACT6/301-581-GEVWLCSG-QSN....M.....EFR.L...............NNALT....A---------------------------
E6U3H5_ETHHY/86-401-GEVWLAGG-QSN....M.....ELE.L...............RNCLN....G---------------------------
E6UDX2_RUMA7/82-393-GEVWFLGG-QSN....M.....ELE.I...............QNAKD....G---------------------------
E6UGH2_RUMA7/87-510-GDVFHITG-QSN....M.....ELP.LNR..........TYDP........F---------------------------
E6WRU5_PSEUU/108-538-GEVWLASG-QSN....M.....EWP.V...............AQTLH....A---------------------------
E6WX51_PSEUU/113-546-GDVWLCSG-QSN....M.....ELQ.V...............WRSLD....A---------------------------
E8RKP4_ASTEC/107-546-GDVFLCSG-QSN....M.....EFT.T...............KYATN....A---------------------------
E8RP08_ASTEC/110-381-GEVWLASG-QSN....M.....EKP.FRNQ.........PGQKDVIN....A---------------------------
E8RR55_ASTEC/105-537-GDVFLCSG-QSN....M.....EWN.L...............KDTLG....A---------------------------
E8RVJ6_ASTEC/120-557-GDVFLCSG-QSN....M.....DLS.V........................G---------------------------
E8V0Q2_TERSS/105-396-GDVWIASG-QSN....M.....EMP.LKGF.........GSGTPIKD....S---------------------------
E8WX56_ACISM/104-394-GDVWIASG-QSN....M.....EMP.LQGF.........GPGTPIKD....G---------------------------
F0RXK6_SPHGB/84-395-GDVWLVGG-QSN....M.....EFF.V...............RFEKH....Y---------------------------
F0S4E8_PEDSD/102-363-GEVWLCSG-QSN....M.....EYQ.MRKIEKEK.APLKGNYF........P---------------------------
F0SBL8_PEDSD/106-542-GDVWVCSG-QSN....M.....YMK.M...............KDLGE.....---------------------------
F0SE55_PEDSD/103-355-GEVWLCSG-QSN....M.....QWS.S..............NNKLQE....M---------------------------
F0SEX3_PEDSD/110-362-GEVWLCSG-QSN....M.....EMP.LKG..........FAGQPIQN....A---------------------------
F0SLB2_PLABD/105-401-GEVWVCSG-QSN....M.....AWP.V...............SSAND....P---------------------------
F0XZG5_AURAN/371-703-GDVFFCSG-QSNAWLVM.....NFA.L........................E---------------------------
F1N0F2_BOVIN/129-405-GDVWLCSG-QSN....M.....KMT.V...............SQVFN....A---------------------------
F2JM57_CELLD/90-525-GDLWICGG-QSN....M.....ELP.VSR..........VMER........Y---------------------------
F2KZ29_PREDF/320-601-GEVWICSG-QSN....M.....ELP.V...............CAVQS....G---------------------------
F2NB41_CORGP/85-397-GEVYLFAG-QSN....I.....EYK..........................M---------------------------
F2NBE0_CORGP/105-528-GDVWLLAG-QSN....M.....QLP.MER..........VKYR........F---------------------------
F4C1D3_SPHS2/119-545-GDVWFCSG-QSN....M.....ELP.ISR..........VAPK........Y---------------------------
F4C667_SPHS2/102-358-GEVWLCSG-QSN....M.....ERQ.LGPR.........PPQKPILG....W---------------------------
F4CDE6_SPHS2/103-363-GEVWLCSG-QSN....M.....EMP.LKG..........FRGQPIIG....S---------------------------
F4KXA6_HALH1/110-541-GDVWICAG-QSN....M.....VLP.MER..........VKER........Y---------------------------
F6RRT5_CIOIN/110-408-GDVWVCGG-QSN....M.....QFT.V...............SMLEN....P---------------------------
F7AJJ3_HORSE/118-419-GDVWLCSG-QSN....M.....QMT.V...............SQIFN....A---------------------------
F7CPG9_XENTR/116-394-GDVWLCSG-QSN....M.....EMT.V...............SQVFN....A---------------------------
F8EA22_RUNSL/103-354-GEVWLCAG-QSN....M.....EWS.A..............DHGVKD....A---------------------------
F8EJ62_RUNSL/102-531-GEVWLCSG-QSN....M.....EWP.V...............QQADN....F---------------------------
F8EQW5_RUNSL/101-532-GDVWLCSG-QSN....M.....VIP.MER..........VKEK........Y---------------------------
F9D4M3_PREDD/105-362-GEVWLCSG-QSN....M.....EFP.VK............GWAQVIN....A---------------------------
F9Z647_ODOSD/105-527-GDVWVCSG-QSN....M.....EFG.L...............NNVIN....A---------------------------
G0GB30_SPITZ/129-404-GDVWLCAG-QSN....M.....EMG.M...............AAIAD....R---------------------------
G0GBV2_SPITZ/85-515-GDVWLLGG-QSN....M.....ELP.VRR..........TLDL........F---------------------------
G0IZQ4_CYCMS/102-365-GDVWLLGG-QSN....M.....EWA.L...............KRTNN....G---------------------------
G0L160_ZOBGA/108-362-GEVWLCSG-QSN....M.....FMT.LKG..........NINQPVLG....S---------------------------
G0L7C6_ZOBGA/106-357-GEVWLCSG-QSN....M.....QWS.AT............TNAGIDN....A---------------------------
G1SIW9_RABIT/119-395-GDVWLCSG-QSN....L.....KMT.V...............SQIFN....A---------------------------
G3IIB1_CRIGR/119-418-GDVWLCSG-QSN....M.....KMT.V...............LQIFN....A---------------------------
G3NT91_GASAC/117-395-GDVWLCGG-QSN....M.....WLQ.T...............SKIFN....A---------------------------
G3TGM8_LOXAF/118-419-GDVWLCSG-QSN....M.....KMT.V...............SQIFN....A---------------------------
G3WPG6_SARHA/128-405-GDVWLCSG-QSN....M.....EMS.V...............SQIFN....A---------------------------
G8NUG1_GRAMM/104-394-GDVWIASG-QSN....M.....EFP.LQGF.........GPDTPLKN....Q---------------------------
G8TBM5_NIAKG/101-532-GDVWVCSG-QSN....M.....ELP.MER..........VKEK........Y---------------------------
G8TEA3_NIAKG/104-360-GEVWLCSG-QSN....M.....EYT.TNRSAHWY.NAKRSKGL........D---------------------------
G8TGS0_NIAKG/106-355-GEVWVCSG-QSN....M.....EFG.Y..............YNKIPD....V---------------------------
G8TLW6_NIAKG/105-533-GDVWVASG-QSN....M.....ELE.V...............QQAAD....A---------------------------
G8TN45_NIAKG/114-379-GELWLCSG-QSN....M.....QFS.M...............KEVTD....A---------------------------
G8TQU6_NIAKG/101-533-GDLWVCSG-QSN....M.....EMP.VK............GWSQVVN....A---------------------------
G8UJ84_TANFA/302-584-GEVWLCSG-QSN....M.....AFR.T...............SEADA....A---------------------------
H0XDV1_OTOGA/118-421-GDVWLCSG-QSN....M.....QMT.V...............LQIFN....A---------------------------
H1Y7E7_9SPHI/107-370-GEVWLCSG-QSN....M.....EYL.MKL..........AHAK........P---------------------------
H1YEP3_9SPHI/107-377-GEVWLCSG-QSN....M.....AYE.MRKNSKVRKPDSLDKNS........P---------------------------
H1YFU1_9SPHI/105-542-GDVWFCSG-QSN....M.....TIK.MER..........VKEK........Y---------------------------
H1YHR5_9SPHI/103-534-GDVWFCSG-QSN....M.....VVK.VER..........VKEK........Y---------------------------
H2MHU5_ORYLA/110-406-GDIWLCGG-QSN....M.....YFK.T...............SQVFN....A---------------------------
H2NFQ7_PONAB/118-394-GDVWLCSG-QSN....M.....QMT.V...............LQVIC....R---------------------------
H2T5J8_TAKRU/109-378-GDIWLCGG-QSN....M.....AFQ.T...............SRIFN....S---------------------------
H8KVR3_SOLCM/112-540-GDVWVASG-QSN....M.....EMK.V...............SESKN....A---------------------------
H9G3E2_ANOCA/113-390-GDVWLCSG-QSN....M.....EMT.V...............SQIFN....A---------------------------
I0IFA8_PHYMF/116-371-GDLWLASG-QSN....M.....QWRVM..............DA........A---------------------------
I0IGP0_PHYMF/113-573-GEVWVASG-QSN....M.....QWP.V........................S---------------------------
I0K882_9BACT/102-533-GDVWFCSG-QSN....M.....VHQ.LNI..........HDVT........Y---------------------------
I0KDZ4_9BACT/80-507-GEVWLCSG-QSN....M.....EWP.V...............RQANN....F---------------------------
I2F010_EMTOG/101-530-GDIWVCSG-QSN....M.....ETD.FNR..........LIDK........Y---------------------------
I3JCR3_ORENI/107-370-GDIWMCGG-QSN....M.....WFN.M...............TQIFN....A---------------------------
I3NAW5_SPETR/119-428-GDVWLCSG-QSN....M.....QMT.V...............LQIFN....A---------------------------
I3YNK6_ALIFI/103-360-GEVWFAGG-QSN....M.....EMP.LGG..........FWQCPVTD....A---------------------------
I3Z657_BELBD/107-540-GDVWLCSG-QSN....M.....ETT.MER..........VEPM........F---------------------------
I6ZXF8_MELRP/103-560-GEVWLCSG-QSN....M.....EMP.LEGW.........PPTDTVAN....S---------------------------
I7A330_MELRP/101-533-GDVWVCSG-QSN....M.....ELP.MRR..........VEPV........Y---------------------------
K1PIG0_CRAGI/75-338-GDVWICSG-QSN....M.....EFT.T...............NKLLN....S---------------------------
L0DNV4_SINAD/113-408-GEVWLCSG-QSN....M.....QWA.V...............DATYD....A---------------------------
L0FZA4_ECHVK/103-365-GEVWLCSG-QSN....M.....EMP.LKG..........FPGQPIIG....G---------------------------
L0G4D5_ECHVK/108-537-GDVWVCSG-QSN....M.....EWP.L...............ERAGN....A---------------------------
L0G5F4_ECHVK/309-586-GDVWLCMG-QSN....M.....DFP.L...............QASRS....W---------------------------
L0G6Q7_ECHVK/110-371-GEVWLCSG-QSN....M.....EMP.MKG..........YTSQPVEG....A---------------------------
M3VYU4_FELCA/118-393-GDVWLCSG-QSN....M.....QMT.V...............SQIFN....A---------------------------
M3XHL6_LATCH/120-399-GDVWFCSG-QSN....M.....EMT.V...............LQIMN....A---------------------------
M3ZH48_XIPMA/107-384-GDIWLCGG-QSN....M.....LFT.M...............SQIFN....S---------------------------
SIAE_MOUSE/118-420-GDVWLCSG-QSN....M.....QMT.V...............SQIFN....A---------------------------
Q022C5_SOLUE/94-383-GEVWVGSG-QSN....M.....EFK.L...............QNANN....H---------------------------
Q15XN0_PSEA6/106-529-GDVWLASG-QSN....M.....EWK.L..............AWQVEN....W---------------------------
Q1IR02_KORVE/102-394-GDVWVASG-QSN....M.....EYP.M...............EGWGGTPKQN---------------------------
Q1LUX8_DANRE/112-383-GDIWLCSG-QSN....M.....AFT.V...............GQVIN....A---------------------------
Q21HS7_SACD2/109-546-GDVWLTSG-QSN....M.....DLP.MRR..........VKHT........Y---------------------------
Q5LA76_BACFN/104-538-GEVWICSG-QSN....M.....EMP.LG............GWGKITN....Y---------------------------
Q7UKM9_RHOBA/136-425-GEVWICSG-QSN....M.....AWA.V...............QSAND....A---------------------------
Q7UL92_RHOBA/160-428-GEVWICSG-QSN....M.....QWK.MR............GFG.VDH....F---------------------------
Q7UPP2_RHOBA/115-412-GEVWLCSG-QSN....M.....EWR.V...............QSSVN....A---------------------------
Q8A0D0_BACTN/104-546-GEVWICSG-QSN....M.....EMQ.VE............GWGKVKN....Y---------------------------
Q8A1R2_BACTN/105-365-GEVWLCAG-QSN....M.....VMP.LNG..........FDYCPISD....S---------------------------
Q8A2Y4_BACTN/104-362-GEVWICSG-QSN....M.....EMT.MKG..........NMGQPIDH....S---------------------------
Q8A323_BACTN/103-546-GEVWICSG-QSN....M.....EMP.VA............GWGKVMN....Y---------------------------
Q8A331_BACTN/104-369-GEVWFCSG-QSN....M.....EMP.MGG..........FDRQPVRG....T---------------------------
Q8A6U7_BACTN/107-449-GDVWVASG-QSN....M.....EWG.I...............KVRKE....Y---------------------------
Q8AAK7_BACTN/303-583-GEVWLCSG-QSN....M.....EFM.L...............KQAST....A---------------------------
Q8P3G8_XANCP/110-540-GDVWLCSG-QSN....M.....ELQ.V...............HRTLD....S---------------------------
Q8P9U4_XANCP/106-528-GDVWLASG-QSN....M.....EWP.L...............AQASD....G---------------------------
Q9AA13_CAUCR/103-537-GDVWLCSG-QSN....M.....EYP.L...............RQALN....G---------------------------
R5ATT9_9BACT/97-358-GEVWIASG-QSN....M.....EMP.LRG..........FWTQPIEG....A---------------------------
R5C0U7_9BACE/106-371-GEVWLCGG-QSN....M.....EYP.MDRTLKRYAAPARGEDL........A---------------------------
R5CMH4_9FIRM/112-544-GAVWYVSG-QSN....I.....DVD.MER..........CRDS........Y---------------------------
R5CR26_9BACT/106-368-GEVWVCAG-QSN....M.....EMP.IKG..........FENCPVEG....Y---------------------------
R5CRW3_9BACT/103-359-GEVWICSG-QSN....M.....EMP.MKG..........FKNQPVEN....A---------------------------
R5CVR0_9BACT/37-472-GEVWLCSG-QSN....M.....EMP.VG............GWGKVMN....Y---------------------------
R5CVU7_9BACT/105-371-GEVWLASG-QSN....M.....EYS.MNNHPHHARPKKGDPEV........L---------------------------
R5FQG9_9BACT/98-360-GEVWVCAG-QSN....M.....EMP.LRG..........FDNCPVEG....Y---------------------------
R5GQ73_9FIRM/87-396-GAVWLAGG-QSN....M.....ELE.L...............RNCST....G---------------------------
R5I3U1_9PORP/108-543-GEVWLCSG-QSN....M.....EMP.LA............GWGRIDN....Y---------------------------
R5I599_9PORP/104-370-GEVWLCSG-QSN....M.....EVP.MRG..........FPYQPVLN....S---------------------------
R5I8Z5_9PORP/109-398-GEVWFTSG-QSN....M.....GWS.V...............AEEKN....S---------------------------
R5I9A4_9PORP/110-550-GEVWICSG-QSN....M.....EMP.LA............GWGKIQN....Y---------------------------
R5ICE3_9PORP/106-356-GEVWLCSG-QSN....M.....EMP.MRG..........FSLQPVRN....S---------------------------
R5IPA1_9PORP/103-532-GDIWFCSG-QSN....M.....EFQ.V...............KEAYN....A---------------------------
R5J8I9_9BACE/107-548-GEVWICSG-QSN....M.....EMP.IK............GWGKVMN....F---------------------------
R5J9D0_9BACE/301-581-GEVWLCSG-QSN....M.....EFM.M...............KEGVD....G---------------------------
R5JB68_9BACE/94-354-GELWICSG-QSN....M.....EMP.MKG..........YKNQPIEG....A---------------------------
R5JE70_9BACE/106-367-GEVWLCTG-QSN....M.....EFP.VARDP......NVKWKTGILN....E---------------------------
R5JUI1_9BACE/107-546-GEVWFCSG-QSN....M.....QMP.VA............QWGGVMN....Y---------------------------
R5JY84_9CLOT/86-397-GEVWLAGG-QSN....M.....ELE.L...............INSDD....G---------------------------
R5KDD9_9BACT/106-367-GEVWFCSG-QSN....M.....EMP.LAG..........FDNCPISG....A---------------------------
R5KI40_9BACT/107-545-GEVWLCSG-QSN....M.....EMP.VG............GWGKVMN....Y---------------------------
R5KI88_9BACT/106-368-GEVWVCAG-QSN....M.....EMP.IKG..........FDDCPVDG....Y---------------------------
R5M4F3_9BACE/103-392-GDVWLAGG-QSN....M.....EFA.L...............RRVKD....A---------------------------
R5M9T3_9BACE/100-533-GDVWLCSG-QSN....M.....ELT.VAR..........VADM........F---------------------------
R5MCJ4_9BACE/107-370-GEVWLCSG-QSN....M.....VYK.M...............KLPGNYALPA---------------------------
R5MCV5_9BACE/117-382-GEVWFCSG-QSN....M.....EMP.MGG..........FDRQPAQG....T---------------------------
R5NAN5_9BACT/95-508-GDVYLCGG-QSN....Q.....ETP.IER..........LVEK........F---------------------------
R5NWA0_9PORP/104-366-GDVWVCSG-QSN....M.....QMP.LKG..........FPAQPVYR....S---------------------------
R5PFV8_9BACT/95-546-GEVWLCSG-QSN....M.....DMP.VN............GWGQVNN....Y---------------------------
R5RU50_9BACE/106-368-GEVWLCAG-QSN....M.....EMP.IKG..........FNGQPVKG....S---------------------------
R5S363_9BACE/112-377-GEVWLCGG-QSN....M.....EMP.LEG..........FYACPIEG....A---------------------------
R5U9L2_9BACE/103-366-GEVWLCSG-QSN....M.....EMP.VKG..........FRGQPVEG....S---------------------------
R5UQU2_9PORP/301-581-GEVWVCSG-QSN....M.....AFP.L...............KQCAT....A---------------------------
R5XXY6_9FIRM/83-407-GEVWVAGG-QSN....M.....EFW.M...............RYEKH....K---------------------------
R6BWP4_9CLOT/125-575-GDVWYCSG-QSN....M.....ELP.VSW..........VAPY........Y---------------------------
R6CBR0_9FIRM/90-402-GEVWLCGG-QSN....M.....ELE.L...............QNCKG....G---------------------------
R6CT48_9BACE/308-588-GEVWLCSG-QSN....M.....AFM.L...............CQADT....Y---------------------------
R6CZR7_9BACE/103-360-GDVWICSG-QSN....M.....EMP.LKG..........FTGQPVKE....S---------------------------
R6DIJ1_9BACE/99-533-GDVYLCSG-QSN....M.....ELT.VKR..........VMDK........Y---------------------------
R6DJ41_9BACE/303-583-GEVWLCSG-QSN....M.....EFM.L...............SQTTT....G---------------------------
R6DWQ0_9BACT/104-366-GEVWVCAG-QSN....M.....EMP.MKG..........FDDCPTEG....Y---------------------------
R6E989_9BACE/963-1241-GEVWLCSG-QSN....M.....AFE.L...............KGADT....F---------------------------
R6EGK2_9FIRM/83-401-GEVWVAGG-QSN....M.....EFW.M...............RYEKH....R---------------------------
R6F527_9BACT/343-624-GEVWLCSG-QSN....M.....EFM.L...............HEAAT....A---------------------------
R6FK85_9BACE/101-514-GDVWLMSG-QSN....Q.....ETP.IHR..........LVEK........F---------------------------
R6GA32_9BACE/128-565-GDVWLCSG-QSN....M.....ELP.VSR..........VTDM........F---------------------------
R6K607_9BACE/105-361-GEVWLASG-QSN....M.....AMQ.LK............ECY...E....S---------------------------
R6KHE9_9BACE/106-368-GEVWLASG-QSN....M.....SMP.LKG..........YYCQPVLG....S---------------------------
R6KHK2_9BACE/100-362-GDVWLCSG-QSN....M.....QWV.V...............NNVTN....A---------------------------
R6KJ37_9BACE/119-553-GDVWLCSG-QSN....M.....ELP.VSR..........VTDM........F---------------------------
R6KNC4_9BACE/104-538-GEVWICSG-QSN....M.....EMP.LK............GWGKVLD....Y---------------------------
R6KU81_9BACE/100-533-GDVWLCSG-QSN....M.....ELT.VAR..........VADM........F---------------------------
R6L845_9BACE/106-539-GDVWLCSG-QSN....M.....ELP.VSR..........VTDM........F---------------------------
R6L914_9BACE/107-368-GEVWLCTG-QSN....M.....EFP.VSRHP......DVKWNTGMLN....E---------------------------
R6LEJ2_9BACE/109-369-GELWLCSG-QSN....M.....EMP.MKG..........FKNQPVEN....A---------------------------
R6M7W6_9BACE/104-365-GEVWLCTG-QSN....M.....EYP.VSKHP......DKKWMTGMIT....E---------------------------
R6MBW6_9BACE/104-365-GEVWFCSG-QSN....M.....EMP.LRG..........FWNCPIAG....A---------------------------
R6MD77_9BACE/131-411-GEVWLCSG-QSN....M.....EFM.L...............KQAAT....A---------------------------
R6MGF8_9BACE/106-368-GEVWLCTG-QSN....M.....EFP.VAHDP......KVKWKTGMSD....E---------------------------
R6MRS7_9FIRM/84-393-GEVWIAGG-QSN....M.....EFF.M...............RYERH....W---------------------------
R6NFL1_9BACE/103-361-GEVWFCSG-QSN....M.....EMP.VKG..........FRGQPVYG....S---------------------------
R6QQ52_9BACT/103-365-GEVWICSG-QSN....M.....EMP.MKG..........FTSQPVEG....T---------------------------
R6SZ03_9FIRM/82-394-GEVWFCGG-QSN....M.....ELE.L...............QNAKG....G---------------------------
R6TMT5_9FIRM/79-326-GEVILFAG-QSN....I.....QFR.L........................E---------------------------
R6TYL3_9FIRM/88-372-GELWLTAG-QSN....M.....AMP.....................NWTMEN---------------------------
R6VGA6_9FIRM/87-503-GDVFVCSG-QSN....M.....ELP.ITR..........VREM........F---------------------------
R6VGP4_9BACT/119-542-GEVWMTSG-QSN....M.....DFR.L...............RSIDR....A---------------------------
R6VYK5_9BACT/95-522-GEVWVASG-QSN....M.....EFR.L...............CSADN....A---------------------------
R6W3N6_9BACT/103-360-GELWICSG-QSN....M.....EMP.MKG..........FKNQPVEN....A---------------------------
R6WVP4_9BACT/103-358-GEVWICSG-QSN....M.....EMP.VGG..........FLHQPVEG....S---------------------------
R6X6R9_9PORP/299-581-GEVWLCSG-QSN....M.....AFQ.V...............SSAVD....S---------------------------
R6X8A0_9BACT/104-361-GEVWLCCG-QSN....M.....EMP.LCG..........FMMQPVEN....Y---------------------------
R6XDK3_9BACT/111-376-GEVWLCGG-QSN....M.....EMP.LNG..........FWHCPVEG....S---------------------------
R6XW57_9BACT/105-369-GEVWVCAG-QSN....M.....EMP.VKG..........FGNCPVEG....Y---------------------------
R6YB86_9BACE/303-583-GEVWLCSG-QSN....M.....EFQ.L...............SQAIT....A---------------------------
R6YLG6_9BACE/106-367-GEVWFCTG-QSN....M.....EMP.LNG..........FWNCPIEN....A---------------------------
R6ZQY5_9FIRM/86-518-GDVWLCAG-QSN....M.....ELP.MER..........VKDR........Y---------------------------
R7D1U4_9BACE/101-514-GDVWLCSG-QSN....Q.....ETP.IAR..........LTDK........F---------------------------
R7DGQ2_9PORP/109-450-GDVWVASG-QSN....M.....EWG.I...............N.KNH....Y---------------------------
R7DHQ3_9PORP/103-362-GEVWFCSG-QSN....M.....EMP.VQG..........FDRQPVNN....I---------------------------
R7EBZ9_9BACE/116-365-GETWLCSG-QSN....M.....EYC..........................F---------------------------
R7ELJ2_9BACE/104-363-GEVWLASG-QSN....M.....EMP.LKG..........FAGCCIMN....G---------------------------
R7FDG6_9FIRM/85-396-GEVWLAGG-QSN....M.....EFM.L...............KDAKG....G---------------------------
R7HK49_9BACT/112-371-GEVWLCSG-QSN....M.....EFP.VGRK........NEWQTGMST....F---------------------------
R7IBZ1_9FIRM/91-402-GEVYLASG-QSN....M.....ELE.L...............QNADE....G---------------------------
R7KXY0_9FIRM/78-504-GELYHISG-QSN....M.....ELP.IFRTI.......DPLDP.........---------------------------
R7L392_9BACT/141-439-GEVWIAGG-QSN....M.....AFG.L...............NGMED....A---------------------------
R7L457_9BACT/106-408-GEVWILGG-QSN....M.....EWV..........................V---------------------------
R7L551_9BACT/107-409-GEVWVLGG-QSN....M.....EWKLI........................P---------------------------
R7LBC9_9BACT/106-408-GEVWVASG-QSN....M.....EWN.V...............SGTDT....A---------------------------
R7LCZ4_9BACT/117-400-GEVWICSG-QSN....M.....EMR.L...............REIST....A---------------------------
R7LEI0_9BACT/104-413-GEVWIAGG-QSN....M.....ELPMR........................E---------------------------
R7N8V0_9FIRM/86-515-GEVWFCSG-QSN....M.....ELP.MNR..........VKDR........F---------------------------
R7NVJ4_9BACE/94-536-GELWLCSG-QSN....M.....EMP.VG............DWGKVLN....Y---------------------------
S0ET71_CHTCT/118-391-GDVWLCSG-QSN....M.....QFG.I...............ANGLN....A---------------------------
T2KJY6_9FLAO/72-379-GDVWLCTG-QSN....M.....DFD.MSKFLKDSREPQYQPLVEY......M---------------------------
T2KKF3_9FLAO/106-399-GEVWICSG-QSN....M.....EFK.V...................D....N---------------------------
T2KL42_9FLAO/108-425-GEVWFCSG-QSN....M.....YRP.FRMLIGEAVESKYEPIAEF......L---------------------------
U3JRM3_FICAL/110-387-GDVWLCSG-QSN....M.....AMT.V...............LQVAN....A---------------------------
U5Q6R0_9BACT/120-374-GEVWICSG-QSN....M.....QWY.L...............KNAEN....G---------------------------
V8NYK2_OPHHA/82-359-GDVWICSG-QSN....M.....EMT.V...............SQIFN....A---------------------------
W0ETR7_9SPHI/108-546-GDVWLCSG-QSN....M.....EMP.LA............GWGKVMN....Y---------------------------
W0ETZ4_9SPHI/87-339-GEVWICSG-QSN....M.....QRS..........................A---------------------------
W0EW65_9PORP/114-543-GEVWICSG-QSN....M.....EFP.IKG...........DWAQLMD....A---------------------------
W0EXJ4_9SPHI/101-529-GEVWLCSG-QSN....M.....EHQ.LAL..........HSVV........Y---------------------------
W0EYF1_9SPHI/303-584-GDVWLCSG-QSN....M.....YFS.V...............RESTG....G---------------------------
W0F205_9SPHI/104-389-GEVWFCSG-QSN....M.....EFP.LAKG........AGWRTGVFN....Y---------------------------
W0F686_9SPHI/73-335-GEVWLCSG-QSN....M.....EFA.MRKIGKL..QSPPGAGW........P---------------------------
W0IV69_9BACT/122-573-GEVWLASG-QSN....MARTMSSSG..........................S---------------------------
W0IY28_9BACT/102-398-GEVWIASG-QSN....M.....AWN.V...............KKTYD....Q---------------------------
W0IZR9_9BACT/107-406-GDVWLCAG-QSN....M.....AWS.L...............GQSLGRSVGA---------------------------
W0J089_9BACT/113-554-GEVWLASG-QSN....M.....EWP.L...............QKTTD....A---------------------------
W0J126_9BACT/103-396-GDVWLCSG-QSN....M.....VWH.V...............SQAEG....G---------------------------
W0J1D8_9BACT/103-397-GEVWLASG-QSN....M.....EWV.V...............KNTNS....G---------------------------
W0J1I7_9BACT/127-575-GEVWLASG-QSN....M.....EWA.L...............RNTIG....A---------------------------
W0J1Z1_9BACT/122-573-GEVWLASG-QSN....MARTMSASA..........................S---------------------------
W0J1Z2_9BACT/111-557-GEVWLASG-QSN....M.....AWT.V...............YNCTD....S---------------------------
W0J268_9BACT/121-368-GDVWLCSG-QSN....M.....EWS.I...............RKAAN....A---------------------------
W0J4T5_9BACT/111-561-GEVWLCSG-QSN....M.....EFT.L...............GGALG....A---------------------------
W0J8X3_9BACT/103-397-GEVWLASG-QSN....M.....EWI.V...............RNTDT....G---------------------------
W0JAS2_9BACT/114-570-GEVWLASG-QSN....M.....EFS.L...............ERTLD....A---------------------------
W0RMP1_9BACT/123-554-GDVWVASG-QSN....M.....EWP.V...............SAVTD....A---------------------------
W4XVQ4_STRPU/82-385-GDVWVCSG-QSN....M.....AFD.V...............KSAFN....G---------------------------
W4XVQ5_STRPU/118-400-GDVWVCSG-QSN....M.....AFD.V...............KQAFN....G---------------------------
W5M5G7_LEPOC/114-388-GDVWLCGG-QSN....M.....EMT.L...............SQVMN....A---------------------------
W5X997_9BACT/100-533-GDVWVCSG-QSN....M.....EMG.I...............GLVNN....A---------------------------
W5XA59_9BACT/96-545-GEVWLCSG-QSN....M.....EMR.V...............G..EA....R---------------------------
W8EWI8_9BACT/105-543-GDVWLASG-QSN....M.....EWA.L...............RDAAG....G---------------------------
W8F2B5_9BACT/111-544-GDVWLLSG-QSN....M.....ETP.MSR..........LRDK........Y---------------------------
X5DC27_9BACT/316-598-GEVWVCAG-QSN....M.....EFQ.M...............QQAND....A---------------------------

PF03996

HEMA_CVMA5/9-391NDD.WFLFG-DS----------------------------------------R---------------------------
HEMA_INCAA/19-420NQSTWIGFG-DS----------------------------------------R---------------------------
HEMA_BRV1/2-378TFD.WCGFG-DS----------------------------------------R---------------------------

PF14286

D4LDC0_RUMC1/65-436NYYNDTVPK-RE-----------WFK------------------------------------------------------
C4Z3Y8_EUBE2/59-440TWFSDTFPG-RD-----------GFI------------------------------------------------------
R6N2Z9_9CLOT/53-417LWFSDTFPF-RD-----------AFT------------------------------------------------------

PF16822

M4X2G9_PSEDE/89-360-----VVLG.KD-----------GWL------------------------------------------------------
D9SK13_GALCS/90-349-----VRPG.CA-----------DWL------------------------------------------------------
D7CVL9_TRURR/113-377-----VLIG.ED-----------DWL------------------------------------------------------
A4XSW9_PSEMY/87-346-----VVLG.RD-----------GWL------------------------------------------------------
A7IG51_XANP2/41-300-----LIIG.KD-----------GWL------------------------------------------------------
Q0VSK8_ALCBS/79-348-----LVAG.EP-----------YWF------------------------------------------------------
D9SC65_GALCS/39-314-----VLVG.RD-----------GWL------------------------------------------------------
Q2KWS4_BORA1/105-364-----VRQG.CP-----------GWL------------------------------------------------------
A4XSW7_PSEMY/65-332-----IVPG.RD-----------RWL------------------------------------------------------
A8LND2_DINSH/79-327-----AIKG.RD-----------GWL------------------------------------------------------
C4LEL0_TOLAT/54-306-----LQEG.RD-----------GWL------------------------------------------------------
Q0VSL0_ALCBS/86-342-----VLVG.ED-----------DWL------------------------------------------------------
D7CSL0_TRURR/51-309-----LQEG.PD-----------GWL------------------------------------------------------
F6AHE0_PSEF1/87-346-----VVLG.KD-----------GWL------------------------------------------------------
A9BZH9_DELAS/53-312-----VLRG.KD-----------GWL------------------------------------------------------
A7IG52_XANP2/88-341-----VRAG.CP-----------GWL------------------------------------------------------
A8ICK2_AZOC5/86-338-----VRAG.CP-----------GWL------------------------------------------------------
H9UGT7_SPIAZ/108-374-----VVVG.SR-----------GWL------------------------------------------------------
F6AHE2_PSEF1/62-330-----ITPG.ED-----------RWL------------------------------------------------------
A8ICK4_AZOC5/30-289-----IIMG.KN-----------GWL------------------------------------------------------
A4XR24_PSEMY/81-343-----LVIG.ED-----------GWL------------------------------------------------------
A4XR27_PSEMY/64-322-----...A.EE-----------GWL------------------------------------------------------
A9BZH8_DELAS/91-352-----VALG.CP-----------QWM------------------------------------------------------
C1DP87_AZOVD/81-346-----VVIG.AN-----------QWL------------------------------------------------------
C1DP90_AZOVD/67-327-----.VQGNES-----------DWL------------------------------------------------------
F2KL48_PSEBN/64-330-----LVQA.QG-----------DWL------------------------------------------------------
ALGX_PSEAE/64-325-----LVQA.QD-----------DWL------------------------------------------------------
ALGJ_PSEAE/85-355-----VVIG.KD-----------GWL------------------------------------------------------
Q6N6N6_RHOPA/99-362-----VVFG.KD-----------DWL------------------------------------------------------
ALGJ_PSESM/81-346-----VVLG.KD-----------QWL------------------------------------------------------
Q888J0_PSESM/99-365-----VRQG.CP-----------GWL------------------------------------------------------
ALGJ_PSEPK/81-346-----VVLG.RD-----------QWL------------------------------------------------------

PF00657

O04702_DAUCA/33-364SD.............GRLLIDFMATDLGLPFLHPYMDSLGANFSHGA.................................
Q39308_BRANA/36-320GKFS..........DGRIVPDFIAKFMGIPHDLPPAFEPGANVSRGA.................................
AOAH_HUMAN/257-543.............................................GAHFHISPEWITASQMSLNSFI.............
GDL49_ARATH/37-365RFCN..........GRLIVDFLMEAIDRPYLRPYLDSISRQTYRRGC.................................
Q9A6E2_CAUCR/200-399.............................................GYGVQ..............................
F0K6Q8_CLOAE/64-257.............................................GT.................................
A5FND2_FLAJ1/74-458.............................................GDLMTNKIRKLLQQKFGNAGRGFVFPYQLAKTNGS
A0A030Y1E2_PSEAI/215-418.............................................GASAS..............................
D4FZ14_BACNB/25-235.............................................GS.................................
D4FXT7_BACNB/43-243.............................................GV.................................
D6EFV3_STRLI/66-296.............................................GFDACAVL...........................
Q9LHY3_ORYSJ/5-203..........................................ADGGW.................................
Q98E95_RHILO/55-223.............................................GY.................................
H0H5K0_RHIRD/5-204.............................................GS.................................
RHA1_ASPAC/20-225........................................GSGTNGW.................................
Q40317_MEDSA/37-362SD.............GRIIIDFIAQSFRLPYPSPYLNSLGSNFTHGA.................................
Q9KZR1_STRCO/239-441.............................................GARSQ..............................
A6ZNX3_YEAS7/6-203........................................RPIEDGK.................................
APG_ARATH/205-524TGRFSN......GMVASDYLAKYMGVKEIVPAYLDPKIQPNDLLTGV.................................
GDL88_ARATH/5-204..........................................RSGGW.................................
B8ZUH2_MYCLB/42-222.............................................GLWE...............................
F0KA74_CLOAE/3-182.............................................GY.................................
Q9XIY6_ORYSJ/32-357SD.............GRLVVDFLVQAMGLPLLSPYLQSVGSGYRHGA.................................
F7URY0_SYNYG/103-399..................................SAIEKNLPSCPGL.................................
L8ADB1_BACIU/5-198........................................STNQGGW.................................
GCAT_AERHY/28-322........................................YSKMRGYLP...............................
APG_BRANA/126-441TGRFSNGRVASDYISKYLGVKEIVPAYVDKKLQQNNELQQSDLLTGV.................................
GUNE_CLOTM/606-804.............................................AYGNE..............................
GDL20_ARATH/34-330GKFS..........DGKIVPDFIAKFMGIPHDLPPALKPGTDVSRGA.................................
PLB1_RABIT/741-1015.............................................GIGIGSKPNDLSDGTTQYRGLSYSSGGDG......
O13496_NEOPA/166-382.............................................AYGV...............................
D6ETP1_STRLI/75-262.............................................GQ.................................
GDL17_ARATH/35-352GRFT.........NGRTYVDALAQILGFRNYIPPYSRIRGQAILRGA.................................
GDL14_ARATH/33-344RFSN..........GRTTVDVLTELLGFDNYIPAYSTVSGQEILQGV.................................
ESM1_ARATH/37-340NGKFS........DGHIVPDFIADFISIPNGVLPPVLKPGVDISRGV.................................
GDL84_ARATH/6-205..........................................SDGGW.................................
IAH1_MOUSE/18-213..........................................QQGGW.................................
O30643_MYCHY/42-337.............................................GFNEETYRD..........................
Q9AYM5_VIGUN/9-201..........................................DNGGW.................................
Q9AUZ9_ORYSJ/6-205..........................................RPGGW.................................
LIP4_ARATH/41-355LSD...........GRLLIDFLCQSLNTSLLRPYLDSLGRTRFQNGA.................................
LIP1_PHOLU/28-343.............................................GGNNGRY............................
PLB1_RABIT/394-668.............................................GNGAGSQPGNILDVLTQYRGLSWSVGGDQ......
E1CZP1_VIBPH/147-406........................GHFSNGFVWTEYIAKAKNLPLY..................................
O05695_RHILE/46-219............................................GGW.................................
Q9Y7C6_ASPTE/61-245.............................................GY.................................
B8GZL4_CAUCN/136-332.............................................GYGSRS.............................
GDL2_ARATH/38-352LSD...........GRLVIDFLCQSLNTSLLNPYLDSLVGSKFQNGA.................................
E8V9H4_BACST/5-202.............................................GR.................................
IAH1_SCHPO/40-217..........................................TPGGY.................................
A0A023YSK5_ECOLX/30-196.............................................GY.................................
F7UR16_SYNYG/108-371.............................................GD.................................
F7UTB4_SYNYG/22-217.............................................GYGDPIGGGWAER......................
Q98EU1_RHILO/215-418.............................................GNGAT..............................
GDL61_ARATH/35-364SD.............GRLIIDFLAKSLGMPFLSPYLQSIGSDFRHGA.................................
D6EF39_STRLI/5-186.............................................GVGD...............................
Q98FI8_RHILO/49-230........................................GNSEDGL.................................
PLB1_RABIT/1097-1363..............................................LAMGARPSNSSDPPMFWRGLSWSIGGDG......
A0A011SWS0_VIBPH/23-192.............................................GY.................................
D6ESA2_STRLI/10-188.............................................GMSD...............................
F0KDL5_CLOAE/81-259.............................................GY.................................
O82681_DIGLA/36-364TD.............GRLIIDFLAQGIGIPFLSPYLLSIGSDFRHGA.................................
GDL51_ARATH/33-334GRWS..........DGHIVPDFVGRLIGHREPIPPVLDPKADLSRGA.................................
Q9N4P5_CAEEL/105-346.............................................GRGLWPFTDVEFRGAAFPIGGDANMD.........
O13497_NEOPA/65-271.............................................GIGETGGYRKY........................
Q9RLB8_RUMFL/46-256.............................................GMADEGGYRKY........................

PF13472

A6CB21_9PLAN/150-378----------------------------------------.....GE---------------------------------
D1PUP8_9BACT/35-254----------------------------------------.....GA---------------------------------
B3ZRE8_BACCE/94-261----------------------------------------...EKGA---------------------------------
B3JF97_9BACE/27-230----------------------------------------.....DY---------------------------------
D3I0Q9_9BACT/27-262----------------------------------------.....NY---------------------------------
D9ST65_CLOC7/48-258----------------------------------------.....SF---------------------------------
C9P7F5_VIBME/587-832----------------------------------------.....HY---------------------------------
D0KJY6_PECWW/280-526----------------------------------------...A.TY---------------------------------
A6VT95_MARMS/597-842----------------------------------------.....NY---------------------------------
C7PCM7_CHIPD/56-238----------------------------------------.....GQ---------------------------------
A0A015V9G1_BACFG/26-237----------------------------------------.....GA---------------------------------
A0L6K4_MAGSM/99-344----------------------------------------.....GQ---------------------------------
A6CFV6_9PLAN/46-231----------------------------------------HGPSKKI---------------------------------
Q5WDC0_BACSK/80-245----------------------------------------.......---------------------------------
B9XGI8_PEDPL/55-242----------------------------------------.....QK---------------------------------
Q55JQ6_CRYNB/163-345----------------------------------------...CHGV---------------------------------
A0R4U0_MYCS2/44-205----------------------------------------.....GI---------------------------------
A4AUT7_MARSH/28-205----------------------------------------.....GY---------------------------------
A6DGK9_9BACT/47-216----------------------------------------.....GY---------------------------------
A6DN56_9BACT/46-229----------------------------------------.....GY---------------------------------
A6DFI9_9BACT/47-227----------------------------------------.....GY---------------------------------
A6C0R7_9PLAN/137-294----------------------------------------.....GY---------------------------------
B4DAN0_9BACT/47-221----------------------------------------.......---------------------------------
C9RLP9_FIBSS/29-241----------------------------------------.DWADGY---------------------------------
B8HEE5_ARTCA/19-203----------------------------------------...FNGN---------------------------------
D4P7Z6_9CAUD/47-228----------------------------------------...YNGK---------------------------------
Q26FJ0_FLABB/320-507----------------------------------------.....GS---------------------------------
D4LAZ2_RUMC1/45-211----------------------------------------.....GC---------------------------------
A6DGG0_9BACT/306-477----------------------------------------...MNGY---------------------------------
A6C1A5_9PLAN/64-235----------------------------------------...MNGY---------------------------------
C6VTV7_DYAFD/306-477----------------------------------------...NPGW---------------------------------
Q024D6_SOLUE/343-514----------------------------------------...MAGW---------------------------------
C6XTK4_PEDHD/89-262----------------------------------------..ANFGY---------------------------------
A6CD84_9PLAN/59-238----------------------------------------....NGW---------------------------------
B1QLA1_CLOBO/9-176----------------------------------------.....GT---------------------------------
B1QZ80_CLOBU/39-204----------------------------------------.....GC---------------------------------
D1PQR9_9FIRM/213-389----------------------------------------.....GA---------------------------------
D4J178_BUTFI/214-387----------------------------------------.....GA---------------------------------
C7GE42_9FIRM/218-391----------------------------------------.....GA---------------------------------
C6D766_PAESJ/54-231----------------------------------------.....GA---------------------------------
A4F260_9BACL/79-256----------------------------------------.....GA---------------------------------
D4LBB7_RUMC1/90-255----------------------------------------.....GT---------------------------------
B0MNZ3_9FIRM/121-287----------------------------------------.....GT---------------------------------
A9KK54_CLOPH/36-202----------------------------------------.....GS---------------------------------
A8SWK4_9FIRM/25-191----------------------------------------.....GS---------------------------------
D4CMI8_9FIRM/24-190----------------------------------------.....DS---------------------------------
D4JWU9_9FIRM/107-271----------------------------------------.....GL---------------------------------
F1TIB6_9CLOT/41-206----------------------------------------.....GY---------------------------------
D9SWK7_CLOC7/42-207----------------------------------------.....GI---------------------------------
I8IAV0_ASPO3/31-220----------------------------------------.......---------------------------------
Q9NET4_CAEEL/135-382----------------------------------------.....GQ---------------------------------
D4K132_9FIRM/101-367----------------------------------------.....GV---------------------------------
C7NNZ0_HALUD/159-325----------------------------------------.....GA---------------------------------
C7MWU0_SACVD/42-317----------------------------------------.....GE---------------------------------
C6WNW7_ACTMD/46-324----------------------------------------.....GE---------------------------------
Q2JSP6_SYNJA/145-318----------------------------------------.....GC---------------------------------
B7K022_CYAP8/136-309----------------------------------------.....GY---------------------------------
Q7NG29_GLOVI/223-396----------------------------------------.....GY---------------------------------
C8WV25_ALIAD/4-203----------------------------------------.....GE---------------------------------
A2SLH8_METPP/326-507----------------------------------------.....GT---------------------------------
D1YEJ8_PROAA/217-485----------------------------------------.....GN---------------------------------
D4H968_PROAS/4-269----------------------------------------.....GN---------------------------------
C7QHD3_CATAD/44-286----------------------------------------.....GW---------------------------------
D2SC17_GEOOG/45-295----------------------------------------.....GP---------------------------------
B0R7G2_HALS3/8-179----------------------------------------.....G.---------------------------------
C7Q7I2_CATAD/34-215----------------------------------------.....GV---------------------------------
C5AYH8_METEA/18-261----------------------------------------.....GL---------------------------------
C4LKI0_CORK4/42-288----------------------------------------....TGT---------------------------------
C4LIB2_CORK4/93-341----------------------------------------.....GS---------------------------------
C8NQ69_COREF/53-285----------------------------------------....MGG---------------------------------
C6R8G3_9CORY/32-256----------------------------------------.....GS---------------------------------
C2CL07_CORST/42-274----------------------------------------.....GT---------------------------------
C0E4P4_9CORY/59-301----------------------------------------...NPTY---------------------------------
C7Q9F9_CATAD/192-424----------------------------------------...AIGN---------------------------------
C8NR28_COREF/64-307----------------------------------------.....NP---------------------------------
Q4PCC7_USTMA/4-264----------------------------------------.....GP---------------------------------
B0RD91_CLAMS/80-246----------------------------------------.....GH---------------------------------
D0WS14_9ACTO/82-334----------------------------------------.....GE---------------------------------
Q2J4R6_FRASC/58-292----------------------------------------.....GE---------------------------------
Q2JGN4_FRASC/87-354----------------------------------------.....GD---------------------------------
D3Q6I6_STANL/33-249----------------------------------------.....GT---------------------------------
C6WBG5_ACTMD/46-260----------------------------------------.....GL---------------------------------
C7Q4A1_CATAD/38-331----------------------------------------.....GG---------------------------------
C6WEE8_ACTMD/40-312----------------------------------------.....GV---------------------------------
Q59837_9ACTO/42-313----------------------------------------VIRAAGD---------------------------------
B0RDF3_CLAMS/61-325----------------------------------------.....GT---------------------------------
E3J726_FRASU/30-260----------------------------------------.....GS---------------------------------
D0L3H8_GORB4/59-296----------------------------------------.....GP---------------------------------
Q2G7C8_NOVAD/37-269----------------------------------------.....GP---------------------------------
B1MBB4_MYCA9/6-245----------------------------------------.....GP---------------------------------
A0A049DM81_MYCTX/5-247----------------------------------------.....GP---------------------------------
Q1BEL5_MYCSS/5-240----------------------------------------.....GP---------------------------------
C8X8C1_NAKMY/4-247----------------------------------------.....GP---------------------------------
D5UYZ9_TSUPD/8-250----------------------------------------.....GP---------------------------------
C3JHG1_RHOER/48-287----------------------------------------.....GP---------------------------------
I0WS61_9NOCA/25-264----------------------------------------.....GP---------------------------------
Q0SDG5_RHOSR/112-351----------------------------------------.....GS---------------------------------
Q5YWR3_NOCFA/42-272----------------------------------------...TTGV---------------------------------
C7MPN1_SACVD/36-282----------------------------------------.....GP---------------------------------
A3KIR8_STRAM/40-281----------------------------------------.....GS---------------------------------
A4FQW5_SACEN/16-253----------------------------------------.....GP---------------------------------
C7Q6B9_CATAD/40-284----------------------------------------.....GP---------------------------------
C6WQR1_ACTMD/40-279----------------------------------------.....GP---------------------------------
A0ACN1_STRAM/56-294----------------------------------------.....GP---------------------------------
B5GK11_STRSH/58-296----------------------------------------.....GA---------------------------------
E8RZ59_MICSL/43-287----------------------------------------.....AP---------------------------------
D3Q5A1_STANL/36-280----------------------------------------.....GP---------------------------------
D7B873_NOCDD/48-286----------------------------------------.....GP---------------------------------
C7QAZ6_CATAD/32-275----------------------------------------.....GD---------------------------------
C6W714_DYAFD/85-374----------------------------------------.....GY---------------------------------
D6SU72_9DELT/52-277----------------------------------------.......---------------------------------
B7FQA7_PHATC/284-494----------------------------------------.....GT---------------------------------
Q7UHB8_RHOBA/116-390----------------------------------------.......---------------------------------
A3IGT7_9CHRO/5-189----------------------------------------NAAYVGE---------------------------------
A9W7C8_METEP/41-224----------------------------------------.....AA---------------------------------
D2VPA0_NAEGR/183-378----------------------------------------.KPPCGF---------------------------------
A0A059FZA4_9RHOB/45-228----------------------------------------.....GY---------------------------------
A0M4R3_GRAFK/29-191----------------------------------------.......---------------------------------
A1ZSQ7_9BACT/37-218----------------------------------------.......---------------------------------
C7N6X3_SLAHD/4-173----------------------------------------ANHMPDM---------------------------------
B0PGN9_9FIRM/4-174----------------------------------------.....ND---------------------------------
A6C7M7_9PLAN/118-270----------------------------------------.....G.---------------------------------
A9DZV2_9RHOB/29-212----------------------------------------...WNGS---------------------------------
A3TT74_9RHOB/30-207----------------------------------------WNRSAGA---------------------------------
Q1GDU1_RUEST/29-214----------------------------------------...WNGL---------------------------------
A3X495_9RHOB/37-223----------------------------------------.....NR---------------------------------
Q0FN89_PELBH/30-215----------------------------------------...HRGT---------------------------------
A3SQH4_9RHOB/29-214----------------------------------------THQMSGR---------------------------------
B5JQV4_9BACT/5-178----------------------------------------.....DY---------------------------------
Q98QP8_MYCPU/123-384----------------------------------------.....GF---------------------------------
Q4A5V3_MYCS5/112-382----------------------------------------.....GF---------------------------------
C5J6Z9_MYCCR/63-342----------------------------------------.....GF---------------------------------
Q4A638_MYCS5/66-330----------------------------------------.....GF---------------------------------
C7HER8_CLOTM/72-237----------------------------------------.....GG---------------------------------
B1V222_CLOPF/89-252----------------------------------------.....SE---------------------------------
C6JH48_9FIRM/175-357----------------------------------------.....KT---------------------------------
C6JEJ0_9FIRM/144-325----------------------------------------.......---------------------------------
C0CUW9_9CLOT/13-215----------------------------------------.....GC---------------------------------
B6WR90_9DELT/11-187----------------------------------------.....GV---------------------------------
A0LCN0_MAGSM/5-178----------------------------------------.....G.---------------------------------
Q3I1P3_NOSCO/11-184----------------------------------------.....G.---------------------------------
A6SVS4_JANMA/15-191----------------------------------------.....G.---------------------------------
Q9WX72_KOMXY/391-555----------------------------------------.....G.---------------------------------
C7NJR7_KYTSD/35-207----------------------------------------.....G.---------------------------------
C6R448_9MICC/9-180----------------------------------------.....G.---------------------------------
C7MDV1_BRAFD/19-197----------------------------------------.....G.---------------------------------
C0VZX9_9ACTO/7-177----------------------------------------.....G.---------------------------------
D0WRR1_9ACTO/4-174----------------------------------------.....G.---------------------------------
C0W8N0_9ACTO/7-176----------------------------------------.....G.---------------------------------
A7BEA0_9ACTO/4-180----------------------------------------.....G.---------------------------------
B4VFY0_9ACTO/4-206----------------------------------------.....GR---------------------------------
D6EIK2_STRLI/5-204----------------------------------------.....GS---------------------------------
C9YTJ8_STRSW/23-224----------------------------------------.....GS---------------------------------
D1JW12_9BACE/105-286----------------------------------------.....GH---------------------------------
D4LCL4_RUMC1/194-360----------------------------------------....CGM---------------------------------
A9ERQ8_SORC5/256-427----------------------------------------...AYAY---------------------------------
Q2IJI2_ANADE/216-377----------------------------------------.....GV---------------------------------
C7CE49_METED/90-259----------------------------------------.....GL---------------------------------
B1LYU8_METRJ/69-238----------------------------------------.....GA---------------------------------
Q08RB4_STIAD/155-337----------------------------------------.....GC---------------------------------
Q09AA0_STIAD/808-992----------------------------------------.....DT---------------------------------
A1TPP3_ACIAC/38-217----------------------------------------.....GP---------------------------------
D9QH72_BRESC/63-251----------------------------------------.....GG---------------------------------
C1JGV8_OENOE/138-305----------------------------------------.....GC---------------------------------
D2EH32_PEDAC/143-309----------------------------------------.....GC---------------------------------
A3TNT3_9MICO/8-226----------------------------------------.....GV---------------------------------
A1R9P0_ARTAT/42-278----------------------------------------...A.GT---------------------------------
A0K019_ARTS2/42-283----------------------------------------.....GT---------------------------------
D5US67_TSUPD/127-286----------------------------------------.....GY---------------------------------
A0R4U1_MYCS2/55-233----------------------------------------.....GE---------------------------------
A1T9E0_MYCVP/41-214----------------------------------------.....GS---------------------------------
A0A038FFY2_MYCTX/41-217----------------------------------------.....GT---------------------------------
C0FVT0_9FIRM/128-299----------------------------------------.....GL---------------------------------
A6NRB4_9FIRM/119-293----------------------------------------.....GL---------------------------------
D4KZ95_9FIRM/94-264----------------------------------------.....GL---------------------------------
C0D9S1_9CLOT/121-291----------------------------------------.....GL---------------------------------
A8RNE1_CLOBW/141-311----------------------------------------.....GL---------------------------------
A6BEQ0_9FIRM/72-271----------------------------------------.....AY---------------------------------
A9W7Z7_METEP/562-744----------------------------------------.......---------------------------------
C2L1C0_9FIRM/5-187----------------------------------------.....GY---------------------------------
C3Q1I0_9BACE/291-472----------------------------------------...N...---------------------------------
D1PYA2_9BACT/87-263----------------------------------------.......---------------------------------
B9CP22_9ACTN/198-361----------------------------------------.....GF---------------------------------
B2AV39_PODAN/50-240----------------------------------------MLTTANC---------------------------------
D4KBN7_9FIRM/161-338----------------------------------------.....GF---------------------------------
A8SEI6_9FIRM/112-289----------------------------------------.......---------------------------------
D2VNU3_NAEGR/46-260----------------------------------------.....GY---------------------------------
A1DLF9_NEOFI/8-203----------------------------------------.....GY---------------------------------
C7YGY2_NECH7/9-186----------------------------------------GYFCWGM---------------------------------
Q2H5R4_CHAGB/10-200----------------------------------------.....GY---------------------------------
B2AU74_PODAN/10-195----------------------------------------.....GY---------------------------------
A7E7J9_SCLS1/25-195----------------------------------------.....GY---------------------------------
A7E806_SCLS1/10-187----------------------------------------.....GW---------------------------------
C9KK96_9FIRM/165-368----------------------------------------.....GF---------------------------------
A6GTH0_9BURK/185-361----------------------------------------.....GF---------------------------------
Q10VH9_TRIEI/81-296----------------------------------------.....GS---------------------------------
E0UE35_CYAP2/81-296----------------------------------------...N.GA---------------------------------
A8YLF5_MICAE/88-300----------------------------------------...N.GS---------------------------------
B7JX19_CYAP8/84-296----------------------------------------.....GA---------------------------------
B4VXI7_9CYAN/89-309----------------------------------------.....GG---------------------------------
Q3MG18_ANAVT/81-301----------------------------------------.....GG---------------------------------
A0ZJZ9_NODSP/81-301----------------------------------------.....GG---------------------------------
A0YZ06_LYNSP/76-298----------------------------------------...NGGW---------------------------------
B5W630_ARTMA/82-298----------------------------------------.....GG---------------------------------
D3I482_9BACT/84-226----------------------------------------.....GL---------------------------------
C5EAN0_BIFLI/201-341----------------------------------------.....GT---------------------------------
A5CSX8_CLAM3/17-179----------------------------------------.......---------------------------------
D1NVJ1_9BIFI/473-610----------------------------------------.....GA---------------------------------
B5AX52_9CAUD/256-434----------------------------------------.....GD---------------------------------
B8I9G0_CLOCE/36-210----------------------------------------.....DI---------------------------------
C2Y714_BACCE/497-690----------------------------------------...LDGK---------------------------------
B6XSY2_9BIFI/34-205----------------------------------------.....GF---------------------------------
Q8EVG3_MYCPE/337-526----------------------------------------.....GS---------------------------------
B3T8L1_9ARCH/173-373----------------------------------------.....GA---------------------------------
D5SSJ8_PLAL2/90-278----------------------------------------RMNLFGN---------------------------------
B4D083_9BACT/413-601----------------------------------------HFSKFGY---------------------------------
A8SBH6_9FIRM/98-270----------------------------------------.......---------------------------------
D1XVL9_9BACT/196-391----------------------------------------.....GK---------------------------------
D2QQH5_SPILD/51-232----------------------------------------NDFQYGY---------------------------------
A3ZLZ7_9PLAN/28-215----------------------------------------REQHEGY---------------------------------
B4CVC8_9BACT/32-238----------------------------------------REGTYGY---------------------------------
B9XFH7_PEDPL/48-240----------------------------------------REQSYGY---------------------------------
A5FWG0_ACICJ/56-236----------------------------------------YWHREGP---------------------------------
D5X549_THIK1/78-259----------------------------------------.....NW---------------------------------
Q0BTT4_GRABC/70-248----------------------------------------.....NW---------------------------------
A9HI78_GLUDA/63-245----------------------------------------.....NW---------------------------------
B2UPK1_AKKM8/69-229----------------------------------------.....EF---------------------------------
B7B7T9_9PORP/404-572----------------------------------------.....YW---------------------------------
A7SUP9_NEMVE/21-188----------------------------------------.....GL---------------------------------
C1C4W0_LITCT/43-205----------------------------------------.......---------------------------------
B4R5I2_DROSI/38-200----------------------------------------.....TV---------------------------------
C4WWV9_ACYPI/38-200----------------------------------------.......---------------------------------
C8ZKR7_9CAUD/443-631----------------------------------------.....GQ---------------------------------
C2E6W6_LACJH/678-859----------------------------------------.....GF---------------------------------
B8KGJ7_9GAMM/47-224----------------------------------------.......---------------------------------
Q2Z0S4_9CAUD/77-253----------------------------------------.......---------------------------------
Q47SW9_THEFY/34-291----------------------------------------.....GA---------------------------------
D7B7J6_NOCDD/40-317----------------------------------------.....GV---------------------------------
A6F4N9_9ALTE/13-215----------------------------------------.....G.---------------------------------
C3QEU7_9BACE/179-342----------------------------------------.....GI---------------------------------
D4IKA2_9BACT/179-342----------------------------------------.....GT---------------------------------
D4INC2_9BACT/183-346----------------------------------------.....GA---------------------------------
A6DPU9_9BACT/162-332----------------------------------------.....GA---------------------------------
D1W609_9BACT/162-327----------------------------------------.....G.---------------------------------
D3EGN9_GEOS4/190-357----------------------------------------.....GG---------------------------------
D3AB80_9CLOT/163-328----------------------------------------.....GG---------------------------------
A8RI04_CLOBW/163-329----------------------------------------.....G.---------------------------------
D3EIH1_GEOS4/143-315----------------------------------------.....QC---------------------------------
B8H9Y5_ARTCA/179-369----------------------------------------.....SS---------------------------------
D2PQC5_KRIFD/166-336----------------------------------------.....CT---------------------------------
D2KRC2_9CAUD/5-188----------------------------------------.....GW---------------------------------
B8CFB8_THAPS/190-460----------------------------------------.....GW---------------------------------
C6LX44_GIAIB/39-225----------------------------------------.....GY---------------------------------
B1N3Y2_ENTHI/8-201----------------------------------------.....GI---------------------------------
D4J5M8_9FIRM/6-186----------------------------------------.....GA---------------------------------
C0D1G8_9CLOT/6-194----------------------------------------.....GY---------------------------------
B0P4K6_9CLOT/5-202----------------------------------------.....GY---------------------------------
Q28MK4_JANSC/5-193----------------------------------------.....GT---------------------------------
Q39HJ5_BURS3/9-204----------------------------------------.....GT---------------------------------
A8W013_AGRRH/14-208----------------------------------------.....GQ---------------------------------
A4U1B6_9PROT/100-344----------------------------------------.....GL---------------------------------
A7K9Z4_9PHYC/41-196----------------------------------------.......---------------------------------
B2FLV5_STRMK/35-209----------------------------------------.....GF---------------------------------
D2QLR8_SPILD/52-228----------------------------------------.....GY---------------------------------
B3C7M6_9BACE/46-223----------------------------------------.....GY---------------------------------
C6XV53_PEDHD/53-230----------------------------------------.....GY---------------------------------
A5CNW4_CLAM3/55-217----------------------------------------.....GF---------------------------------
C9LYN9_SELS3/296-469----------------------------------------.....GG---------------------------------
C9KKD3_9FIRM/276-447----------------------------------------.....GG---------------------------------
B7KL00_CYAP7/104-265----------------------------------------.....GL---------------------------------
C5US72_CLOBO/411-600----------------------------------------GVGGTGY---------------------------------
A3I2P8_9BACT/37-228----------------------------------------...YGGQ---------------------------------
D2R3I8_PIRSD/56-262----------------------------------------.....GR---------------------------------
Q1YPD0_9GAMM/318-501----------------------------------------.....GQ---------------------------------
A3TL07_9MICO/62-234----------------------------------------.....GK---------------------------------
A7HAV9_ANADF/45-222----------------------------------------.....GS---------------------------------
Q8KP08_9BACT/54-230----------------------------------------.....GT---------------------------------
A4S546_OSTLU/12-245----------------------------------------...GVGC---------------------------------
C1FIK9_MICSR/186-403----------------------------------------.....GV---------------------------------
Q6AE96_LEIXX/17-180----------------------------------------.....G.---------------------------------
B1M205_METRJ/17-182----------------------------------------.......---------------------------------
B1M3V4_METRJ/6-173----------------------------------------.......---------------------------------
B1LTZ6_METRJ/10-173----------------------------------------.......---------------------------------
B0U7X0_METS4/36-232----------------------------------------.....GI---------------------------------
Q6ACS0_LEIXX/64-231----------------------------------------.....GI---------------------------------
C4XUC8_DESMR/131-314----------------------------------------.....GV---------------------------------
A7IVK2_PBCVM/122-270----------------------------------------.....GI---------------------------------
C7Q7D8_CATAD/157-343----------------------------------------...FDGQ---------------------------------
A5VBY8_SPHWW/103-291----------------------------------------.....GI---------------------------------
C6RHF9_9PROT/168-353----------------------------------------.....GF---------------------------------
C8PHJ9_9PROT/240-425----------------------------------------.......---------------------------------
D2PRA6_KRIFD/46-221----------------------------------------.....GC---------------------------------
Q1YKL3_MOBAS/54-228----------------------------------------.....GV---------------------------------
Q0VS26_ALCBS/87-262----------------------------------------.....GV---------------------------------
A0A030RMR7_PSEAI/57-230----------------------------------------.....GV---------------------------------
A4XXU1_PSEMY/55-228----------------------------------------.....GV---------------------------------
B1XWT3_LEPCP/47-232----------------------------------------.....GV---------------------------------
Q6LG08_PHOPR/48-221----------------------------------------.....GV---------------------------------
Q0F8N5_9RHOB/51-224----------------------------------------.....GV---------------------------------
B7RN26_9RHOB/48-221----------------------------------------.....GV---------------------------------
C0Q8S6_DESAH/49-222----------------------------------------.....GV---------------------------------
A4F1H2_9RHOB/50-223----------------------------------------.....GV---------------------------------
Q5LN18_RUEPO/38-210----------------------------------------.....GV---------------------------------
A4BHN8_9GAMM/48-221----------------------------------------.....GV---------------------------------
A6FTW8_9RHOB/64-237----------------------------------------.....GV---------------------------------
A4JA74_BURVG/48-221----------------------------------------.....GV---------------------------------
C8XKQ3_NAKMY/142-320----------------------------------------.....GY---------------------------------
A8M302_SALAI/68-248----------------------------------------.....GV---------------------------------
D2PP87_KRIFD/68-246----------------------------------------.....GY---------------------------------
A1SF76_NOCSJ/69-248----------------------------------------.....GY---------------------------------
C0W3H8_9ACTO/21-199----------------------------------------.....GW---------------------------------
C4XN11_DESMR/67-258----------------------------------------.....GL---------------------------------
A1SNE8_NOCSJ/71-225----------------------------------------.....GL---------------------------------
A4AKB0_9ACTN/42-210----------------------------------------.....GT---------------------------------

PF14606

Q7US24_RHOBA/217-394---------------------------------------------GA---------------------------------
A4APA9_MARSH/176-358---------------------------------------------GA---------------------------------
Q01R43_SOLUE/183-360---------------------------------------------GI---------------------------------
C6XT40_PEDHD/174-351---------------------------------------------GA---------------------------------
F0SBL3_PEDSD/182-361---------------------------------------------GA---------------------------------
D3IDS0_9BACT/151-329---------------------------------------------GA---------------------------------
C6CUH9_PAESJ/158-340---------------------------------------------GA---------------------------------
D6D291_9BACE/177-350---------------------------------------------GV---------------------------------
D6D414_9BACE/177-354---------------------------------------------GG---------------------------------
Q8A1R6_BACTN/176-353---------------------------------------------GG---------------------------------
R7EPR9_9BACE/173-349---------------------------------------------GG---------------------------------

PF04311

W6REB0_9RHIZ/75-346--------------------------------------------------------------------------------
Q98H53_RHILO/33-310--------------------------------------------------------------------------------
O83576_TREPA/55-376--------------------------------------------------------------------------------

PF16255

A6L182_BACV8/24-226--------------------------------------------------------------------------------
D6D1C7_9BACE/24-224--------------------------------------------------------------------------------
R7ECW1_9BACE/24-225--------------------------------------------------------------------------------

PF08885

T2KQ07_9FLAO/22-260--------------------------------------------------------------------------------
C0QCX9_DESAH/46-310--------------------------------------------------------------------------------
R5EPC9_9BACE/21-255--------------------------------------------------------------------------------
A5VDH6_SPHWW/41-313--------------------------------------------------------------------------------
R6YAM1_9BACE/32-267--------------------------------------------------------------------------------
R7HNG1_9BACT/21-257--------------------------------------------------------------------------------
G2PK85_MURRD/21-260--------------------------------------------------------------------------------
I2EY90_EMTOG/21-257--------------------------------------------------------------------------------
B8IP12_METNO/42-312--------------------------------------------------------------------------------
A4YK23_BRASO/229-462--------------------------------------------------------------------------------
G8TR03_NIAKG/21-267--------------------------------------------------------------------------------
B1M3F5_METRJ/42-313--------------------------------------------------------------------------------
R5M3J3_9BACE/21-258--------------------------------------------------------------------------------
R7EUS3_9BACT/13-248--------------------------------------------------------------------------------
D5MM94_9BACT/76-315--------------------------------------------------------------------------------
R6Y730_9PORP/28-264--------------------------------------------------------------------------------
R7J1F8_9BACT/24-253--------------------------------------------------------------------------------
F0P1S2_WEEVC/21-257--------------------------------------------------------------------------------
B9J8F4_AGRRK/41-310--------------------------------------------------------------------------------
F8EN95_RUNSL/21-257--------------------------------------------------------------------------------
G0IXU2_CYCMS/22-258--------------------------------------------------------------------------------
E8RMP0_ASTEC/39-308--------------------------------------------------------------------------------
C5AUI8_METEA/49-319--------------------------------------------------------------------------------
L0G2R2_ECHVK/22-255--------------------------------------------------------------------------------
G2Z7S8_FLABF/21-259--------------------------------------------------------------------------------
G8X6A0_FLACA/17-254--------------------------------------------------------------------------------
G8ULQ0_TANFA/21-258--------------------------------------------------------------------------------
G8PQJ6_PSEUV/51-307--------------------------------------------------------------------------------
C7PMX6_CHIPD/22-258--------------------------------------------------------------------------------
A6LHC4_PARD8/21-258--------------------------------------------------------------------------------
R7LF46_9BACT/50-294--------------------------------------------------------------------------------
A0LXX4_GRAFK/22-257--------------------------------------------------------------------------------
F0R195_BACSH/21-257--------------------------------------------------------------------------------
F8JMP9_STREN/40-309--------------------------------------------------------------------------------
E4T1X0_PALPW/20-256--------------------------------------------------------------------------------
R6X342_9BACT/24-260--------------------------------------------------------------------------------
A6L176_BACV8/21-257--------------------------------------------------------------------------------
M9RBE9_9RHOB/323-562--------------------------------------------------------------------------------
R6L892_9BACE/21-258--------------------------------------------------------------------------------
T2GGB5_DESGI/40-310--------------------------------------------------------------------------------
Q11RW7_CYTH3/21-254--------------------------------------------------------------------------------
F4B2J3_KROS4/22-257--------------------------------------------------------------------------------
R6FFG9_9BACE/21-258--------------------------------------------------------------------------------
R5RV25_9BACE/22-258--------------------------------------------------------------------------------
A1S3K5_SHEAM/44-301--------------------------------------------------------------------------------
F4L6L3_HALH1/23-258--------------------------------------------------------------------------------
R5NCX1_9BACT/22-258--------------------------------------------------------------------------------
R7D323_9BACE/32-279--------------------------------------------------------------------------------
H6L5M5_SAPGL/25-259--------------------------------------------------------------------------------
E6XET3_CELAD/21-258--------------------------------------------------------------------------------
C3KQN9_RHISN/57-328--------------------------------------------------------------------------------
F4KMJ5_PORAD/29-267--------------------------------------------------------------------------------
E4TT54_MARTH/21-257--------------------------------------------------------------------------------
D6D188_9BACE/31-268--------------------------------------------------------------------------------
A6H0Z4_FLAPJ/21-258--------------------------------------------------------------------------------
H1ZDZ1_MYROD/21-259--------------------------------------------------------------------------------
C4XP38_DESMR/33-276--------------------------------------------------------------------------------
W0EN83_9PORP/21-255--------------------------------------------------------------------------------
W0EYV8_9SPHI/21-264--------------------------------------------------------------------------------
R5VH21_9PORP/22-257--------------------------------------------------------------------------------
I4AP67_FLELS/21-272--------------------------------------------------------------------------------
I0KF94_9BACT/21-257--------------------------------------------------------------------------------
D4IN95_9BACT/21-252--------------------------------------------------------------------------------
A3U798_CROAH/21-257--------------------------------------------------------------------------------
R5GUT3_9BACT/21-259--------------------------------------------------------------------------------
F0RBR0_CELLC/21-260--------------------------------------------------------------------------------
A1B3U8_PARDP/64-333--------------------------------------------------------------------------------
I4C880_DESTA/46-310--------------------------------------------------------------------------------
Q121I3_POLSJ/60-298--------------------------------------------------------------------------------
R6CLT6_9BACE/22-257--------------------------------------------------------------------------------
X5DG71_9BACT/26-262--------------------------------------------------------------------------------
D5ATP2_RHOCB/41-310--------------------------------------------------------------------------------
R5YHQ3_9BACE/21-258--------------------------------------------------------------------------------
R6SA44_9BACE/21-257--------------------------------------------------------------------------------
S5XTM4_PARAH/50-309--------------------------------------------------------------------------------
J7QVY3_METSZ/42-313--------------------------------------------------------------------------------
R7JRE2_9BACT/59-292--------------------------------------------------------------------------------
A4AUF0_MARSH/21-260--------------------------------------------------------------------------------
R6EUG1_9BACE/22-258--------------------------------------------------------------------------------
Q5LH25_BACFN/21-258--------------------------------------------------------------------------------
C6X454_FLAB3/21-258--------------------------------------------------------------------------------
I3Z6K2_BELBD/21-257--------------------------------------------------------------------------------
G0L2J8_ZOBGA/21-255--------------------------------------------------------------------------------
I3YP53_ALIFI/21-252--------------------------------------------------------------------------------
F9Z2U7_ODOSD/27-263--------------------------------------------------------------------------------
R5JB51_9BACE/21-258--------------------------------------------------------------------------------
D3HQS8_LEGLN/335-604--------------------------------------------------------------------------------
F9YS98_CAPCC/21-256--------------------------------------------------------------------------------
R7PCY6_9BACT/23-264--------------------------------------------------------------------------------
Q28TN8_JANSC/41-309--------------------------------------------------------------------------------
L0FZB4_ECHVK/21-257--------------------------------------------------------------------------------
S5XXU5_PARAH/13-280--------------------------------------------------------------------------------
H2JZH7_STRHJ/41-311--------------------------------------------------------------------------------
R7NWR5_9BACE/21-257--------------------------------------------------------------------------------
D2QBX3_SPILD/37-300--------------------------------------------------------------------------------
H8XPR8_FLAIG/21-258--------------------------------------------------------------------------------
T0U393_9STRE/22-259--------------------------------------------------------------------------------
D2QK40_SPILD/21-257--------------------------------------------------------------------------------
R5CG89_9BACE/13-250--------------------------------------------------------------------------------
R5WEX8_9BACT/23-254--------------------------------------------------------------------------------
A5FIN8_FLAJ1/21-261--------------------------------------------------------------------------------
R6AYA1_9BACT/21-266--------------------------------------------------------------------------------
E4RZ72_LEAB4/28-259--------------------------------------------------------------------------------
K4IFD9_PSYTT/21-259--------------------------------------------------------------------------------
R5B7Q4_9BACE/21-258--------------------------------------------------------------------------------
F3ZNK8_9BACE/22-259--------------------------------------------------------------------------------
L7W558_NONDD/21-252--------------------------------------------------------------------------------
I3ZZB3_ORNRL/21-258--------------------------------------------------------------------------------
A3HZZ3_9BACT/21-256--------------------------------------------------------------------------------
R5BJ82_9BACE/23-256--------------------------------------------------------------------------------
R6E4B6_9BACE/21-258--------------------------------------------------------------------------------
R5IRK1_9PORP/21-258--------------------------------------------------------------------------------
B0UMN0_METS4/39-306--------------------------------------------------------------------------------
R5PD70_9PORP/21-257--------------------------------------------------------------------------------
W0AHI1_9SPHN/141-410--------------------------------------------------------------------------------
I3YWC9_AEQSU/21-270--------------------------------------------------------------------------------
A2TZ06_9FLAO/22-258--------------------------------------------------------------------------------
D8LTE6_ECTSI/26-281--------------------------------------------------------------------------------
E6SU26_BACT6/22-259--------------------------------------------------------------------------------
C7M4J9_CAPOD/21-255--------------------------------------------------------------------------------
R5IIF1_9BACT/9-264--------------------------------------------------------------------------------
R5GFU6_9PORP/21-256--------------------------------------------------------------------------------
R6M862_9BACE/23-259--------------------------------------------------------------------------------
C5AW44_METEA/40-311--------------------------------------------------------------------------------
R5W2G8_9BACE/21-257--------------------------------------------------------------------------------
A8LP01_DINSH/55-319--------------------------------------------------------------------------------
S5Y059_PARAH/41-311--------------------------------------------------------------------------------
B0T687_CAUSK/47-313--------------------------------------------------------------------------------
R7DF91_9PORP/21-258--------------------------------------------------------------------------------
C6W6S3_DYAFD/24-261--------------------------------------------------------------------------------
U5Q7D6_9BACT/21-253--------------------------------------------------------------------------------
W8FAI7_9BACT/20-256--------------------------------------------------------------------------------
S5YTU2_PARAH/50-305--------------------------------------------------------------------------------
F2IKK3_FLUTR/21-251--------------------------------------------------------------------------------
F6GCA5_LACS5/22-256--------------------------------------------------------------------------------
H1XPK2_9BACT/21-257--------------------------------------------------------------------------------
J9R834_RIEAN/21-258--------------------------------------------------------------------------------
Q7MVG8_PORGI/56-293--------------------------------------------------------------------------------
D5BGH9_ZUNPS/21-262--------------------------------------------------------------------------------
K4KIG2_SIMAS/57-326--------------------------------------------------------------------------------
R5V0S4_9BACE/23-258--------------------------------------------------------------------------------
D9SAD6_FIBSS/55-314--------------------------------------------------------------------------------
R7EIY0_9BACE/21-258--------------------------------------------------------------------------------

PF13839

CPED1_HUMAN/757-1021---------------------------------------------GI---------------------------------
A9U1Q5_PHYPA/72-368---------------------------------------------NQ---------------------------------
TBL18_ARATH/227-526---------------------------------------------NQ---------------------------------
TBL17_ARATH/190-490---------------------------------------------NQ---------------------------------
TBL22_ARATH/122-412---------------------------------------------NH---------------------------------
TBL19_ARATH/121-411---------------------------------------------NH---------------------------------
A9RCM6_PHYPA/75-370---------------------------------------------NQ---------------------------------
A9RAV2_PHYPA/82-374---------------------------------------------NQ---------------------------------
A9T2B6_PHYPA/55-352---------------------------------------------NQ---------------------------------
A9TUK8_PHYPA/53-350---------------------------------------------NQ---------------------------------
TBL27_ARATH/131-413---------------------------------------------NQ---------------------------------
TBL24_ARATH/132-429---------------------------------------------NH---------------------------------
TBL23_ARATH/132-427---------------------------------------------NH---------------------------------
TBL25_ARATH/151-449---------------------------------------------NH---------------------------------
TBL26_ARATH/143-432---------------------------------------------NH---------------------------------
A5C5G9_VITVI/125-419---------------------------------------------NH---------------------------------
A5BFA6_VITVI/191-485---------------------------------------------NH---------------------------------
A9SPN8_PHYPA/96-376---------------------------------------------QQ---------------------------------
TBL30_ARATH/130-425---------------------------------------------NQ---------------------------------
TBL28_ARATH/124-422---------------------------------------------NQ---------------------------------
TBL31_ARATH/120-407---------------------------------------------ST---------------------------------
A5ADJ7_VITVI/123-409---------------------------------------------GQ---------------------------------
TBL33_ARATH/134-424---------------------------------------------GM---------------------------------
TBL32_ARATH/159-450---------------------------------------------GM---------------------------------
D7SR66_VITVI/138-430---------------------------------------------GQ---------------------------------
TBL34_ARATH/112-406---------------------------------------------GQ---------------------------------
D7SSF9_VITVI/114-388---------------------------------------------NQ---------------------------------
TBL36_ARATH/102-376---------------------------------------------NQ---------------------------------
TBL7_ARATH/167-441---------------------------------------------TQ---------------------------------
E0CQN6_VITVI/163-439---------------------------------------------TQ---------------------------------
TBL43_ARATH/95-367---------------------------------------------NQ---------------------------------
TBL44_ARATH/119-402---------------------------------------------NQ---------------------------------
D7SJV7_VITVI/21-302---------------------------------------------NQ---------------------------------
TBL37_ARATH/117-385---------------------------------------------NM---------------------------------
TBL40_ARATH/97-364---------------------------------------------NM---------------------------------
TBL39_ARATH/99-366---------------------------------------------NM---------------------------------
TBL41_ARATH/86-356---------------------------------------------NQ---------------------------------
TBL42_ARATH/89-358---------------------------------------------NM---------------------------------
E0CS20_VITVI/95-364---------------------------------------------NQ---------------------------------
E0CTP6_VITVI/133-405---------------------------------------------NQ---------------------------------
TBL9_ARATH/120-407---------------------------------------------NQ---------------------------------
D7T6S6_VITVI/145-435---------------------------------------------NQ---------------------------------
TBL10_ARATH/155-447---------------------------------------------NQ---------------------------------
TBL11_ARATH/151-446---------------------------------------------NQ---------------------------------
TBL5_ARATH/194-481---------------------------------------------NQ---------------------------------
TBL6_ARATH/190-473---------------------------------------------NQ---------------------------------
D7SY59_VITVI/169-450---------------------------------------------NM---------------------------------
TBR_ARATH/307-596---------------------------------------------NM---------------------------------
TBL2_ARATH/244-534---------------------------------------------NM---------------------------------
P90793_CAEEL/44-306---------------------------------------------AM---------------------------------
A8XEN8_CAEBR/12-234---------------------------------------------GM---------------------------------
A7SCU9_NEMVE/11-255---------------------------------------------SV---------------------------------
A4IHH2_XENTR/4-243---------------------------------------------SV---------------------------------
PED1B_MOUSE/4-254---------------------------------------------AV---------------------------------
F1M6L4_RAT/19-264---------------------------------------------AV---------------------------------
PED1A_MOUSE/21-267---------------------------------------------AV---------------------------------
PED1B_BOVIN/4-250---------------------------------------------AV---------------------------------
F1PVW1_CANFA/4-250---------------------------------------------AV---------------------------------
A0A024R115_HUMAN/4-250---------------------------------------------AV---------------------------------
B0W8N6_CULQU/74-300---------------------------------------------SL---------------------------------
Q8T3H4_DROME/119-348---------------------------------------------LL---------------------------------
Q6CDI8_YARLI/64-294---------------------------------------------EM---------------------------------
A7RI69_NEMVE/99-327---------------------------------------------GL---------------------------------
B2RAS9_HUMAN/74-292---------------------------------------------QL---------------------------------
A7F4H3_SCLS1/82-326---------------------------------------------QI---------------------------------
CAS1_CRYNJ/90-372---------------------------------------------QL---------------------------------
A8N197_COPC7/69-295---------------------------------------------KL---------------------------------

PF03629

A0ZZI1_BIFAA/132-445--------------------------------------------------------------------------------
A3HTJ4_9BACT/102-524--------------------------------------------------------------------------------
A4AN28_MARSH/117-413--------------------------------------------------------------------------------
A4XG19_CALS8/84-518--------------------------------------------------------------------------------
A5FA09_FLAJ1/103-353--------------------------------------------------------------------------------
A5FC32_FLAJ1/109-397--------------------------------------------------------------------------------
A5FCG2_FLAJ1/104-366--------------------------------------------------------------------------------
A5FLW6_FLAJ1/100-526--------------------------------------------------------------------------------
A6KYD0_BACV8/104-544--------------------------------------------------------------------------------
A6L7S8_BACV8/301-581--------------------------------------------------------------------------------
A6L837_PARD8/106-365--------------------------------------------------------------------------------
A6LG42_PARD8/302-584--------------------------------------------------------------------------------
A9KN08_CLOPH/81-525--------------------------------------------------------------------------------
A9UY79_MONBE/110-371--------------------------------------------------------------------------------
A9UYV9_MONBE/183-446--------------------------------------------------------------------------------
B0SVR2_CAUSK/105-536--------------------------------------------------------------------------------
B0SYV3_CAUSK/103-536--------------------------------------------------------------------------------
B1ZN38_OPITP/124-558--------------------------------------------------------------------------------
B1ZRD5_OPITP/111-543--------------------------------------------------------------------------------
B2UNI0_AKKM8/105-396--------------------------------------------------------------------------------
B3PDW1_CELJU/103-559--------------------------------------------------------------------------------
B8DTK8_BIFA0/83-504--------------------------------------------------------------------------------
B8DVE1_BIFA0/120-432--------------------------------------------------------------------------------
B8I0P3_CLOCE/95-527--------------------------------------------------------------------------------
C1F347_ACIC5/141-569--------------------------------------------------------------------------------
C1F9V4_ACIC5/112-403--------------------------------------------------------------------------------
C3Y8H9_BRAFL/120-404--------------------------------------------------------------------------------
C3Z127_BRAFL/109-390--------------------------------------------------------------------------------
C3Z129_BRAFL/93-393--------------------------------------------------------------------------------
C3ZBF5_BRAFL/95-370--------------------------------------------------------------------------------
C5BNV0_TERTT/112-545--------------------------------------------------------------------------------
C6VYA3_DYAFD/101-531--------------------------------------------------------------------------------
C6W5L8_DYAFD/109-390--------------------------------------------------------------------------------
C6X165_FLAB3/103-532--------------------------------------------------------------------------------
C6XSG1_PEDHD/103-356--------------------------------------------------------------------------------
C6XSW9_PEDHD/104-358--------------------------------------------------------------------------------
C6XUV3_PEDHD/100-352--------------------------------------------------------------------------------
C6XXZ6_PEDHD/106-358--------------------------------------------------------------------------------
C6XYN0_PEDHD/106-369--------------------------------------------------------------------------------
C6Y155_PEDHD/105-361--------------------------------------------------------------------------------
C6Y1K6_PEDHD/105-533--------------------------------------------------------------------------------
C6Y404_PEDHD/303-583--------------------------------------------------------------------------------
C7M404_CAPOD/302-582--------------------------------------------------------------------------------
C7PN71_CHIPD/105-526--------------------------------------------------------------------------------
C7PT40_CHIPD/107-370--------------------------------------------------------------------------------
D0MJ56_RHOM4/105-565--------------------------------------------------------------------------------
D2QQ30_SPILD/101-534--------------------------------------------------------------------------------
D2QX68_PIRSD/107-360--------------------------------------------------------------------------------
D2QYI9_PIRSD/142-409--------------------------------------------------------------------------------
D2R7J4_PIRSD/115-431--------------------------------------------------------------------------------
D2U910_XANAP/119-550--------------------------------------------------------------------------------
D2U9U1_XANAP/109-532--------------------------------------------------------------------------------
D4INS5_9BACT/103-361--------------------------------------------------------------------------------
D4JVY2_9FIRM/84-395--------------------------------------------------------------------------------
D4Z7X6_SPHJU/109-541--------------------------------------------------------------------------------
D5BHF0_ZUNPS/98-525--------------------------------------------------------------------------------
D5EN53_CORAD/103-390--------------------------------------------------------------------------------
D5ER35_CORAD/101-350--------------------------------------------------------------------------------
D5EXD4_PRER2/104-368--------------------------------------------------------------------------------
D6CYE8_9BACE/85-509--------------------------------------------------------------------------------
D6CYV5_9BACE/104-362--------------------------------------------------------------------------------
D6D068_9BACE/96-526--------------------------------------------------------------------------------
D6D180_9BACE/73-515--------------------------------------------------------------------------------
D6D411_9BACE/118-376--------------------------------------------------------------------------------
D9SLS9_CLOC7/541-802--------------------------------------------------------------------------------
D9SWK5_CLOC7/539-800--------------------------------------------------------------------------------
E4RWD7_LEAB4/99-523--------------------------------------------------------------------------------
E4T5G4_PALPW/145-396--------------------------------------------------------------------------------
E4T6U6_PALPW/106-547--------------------------------------------------------------------------------
E6SN70_BACT6/301-581--------------------------------------------------------------------------------
E6U3H5_ETHHY/86-401--------------------------------------------------------------------------------
E6UDX2_RUMA7/82-393--------------------------------------------------------------------------------
E6UGH2_RUMA7/87-510--------------------------------------------------------------------------------
E6WRU5_PSEUU/108-538--------------------------------------------------------------------------------
E6WX51_PSEUU/113-546--------------------------------------------------------------------------------
E8RKP4_ASTEC/107-546--------------------------------------------------------------------------------
E8RP08_ASTEC/110-381--------------------------------------------------------------------------------
E8RR55_ASTEC/105-537--------------------------------------------------------------------------------
E8RVJ6_ASTEC/120-557--------------------------------------------------------------------------------
E8V0Q2_TERSS/105-396--------------------------------------------------------------------------------
E8WX56_ACISM/104-394--------------------------------------------------------------------------------
F0RXK6_SPHGB/84-395--------------------------------------------------------------------------------
F0S4E8_PEDSD/102-363--------------------------------------------------------------------------------
F0SBL8_PEDSD/106-542--------------------------------------------------------------------------------
F0SE55_PEDSD/103-355--------------------------------------------------------------------------------
F0SEX3_PEDSD/110-362--------------------------------------------------------------------------------
F0SLB2_PLABD/105-401--------------------------------------------------------------------------------
F0XZG5_AURAN/371-703--------------------------------------------------------------------------------
F1N0F2_BOVIN/129-405--------------------------------------------------------------------------------
F2JM57_CELLD/90-525--------------------------------------------------------------------------------
F2KZ29_PREDF/320-601--------------------------------------------------------------------------------
F2NB41_CORGP/85-397--------------------------------------------------------------------------------
F2NBE0_CORGP/105-528--------------------------------------------------------------------------------
F4C1D3_SPHS2/119-545--------------------------------------------------------------------------------
F4C667_SPHS2/102-358--------------------------------------------------------------------------------
F4CDE6_SPHS2/103-363--------------------------------------------------------------------------------
F4KXA6_HALH1/110-541--------------------------------------------------------------------------------
F6RRT5_CIOIN/110-408--------------------------------------------------------------------------------
F7AJJ3_HORSE/118-419--------------------------------------------------------------------------------
F7CPG9_XENTR/116-394--------------------------------------------------------------------------------
F8EA22_RUNSL/103-354--------------------------------------------------------------------------------
F8EJ62_RUNSL/102-531--------------------------------------------------------------------------------
F8EQW5_RUNSL/101-532--------------------------------------------------------------------------------
F9D4M3_PREDD/105-362--------------------------------------------------------------------------------
F9Z647_ODOSD/105-527--------------------------------------------------------------------------------
G0GB30_SPITZ/129-404--------------------------------------------------------------------------------
G0GBV2_SPITZ/85-515--------------------------------------------------------------------------------
G0IZQ4_CYCMS/102-365--------------------------------------------------------------------------------
G0L160_ZOBGA/108-362--------------------------------------------------------------------------------
G0L7C6_ZOBGA/106-357--------------------------------------------------------------------------------
G1SIW9_RABIT/119-395--------------------------------------------------------------------------------
G3IIB1_CRIGR/119-418--------------------------------------------------------------------------------
G3NT91_GASAC/117-395--------------------------------------------------------------------------------
G3TGM8_LOXAF/118-419--------------------------------------------------------------------------------
G3WPG6_SARHA/128-405--------------------------------------------------------------------------------
G8NUG1_GRAMM/104-394--------------------------------------------------------------------------------
G8TBM5_NIAKG/101-532--------------------------------------------------------------------------------
G8TEA3_NIAKG/104-360--------------------------------------------------------------------------------
G8TGS0_NIAKG/106-355--------------------------------------------------------------------------------
G8TLW6_NIAKG/105-533--------------------------------------------------------------------------------
G8TN45_NIAKG/114-379--------------------------------------------------------------------------------
G8TQU6_NIAKG/101-533--------------------------------------------------------------------------------
G8UJ84_TANFA/302-584--------------------------------------------------------------------------------
H0XDV1_OTOGA/118-421--------------------------------------------------------------------------------
H1Y7E7_9SPHI/107-370--------------------------------------------------------------------------------
H1YEP3_9SPHI/107-377--------------------------------------------------------------------------------
H1YFU1_9SPHI/105-542--------------------------------------------------------------------------------
H1YHR5_9SPHI/103-534--------------------------------------------------------------------------------
H2MHU5_ORYLA/110-406--------------------------------------------------------------------------------
H2NFQ7_PONAB/118-394--------------------------------------------------------------------------------
H2T5J8_TAKRU/109-378--------------------------------------------------------------------------------
H8KVR3_SOLCM/112-540--------------------------------------------------------------------------------
H9G3E2_ANOCA/113-390--------------------------------------------------------------------------------
I0IFA8_PHYMF/116-371--------------------------------------------------------------------------------
I0IGP0_PHYMF/113-573--------------------------------------------------------------------------------
I0K882_9BACT/102-533--------------------------------------------------------------------------------
I0KDZ4_9BACT/80-507--------------------------------------------------------------------------------
I2F010_EMTOG/101-530--------------------------------------------------------------------------------
I3JCR3_ORENI/107-370--------------------------------------------------------------------------------
I3NAW5_SPETR/119-428--------------------------------------------------------------------------------
I3YNK6_ALIFI/103-360--------------------------------------------------------------------------------
I3Z657_BELBD/107-540--------------------------------------------------------------------------------
I6ZXF8_MELRP/103-560--------------------------------------------------------------------------------
I7A330_MELRP/101-533--------------------------------------------------------------------------------
K1PIG0_CRAGI/75-338--------------------------------------------------------------------------------
L0DNV4_SINAD/113-408--------------------------------------------------------------------------------
L0FZA4_ECHVK/103-365--------------------------------------------------------------------------------
L0G4D5_ECHVK/108-537--------------------------------------------------------------------------------
L0G5F4_ECHVK/309-586--------------------------------------------------------------------------------
L0G6Q7_ECHVK/110-371--------------------------------------------------------------------------------
M3VYU4_FELCA/118-393--------------------------------------------------------------------------------
M3XHL6_LATCH/120-399--------------------------------------------------------------------------------
M3ZH48_XIPMA/107-384--------------------------------------------------------------------------------
SIAE_MOUSE/118-420--------------------------------------------------------------------------------
Q022C5_SOLUE/94-383--------------------------------------------------------------------------------
Q15XN0_PSEA6/106-529--------------------------------------------------------------------------------
Q1IR02_KORVE/102-394--------------------------------------------------------------------------------
Q1LUX8_DANRE/112-383--------------------------------------------------------------------------------
Q21HS7_SACD2/109-546--------------------------------------------------------------------------------
Q5LA76_BACFN/104-538--------------------------------------------------------------------------------
Q7UKM9_RHOBA/136-425--------------------------------------------------------------------------------
Q7UL92_RHOBA/160-428--------------------------------------------------------------------------------
Q7UPP2_RHOBA/115-412--------------------------------------------------------------------------------
Q8A0D0_BACTN/104-546--------------------------------------------------------------------------------
Q8A1R2_BACTN/105-365--------------------------------------------------------------------------------
Q8A2Y4_BACTN/104-362--------------------------------------------------------------------------------
Q8A323_BACTN/103-546--------------------------------------------------------------------------------
Q8A331_BACTN/104-369--------------------------------------------------------------------------------
Q8A6U7_BACTN/107-449--------------------------------------------------------------------------------
Q8AAK7_BACTN/303-583--------------------------------------------------------------------------------
Q8P3G8_XANCP/110-540--------------------------------------------------------------------------------
Q8P9U4_XANCP/106-528--------------------------------------------------------------------------------
Q9AA13_CAUCR/103-537--------------------------------------------------------------------------------
R5ATT9_9BACT/97-358--------------------------------------------------------------------------------
R5C0U7_9BACE/106-371--------------------------------------------------------------------------------
R5CMH4_9FIRM/112-544--------------------------------------------------------------------------------
R5CR26_9BACT/106-368--------------------------------------------------------------------------------
R5CRW3_9BACT/103-359--------------------------------------------------------------------------------
R5CVR0_9BACT/37-472--------------------------------------------------------------------------------
R5CVU7_9BACT/105-371--------------------------------------------------------------------------------
R5FQG9_9BACT/98-360--------------------------------------------------------------------------------
R5GQ73_9FIRM/87-396--------------------------------------------------------------------------------
R5I3U1_9PORP/108-543--------------------------------------------------------------------------------
R5I599_9PORP/104-370--------------------------------------------------------------------------------
R5I8Z5_9PORP/109-398--------------------------------------------------------------------------------
R5I9A4_9PORP/110-550--------------------------------------------------------------------------------
R5ICE3_9PORP/106-356--------------------------------------------------------------------------------
R5IPA1_9PORP/103-532--------------------------------------------------------------------------------
R5J8I9_9BACE/107-548--------------------------------------------------------------------------------
R5J9D0_9BACE/301-581--------------------------------------------------------------------------------
R5JB68_9BACE/94-354--------------------------------------------------------------------------------
R5JE70_9BACE/106-367--------------------------------------------------------------------------------
R5JUI1_9BACE/107-546--------------------------------------------------------------------------------
R5JY84_9CLOT/86-397--------------------------------------------------------------------------------
R5KDD9_9BACT/106-367--------------------------------------------------------------------------------
R5KI40_9BACT/107-545--------------------------------------------------------------------------------
R5KI88_9BACT/106-368--------------------------------------------------------------------------------
R5M4F3_9BACE/103-392--------------------------------------------------------------------------------
R5M9T3_9BACE/100-533--------------------------------------------------------------------------------
R5MCJ4_9BACE/107-370--------------------------------------------------------------------------------
R5MCV5_9BACE/117-382--------------------------------------------------------------------------------
R5NAN5_9BACT/95-508--------------------------------------------------------------------------------
R5NWA0_9PORP/104-366--------------------------------------------------------------------------------
R5PFV8_9BACT/95-546--------------------------------------------------------------------------------
R5RU50_9BACE/106-368--------------------------------------------------------------------------------
R5S363_9BACE/112-377--------------------------------------------------------------------------------
R5U9L2_9BACE/103-366--------------------------------------------------------------------------------
R5UQU2_9PORP/301-581--------------------------------------------------------------------------------
R5XXY6_9FIRM/83-407--------------------------------------------------------------------------------
R6BWP4_9CLOT/125-575--------------------------------------------------------------------------------
R6CBR0_9FIRM/90-402--------------------------------------------------------------------------------
R6CT48_9BACE/308-588--------------------------------------------------------------------------------
R6CZR7_9BACE/103-360--------------------------------------------------------------------------------
R6DIJ1_9BACE/99-533--------------------------------------------------------------------------------
R6DJ41_9BACE/303-583--------------------------------------------------------------------------------
R6DWQ0_9BACT/104-366--------------------------------------------------------------------------------
R6E989_9BACE/963-1241--------------------------------------------------------------------------------
R6EGK2_9FIRM/83-401--------------------------------------------------------------------------------
R6F527_9BACT/343-624--------------------------------------------------------------------------------
R6FK85_9BACE/101-514--------------------------------------------------------------------------------
R6GA32_9BACE/128-565--------------------------------------------------------------------------------
R6K607_9BACE/105-361--------------------------------------------------------------------------------
R6KHE9_9BACE/106-368--------------------------------------------------------------------------------
R6KHK2_9BACE/100-362--------------------------------------------------------------------------------
R6KJ37_9BACE/119-553--------------------------------------------------------------------------------
R6KNC4_9BACE/104-538--------------------------------------------------------------------------------
R6KU81_9BACE/100-533--------------------------------------------------------------------------------
R6L845_9BACE/106-539--------------------------------------------------------------------------------
R6L914_9BACE/107-368--------------------------------------------------------------------------------
R6LEJ2_9BACE/109-369--------------------------------------------------------------------------------
R6M7W6_9BACE/104-365--------------------------------------------------------------------------------
R6MBW6_9BACE/104-365--------------------------------------------------------------------------------
R6MD77_9BACE/131-411--------------------------------------------------------------------------------
R6MGF8_9BACE/106-368--------------------------------------------------------------------------------
R6MRS7_9FIRM/84-393--------------------------------------------------------------------------------
R6NFL1_9BACE/103-361--------------------------------------------------------------------------------
R6QQ52_9BACT/103-365--------------------------------------------------------------------------------
R6SZ03_9FIRM/82-394--------------------------------------------------------------------------------
R6TMT5_9FIRM/79-326--------------------------------------------------------------------------------
R6TYL3_9FIRM/88-372--------------------------------------------------------------------------------
R6VGA6_9FIRM/87-503--------------------------------------------------------------------------------
R6VGP4_9BACT/119-542--------------------------------------------------------------------------------
R6VYK5_9BACT/95-522--------------------------------------------------------------------------------
R6W3N6_9BACT/103-360--------------------------------------------------------------------------------
R6WVP4_9BACT/103-358--------------------------------------------------------------------------------
R6X6R9_9PORP/299-581--------------------------------------------------------------------------------
R6X8A0_9BACT/104-361--------------------------------------------------------------------------------
R6XDK3_9BACT/111-376--------------------------------------------------------------------------------
R6XW57_9BACT/105-369--------------------------------------------------------------------------------
R6YB86_9BACE/303-583--------------------------------------------------------------------------------
R6YLG6_9BACE/106-367--------------------------------------------------------------------------------
R6ZQY5_9FIRM/86-518--------------------------------------------------------------------------------
R7D1U4_9BACE/101-514--------------------------------------------------------------------------------
R7DGQ2_9PORP/109-450--------------------------------------------------------------------------------
R7DHQ3_9PORP/103-362--------------------------------------------------------------------------------
R7EBZ9_9BACE/116-365--------------------------------------------------------------------------------
R7ELJ2_9BACE/104-363--------------------------------------------------------------------------------
R7FDG6_9FIRM/85-396--------------------------------------------------------------------------------
R7HK49_9BACT/112-371--------------------------------------------------------------------------------
R7IBZ1_9FIRM/91-402--------------------------------------------------------------------------------
R7KXY0_9FIRM/78-504--------------------------------------------------------------------------------
R7L392_9BACT/141-439--------------------------------------------------------------------------------
R7L457_9BACT/106-408--------------------------------------------------------------------------------
R7L551_9BACT/107-409--------------------------------------------------------------------------------
R7LBC9_9BACT/106-408--------------------------------------------------------------------------------
R7LCZ4_9BACT/117-400--------------------------------------------------------------------------------
R7LEI0_9BACT/104-413--------------------------------------------------------------------------------
R7N8V0_9FIRM/86-515--------------------------------------------------------------------------------
R7NVJ4_9BACE/94-536--------------------------------------------------------------------------------
S0ET71_CHTCT/118-391--------------------------------------------------------------------------------
T2KJY6_9FLAO/72-379--------------------------------------------------------------------------------
T2KKF3_9FLAO/106-399--------------------------------------------------------------------------------
T2KL42_9FLAO/108-425--------------------------------------------------------------------------------
U3JRM3_FICAL/110-387--------------------------------------------------------------------------------
U5Q6R0_9BACT/120-374--------------------------------------------------------------------------------
V8NYK2_OPHHA/82-359--------------------------------------------------------------------------------
W0ETR7_9SPHI/108-546--------------------------------------------------------------------------------
W0ETZ4_9SPHI/87-339--------------------------------------------------------------------------------
W0EW65_9PORP/114-543--------------------------------------------------------------------------------
W0EXJ4_9SPHI/101-529--------------------------------------------------------------------------------
W0EYF1_9SPHI/303-584--------------------------------------------------------------------------------
W0F205_9SPHI/104-389--------------------------------------------------------------------------------
W0F686_9SPHI/73-335--------------------------------------------------------------------------------
W0IV69_9BACT/122-573--------------------------------------------------------------------------------
W0IY28_9BACT/102-398--------------------------------------------------------------------------------
W0IZR9_9BACT/107-406--------------------------------------------------------------------------------
W0J089_9BACT/113-554--------------------------------------------------------------------------------
W0J126_9BACT/103-396--------------------------------------------------------------------------------
W0J1D8_9BACT/103-397--------------------------------------------------------------------------------
W0J1I7_9BACT/127-575--------------------------------------------------------------------------------
W0J1Z1_9BACT/122-573--------------------------------------------------------------------------------
W0J1Z2_9BACT/111-557--------------------------------------------------------------------------------
W0J268_9BACT/121-368--------------------------------------------------------------------------------
W0J4T5_9BACT/111-561--------------------------------------------------------------------------------
W0J8X3_9BACT/103-397--------------------------------------------------------------------------------
W0JAS2_9BACT/114-570--------------------------------------------------------------------------------
W0RMP1_9BACT/123-554--------------------------------------------------------------------------------
W4XVQ4_STRPU/82-385--------------------------------------------------------------------------------
W4XVQ5_STRPU/118-400--------------------------------------------------------------------------------
W5M5G7_LEPOC/114-388--------------------------------------------------------------------------------
W5X997_9BACT/100-533--------------------------------------------------------------------------------
W5XA59_9BACT/96-545--------------------------------------------------------------------------------
W8EWI8_9BACT/105-543--------------------------------------------------------------------------------
W8F2B5_9BACT/111-544--------------------------------------------------------------------------------
X5DC27_9BACT/316-598--------------------------------------------------------------------------------

PF03996

HEMA_CVMA5/9-391--------------------------------------------------------------------------------
HEMA_INCAA/19-420--------------------------------------------------------------------------------
HEMA_BRV1/2-378--------------------------------------------------------------------------------

PF14286

D4LDC0_RUMC1/65-436--------------------------------------------------------------------------------
C4Z3Y8_EUBE2/59-440--------------------------------------------------------------------------------
R6N2Z9_9CLOT/53-417--------------------------------------------------------------------------------

PF16822

M4X2G9_PSEDE/89-360--------------------------------------------------------------------------------
D9SK13_GALCS/90-349--------------------------------------------------------------------------------
D7CVL9_TRURR/113-377--------------------------------------------------------------------------------
A4XSW9_PSEMY/87-346--------------------------------------------------------------------------------
A7IG51_XANP2/41-300--------------------------------------------------------------------------------
Q0VSK8_ALCBS/79-348--------------------------------------------------------------------------------
D9SC65_GALCS/39-314--------------------------------------------------------------------------------
Q2KWS4_BORA1/105-364--------------------------------------------------------------------------------
A4XSW7_PSEMY/65-332--------------------------------------------------------------------------------
A8LND2_DINSH/79-327--------------------------------------------------------------------------------
C4LEL0_TOLAT/54-306--------------------------------------------------------------------------------
Q0VSL0_ALCBS/86-342--------------------------------------------------------------------------------
D7CSL0_TRURR/51-309--------------------------------------------------------------------------------
F6AHE0_PSEF1/87-346--------------------------------------------------------------------------------
A9BZH9_DELAS/53-312--------------------------------------------------------------------------------
A7IG52_XANP2/88-341--------------------------------------------------------------------------------
A8ICK2_AZOC5/86-338--------------------------------------------------------------------------------
H9UGT7_SPIAZ/108-374--------------------------------------------------------------------------------
F6AHE2_PSEF1/62-330--------------------------------------------------------------------------------
A8ICK4_AZOC5/30-289--------------------------------------------------------------------------------
A4XR24_PSEMY/81-343--------------------------------------------------------------------------------
A4XR27_PSEMY/64-322--------------------------------------------------------------------------------
A9BZH8_DELAS/91-352--------------------------------------------------------------------------------
C1DP87_AZOVD/81-346--------------------------------------------------------------------------------
C1DP90_AZOVD/67-327--------------------------------------------------------------------------------
F2KL48_PSEBN/64-330--------------------------------------------------------------------------------
ALGX_PSEAE/64-325--------------------------------------------------------------------------------
ALGJ_PSEAE/85-355--------------------------------------------------------------------------------
Q6N6N6_RHOPA/99-362--------------------------------------------------------------------------------
ALGJ_PSESM/81-346--------------------------------------------------------------------------------
Q888J0_PSESM/99-365--------------------------------------------------------------------------------
ALGJ_PSEPK/81-346--------------------------------------------------------------------------------

PF00657

O04702_DAUCA/33-364.............................................................................---
Q39308_BRANA/36-320.............................................................................---
AOAH_HUMAN/257-543...................................................NLPTALTNELDWPQLSGATGFLDSTV---
GDL49_ARATH/37-365.............................................................................---
Q9A6E2_CAUCR/200-399.....................................................................PNTNLRWT---
F0K6Q8_CLOAE/64-257.........................................................................GDEK---
A5FND2_FLAJ1/74-458YNERFSCNRIWESYRNIYPVRNYPVGLSGIGLWRDTGGFVMEMSVKDAAYKFNTIQIITPKNENMFDLASGSQTKFV---
A0A030Y1E2_PSEAI/215-418.....................................................................LDRNSRWP---
D4FZ14_BACNB/25-235........................................................................NWDYR---
D4FXT7_BACNB/43-243........................................................................GDPDG---
D6EFV3_STRLI/66-296..................................................................SDCPEVSWATG---
Q9LHY3_ORYSJ/5-203.............................................................................---
Q98E95_RHILO/55-223..........................................................................GLG---
H0H5K0_RHIRD/5-204.......................................................................DAETGG---
RHA1_ASPAC/20-225.............................................................................---
Q40317_MEDSA/37-362.............................................................................---
Q9KZR1_STRCO/239-441.....................................................................SDANHRWT---
A6ZNX3_YEAS7/6-203.............................................................................---
APG_ARATH/205-524.............................................................................---
GDL88_ARATH/5-204.............................................................................---
B8ZUH2_MYCLB/42-222......................................................................GDDTVGL---
F0KA74_CLOAE/3-182.............................................................................---
Q9XIY6_ORYSJ/32-357.............................................................................---
F7URY0_SYNYG/103-399.............................................................................---
L8ADB1_BACIU/5-198.............................................................................---
GCAT_AERHY/28-322......................................................................SSPPYYE---
APG_BRANA/126-441.............................................................................---
GUNE_CLOTM/606-804....................................................................GTSKEQSFT---
GDL20_ARATH/34-330.............................................................................---
PLB1_RABIT/741-1015............................................SLDNVTTLPNILRQFNSNLMGFAVGTGDASGT.---
O13496_NEOPA/166-382.....................................................................DGTEGTFS---
D6ETP1_STRLI/75-262........................................................................GVHRA---
GDL17_ARATH/35-352.............................................................................---
GDL14_ARATH/33-344.............................................................................---
ESM1_ARATH/37-340.............................................................................---
GDL84_ARATH/6-205.............................................................................---
IAH1_MOUSE/18-213.............................................................................---
O30643_MYCHY/42-337................................................................FQGTLDKDGNLSG---
Q9AYM5_VIGUN/9-201.............................................................................---
Q9AUZ9_ORYSJ/6-205.............................................................................---
LIP4_ARATH/41-355.............................................................................---
LIP1_PHOLU/28-343...................................................................TVDGINGTES---
PLB1_RABIT/394-668............................................NISTVTTLANILREFNPSLQGFSVGTGRETTS.---
E1CZP1_VIBPH/147-406.............................................................................---
O05695_RHILE/46-219.............................................................................---
Q9Y7C6_ASPTE/61-245..........................................................................LSS---
B8GZL4_CAUCN/136-332...................................................................TSRSCTAQQI---
GDL2_ARATH/38-352.............................................................................---
E8V9H4_BACST/5-202........................................................................GSGLF---
IAH1_SCHPO/40-217.............................................................................---
A0A023YSK5_ECOLX/30-196..........................................................................RMS---
F7UR16_SYNYG/108-371.............................................................................---
F7UTB4_SYNYG/22-217.............................................................LRRFWMEENGPV....---
Q98EU1_RHILO/215-418.....................................................................LDADNRWP---
GDL61_ARATH/35-364.............................................................................---
D6EF39_STRLI/5-186......................................................................PGPDGAF---
Q98FI8_RHILO/49-230.............................................................................---
PLB1_RABIT/1097-1363............................................ALETHTTLPNILKKFNPSILGFSTGTLEGTMG.---
A0A011SWS0_VIBPH/23-192..........................................................................QMP---
D6ESA2_STRLI/10-188......................................................................LLPDGSY---
F0KDL5_CLOAE/81-259........................................................................SATSQ---
O82681_DIGLA/36-364.............................................................................---
GDL51_ARATH/33-334.............................................................................---
Q9N4P5_CAEEL/105-346...............................................GLVTIPNILSQFGSNLEGISHGMGSKRALP---
O13497_NEOPA/65-271..............................................................LYSDLTKQGYKIDMV---
Q9RLB8_RUMFL/46-256..............................................................LSYFLQQKGYTNVDL---

PF13472

A6CB21_9PLAN/150-378------------------------------------------------------------------------GVPIE---
D1PUP8_9BACT/35-254------------------------------------------------------------------------LHKHP---
B3ZRE8_BACCE/94-261------------------------------------------------------------------------WAAQ.---
B3JF97_9BACE/27-230------------------------------------------------------------------------V....---
D3I0Q9_9BACT/27-262------------------------------------------------------------------------.....---
D9ST65_CLOC7/48-258------------------------------------------------------------------------TD...---
C9P7F5_VIBME/587-832------------------------------------------------------------------------EPEV.---
D0KJY6_PECWW/280-526------------------------------------------------------------------------E....---
A6VT95_MARMS/597-842------------------------------------------------------------------------P....---
C7PCM7_CHIPD/56-238------------------------------------------------------------------------YQSPG---
A0A015V9G1_BACFG/26-237------------------------------------------------------------------------LLKTP---
A0L6K4_MAGSM/99-344------------------------------------------------------------------------GIADE---
A6CFV6_9PLAN/46-231------------------------------------------------------------------------GWEGN---
Q5WDC0_BACSK/80-245------------------------------------------------------------------------.....---
B9XGI8_PEDPL/55-242------------------------------------------------------------------------.....---
Q55JQ6_CRYNB/163-345------------------------------------------------------------------------HPSDR---
A0R4U0_MYCS2/44-205------------------------------------------------------------------------KNRVV---
A4AUT7_MARSH/28-205------------------------------------------------------------------------TP...---
A6DGK9_9BACT/47-216------------------------------------------------------------------------TPRVR---
A6DN56_9BACT/46-229------------------------------------------------------------------------TLYVR---
A6DFI9_9BACT/47-227------------------------------------------------------------------------TLQVR---
A6C0R7_9PLAN/137-294------------------------------------------------------------------------TQ...---
B4DAN0_9BACT/47-221------------------------------------------------------------------------.....---
C9RLP9_FIBSS/29-241------------------------------------------------------------------------YPKQ.---
B8HEE5_ARTCA/19-203------------------------------------------------------------------------IRQED---
D4P7Z6_9CAUD/47-228------------------------------------------------------------------------VIVPA---
Q26FJ0_FLABB/320-507------------------------------------------------------------------------GP...---
D4LAZ2_RUMC1/45-211------------------------------------------------------------------------LDNA.---
A6DGG0_9BACT/306-477------------------------------------------------------------------------RPI..---
A6C1A5_9PLAN/64-235------------------------------------------------------------------------RPM..---
C6VTV7_DYAFD/306-477------------------------------------------------------------------------RDK..---
Q024D6_SOLUE/343-514------------------------------------------------------------------------RDL..---
C6XTK4_PEDHD/89-262------------------------------------------------------------------------RLQ..---
A6CD84_9PLAN/59-238------------------------------------------------------------------------RVK..---
B1QLA1_CLOBO/9-176------------------------------------------------------------------------GATAK---
B1QZ80_CLOBU/39-204------------------------------------------------------------------------NSTVY---
D1PQR9_9FIRM/213-389------------------------------------------------------------------------GAVPE---
D4J178_BUTFI/214-387------------------------------------------------------------------------GATPI---
C7GE42_9FIRM/218-391------------------------------------------------------------------------GAVPL---
C6D766_PAESJ/54-231------------------------------------------------------------------------GADPL---
A4F260_9BACL/79-256------------------------------------------------------------------------GAIPI---
D4LBB7_RUMC1/90-255------------------------------------------------------------------------AASTT---
B0MNZ3_9FIRM/121-287------------------------------------------------------------------------SAGND---
A9KK54_CLOPH/36-202------------------------------------------------------------------------LSSAP---
A8SWK4_9FIRM/25-191------------------------------------------------------------------------LATEH---
D4CMI8_9FIRM/24-190------------------------------------------------------------------------LASVH---
D4JWU9_9FIRM/107-271------------------------------------------------------------------------TAGPE---
F1TIB6_9CLOT/41-206------------------------------------------------------------------------NGGPD---
D9SWK7_CLOC7/42-207------------------------------------------------------------------------MVEEK---
I8IAV0_ASPO3/31-220------------------------------------------------------------------------.....---
Q9NET4_CAEEL/135-382------------------------------------------------------------------------GNPDI---
D4K132_9FIRM/101-367------------------------------------------------------------------------GLADV---
C7NNZ0_HALUD/159-325------------------------------------------------------------------------.....---
C7MWU0_SACVD/42-317------------------------------------------------------------------------GAGDY---
C6WNW7_ACTMD/46-324------------------------------------------------------------------------GAGDY---
Q2JSP6_SYNJA/145-318------------------------------------------------------------------------SA...---
B7K022_CYAP8/136-309------------------------------------------------------------------------NA...---
Q7NG29_GLOVI/223-396------------------------------------------------------------------------KA...---
C8WV25_ALIAD/4-203------------------------------------------------------------------------CAS..---
A2SLH8_METPP/326-507------------------------------------------------------------------------.....---
D1YEJ8_PROAA/217-485------------------------------------------------------------------------GTLRD---
D4H968_PROAS/4-269------------------------------------------------------------------------GTLVD---
C7QHD3_CATAD/44-286------------------------------------------------------------------------QPNAV---
D2SC17_GEOOG/45-295------------------------------------------------------------------------GIPNI---
B0R7G2_HALS3/8-179------------------------------------------------------------------------.....---
C7Q7I2_CATAD/34-215------------------------------------------------------------------------ADEVP---
C5AYH8_METEA/18-261------------------------------------------------------------------------QIDKL---
C4LKI0_CORK4/42-288------------------------------------------------------------------------LAQQV---
C4LIB2_CORK4/93-341------------------------------------------------------------------------LTTPQ---
C8NQ69_COREF/53-285------------------------------------------------------------------------RDQPL---
C6R8G3_9CORY/32-256------------------------------------------------------------------------TTLPL---
C2CL07_CORST/42-274------------------------------------------------------------------------RQGPH---
C0E4P4_9CORY/59-301------------------------------------------------------------------------WDQVE---
C7Q9F9_CATAD/192-424------------------------------------------------------------------------RPVSH---
C8NR28_COREF/64-307------------------------------------------------------------------------EIPLQ---
Q4PCC7_USTMA/4-264------------------------------------------------------------------------GIPPQ---
B0RD91_CLAMS/80-246------------------------------------------------------------------------GIETS---
D0WS14_9ACTO/82-334------------------------------------------------------------------------GVPPY---
Q2J4R6_FRASC/58-292------------------------------------------------------------------------GNPPF---
Q2JGN4_FRASC/87-354------------------------------------------------------------------------GAGPV---
D3Q6I6_STANL/33-249------------------------------------------------------------------------GTREY---
C6WBG5_ACTMD/46-260------------------------------------------------------------------------GAGSE---
C7Q4A1_CATAD/38-331------------------------------------------------------------------------FVGDP---
C6WEE8_ACTMD/40-312------------------------------------------------------------------------IQAAG---
Q59837_9ACTO/42-313------------------------------------------------------------------------AIDYP---
B0RDF3_CLAMS/61-325------------------------------------------------------------------------GSA..---
E3J726_FRASU/30-260------------------------------------------------------------------------GTGPD---
D0L3H8_GORB4/59-296------------------------------------------------------------------------AVSRL---
Q2G7C8_NOVAD/37-269------------------------------------------------------------------------GVGPN---
B1MBB4_MYCA9/6-245------------------------------------------------------------------------GIMPR---
A0A049DM81_MYCTX/5-247------------------------------------------------------------------------GIRPR---
Q1BEL5_MYCSS/5-240------------------------------------------------------------------------GIRPS---
C8X8C1_NAKMY/4-247------------------------------------------------------------------------TLEPV---
D5UYZ9_TSUPD/8-250------------------------------------------------------------------------GIDPV---
C3JHG1_RHOER/48-287------------------------------------------------------------------------RLEPM---
I0WS61_9NOCA/25-264------------------------------------------------------------------------YLAPI---
Q0SDG5_RHOSR/112-351------------------------------------------------------------------------PHDPL---
Q5YWR3_NOCFA/42-272------------------------------------------------------------------------RDVDL---
C7MPN1_SACVD/36-282------------------------------------------------------------------------LIPFQ---
A3KIR8_STRAM/40-281------------------------------------------------------------------------GVLPV---
A4FQW5_SACEN/16-253------------------------------------------------------------------------LIPGP---
C7Q6B9_CATAD/40-284------------------------------------------------------------------------LIPDP---
C6WQR1_ACTMD/40-279------------------------------------------------------------------------LIPDF---
A0ACN1_STRAM/56-294------------------------------------------------------------------------GVPEQ---
B5GK11_STRSH/58-296------------------------------------------------------------------------GIPPQ---
E8RZ59_MICSL/43-287------------------------------------------------------------------------LVPTQ---
D3Q5A1_STANL/36-280------------------------------------------------------------------------LNTLP---
D7B873_NOCDD/48-286------------------------------------------------------------------------LIREE---
C7QAZ6_CATAD/32-275------------------------------------------------------------------------LLKPA---
C6W714_DYAFD/85-374------------------------------------------------------------------------PY...---
D6SU72_9DELT/52-277------------------------------------------------------------------------.....---
B7FQA7_PHATC/284-494------------------------------------------------------------------------NCAIS---
Q7UHB8_RHOBA/116-390------------------------------------------------------------------------.....---
A3IGT7_9CHRO/5-189------------------------------------------------------------------------NNP..---
A9W7C8_METEP/41-224------------------------------------------------------------------------YVRGG---
D2VPA0_NAEGR/183-378------------------------------------------------------------------------SPLTE---
A0A059FZA4_9RHOB/45-228------------------------------------------------------------------------GVLGE---
A0M4R3_GRAFK/29-191------------------------------------------------------------------------.....---
A1ZSQ7_9BACT/37-218------------------------------------------------------------------------.....---
C7N6X3_SLAHD/4-173------------------------------------------------------------------------LAELL---
B0PGN9_9FIRM/4-174------------------------------------------------------------------------MPQML---
A6C7M7_9PLAN/118-270------------------------------------------------------------------------.....---
A9DZV2_9RHOB/29-212------------------------------------------------------------------------AAIPD---
A3TT74_9RHOB/30-207------------------------------------------------------------------------.....---
Q1GDU1_RUEST/29-214------------------------------------------------------------------------SQQ..---
A3X495_9RHOB/37-223------------------------------------------------------------------------ASSR.---
Q0FN89_PELBH/30-215------------------------------------------------------------------------GQ...---
A3SQH4_9RHOB/29-214------------------------------------------------------------------------.....---
B5JQV4_9BACT/5-178------------------------------------------------------------------------SPVLA---
Q98QP8_MYCPU/123-384------------------------------------------------------------------------NAKML---
Q4A5V3_MYCS5/112-382------------------------------------------------------------------------DGSLD---
C5J6Z9_MYCCR/63-342------------------------------------------------------------------------NFDYF---
Q4A638_MYCS5/66-330------------------------------------------------------------------------DASLP---
C7HER8_CLOTM/72-237------------------------------------------------------------------------LET..---
B1V222_CLOPF/89-252------------------------------------------------------------------------GKTDE---
C6JH48_9FIRM/175-357------------------------------------------------------------------------LLR..---
C6JEJ0_9FIRM/144-325------------------------------------------------------------------------.....---
C0CUW9_9CLOT/13-215------------------------------------------------------------------------GSSDD---
B6WR90_9DELT/11-187------------------------------------------------------------------------.....---
A0LCN0_MAGSM/5-178------------------------------------------------------------------------.....---
Q3I1P3_NOSCO/11-184------------------------------------------------------------------------.....---
A6SVS4_JANMA/15-191------------------------------------------------------------------------.....---
Q9WX72_KOMXY/391-555------------------------------------------------------------------------.....---
C7NJR7_KYTSD/35-207------------------------------------------------------------------------.....---
C6R448_9MICC/9-180------------------------------------------------------------------------.....---
C7MDV1_BRAFD/19-197------------------------------------------------------------------------.....---
C0VZX9_9ACTO/7-177------------------------------------------------------------------------.....---
D0WRR1_9ACTO/4-174------------------------------------------------------------------------.....---
C0W8N0_9ACTO/7-176------------------------------------------------------------------------.....---
A7BEA0_9ACTO/4-180------------------------------------------------------------------------.....---
B4VFY0_9ACTO/4-206------------------------------------------------------------------------AGDYT---
D6EIK2_STRLI/5-204------------------------------------------------------------------------AGEHT---
C9YTJ8_STRSW/23-224------------------------------------------------------------------------AGEHT---
D1JW12_9BACE/105-286------------------------------------------------------------------------IFPRT---
D4LCL4_RUMC1/194-360------------------------------------------------------------------------MN...---
A9ERQ8_SORC5/256-427------------------------------------------------------------------------DR...---
Q2IJI2_ANADE/216-377------------------------------------------------------------------------FDRAP---
C7CE49_METED/90-259------------------------------------------------------------------------GASAS---
B1LYU8_METRJ/69-238------------------------------------------------------------------------SA...---
Q08RB4_STIAD/155-337------------------------------------------------------------------------CALSQ---
Q09AA0_STIAD/808-992------------------------------------------------------------------------AWP..---
A1TPP3_ACIAC/38-217------------------------------------------------------------------------GISTP---
D9QH72_BRESC/63-251------------------------------------------------------------------------DIAAS---
C1JGV8_OENOE/138-305------------------------------------------------------------------------WVMGK---
D2EH32_PEDAC/143-309------------------------------------------------------------------------WVREK---
A3TNT3_9MICO/8-226------------------------------------------------------------------------GGGAK---
A1R9P0_ARTAT/42-278------------------------------------------------------------------------GAGGL---
A0K019_ARTS2/42-283------------------------------------------------------------------------GAGAA---
D5US67_TSUPD/127-286------------------------------------------------------------------------GVSKT---
A0R4U1_MYCS2/55-233------------------------------------------------------------------------SSAEL---
A1T9E0_MYCVP/41-214------------------------------------------------------------------------D....---
A0A038FFY2_MYCTX/41-217------------------------------------------------------------------------D....---
C0FVT0_9FIRM/128-299------------------------------------------------------------------------HDYGG---
A6NRB4_9FIRM/119-293------------------------------------------------------------------------RL...---
D4KZ95_9FIRM/94-264------------------------------------------------------------------------KEYGT---
C0D9S1_9CLOT/121-291------------------------------------------------------------------------FEYGD---
A8RNE1_CLOBW/141-311------------------------------------------------------------------------FEYGD---
A6BEQ0_9FIRM/72-271------------------------------------------------------------------------LNSYF---
A9W7Z7_METEP/562-744------------------------------------------------------------------------.....---
C2L1C0_9FIRM/5-187------------------------------------------------------------------------LPNEK---
C3Q1I0_9BACE/291-472------------------------------------------------------------------------.....---
D1PYA2_9BACT/87-263------------------------------------------------------------------------.....---
B9CP22_9ACTN/198-361------------------------------------------------------------------------VAG..---
B2AV39_PODAN/50-240------------------------------------------------------------------------GPNL.---
D4KBN7_9FIRM/161-338------------------------------------------------------------------------SDYQI---
A8SEI6_9FIRM/112-289------------------------------------------------------------------------.....---
D2VNU3_NAEGR/46-260------------------------------------------------------------------------Y....---
A1DLF9_NEOFI/8-203------------------------------------------------------------------------YHFG.---
C7YGY2_NECH7/9-186------------------------------------------------------------------------GSHPY---
Q2H5R4_CHAGB/10-200------------------------------------------------------------------------SAWG.---
B2AU74_PODAN/10-195------------------------------------------------------------------------SYLG.---
A7E7J9_SCLS1/25-195------------------------------------------------------------------------SQYG.---
A7E806_SCLS1/10-187------------------------------------------------------------------------PSNHP---
C9KK96_9FIRM/165-368------------------------------------------------------------------------RNDGK---
A6GTH0_9BURK/185-361------------------------------------------------------------------------NTSQN---
Q10VH9_TRIEI/81-296------------------------------------------------------------------------WWT..---
E0UE35_CYAP2/81-296------------------------------------------------------------------------WWT..---
A8YLF5_MICAE/88-300------------------------------------------------------------------------WWT..---
B7JX19_CYAP8/84-296------------------------------------------------------------------------WWT..---
B4VXI7_9CYAN/89-309------------------------------------------------------------------------WWTDQ---
Q3MG18_ANAVT/81-301------------------------------------------------------------------------WWT..---
A0ZJZ9_NODSP/81-301------------------------------------------------------------------------WWT..---
A0YZ06_LYNSP/76-298------------------------------------------------------------------------WT...---
B5W630_ARTMA/82-298------------------------------------------------------------------------WWT..---
D3I482_9BACT/84-226------------------------------------------------------------------------G....---
C5EAN0_BIFLI/201-341------------------------------------------------------------------------SDAIQ---
A5CSX8_CLAM3/17-179------------------------------------------------------------------------.....---
D1NVJ1_9BIFI/473-610------------------------------------------------------------------------QPV..---
B5AX52_9CAUD/256-434------------------------------------------------------------------------TTTMR---
B8I9G0_CLOCE/36-210------------------------------------------------------------------------TKRL.---
C2Y714_BACCE/497-690------------------------------------------------------------------------TVP..---
B6XSY2_9BIFI/34-205------------------------------------------------------------------------YS...---
Q8EVG3_MYCPE/337-526------------------------------------------------------------------------YFTRG---
B3T8L1_9ARCH/173-373------------------------------------------------------------------------GV...---
D5SSJ8_PLAL2/90-278------------------------------------------------------------------------.....---
B4D083_9BACT/413-601------------------------------------------------------------------------FESLL---
A8SBH6_9FIRM/98-270------------------------------------------------------------------------.....---
D1XVL9_9BACT/196-391------------------------------------------------------------------------GSTI.---
D2QQH5_SPILD/51-232------------------------------------------------------------------------.....---
A3ZLZ7_9PLAN/28-215------------------------------------------------------------------------.....---
B4CVC8_9BACT/32-238------------------------------------------------------------------------LETRM---
B9XFH7_PEDPL/48-240------------------------------------------------------------------------VEERL---
A5FWG0_ACICJ/56-236------------------------------------------------------------------------NPYQ.---
D5X549_THIK1/78-259------------------------------------------------------------------------ER...---
Q0BTT4_GRABC/70-248------------------------------------------------------------------------EK...---
A9HI78_GLUDA/63-245------------------------------------------------------------------------ERTGP---
B2UPK1_AKKM8/69-229------------------------------------------------------------------------WLK..---
B7B7T9_9PORP/404-572------------------------------------------------------------------------GGEPE---
A7SUP9_NEMVE/21-188------------------------------------------------------------------------T....---
C1C4W0_LITCT/43-205------------------------------------------------------------------------.....---
B4R5I2_DROSI/38-200------------------------------------------------------------------------.....---
C4WWV9_ACYPI/38-200------------------------------------------------------------------------.....---
C8ZKR7_9CAUD/443-631------------------------------------------------------------------------NEYGV---
C2E6W6_LACJH/678-859------------------------------------------------------------------------KVK..---
B8KGJ7_9GAMM/47-224------------------------------------------------------------------------.....---
Q2Z0S4_9CAUD/77-253------------------------------------------------------------------------.....---
Q47SW9_THEFY/34-291------------------------------------------------------------------------QPDDS---
D7B7J6_NOCDD/40-317------------------------------------------------------------------------QPDGN---
A6F4N9_9ALTE/13-215------------------------------------------------------------------------.....---
C3QEU7_9BACE/179-342------------------------------------------------------------------------.....---
D4IKA2_9BACT/179-342------------------------------------------------------------------------.....---
D4INC2_9BACT/183-346------------------------------------------------------------------------.....---
A6DPU9_9BACT/162-332------------------------------------------------------------------------SPTSY---
D1W609_9BACT/162-327------------------------------------------------------------------------.....---
D3EGN9_GEOS4/190-357------------------------------------------------------------------------.....---
D3AB80_9CLOT/163-328------------------------------------------------------------------------NASVP---
A8RI04_CLOBW/163-329------------------------------------------------------------------------.....---
D3EIH1_GEOS4/143-315------------------------------------------------------------------------V....---
B8H9Y5_ARTCA/179-369------------------------------------------------------------------------.....---
D2PQC5_KRIFD/166-336------------------------------------------------------------------------.....---
D2KRC2_9CAUD/5-188------------------------------------------------------------------------DGTKN---
B8CFB8_THAPS/190-460------------------------------------------------------------------------NGTSF---
C6LX44_GIAIB/39-225------------------------------------------------------------------------PHNSR---
B1N3Y2_ENTHI/8-201------------------------------------------------------------------------EAVTY---
D4J5M8_9FIRM/6-186------------------------------------------------------------------------CGFAG---
C0D1G8_9CLOT/6-194------------------------------------------------------------------------KPVTG---
B0P4K6_9CLOT/5-202------------------------------------------------------------------------NPENG---
Q28MK4_JANSC/5-193------------------------------------------------------------------------VPLRV---
Q39HJ5_BURS3/9-204------------------------------------------------------------------------RPMTH---
A8W013_AGRRH/14-208------------------------------------------------------------------------IPGGS---
A4U1B6_9PROT/100-344------------------------------------------------------------------------FV...---
A7K9Z4_9PHYC/41-196------------------------------------------------------------------------.....---
B2FLV5_STRMK/35-209------------------------------------------------------------------------GVTPA---
D2QLR8_SPILD/52-228------------------------------------------------------------------------WHDHE---
B3C7M6_9BACE/46-223------------------------------------------------------------------------ANTPN---
C6XV53_PEDHD/53-230------------------------------------------------------------------------FATPD---
A5CNW4_CLAM3/55-217------------------------------------------------------------------------VGTLP---
C9LYN9_SELS3/296-469------------------------------------------------------------------------GAIVY---
C9KKD3_9FIRM/276-447------------------------------------------------------------------------GHFSY---
B7KL00_CYAP7/104-265------------------------------------------------------------------------WWKQ.---
C5US72_CLOBO/411-600------------------------------------------------------------------------SATGE---
A3I2P8_9BACT/37-228------------------------------------------------------------------------YIAFI---
D2R3I8_PIRSD/56-262------------------------------------------------------------------------YIEII---
Q1YPD0_9GAMM/318-501------------------------------------------------------------------------SVCES---
A3TL07_9MICO/62-234------------------------------------------------------------------------.....---
A7HAV9_ANADF/45-222------------------------------------------------------------------------GAT..---
Q8KP08_9BACT/54-230------------------------------------------------------------------------GTSHA---
A4S546_OSTLU/12-245------------------------------------------------------------------------GDDGR---
C1FIK9_MICSR/186-403------------------------------------------------------------------------GCRVD---
Q6AE96_LEIXX/17-180------------------------------------------------------------------------.....---
B1M205_METRJ/17-182------------------------------------------------------------------------.....---
B1M3V4_METRJ/6-173------------------------------------------------------------------------.....---
B1LTZ6_METRJ/10-173------------------------------------------------------------------------.....---
B0U7X0_METS4/36-232------------------------------------------------------------------------WGGA.---
Q6ACS0_LEIXX/64-231------------------------------------------------------------------------GAS..---
C4XUC8_DESMR/131-314------------------------------------------------------------------------GMT..---
A7IVK2_PBCVM/122-270------------------------------------------------------------------------EVIKG---
C7Q7D8_CATAD/157-343------------------------------------------------------------------------Q....---
A5VBY8_SPHWW/103-291------------------------------------------------------------------------WSALY---
C6RHF9_9PROT/168-353------------------------------------------------------------------------GWGF.---
C8PHJ9_9PROT/240-425------------------------------------------------------------------------.....---
D2PRA6_KRIFD/46-221------------------------------------------------------------------------GVA..---
Q1YKL3_MOBAS/54-228------------------------------------------------------------------------GVD..---
Q0VS26_ALCBS/87-262------------------------------------------------------------------------GVL..---
A0A030RMR7_PSEAI/57-230------------------------------------------------------------------------GAS..---
A4XXU1_PSEMY/55-228------------------------------------------------------------------------GVE..---
B1XWT3_LEPCP/47-232------------------------------------------------------------------------GVD..---
Q6LG08_PHOPR/48-221------------------------------------------------------------------------GVE..---
Q0F8N5_9RHOB/51-224------------------------------------------------------------------------GVE..---
B7RN26_9RHOB/48-221------------------------------------------------------------------------GVD..---
C0Q8S6_DESAH/49-222------------------------------------------------------------------------GVP..---
A4F1H2_9RHOB/50-223------------------------------------------------------------------------GAG..---
Q5LN18_RUEPO/38-210------------------------------------------------------------------------GAA..---
A4BHN8_9GAMM/48-221------------------------------------------------------------------------GVE..---
A6FTW8_9RHOB/64-237------------------------------------------------------------------------GVA..---
A4JA74_BURVG/48-221------------------------------------------------------------------------GVA..---
C8XKQ3_NAKMY/142-320------------------------------------------------------------------------GTH..---
A8M302_SALAI/68-248------------------------------------------------------------------------GVG..---
D2PP87_KRIFD/68-246------------------------------------------------------------------------GTS..---
A1SF76_NOCSJ/69-248------------------------------------------------------------------------GVE..---
C0W3H8_9ACTO/21-199------------------------------------------------------------------------QAVTH---
C4XN11_DESMR/67-258------------------------------------------------------------------------GQ...---
A1SNE8_NOCSJ/71-225------------------------------------------------------------------------.....---
A4AKB0_9ACTN/42-210------------------------------------------------------------------------GASAV---

PF14606

Q7US24_RHOBA/217-394--------------------------------------------------------------------------------
A4APA9_MARSH/176-358--------------------------------------------------------------------------------
Q01R43_SOLUE/183-360--------------------------------------------------------------------------------
C6XT40_PEDHD/174-351--------------------------------------------------------------------------------
F0SBL3_PEDSD/182-361--------------------------------------------------------------------------------
D3IDS0_9BACT/151-329--------------------------------------------------------------------------------
C6CUH9_PAESJ/158-340--------------------------------------------------------------------------------
D6D291_9BACE/177-350--------------------------------------------------------------------------------
D6D414_9BACE/177-354--------------------------------------------------------------------------------
Q8A1R6_BACTN/176-353--------------------------------------------------------------------------------
R7EPR9_9BACE/173-349--------------------------------------------------------------------------------

PF04311

W6REB0_9RHIZ/75-346------------------------------------------------------------------------KLVNA---
Q98H53_RHILO/33-310------------------------------------------------------------------------KAPDA---
O83576_TREPA/55-376------------------------------------------------------------------------RKTTA---

PF16255

A6L182_BACV8/24-226------------------------------------------------------------------------FEGYV---
D6D1C7_9BACE/24-224------------------------------------------------------------------------FEGYL---
R7ECW1_9BACE/24-225------------------------------------------------------------------------FYGHV---

PF08885

T2KQ07_9FLAO/22-260------------------------------------------------------------------------NIGQK---
C0QCX9_DESAH/46-310------------------------------------------------------------------------EIRKR---
R5EPC9_9BACE/21-255------------------------------------------------------------------------NIGLW---
A5VDH6_SPHWW/41-313------------------------------------------------------------------------HIARY---
R6YAM1_9BACE/32-267------------------------------------------------------------------------NIGKR---
R7HNG1_9BACT/21-257------------------------------------------------------------------------DVGNL---
G2PK85_MURRD/21-260------------------------------------------------------------------------NMGRK---
I2EY90_EMTOG/21-257------------------------------------------------------------------------VIGSQ---
B8IP12_METNO/42-312------------------------------------------------------------------------RVAQA---
A4YK23_BRASO/229-462------------------------------------------------------------------------NLSKS---
G8TR03_NIAKG/21-267------------------------------------------------------------------------HIGDK---
B1M3F5_METRJ/42-313------------------------------------------------------------------------RVAEA---
R5M3J3_9BACE/21-258------------------------------------------------------------------------NMGSL---
R7EUS3_9BACT/13-248------------------------------------------------------------------------NIGQR---
D5MM94_9BACT/76-315------------------------------------------------------------------------YFILW---
R6Y730_9PORP/28-264------------------------------------------------------------------------NIGKK---
R7J1F8_9BACT/24-253------------------------------------------------------------------------NIGEC---
F0P1S2_WEEVC/21-257------------------------------------------------------------------------EIGAR---
B9J8F4_AGRRK/41-310------------------------------------------------------------------------HISRQ---
F8EN95_RUNSL/21-257------------------------------------------------------------------------VIGQK---
G0IXU2_CYCMS/22-258------------------------------------------------------------------------VIGER---
E8RMP0_ASTEC/39-308------------------------------------------------------------------------HLGRF---
C5AUI8_METEA/49-319------------------------------------------------------------------------HIADR---
L0G2R2_ECHVK/22-255------------------------------------------------------------------------MMAQN---
G2Z7S8_FLABF/21-259------------------------------------------------------------------------NIAQQ---
G8X6A0_FLACA/17-254------------------------------------------------------------------------NIGNK---
G8ULQ0_TANFA/21-258------------------------------------------------------------------------SIGKR---
G8PQJ6_PSEUV/51-307------------------------------------------------------------------------NVERN---
C7PMX6_CHIPD/22-258------------------------------------------------------------------------EIGER---
A6LHC4_PARD8/21-258------------------------------------------------------------------------NIGRK---
R7LF46_9BACT/50-294------------------------------------------------------------------------HIGKH---
A0LXX4_GRAFK/22-257------------------------------------------------------------------------NIGAK---
F0R195_BACSH/21-257------------------------------------------------------------------------NIGKL---
F8JMP9_STREN/40-309------------------------------------------------------------------------RIGPA---
E4T1X0_PALPW/20-256------------------------------------------------------------------------NIGRK---
R6X342_9BACT/24-260------------------------------------------------------------------------NMGQK---
A6L176_BACV8/21-257------------------------------------------------------------------------NIGNL---
M9RBE9_9RHOB/323-562------------------------------------------------------------------------NISKW---
R6L892_9BACE/21-258------------------------------------------------------------------------NMGTR---
T2GGB5_DESGI/40-310------------------------------------------------------------------------HLARY---
Q11RW7_CYTH3/21-254------------------------------------------------------------------------MIGEK---
F4B2J3_KROS4/22-257------------------------------------------------------------------------NIGDK---
R6FFG9_9BACE/21-258------------------------------------------------------------------------NIGAR---
R5RV25_9BACE/22-258------------------------------------------------------------------------NIGLI---
A1S3K5_SHEAM/44-301------------------------------------------------------------------------HIGNW---
F4L6L3_HALH1/23-258------------------------------------------------------------------------QIGQK---
R5NCX1_9BACT/22-258------------------------------------------------------------------------HIGRR---
R7D323_9BACE/32-279------------------------------------------------------------------------HIGNR---
H6L5M5_SAPGL/25-259------------------------------------------------------------------------EMGLR---
E6XET3_CELAD/21-258------------------------------------------------------------------------NIGDR---
C3KQN9_RHISN/57-328------------------------------------------------------------------------EIARA---
F4KMJ5_PORAD/29-267------------------------------------------------------------------------HIGER---
E4TT54_MARTH/21-257------------------------------------------------------------------------HIGSR---
D6D188_9BACE/31-268------------------------------------------------------------------------NIGRQ---
A6H0Z4_FLAPJ/21-258------------------------------------------------------------------------NMAKK---
H1ZDZ1_MYROD/21-259------------------------------------------------------------------------NIGEK---
C4XP38_DESMR/33-276------------------------------------------------------------------------NIQLF---
W0EN83_9PORP/21-255------------------------------------------------------------------------NIGLW---
W0EYV8_9SPHI/21-264------------------------------------------------------------------------HIGNA---
R5VH21_9PORP/22-257------------------------------------------------------------------------NIGQK---
I4AP67_FLELS/21-272------------------------------------------------------------------------NIGQK---
I0KF94_9BACT/21-257------------------------------------------------------------------------VMGQR---
D4IN95_9BACT/21-252------------------------------------------------------------------------HIARK---
A3U798_CROAH/21-257------------------------------------------------------------------------NIGKK---
R5GUT3_9BACT/21-259------------------------------------------------------------------------HVGRR---
F0RBR0_CELLC/21-260------------------------------------------------------------------------HIGNK---
A1B3U8_PARDP/64-333------------------------------------------------------------------------HVGRA---
I4C880_DESTA/46-310------------------------------------------------------------------------EIKSV---
Q121I3_POLSJ/60-298------------------------------------------------------------------------NISNY---
R6CLT6_9BACE/22-257------------------------------------------------------------------------NISRK---
X5DG71_9BACT/26-262------------------------------------------------------------------------NVGAK---
D5ATP2_RHOCB/41-310------------------------------------------------------------------------HVGRA---
R5YHQ3_9BACE/21-258------------------------------------------------------------------------HIGTR---
R6SA44_9BACE/21-257------------------------------------------------------------------------HIGNR---
S5XTM4_PARAH/50-309------------------------------------------------------------------------NIESA---
J7QVY3_METSZ/42-313------------------------------------------------------------------------EIAMR---
R7JRE2_9BACT/59-292------------------------------------------------------------------------HISGR---
A4AUF0_MARSH/21-260------------------------------------------------------------------------NIGGK---
R6EUG1_9BACE/22-258------------------------------------------------------------------------NIGKI---
Q5LH25_BACFN/21-258------------------------------------------------------------------------NIGTL---
C6X454_FLAB3/21-258------------------------------------------------------------------------EMSEL---
I3Z6K2_BELBD/21-257------------------------------------------------------------------------MIGEK---
G0L2J8_ZOBGA/21-255------------------------------------------------------------------------NIGGK---
I3YP53_ALIFI/21-252------------------------------------------------------------------------HIAGR---
F9Z2U7_ODOSD/27-263------------------------------------------------------------------------NVGAK---
R5JB51_9BACE/21-258------------------------------------------------------------------------NIGRQ---
D3HQS8_LEGLN/335-604------------------------------------------------------------------------HVSKF---
F9YS98_CAPCC/21-256------------------------------------------------------------------------NIGKQ---
R7PCY6_9BACT/23-264------------------------------------------------------------------------HIGLR---
Q28TN8_JANSC/41-309------------------------------------------------------------------------HVGAA---
L0FZB4_ECHVK/21-257------------------------------------------------------------------------VMGQH---
S5XXU5_PARAH/13-280------------------------------------------------------------------------HVGRA---
H2JZH7_STRHJ/41-311------------------------------------------------------------------------HIGPA---
R7NWR5_9BACE/21-257------------------------------------------------------------------------NIGNL---
D2QBX3_SPILD/37-300------------------------------------------------------------------------NIEAC---
H8XPR8_FLAIG/21-258------------------------------------------------------------------------NIGNK---
T0U393_9STRE/22-259------------------------------------------------------------------------NLSLG---
D2QK40_SPILD/21-257------------------------------------------------------------------------VMGRR---
R5CG89_9BACE/13-250------------------------------------------------------------------------NIGTR---
R5WEX8_9BACT/23-254------------------------------------------------------------------------QIFGR---
A5FIN8_FLAJ1/21-261------------------------------------------------------------------------NMAGK---
R6AYA1_9BACT/21-266------------------------------------------------------------------------HIGGR---
E4RZ72_LEAB4/28-259------------------------------------------------------------------------VVGEF---
K4IFD9_PSYTT/21-259------------------------------------------------------------------------HIGDK---
R5B7Q4_9BACE/21-258------------------------------------------------------------------------NISSR---
F3ZNK8_9BACE/22-259------------------------------------------------------------------------HIGDK---
L7W558_NONDD/21-252------------------------------------------------------------------------NIGAK---
I3ZZB3_ORNRL/21-258------------------------------------------------------------------------NIYNK---
A3HZZ3_9BACT/21-256------------------------------------------------------------------------SMGQR---
R5BJ82_9BACE/23-256------------------------------------------------------------------------EIGGK---
R6E4B6_9BACE/21-258------------------------------------------------------------------------NIGAL---
R5IRK1_9PORP/21-258------------------------------------------------------------------------NIGKY---
B0UMN0_METS4/39-306------------------------------------------------------------------------HIARY---
R5PD70_9PORP/21-257------------------------------------------------------------------------NIGQR---
W0AHI1_9SPHN/141-410------------------------------------------------------------------------HISRR---
I3YWC9_AEQSU/21-270------------------------------------------------------------------------NIGGK---
A2TZ06_9FLAO/22-258------------------------------------------------------------------------NIGQK---
D8LTE6_ECTSI/26-281------------------------------------------------------------------------NIGTR---
E6SU26_BACT6/22-259------------------------------------------------------------------------NMGTR---
C7M4J9_CAPOD/21-255------------------------------------------------------------------------NMAQK---
R5IIF1_9BACT/9-264------------------------------------------------------------------------EMGRR---
R5GFU6_9PORP/21-256------------------------------------------------------------------------ELQRH---
R6M862_9BACE/23-259------------------------------------------------------------------------NIGKL---
C5AW44_METEA/40-311------------------------------------------------------------------------RVSQA---
R5W2G8_9BACE/21-257------------------------------------------------------------------------HIGNL---
A8LP01_DINSH/55-319------------------------------------------------------------------------NIEDA---
S5Y059_PARAH/41-311------------------------------------------------------------------------HISRQ---
B0T687_CAUSK/47-313------------------------------------------------------------------------NIEER---
R7DF91_9PORP/21-258------------------------------------------------------------------------NIGHL---
C6W6S3_DYAFD/24-261------------------------------------------------------------------------VLGGQ---
U5Q7D6_9BACT/21-253------------------------------------------------------------------------EIGSR---
W8FAI7_9BACT/20-256------------------------------------------------------------------------SIGSR---
S5YTU2_PARAH/50-305------------------------------------------------------------------------NIEDF---
F2IKK3_FLUTR/21-251------------------------------------------------------------------------NMSLW---
F6GCA5_LACS5/22-256------------------------------------------------------------------------NIGSE---
H1XPK2_9BACT/21-257------------------------------------------------------------------------NISKA---
J9R834_RIEAN/21-258------------------------------------------------------------------------EMSNR---
Q7MVG8_PORGI/56-293------------------------------------------------------------------------EVGSY---
D5BGH9_ZUNPS/21-262------------------------------------------------------------------------NIGDK---
K4KIG2_SIMAS/57-326------------------------------------------------------------------------NVERS---
R5V0S4_9BACE/23-258------------------------------------------------------------------------NMGRQ---
D9SAD6_FIBSS/55-314------------------------------------------------------------------------NISAQ---
R7EIY0_9BACE/21-258------------------------------------------------------------------------EMGQR---

PF13839

CPED1_HUMAN/757-1021------------------------------------------------------------------------MYYLI---
A9U1Q5_PHYPA/72-368------------------------------------------------------------------------YEALM---
TBL18_ARATH/227-526------------------------------------------------------------------------MESML---
TBL17_ARATH/190-490------------------------------------------------------------------------MESMM---
TBL22_ARATH/122-412------------------------------------------------------------------------MESLL---
TBL19_ARATH/121-411------------------------------------------------------------------------MQSLI---
A9RCM6_PHYPA/75-370------------------------------------------------------------------------FQSLL---
A9RAV2_PHYPA/82-374------------------------------------------------------------------------FQSLL---
A9T2B6_PHYPA/55-352------------------------------------------------------------------------FQSLL---
A9TUK8_PHYPA/53-350------------------------------------------------------------------------FQSLL---
TBL27_ARATH/131-413------------------------------------------------------------------------LESLL---
TBL24_ARATH/132-429------------------------------------------------------------------------VESLL---
TBL23_ARATH/132-427------------------------------------------------------------------------VESLL---
TBL25_ARATH/151-449------------------------------------------------------------------------VQSLL---
TBL26_ARATH/143-432------------------------------------------------------------------------VQSLI---
A5C5G9_VITVI/125-419------------------------------------------------------------------------VQSLL---
A5BFA6_VITVI/191-485------------------------------------------------------------------------VQSLL---
A9SPN8_PHYPA/96-376------------------------------------------------------------------------YQSIM---
TBL30_ARATH/130-425------------------------------------------------------------------------WQSMV---
TBL28_ARATH/124-422------------------------------------------------------------------------WESMV---
TBL31_ARATH/120-407------------------------------------------------------------------------FESMV---
A5ADJ7_VITVI/123-409------------------------------------------------------------------------FESLV---
TBL33_ARATH/134-424------------------------------------------------------------------------FVSMI---
TBL32_ARATH/159-450------------------------------------------------------------------------YVSLI---
D7SR66_VITVI/138-430------------------------------------------------------------------------WVSMV---
TBL34_ARATH/112-406------------------------------------------------------------------------WVSMV---
D7SSF9_VITVI/114-388------------------------------------------------------------------------WESLV---
TBL36_ARATH/102-376------------------------------------------------------------------------WESLV---
TBL7_ARATH/167-441------------------------------------------------------------------------WESLI---
E0CQN6_VITVI/163-439------------------------------------------------------------------------WESLI---
TBL43_ARATH/95-367------------------------------------------------------------------------WQSLT---
TBL44_ARATH/119-402------------------------------------------------------------------------WESLI---
D7SJV7_VITVI/21-302------------------------------------------------------------------------WESLV---
TBL37_ARATH/117-385------------------------------------------------------------------------WESLA---
TBL40_ARATH/97-364------------------------------------------------------------------------FESLA---
TBL39_ARATH/99-366------------------------------------------------------------------------WQSLA---
TBL41_ARATH/86-356------------------------------------------------------------------------WQSLA---
TBL42_ARATH/89-358------------------------------------------------------------------------WVSLS---
E0CS20_VITVI/95-364------------------------------------------------------------------------WQSLT---
E0CTP6_VITVI/133-405------------------------------------------------------------------------WESLA---
TBL9_ARATH/120-407------------------------------------------------------------------------WESLM---
D7T6S6_VITVI/145-435------------------------------------------------------------------------WESLL---
TBL10_ARATH/155-447------------------------------------------------------------------------WESLL---
TBL11_ARATH/151-446------------------------------------------------------------------------WESLL---
TBL5_ARATH/194-481------------------------------------------------------------------------FESML---
TBL6_ARATH/190-473------------------------------------------------------------------------WESML---
D7SY59_VITVI/169-450------------------------------------------------------------------------WESLV---
TBR_ARATH/307-596------------------------------------------------------------------------WESLV---
TBL2_ARATH/244-534------------------------------------------------------------------------WESLI---
P90793_CAEEL/44-306------------------------------------------------------------------------YKDMV---
A8XEN8_CAEBR/12-234------------------------------------------------------------------------YKDML---
A7SCU9_NEMVE/11-255------------------------------------------------------------------------YKDLV---
A4IHH2_XENTR/4-243------------------------------------------------------------------------YKDLV---
PED1B_MOUSE/4-254------------------------------------------------------------------------YKDLV---
F1M6L4_RAT/19-264------------------------------------------------------------------------YKDLV---
PED1A_MOUSE/21-267------------------------------------------------------------------------YKDLV---
PED1B_BOVIN/4-250------------------------------------------------------------------------YKDLV---
F1PVW1_CANFA/4-250------------------------------------------------------------------------YKDLV---
A0A024R115_HUMAN/4-250------------------------------------------------------------------------YKDLV---
B0W8N6_CULQU/74-300------------------------------------------------------------------------YLEMV---
Q8T3H4_DROME/119-348------------------------------------------------------------------------YERFV---
Q6CDI8_YARLI/64-294------------------------------------------------------------------------FWAVV---
A7RI69_NEMVE/99-327------------------------------------------------------------------------YYKLV---
B2RAS9_HUMAN/74-292------------------------------------------------------------------------FYSFV---
A7F4H3_SCLS1/82-326------------------------------------------------------------------------FWAVA---
CAS1_CRYNJ/90-372------------------------------------------------------------------------YFAAA---
A8N197_COPC7/69-295------------------------------------------------------------------------FFQFA---

PF03629

A0ZZI1_BIFAA/132-445------------------------------------------------------------------------DEALED.C
A3HTJ4_9BACT/102-524------------------------------------------------------------------------EKEFS...
A4AN28_MARSH/117-413------------------------------------------------------------------------DKEKK...
A4XG19_CALS8/84-518------------------------------------------------------------------------KEELD...
A5FA09_FLAJ1/103-353------------------------------------------------------------------------DEEVK...
A5FC32_FLAJ1/109-397------------------------------------------------------------------------EEEVK...
A5FCG2_FLAJ1/104-366------------------------------------------------------------------------NEIIV...
A5FLW6_FLAJ1/100-526------------------------------------------------------------------------EKEIA...
A6KYD0_BACV8/104-544------------------------------------------------------------------------EQEIA...
A6L7S8_BACV8/301-581------------------------------------------------------------------------AQDVP...
A6L837_PARD8/106-365------------------------------------------------------------------------NHAIA...
A6LG42_PARD8/302-584------------------------------------------------------------------------EQQQQL.D
A9KN08_CLOPH/81-525------------------------------------------------------------------------ADEIC...
A9UY79_MONBE/110-371------------------------------------------------------------------------SAEEK...
A9UYV9_MONBE/183-446------------------------------------------------------------------------TYEMA...
B0SVR2_CAUSK/105-536------------------------------------------------------------------------F.QIA...
B0SYV3_CAUSK/103-536------------------------------------------------------------------------EAEAA...
B1ZN38_OPITP/124-558------------------------------------------------------------------------NDEVK...
B1ZRD5_OPITP/111-543------------------------------------------------------------------------EQEAA...
B2UNI0_AKKM8/105-396------------------------------------------------------------------------KEDIAASG
B3PDW1_CELJU/103-559------------------------------------------------------------------------PEVLA...
B8DTK8_BIFA0/83-504------------------------------------------------------------------------PSEFQ...
B8DVE1_BIFA0/120-432------------------------------------------------------------------------KEAVAD.A
B8I0P3_CLOCE/95-527------------------------------------------------------------------------PDEIV...
C1F347_ACIC5/141-569------------------------------------------------------------------------AKVAA...
C1F9V4_ACIC5/112-403------------------------------------------------------------------------KEEIA...
C3Y8H9_BRAFL/120-404------------------------------------------------------------------------TEEIL...
C3Z127_BRAFL/109-390------------------------------------------------------------------------SYAIA...
C3Z129_BRAFL/93-393------------------------------------------------------------------------QQAIA...
C3ZBF5_BRAFL/95-370------------------------------------------------------------------------SAEIA...
C5BNV0_TERTT/112-545------------------------------------------------------------------------PDLVA...
C6VYA3_DYAFD/101-531------------------------------------------------------------------------EEERK...
C6W5L8_DYAFD/109-390------------------------------------------------------------------------PEELR...
C6X165_FLAB3/103-532------------------------------------------------------------------------EDELS...
C6XSG1_PEDHD/103-356------------------------------------------------------------------------SEIIL...
C6XSW9_PEDHD/104-358------------------------------------------------------------------------DGIIA...
C6XUV3_PEDHD/100-352------------------------------------------------------------------------LNDLK...
C6XXZ6_PEDHD/106-358------------------------------------------------------------------------NELLS...
C6XYN0_PEDHD/106-369------------------------------------------------------------------------ENEIA...
C6Y155_PEDHD/105-361------------------------------------------------------------------------ANEVA...
C6Y1K6_PEDHD/105-533------------------------------------------------------------------------PKDTV...
C6Y404_PEDHD/303-583------------------------------------------------------------------------KSELA...
C7M404_CAPOD/302-582------------------------------------------------------------------------EKDIP...
C7PN71_CHIPD/105-526------------------------------------------------------------------------AFDIT...
C7PT40_CHIPD/107-370------------------------------------------------------------------------DQEIA...
D0MJ56_RHOM4/105-565------------------------------------------------------------------------AEAVR...
D2QQ30_SPILD/101-534------------------------------------------------------------------------ANEIK...
D2QX68_PIRSD/107-360------------------------------------------------------------------------QKEAE...
D2QYI9_PIRSD/142-409------------------------------------------------------------------------QDDIRAAD
D2R7J4_PIRSD/115-431------------------------------------------------------------------------DTESA...
D2U910_XANAP/119-550------------------------------------------------------------------------RNEIA...
D2U9U1_XANAP/109-532------------------------------------------------------------------------AREVA...
D4INS5_9BACT/103-361------------------------------------------------------------------------AEAII...
D4JVY2_9FIRM/84-395------------------------------------------------------------------------KDFLAN.D
D4Z7X6_SPHJU/109-541------------------------------------------------------------------------VGQIR...
D5BHF0_ZUNPS/98-525------------------------------------------------------------------------PEEIK...
D5EN53_CORAD/103-390------------------------------------------------------------------------DVEIA...
D5ER35_CORAD/101-350------------------------------------------------------------------------QETIL...
D5EXD4_PRER2/104-368------------------------------------------------------------------------NQVVI...
D6CYE8_9BACE/85-509------------------------------------------------------------------------TEEVA...
D6CYV5_9BACE/104-362------------------------------------------------------------------------LETLL...
D6D068_9BACE/96-526------------------------------------------------------------------------QQEVA...
D6D180_9BACE/73-515------------------------------------------------------------------------QQEKK...
D6D411_9BACE/118-376------------------------------------------------------------------------QPYIV...
D9SLS9_CLOC7/541-802------------------------------------------------------------------------ENEIK...
D9SWK5_CLOC7/539-800------------------------------------------------------------------------ANEIQ...
E4RWD7_LEAB4/99-523------------------------------------------------------------------------ARDIE...
E4T5G4_PALPW/145-396------------------------------------------------------------------------GDAVA...
E4T6U6_PALPW/106-547------------------------------------------------------------------------EKEIA...
E6SN70_BACT6/301-581------------------------------------------------------------------------KADIP...
E6U3H5_ETHHY/86-401------------------------------------------------------------------------EEEVAQ.S
E6UDX2_RUMA7/82-393------------------------------------------------------------------------ASYLAELD
E6UGH2_RUMA7/87-510------------------------------------------------------------------------KGDVPVPE
E6WRU5_PSEUU/108-538------------------------------------------------------------------------AEDIA...
E6WX51_PSEUU/113-546------------------------------------------------------------------------RAELA...
E8RKP4_ASTEC/107-546------------------------------------------------------------------------YNEIL...
E8RP08_ASTEC/110-381------------------------------------------------------------------------DAELA...
E8RR55_ASTEC/105-537------------------------------------------------------------------------AEQIA...
E8RVJ6_ASTEC/120-557------------------------------------------------------------------------DTSYP...
E8V0Q2_TERSS/105-396------------------------------------------------------------------------EKEIA...
E8WX56_ACISM/104-394------------------------------------------------------------------------EKEIA...
F0RXK6_SPHGB/84-395------------------------------------------------------------------------EETFALRN
F0S4E8_PEDSD/102-363------------------------------------------------------------------------KNAIA...
F0SBL8_PEDSD/106-542------------------------------------------------------------------------........
F0SE55_PEDSD/103-355------------------------------------------------------------------------LDELP...
F0SEX3_PEDSD/110-362------------------------------------------------------------------------QELIT...
F0SLB2_PLABD/105-401------------------------------------------------------------------------ELERL...
F0XZG5_AURAN/371-703------------------------------------------------------------------------RNETYA.D
F1N0F2_BOVIN/129-405------------------------------------------------------------------------TGELS...
F2JM57_CELLD/90-525------------------------------------------------------------------------RDEIN...
F2KZ29_PREDF/320-601------------------------------------------------------------------------ECDLE...
F2NB41_CORGP/85-397------------------------------------------------------------------------CDEAE...
F2NBE0_CORGP/105-528------------------------------------------------------------------------PQEYS...
F4C1D3_SPHS2/119-545------------------------------------------------------------------------QREID...
F4C667_SPHS2/102-358------------------------------------------------------------------------EAERD...
F4CDE6_SPHS2/103-363------------------------------------------------------------------------NDAIL...
F4KXA6_HALH1/110-541------------------------------------------------------------------------MADIE...
F6RRT5_CIOIN/110-408------------------------------------------------------------------------AKEVE...
F7AJJ3_HORSE/118-419------------------------------------------------------------------------TSELS...
F7CPG9_XENTR/116-394------------------------------------------------------------------------SEELA...
F8EA22_RUNSL/103-354------------------------------------------------------------------------KAELP...
F8EJ62_RUNSL/102-531------------------------------------------------------------------------KVEKK...
F8EQW5_RUNSL/101-532------------------------------------------------------------------------PEDIA...
F9D4M3_PREDD/105-362------------------------------------------------------------------------DKEVA...
F9Z647_ODOSD/105-527------------------------------------------------------------------------GQEIA...
G0GB30_SPITZ/129-404------------------------------------------------------------------------DRELE...
G0GBV2_SPITZ/85-515------------------------------------------------------------------------GEEVR...
G0IZQ4_CYCMS/102-365------------------------------------------------------------------------EDSIK...
G0L160_ZOBGA/108-362------------------------------------------------------------------------NKAIA...
G0L7C6_ZOBGA/106-357------------------------------------------------------------------------EEEIK...
G1SIW9_RABIT/119-395------------------------------------------------------------------------TKEMY...
G3IIB1_CRIGR/119-418------------------------------------------------------------------------SKELA...
G3NT91_GASAC/117-395------------------------------------------------------------------------SDELR...
G3TGM8_LOXAF/118-419------------------------------------------------------------------------TREMS...
G3WPG6_SARHA/128-405------------------------------------------------------------------------SEEEA...
G8NUG1_GRAMM/104-394------------------------------------------------------------------------ASEIA...
G8TBM5_NIAKG/101-532------------------------------------------------------------------------PTVIA...
G8TEA3_NIAKG/104-360------------------------------------------------------------------------SIQVN...
G8TGS0_NIAKG/106-355------------------------------------------------------------------------VAEVP...
G8TLW6_NIAKG/105-533------------------------------------------------------------------------RREIE...
G8TN45_NIAKG/114-379------------------------------------------------------------------------NNEVA...
G8TQU6_NIAKG/101-533------------------------------------------------------------------------DQEIA...
G8UJ84_TANFA/302-584------------------------------------------------------------------------ERAKLL.D
H0XDV1_OTOGA/118-421------------------------------------------------------------------------TRELS...
H1Y7E7_9SPHI/107-370------------------------------------------------------------------------VKTID...
H1YEP3_9SPHI/107-377------------------------------------------------------------------------VDELE...
H1YFU1_9SPHI/105-542------------------------------------------------------------------------PEEIA...
H1YHR5_9SPHI/103-534------------------------------------------------------------------------PDEIA...
H2MHU5_ORYLA/110-406------------------------------------------------------------------------SEELA...
H2NFQ7_PONAB/118-394------------------------------------------------------------------------VSAII...
H2T5J8_TAKRU/109-378------------------------------------------------------------------------LEELN...
H8KVR3_SOLCM/112-540------------------------------------------------------------------------PTEIK...
H9G3E2_ANOCA/113-390------------------------------------------------------------------------SQELA...
I0IFA8_PHYMF/116-371------------------------------------------------------------------------DGAVV...
I0IGP0_PHYMF/113-573------------------------------------------------------------------------RSDGG...
I0K882_9BACT/102-533------------------------------------------------------------------------ASEIA...
I0KDZ4_9BACT/80-507------------------------------------------------------------------------AAEKK...
I2F010_EMTOG/101-530------------------------------------------------------------------------ADEIK...
I3JCR3_ORENI/107-370------------------------------------------------------------------------TEELS...
I3NAW5_SPETR/119-428------------------------------------------------------------------------TRELS...
I3YNK6_ALIFI/103-360------------------------------------------------------------------------NEIIA...
I3Z657_BELBD/107-540------------------------------------------------------------------------PKEFV...
I6ZXF8_MELRP/103-560------------------------------------------------------------------------KEVIA...
I7A330_MELRP/101-533------------------------------------------------------------------------KDIIA...
K1PIG0_CRAGI/75-338------------------------------------------------------------------------SEEYS...
L0DNV4_SINAD/113-408------------------------------------------------------------------------DLETR...
L0FZA4_ECHVK/103-365------------------------------------------------------------------------NEAIV...
L0G4D5_ECHVK/108-537------------------------------------------------------------------------SEEIR...
L0G5F4_ECHVK/309-586------------------------------------------------------------------------RTGEV...
L0G6Q7_ECHVK/110-371------------------------------------------------------------------------NEEIL...
M3VYU4_FELCA/118-393------------------------------------------------------------------------TRELS...
M3XHL6_LATCH/120-399------------------------------------------------------------------------TEELA...
M3ZH48_XIPMA/107-384------------------------------------------------------------------------SEELA...
SIAE_MOUSE/118-420------------------------------------------------------------------------SKELS...
Q022C5_SOLUE/94-383------------------------------------------------------------------------DEEIA...
Q15XN0_PSEA6/106-529------------------------------------------------------------------------QQEVK...
Q1IR02_KORVE/102-394------------------------------------------------------------------------LDEFP...
Q1LUX8_DANRE/112-383------------------------------------------------------------------------TEELT...
Q21HS7_SACD2/109-546------------------------------------------------------------------------PLDVA...
Q5LA76_BACFN/104-538------------------------------------------------------------------------QKEIA...
Q7UKM9_RHOBA/136-425------------------------------------------------------------------------DLESL...
Q7UL92_RHOBA/160-428------------------------------------------------------------------------KEDVV...
Q7UPP2_RHOBA/115-412------------------------------------------------------------------------AEEIA...
Q8A0D0_BACTN/104-546------------------------------------------------------------------------EQEKE...
Q8A1R2_BACTN/105-365------------------------------------------------------------------------NNVIA...
Q8A2Y4_BACTN/104-362------------------------------------------------------------------------LETLL...
Q8A323_BACTN/103-546------------------------------------------------------------------------EQEVA...
Q8A331_BACTN/104-369------------------------------------------------------------------------NDIIA...
Q8A6U7_BACTN/107-449------------------------------------------------------------------------ADDIS...
Q8AAK7_BACTN/303-583------------------------------------------------------------------------RADIP...
Q8P3G8_XANCP/110-540------------------------------------------------------------------------RSEIA...
Q8P9U4_XANCP/106-528------------------------------------------------------------------------PQAVA...
Q9AA13_CAUCR/103-537------------------------------------------------------------------------DGEVA...
R5ATT9_9BACT/97-358------------------------------------------------------------------------QEEIV...
R5C0U7_9BACE/106-371------------------------------------------------------------------------EKEWKNPN
R5CMH4_9FIRM/112-544------------------------------------------------------------------------PEIIE...
R5CR26_9BACT/106-368------------------------------------------------------------------------NDVVA...
R5CRW3_9BACT/103-359------------------------------------------------------------------------VEDIL...
R5CVR0_9BACT/37-472------------------------------------------------------------------------WHEIM...
R5CVU7_9BACT/105-371------------------------------------------------------------------------YKEFK...
R5FQG9_9BACT/98-360------------------------------------------------------------------------NNEVV...
R5GQ73_9FIRM/87-396------------------------------------------------------------------------RESLEN.D
R5I3U1_9PORP/108-543------------------------------------------------------------------------EQEIA...
R5I599_9PORP/104-370------------------------------------------------------------------------NKIIT...
R5I8Z5_9PORP/109-398------------------------------------------------------------------------ENVLK...
R5I9A4_9PORP/110-550------------------------------------------------------------------------QDEIA...
R5ICE3_9PORP/106-356------------------------------------------------------------------------QDAIV...
R5IPA1_9PORP/103-532------------------------------------------------------------------------SGEIE...
R5J8I9_9BACE/107-548------------------------------------------------------------------------QQEIN...
R5J9D0_9BACE/301-581------------------------------------------------------------------------KVDIP...
R5JB68_9BACE/94-354------------------------------------------------------------------------DMDIL...
R5JE70_9BACE/106-367------------------------------------------------------------------------TEEMK...
R5JUI1_9BACE/107-546------------------------------------------------------------------------EQETA...
R5JY84_9CLOT/86-397------------------------------------------------------------------------ANQVKA.A
R5KDD9_9BACT/106-367------------------------------------------------------------------------NEVIA...
R5KI40_9BACT/107-545------------------------------------------------------------------------EQEIA...
R5KI88_9BACT/106-368------------------------------------------------------------------------NDVVS...
R5M4F3_9BACE/103-392------------------------------------------------------------------------KAEID...
R5M9T3_9BACE/100-533------------------------------------------------------------------------GKETV...
R5MCJ4_9BACE/107-370------------------------------------------------------------------------KGENL...
R5MCV5_9BACE/117-382------------------------------------------------------------------------NDIIA...
R5NAN5_9BACT/95-508------------------------------------------------------------------------P.EIP...
R5NWA0_9PORP/104-366------------------------------------------------------------------------TETIL...
R5PFV8_9BACT/95-546------------------------------------------------------------------------EAEVK...
R5RU50_9BACE/106-368------------------------------------------------------------------------AETIL...
R5S363_9BACE/112-377------------------------------------------------------------------------EEAIL...
R5U9L2_9BACE/103-366------------------------------------------------------------------------CDAIA...
R5UQU2_9PORP/301-581------------------------------------------------------------------------PSAFR...
R5XXY6_9FIRM/83-407------------------------------------------------------------------------EEAMKEMP
R6BWP4_9CLOT/125-575------------------------------------------------------------------------EEEIK...
R6CBR0_9FIRM/90-402------------------------------------------------------------------------KEILKELT
R6CT48_9BACE/308-588------------------------------------------------------------------------KRDID...
R6CZR7_9BACE/103-360------------------------------------------------------------------------LKFVT...
R6DIJ1_9BACE/99-533------------------------------------------------------------------------KDEIM...
R6DJ41_9BACE/303-583------------------------------------------------------------------------KKDIP...
R6DWQ0_9BACT/104-366------------------------------------------------------------------------NKAVL...
R6E989_9BACE/963-1241------------------------------------------------------------------------SKE.....
R6EGK2_9FIRM/83-401------------------------------------------------------------------------EEEFENCP
R6F527_9BACT/343-624------------------------------------------------------------------------KRDIP...
R6FK85_9BACE/101-514------------------------------------------------------------------------P.EIP...
R6GA32_9BACE/128-565------------------------------------------------------------------------AEEIA...
R6K607_9BACE/105-361------------------------------------------------------------------------TKAIL...
R6KHE9_9BACE/106-368------------------------------------------------------------------------TEAIL...
R6KHK2_9BACE/100-362------------------------------------------------------------------------EVEKK...
R6KJ37_9BACE/119-553------------------------------------------------------------------------RDEIS...
R6KNC4_9BACE/104-538------------------------------------------------------------------------EKEIA...
R6KU81_9BACE/100-533------------------------------------------------------------------------GRETA...
R6L845_9BACE/106-539------------------------------------------------------------------------AAEIN...
R6L914_9BACE/107-368------------------------------------------------------------------------AEELK...
R6LEJ2_9BACE/109-369------------------------------------------------------------------------NMDIL...
R6M7W6_9BACE/104-365------------------------------------------------------------------------AEEMK...
R6MBW6_9BACE/104-365------------------------------------------------------------------------NETIA...
R6MD77_9BACE/131-411------------------------------------------------------------------------QTDVS...
R6MGF8_9BACE/106-368------------------------------------------------------------------------MEEMK...
R6MRS7_9FIRM/84-393------------------------------------------------------------------------AQAKQLPH
R6NFL1_9BACE/103-361------------------------------------------------------------------------QPYIV...
R6QQ52_9BACT/103-365------------------------------------------------------------------------ANELM...
R6SZ03_9FIRM/82-394------------------------------------------------------------------------KEVLENLT
R6TMT5_9FIRM/79-326------------------------------------------------------------------------ESNVPE.C
R6TYL3_9FIRM/88-372------------------------------------------------------------------------REEFL...
R6VGA6_9FIRM/87-503------------------------------------------------------------------------PDE.....
R6VGP4_9BACT/119-542------------------------------------------------------------------------DDEIS...
R6VYK5_9BACT/95-522------------------------------------------------------------------------EEAAL...
R6W3N6_9BACT/103-360------------------------------------------------------------------------VEDIL...
R6WVP4_9BACT/103-358------------------------------------------------------------------------AEAVA...
R6X6R9_9PORP/299-581------------------------------------------------------------------------QRKAFL.E
R6X8A0_9BACT/104-361------------------------------------------------------------------------PEYLM...
R6XDK3_9BACT/111-376------------------------------------------------------------------------IEEVA...
R6XW57_9BACT/105-369------------------------------------------------------------------------NKAVV...
R6YB86_9BACE/303-583------------------------------------------------------------------------DKDIP...
R6YLG6_9BACE/106-367------------------------------------------------------------------------NETIA...
R6ZQY5_9FIRM/86-518------------------------------------------------------------------------PEEIR...
R7D1U4_9BACE/101-514------------------------------------------------------------------------P.EIN...
R7DGQ2_9PORP/109-450------------------------------------------------------------------------KKDVD...
R7DHQ3_9PORP/103-362------------------------------------------------------------------------QDILI...
R7EBZ9_9BACE/116-365------------------------------------------------------------------------KWRVDDIT
R7ELJ2_9BACE/104-363------------------------------------------------------------------------ADDII...
R7FDG6_9FIRM/85-396------------------------------------------------------------------------AEALQH.C
R7HK49_9BACT/112-371------------------------------------------------------------------------ESDIQ...
R7IBZ1_9FIRM/91-402------------------------------------------------------------------------QDLISA.H
R7KXY0_9FIRM/78-504------------------------------------------------------------------------........
R7L392_9BACT/141-439------------------------------------------------------------------------KSVVEKAD
R7L457_9BACT/106-408------------------------------------------------------------------------NNTTD...
R7L551_9BACT/107-409------------------------------------------------------------------------TTDGEAAA
R7LBC9_9BACT/106-408------------------------------------------------------------------------EETKK...
R7LCZ4_9BACT/117-400------------------------------------------------------------------------KRDLA...
R7LEI0_9BACT/104-413------------------------------------------------------------------------CDTLKYAE
R7N8V0_9FIRM/86-515------------------------------------------------------------------------PEDVA...
R7NVJ4_9BACE/94-536------------------------------------------------------------------------ENEIR...
S0ET71_CHTCT/118-391------------------------------------------------------------------------QQEIA...
T2KJY6_9FLAO/72-379------------------------------------------------------------------------RNEVA...
T2KKF3_9FLAO/106-399------------------------------------------------------------------------VPEIK...
T2KL42_9FLAO/108-425------------------------------------------------------------------------RQEAL...
U3JRM3_FICAL/110-387------------------------------------------------------------------------SQELA...
U5Q6R0_9BACT/120-374------------------------------------------------------------------------ATEVASAT
V8NYK2_OPHHA/82-359------------------------------------------------------------------------SKEME...
W0ETR7_9SPHI/108-546------------------------------------------------------------------------QQEIA...
W0ETZ4_9SPHI/87-339------------------------------------------------------------------------KEKLP...
W0EW65_9PORP/114-543------------------------------------------------------------------------DEVVA...
W0EXJ4_9SPHI/101-529------------------------------------------------------------------------AREIE...
W0EYF1_9SPHI/303-584------------------------------------------------------------------------DSLIRK.A
W0F205_9SPHI/104-389------------------------------------------------------------------------EQEVV...
W0F686_9SPHI/73-335------------------------------------------------------------------------VKELE...
W0IV69_9BACT/122-573------------------------------------------------------------------------REEIA...
W0IY28_9BACT/102-398------------------------------------------------------------------------ALSIP...
W0IZR9_9BACT/107-406------------------------------------------------------------------------EEAVDA.P
W0J089_9BACT/113-554------------------------------------------------------------------------AAGIA...
W0J126_9BACT/103-396------------------------------------------------------------------------RDDAK...
W0J1D8_9BACT/103-397------------------------------------------------------------------------GYEAI...
W0J1I7_9BACT/127-575------------------------------------------------------------------------REELA...
W0J1Z1_9BACT/122-573------------------------------------------------------------------------KDEIA...
W0J1Z2_9BACT/111-557------------------------------------------------------------------------RPLIA...
W0J268_9BACT/121-368------------------------------------------------------------------------VDEIA...
W0J4T5_9BACT/111-561------------------------------------------------------------------------KEEIA...
W0J8X3_9BACT/103-397------------------------------------------------------------------------KFETT...
W0JAS2_9BACT/114-570------------------------------------------------------------------------EAEIA...
W0RMP1_9BACT/123-554------------------------------------------------------------------------PAVIA...
W4XVQ4_STRPU/82-385------------------------------------------------------------------------TEALQ...
W4XVQ5_STRPU/118-400------------------------------------------------------------------------SVSME...
W5M5G7_LEPOC/114-388------------------------------------------------------------------------TEELS...
W5X997_9BACT/100-533------------------------------------------------------------------------AAEIA...
W5XA59_9BACT/96-545------------------------------------------------------------------------ESQVA...
W8EWI8_9BACT/105-543------------------------------------------------------------------------AEATT...
W8F2B5_9BACT/111-544------------------------------------------------------------------------PAVIA...
X5DC27_9BACT/316-598------------------------------------------------------------------------STLID...

PF03996

HEMA_CVMA5/9-391------------------------------------------------------------------------SDCTYVEN
HEMA_INCAA/19-420------------------------------------------------------------------------TDKS...N
HEMA_BRV1/2-378------------------------------------------------------------------------SDCT...N

PF14286

D4LDC0_RUMC1/65-436------------------------------------------------------------------------NLTASMRR
C4Z3Y8_EUBE2/59-440------------------------------------------------------------------------TCNERMTG
R6N2Z9_9CLOT/53-417------------------------------------------------------------------------SANARLKS

PF16822

M4X2G9_PSEDE/89-360------------------------------------------------------------------------FTDEE...
D9SK13_GALCS/90-349------------------------------------------------------------------------FLTDE...
D7CVL9_TRURR/113-377------------------------------------------------------------------------FTDEE...
A4XSW9_PSEMY/87-346------------------------------------------------------------------------FTNQE...
A7IG51_XANP2/41-300------------------------------------------------------------------------FPGWE...
Q0VSK8_ALCBS/79-348------------------------------------------------------------------------FRTEV...
D9SC65_GALCS/39-314------------------------------------------------------------------------YFSHE...
Q2KWS4_BORA1/105-364------------------------------------------------------------------------FLSDE...
A4XSW7_PSEMY/65-332------------------------------------------------------------------------FRSEV...
A8LND2_DINSH/79-327------------------------------------------------------------------------FTREE...
C4LEL0_TOLAT/54-306------------------------------------------------------------------------FTSAS...
Q0VSL0_ALCBS/86-342------------------------------------------------------------------------FTREE...
D7CSL0_TRURR/51-309------------------------------------------------------------------------LR.HA...
F6AHE0_PSEF1/87-346------------------------------------------------------------------------YTNQE...
A9BZH9_DELAS/53-312------------------------------------------------------------------------FPGWG...
A7IG52_XANP2/88-341------------------------------------------------------------------------FYADE...
A8ICK2_AZOC5/86-338------------------------------------------------------------------------FLAEE...
H9UGT7_SPIAZ/108-374------------------------------------------------------------------------FSAEE...
F6AHE2_PSEF1/62-330------------------------------------------------------------------------FRSSV...
A8ICK4_AZOC5/30-289------------------------------------------------------------------------FPGWE...
A4XR24_PSEMY/81-343------------------------------------------------------------------------YSDEE...
A4XR27_PSEMY/64-322------------------------------------------------------------------------FRSVE...
A9BZH8_DELAS/91-352------------------------------------------------------------------------FYRDG...
C1DP87_AZOVD/81-346------------------------------------------------------------------------FSDEE...
C1DP90_AZOVD/67-327------------------------------------------------------------------------FRTNE...
F2KL48_PSEBN/64-330------------------------------------------------------------------------FRTQE...
ALGX_PSEAE/64-325------------------------------------------------------------------------FRTTY...
ALGJ_PSEAE/85-355------------------------------------------------------------------------FTDEE...
Q6N6N6_RHOPA/99-362------------------------------------------------------------------------FYAGDNSI
ALGJ_PSESM/81-346------------------------------------------------------------------------YTDEE...
Q888J0_PSESM/99-365------------------------------------------------------------------------FLTDE...
ALGJ_PSEPK/81-346------------------------------------------------------------------------FSDEE...

PF00657

O04702_DAUCA/33-364-...----------------------------------------------------------------------------
Q39308_BRANA/36-320-...----------------------------------------------------------------------------
AOAH_HUMAN/257-543-GIK----------------------------------------------------------------------------
GDL49_ARATH/37-365-...----------------------------------------------------------------------------
Q9A6E2_CAUCR/200-399-DGL----------------------------------------------------------------------------
F0K6Q8_CLOAE/64-257-GKG----------------------------------------------------------------------------
A5FND2_FLAJ1/74-458-ETT----------------------------------------------------------------------------
A0A030Y1E2_PSEAI/215-418-DFL----------------------------------------------------------------------------
D4FZ14_BACNB/25-235-DYP----------------------------------------------------------------------------
D4FXT7_BACNB/43-243-KGY----------------------------------------------------------------------------