Sequence alignment for CL0265

PF11969

Q5TVU2_ANOGA/17-126----------------------------------------------------------SYQLVR..E-------LND..E
A5DAJ7_PICGU/3-137----------------------------------------------------------RHAFQPYID-------DPP.AH
A5DAR3_PICGU/136-257----------------------------------------------------------KWVYNILFE-------GKE..S
Q297L1_DROPS/153-272----------------------------------------------------------EWVYNILEH-------KKE..T
Q29LN6_DROPS/45-159----------------------------------------------------------ECLFCDFAN-------GKQ..G
HINT3_RAT/40-155----------------------------------------------------------NCVFCRVAA-------GQE..P
A0EGQ1_PARTE/118-231----------------------------------------------------------DWVYNILEK-------KKE..V
A1CEC1_ASPCL/149-272----------------------------------------------------------NWVFNILEG-------RTE..Q
A3DF72_CLOTH/3-110----------------------------------------------------------NCVFCKIIK-------REL..P
A3LWH2_PICST/136-257----------------------------------------------------------KWVYNILFE-------GKE..S
A4S248_OSTLU/99-229----------------------------------------------------------AWVRKILSL-------EKE..R
APTX_DROME/4-113----------------------------------------------------------SSALIK..D-------ISK..P
APTX_DROME/229-339----------------------------------------------------------RDELQR..K-------LND..K
A4XKP5_CALS8/3-110----------------------------------------------------------ECIFCKIVN-------KQI..P
A5D7U9_BOVIN/174-293----------------------------------------------------------QWVYNILDK-------KAE..A
A5E770_LODEL/177-298----------------------------------------------------------QWVYNILYH-------GKE..A
A5GQU3_SYNR3/125-230----------------------------------------------------------PTIFGRILR-------GEI..P
A5I635_CLOBH/3-110----------------------------------------------------------NCIFCKILK-------GEI..P
A6QUC5_AJECN/141-262----------------------------------------------------------NWVYNIIEG-------RKE..Q
A6VZM3_MARMS/2-109----------------------------------------------------------DCLFCKIVK-------GDI..P
A7HMY4_FERNB/3-108----------------------------------------------------------DCVFCKIID-------GQI..P
A7S614_NEMVE/151-270----------------------------------------------------------QWVYNILEK-------KAE..T
A7SFV5_NEMVE/10-122----------------------------------------------------------KCVFCKISS-------KEQ..E
A7TKH2_VANPO/142-261----------------------------------------------------------KWVENILYN-------GAE..S
A7TQ97_VANPO/171-297----------------------------------------------------------SWVNEILYE-------DVE..A
YHIT_CHLTR/2-108----------------------------------------------------------TTIFERIIE-------GAV..E
APTX_CHICK/142-252----------------------------------------------------------SQGLKS..S-------MQD..P
APTX_DANRE/150-260----------------------------------------------------------SQGLKA..S-------MQD..P
APTX_XENTR/173-283----------------------------------------------------------SQGLKA..S-------MQD..P
APTX_CIOIN/206-317----------------------------------------------------------SQGLKA..S-------MED..P
Q0U2I6_PHANO/148-269----------------------------------------------------------NWVFNIIEG-------RTE..Q
Q15X15_PSEA6/3-110----------------------------------------------------------ETIFTKIIN-------KEI..P
Q16F07_AEDAE/8-123----------------------------------------------------------SYALIR..D-------INS..P
Q16XY1_AEDAE/224-343----------------------------------------------------------EWLYNILEH-------RKE..K
Q16YN6_AEDAE/11-125----------------------------------------------------------RCIFCKIVT-------GQD..P
Q18227_CAEEL/10-129----------------------------------------------------------GCKFCDIVK-------NKK..E
Q1CY35_MYXXD/3-112----------------------------------------------------------DCLFCKIRD-------GLI..P
Q1QZ40_CHRSD/2-109----------------------------------------------------------ECLFCKMVN-------RDI..E
HINT3_XENTR/18-132----------------------------------------------------------SCIFCRIAN-------KQE..S
Q2H2H7_CHAGB/31-147----------------------------------------------------------SPLYDICDN-------PER..Y
Q2H304_CHAGB/151-275----------------------------------------------------------NWAFNIIEG-------TKE..A
HINT3_BOVIN/47-162----------------------------------------------------------KCVFCRIAA-------HQD..P
Q3IJU5_PSEHT/4-111----------------------------------------------------------ETIFTKIIN-------REI..P
A0A0D1DZS3_USTMA/46-158----------------------------------------------------------KCVFCNVTP-------DRF...
Q54DF5_DICDI/36-141----------------------------------------------------------GCPFCDYPN-------DKI...
Y2839_DICDI/224-348----------------------------------------------------------NVGLSALVY-------FCN.KP
Q59S51_CANAL/134-254----------------------------------------------------------KWVYNILFE-------GKE..S
Q5TUI6_ANOGA/154-273----------------------------------------------------------EWLYNVLEH-------RKE..K
A8XGQ1_CAEBR/148-267----------------------------------------------------------NWVYNCLEK-------RSE..V
Q6BZT0_YARLI/136-263----------------------------------------------------------QWVHNILYH-------GKE..A
Q6C515_YARLI/4-127----------------------------------------------------------KYALGQ..Y-------IKS..P
Q6C6M8_YARLI/30-153----------------------------------------------------------KWADGVLYR-------DES..P
Q6CJA1_KLULA/160-286----------------------------------------------------------QWVQNILYN-------GAE..S
Q6FLB9_CANGA/198-323----------------------------------------------------------KWVNNILYN-------GAE..D
Q6FWT2_CANGA/170-296----------------------------------------------------------AWVNNILYG-------EAE..A
Q6IIA4_DROME/5-118----------------------------------------------------------NCIFCLISD-------GRI..P
Q74ZD1_ASHGO/153-277----------------------------------------------------------QWVHNILYN-------GAE..A
Q7PHF8_ANOGA/7-116----------------------------------------------------------SDGLIH..A-------ISN..V
Q7QJM2_ANOGA/10-124----------------------------------------------------------NCIFCKIAT-------GND..P
Q83DE2_COXBU/3-109----------------------------------------------------------ACVFCKIAK-------GEI...
Q84VV6_ARATH/7-121----------------------------------------------------------ACIFCEIVR-------NPT..T
Q8GYJ9_ARATH/75-183----------------------------------------------------------PTIFDKIIA-------KEI..P
Q8SUA2_ENCCU/116-232----------------------------------------------------------NWMDNLIAQ-------DRSDLN
Q97JJ3_CLOAB/3-110----------------------------------------------------------ECIFCKIIK-------GEI..P
BH140_ARATH/717-833----------------------------------------------------------ALALHSIAM-------H....P
DCPS_SCHPO/141-261----------------------------------------------------------QWVENILTH-------KAE..A
E7KRX8_YEASL/160-281----------------------------------------------------------KWVNNILYE-------GAE..S
E7KUH0_YEASL/160-281----------------------------------------------------------KWVNNILYE-------GAE..D
F1R776_DANRE/159-276----------------------------------------------------------QWVYNILEK-------KAE..A
F7CC42_XENTR/161-276----------------------------------------------------------QWVYNILEK-------KAE..A
H3C365_TETNG/54-161----------------------------------------------------------.CPFCQIAD-------KQT..N
H3CJX6_TETNG/127-244----------------------------------------------------------QWVYNILEK-------KAE..A
H3DP42_TETNG/31-141----------------------------------------------------------KCIFCKIVN-------KEL..E
Q0JBF2_ORYSJ/25-136----------------------------------------------------------.CVFCPIAR-------RDP..A
Q5K774_CRYNJ/143-255----------------------------------------------------------.WVYEILEG-------RKE..A
Q9VQ59_DROME/32-141----------------------------------------------------------KCFFCDFAH-------RRQ.GP

PF01230

HINT1_RAT/24-121------------------------------------------------------------------R-------KEI--P
HNT2_YEAST/12-107------------------------------------------------------------------V-------T..--.
FHIT_HUMAN/11-105------------------------------------------------------------------K-------P..--.
APH1_SCHPO/12-106------------------------------------------------------------------V-------G..--.
APTX_YEAST/15-139------------------------------------------------------------------E-------TVN--D
Q9I500_PSEAE/74-166------------------------------------------------------------------R-------LEQ--D
Q98BM9_RHILO/14-106------------------------------------------------------------------R-------LEA--D
Y866_METJA/9-105------------------------------------------------------------------N-------GEI--P
YHIT_MYCPN/19-116------------------------------------------------------------------E-------GNV--K
APTX_SCHPO/44-156------------------------------------------------------------------S-------PES--Y
YHIT_HELPY/9-104------------------------------------------------------------------Q-------GEI--P
HNT1_YEAST/32-125------------------------------------------------------------------K-------SEI--P
Q9A2A9_CAUCR/9-106------------------------------------------------------------------A-------FVA--T
YHIT_SYNY3/12-109------------------------------------------------------------------R-------REI--P
Y1390_SYNE7/12-109------------------------------------------------------------------R-------REI--P
YHI1_MYCLE/10-102------------------------------------------------------------------N-------REL--P
Y961_HAEIN/12-110------------------------------------------------------------------R-------KEI--P
Q9JYE4_NEIMB/10-102------------------------------------------------------------------T-------AQN--E
Q9KQC5_VIBCH/14-106------------------------------------------------------------------Q-------LQK--D
ZB14_MAIZE/24-123------------------------------------------------------------------K-------KEI--P
HINT_CAEEL/28-125------------------------------------------------------------------R-------KEI--P
G8AG53_AZOBR/16-114------------------------------------------------------------------R-------GEI--P
K7XM15_MYCHR/14-110------------------------------------------------------------------K-------REE--P
YHI2_MYCTU/11-106------------------------------------------------------------------.-------GEA--P
Q32EW3_SHIDS/12-109------------------------------------------------------------------R-------REI--P

PF04677

C3H64_ARATH/370-491----------------------------------------------RKPRSENANRSKECWFCLSSP-------SV---E
C19L1_CAEEL/309-429----------------------------------------------GNDGPRNKQPVGPCWFCLSNV-------DA---E
C19L2_CAEEL/226-350----------------------------------------------IKEHKRIERSFDDCSRCIDSS-------RL---K
C19L2_DROME/460-584----------------------------------------------IREHEKLVATLDNCERCFDSA-------KL---D
CWF19_SCHPO/399-523----------------------------------------------GGDLKKINHVLDTCPLCLNYE-------TQ---P
DRN1_YEAST/256-389----------------------------------------------NENKKIRTILPSSCHFCFSNP-------NL---E
MU161_SCHPO/334-470----------------------------------------------SLNNRRSKVGPGSCFFCLSNP-------NV---A
Q93ZX4_ARATH/458-582----------------------------------------------.NRVKRIMTQQERCLFCFENP-------KR---P

PF02611

CDH_HELPY/24-243------------------------------------------------PNVLRKIVFEKCLPNYEKN-------QN.PSP
Q8P9Z9_XANCP/30-250------------------------------------------------PDALWRIVTTHCL...QAG-------PV.PDD
E8V0N7_TERSS/35-269------------------------------------------------GDVLWQIVHEDCVPDMQAN-------HL.ASP
A8GL49_SERP5/45-264------------------------------------------------SSALWRIVSQQCLPNQQAN-------NN.PAP
E0SJ94_DICD3/33-253------------------------------------------------GNALWEFVGQQCVPNQQKN-------NS.PAP
CDH_YERPE/33-252------------------------------------------------ADALWKIISQQCIPHMTTE-------DD.PRP
B8IMH8_METNO/37-256------------------------------------------------RNLLW.VTLQTCILTKRMT-------GR.ALP
W0LHA3_9ENTR/26-254------------------------------------------------SNALWNVVDKLCMVNYQQK-------HD.PAP
B1M455_METRJ/29-249------------------------------------------------RDVLW.AALKTCVLAKRLA-------NR.TFP
Q1LBK3_CUPMC/33-250------------------------------------------------RDSLWKNVQERCLTPATPT-------HS...D
Q6MQF2_BDEBA/30-256------------------------------------------------SDALWNLISTQCLPLHKIG-------EE.KNP
G8MBN7_9BURK/67-288------------------------------------------------PNALWEIVHDYCEPAAEGA-------RV.QQK
A6TFQ8_KLEP7/24-243------------------------------------------------PDALRKIVLQQCVPHQQQQ-------QN.PSP
H2INV4_RAHAC/31-250------------------------------------------------PNALWNIVSTKCVPNQRSN-------GK.PDP
B0U7T2_METS4/29-248------------------------------------------------RDVLW.VALQGCILAKKTT-------GG.AFP
B2VF57_ERWT9/34-251------------------------------------------------SEKLWQIVSQQCLPGQQLK-------SD.PQP
B9JRW8_AGRVS/27-242------------------------------------------------PDALWKIVHDKCV......-------.VATAP
D8IW24_HERSS/34-253------------------------------------------------PHKLWEITSQQCVPHMQAS-------GQ.PQP
C5BB31_EDWI9/31-247------------------------------------------------SDALWRIVSQQCLPHQQAS-------GD.PAP
A9HJU4_GLUDA/35-256------------------------------------------------PNVLWSIVHDRCVPNQAGE-------NT.PAP
B2JLJ5_BURP8/29-246------------------------------------------------PNALWKIVDHQCVPAARAS-------GR.PGF
B1LSY8_METRJ/26-246------------------------------------------------RDVLW.VALQGCVLAKKAA-------GR.SFP
L0IYV5_MYCSM/29-248------------------------------------------------PNALWTIVHDQCVPDQLAS-------GD.PAP
B8IPC5_METNO/27-247------------------------------------------------RDSLW.LVVRSCLGAERLT-------GL.PFP
B2FII5_STRMK/27-247------------------------------------------------SDALWRLIERDCR....GP-------EGPRGD
CDH_CROS8/31-250------------------------------------------------PDALRHIVMQQCLPGERER-------QE.PAP
B8EQB5_METSB/40-259------------------------------------------------SNALWTIVHGPCTFNETHF-------NS.PAP
B2HIW3_MYCMM/43-260------------------------------------------------RDQLWKIVHDRCERDYQRT-------GA.YAP
W0HRX4_9ENTR/35-254------------------------------------------------PDALWRIVSEECVPHQLQR-------GD.PSP
E6WAG7_PANSA/33-250------------------------------------------------SNALWQIISEKCLPGMMQK-------GN.PAP
B1M8V7_METRJ/69-294------------------------------------------------.GALWAIVHGACVPHERRG-------QG.PAP
D8MKK8_ERWBE/33-250------------------------------------------------SDALWKIVSQKCVPNQNQN-------ND.PTP
Q6D6W9_PECAS/32-251------------------------------------------------SNALWEIVSEQCVPNQQHS-------GN.PAP
D2UA62_XANAP/30-247------------------------------------------------ADTVWRVVHRQCASDASCS-------GE.AMP
CDH_MYCLE/38-255------------------------------------------------RDALWKIVHDRCELGYQHT-------GA.YAP
Q13LU5_BURXL/41-259------------------------------------------------SNALWKIVDLRCVPSQQAT-------GT.PGQ
Q7NQ26_CHRVO/27-251------------------------------------------------GDALWRIVGGQCVPAQQAQ-------GQ.PGP
K7SS21_GLUOY/32-232------------------------------------------------RNKLWELVGSRCAKDAQH.-------....QP
Q0JZ98_CUPNH/25-246------------------------------------------------RDGLWRNVQQRCLGSTAAA-------HP...D
H8L0L3_FRAAD/32-259------------------------------------------------PSQLW.LLLQRCAVQAKAG-------HQPPLP
CDH_ECOLI/31-250------------------------------------------------SDTLRKIVLEECLPNQQQN-------QN.PSP
Q5FPM0_GLUOX/32-232------------------------------------------------RGALWKVVHGRCAPDAAH.-------....KP
W0PFV2_9BURK/44-257------------------------------------------------.DILWHFVHDQCVPNQQAG-------NQPPAP
I2BEE8_SHIBC/29-247------------------------------------------------PDALWQIVSRQCVPGQQQH-------QD.PAP
CDH_MYCTU/41-258------------------------------------------------REALWKIVHDRCEFGYRRT-------GA.YAP
U3U143_9ENTR/33-250------------------------------------------------ADALWQIVSEKCVPDMTQR-------GN.PAS

PF02744

GAL7_CRYNJ/204-373----------------------------------------------E........IENFVRYASGRS.......GSHMLL
GAL7_HAEIN/183-348----------------------------------------------E........DRTQRDYLLKH........GSVMLV
GALT_STRMU/231-435----------------------------------------------NTFRQLLDIVDIFPGYFAGSNSDLPIVGGSILSH
GALT_BACSU/240-451----------------------------------------------KTFERLLSFLGQYPHYFIGSNADLPIVGGSILSH
GAL7_YEAST/198-366----------------------------------------------E........LKSFDKYKREH........NTDLFA
GAL7_KLULA/195-363----------------------------------------------E........FDHFEKYEHQH........GAHLLE
GAL7_ECOLI/182-347----------------------------------------------E........DRLQKEYFAEQ........KSPMLV
GALT_HUMAN/202-370----------------------------------------------E........ERSQQAYKSQH........GEPLLM

PF16285

C0ZAZ1_BREBN/8-252--FNMQIGR-------------------------------------KKPVSVNNTETACPFCDRNSLTDVLEQRGSMIWL
B2TPI8_CLOBB/11-256--FINSIGK-------------------------------------NKPNSFNNNNTECPFCNRNKLTDIIQENGPFVLL
C9LU44_SELS3/8-252--FNTTLGK-------------------------------------KKPENIINKTAPCPFCDRENLSGIVDTDGDLVLL
D9SRU9_CLOC7/9-253--FISNISI-------------------------------------KKPNTIINQTTVCPFCHKENLTDIFDEKGVFIFL
Q81VH8_BACAN/8-251--FLNDIGK-------------------------------------QKPESIRNRSAACPFCDRENLTDILATEGPIIWL
U5LFA6_9BACI/8-252--FNTSIGV-------------------------------------KKPNSIRDKEQGCPFCEREKLTDILAVEDNIILL

PF01087

GAL7_CRYNJ/15-198T.PVSINDH.......................................VHRRFNPLLGKHVL.............VSPHR
Q7QA38_ANOGA/1-174M..FDPTDH.......................................QHRRYNPLNGQWVL.............VSPHR
A5DRG5_PICGU/6-197T.EFDFTNH.......................................SHRRHNPLTDTYVL.............CSPHR
Q9CM11_PASMU/4-178S.RFEPTEH.......................................PHRRYNPLTDQWVL.............VSPHR
Q2H1V5_CHAGB/2-211P.DQVLDDI.......................................SHRRYNPLTGSWLL.............VSPHR
A4AQM0_MARSH/1-176M.DIDFNEN.......................................PHRRFNILTGEWIL.............VSPHR
Q65CW7_BACLD/17-231G.FIEPADVN....................................YARN.QVMNLLGLESFPEEAT...AASGDSIPDL
A9WJH8_CHLAA/4-191E.QQELFLR.......................................PHRRLNRLTGEWVL.............VSPHR
A7MIY8_CROS8/2-176E.QFNPVDH.......................................PHRRYNPLTGQWIL.............VSPHR
Q03XA5_LEUMM/18-235S.DYTIDDEI....................................YLVN.QIMGLVGETNHNTTPRL.VDDDSVTTLAL
A3N102_ACTP2/3-177Q.QFILNDH.......................................PHRRFNPLKNQWIL.............VSPHR
GALT_STRMU/16-225S.DYAELDAT....................................YLSN.RILALVGEDNAQQD......TNQSNLIAL
A5DWA9_LODEL/21-211S.EFDFTNH.......................................SHRRYNPLTNRYVL.............CSPHR
Q6D2C5_PECAS/1-175M.QFEPTEH.......................................PHRRFNPLKGEWIL.............VSPHR
Q1IQZ6_KORVE/1-177M.SDATKST.......................................PHRRFNPLTGEWIL.............VSPHR
Q6LQE3_PHOPR/15-189D.AFDATDH.......................................PHRRYNPLTGQWVL.............VSPHR
A8LEI8_FRASN/19-211R.GSGVPST.......................................PHRRFDPLRGRWVL.............VSAGR
Q59VY3_CANAL/21-210Q.EFDFTNH.......................................SHRRLNLLTNKFVL.............CSPHR
A1L2D1_DANRE/7-181P.TFDPKEH.......................................QHLRYNPLRDSWVL.............VSAHR
A7F8S7_SCLS1/1-208MPEKILDDI.......................................SHRRFNPLRGTWLL.............VSPHR
Q3XZ93_ENTFC/18-230G.GWMEMDRL....................................YLQN.RLLGMVGEDALESIEV...RPVKEESVDL
B1YII0_EXIS2/18-230R.LIEPEDTV....................................YARN.RLLSLLGEAAYVDPG....TVGTRPIPDL
Q0RE52_FRAAA/14-191A.VESMDDT.......................................THRRFNPLTGRWVL.............VSPGR
Q21LR9_SACD2/5-180L.AFDPNDH.......................................SHRRKNPLTGEWVL.............VSPHR
GALT_STACT/19-233G.DYEREDNY....................................YLQN.LILEITKAESIDETKNN.NGLVNPTSNEI
GALT_LACPL/16-224S.QYTELDRI....................................YVHN.RVLGLVGEGDPIAA.......SDDQLTSL
A8WVF3_CAEBR/2-179S.....KIN.......................................NFRRYNPLIDEWII.............VAVNR
A2AMS2_MOUSE/3-177A.TFRASEH.......................................QHIRYNPLQDEWVL.............VSAHR
GAL7_NEUCR/2-217T.DKVLDDI.......................................SHRRYNPLNGSWLL.............VSPHR
A7TJY6_VANPO/4-190A.KFDYTDN.......................................SHRRYNPLTDSWVL.............VSPHR
A6RBX1_AJECN/45-253V.ESVLDDI.......................................SHRRYNILRGSYVL.............VSPHR
GAL7_KLULA/1-189M.SFDLTDH.......................................SHARYNPLTDSWIL.............VSPHR
Q5KY03_GEOKA/19-233G.LLAPEDVV....................................YARN.RLLATLRLTEWQPAEV..KDVPLASPAPV
Q03PB0_LACBA/18-226A.PYTELDRQ....................................YVTN.RILALIGEGSVPTA.......TANEPIDL
A2QCH5_ASPNC/2-209V.EHVLDDI.......................................SHRRFNPLRGSYIL.............VSPHR
A6WF46_KINRD/10-216R.KTSTRMADGRELIYFDDTEPWLSGERARDAVDHRPLRPADETLRGGSQVRFDPLTGDWIA.............MASHR
Q2J7D6_FRASC/3-201G.FVAMDDI.......................................THRRFNPLTGRWVL.............VSPGR
A3QFA6_SHELP/9-182S.QFSTDEH.......................................PHRRFNPLTGEWVL.............LSPHR
GALT_BACHD/21-236G.LITKWDID....................................ASRN.RVLDVLDLDELEPVEQ..VDVECEMPYPI
Q5WD06_BACSK/20-235K.LLPLADVD....................................YSRN.QLLDRLGLDAPMIGET..LPETNEPIYDI
A0QYK5_MYCS2/3-199Q.PLRWTLADGREQLYFSLPGHTP........APVGDRRPLPPRGNQQSELRFDRQTGQWVV.............IAALR
GALT_LACSS/20-231T.TYTAEDEQ....................................YLFN.VVLDLVGEGDETPVV....AQETTTLIDL
Q896X9_CLOTE/19-233N.LIEEIDKV....................................AARN.SLLELFKLDEPYKEDV..EFEDINTATDI
GALT_DROME/1-175M.QFVASEH.......................................PHRRLNPLNGQWVL.............VCPHR
GAL7_SCHPO/4-195K.KFDFTEY.......................................SHRRYNPLTDSYVL.............CSPHR
B8I4V5_CLOCE/19-234G.MISKLDKI....................................IARN.QLLDLLKLNEPFYGEI..PDEYIEFPTEI
A3LR66_PICST/19-206N.EFDFTNH.......................................SHRRFNPLSNTYVL.............CSPHR
Q7N8Y8_PHOLL/4-178I.AFNPIEH.......................................PHRRYNPLTGQWVL.............VSPHR
Q73SK2_MYCPA/2-203G.PTRAKLADGRDLLFFSLPGHRASPV..EDRRPLPPRTAETVAPGGQSQLRFDRSTGQWVI.............IAALR
A8FIP9_BACP2/20-233K.LITSLDIE....................................YTRN.RLLEVLRLDEAETRT....VPGEEDLEDI
Q3IH81_PSEHT/3-176T.IFDPTEH.......................................PHRRYNPLIDEWVL.............VSPHR
A0M3B7_GRAFK/1-176M.KTELNNT.......................................PHRRYNILTGEWIL.............VSPHR
A5FKW9_FLAJ1/2-179K.NFDINED.......................................PHRRFNPLINEWVL.............VSPHR
A0A0D1E3L7_USTMA/31-214V.EFDATEH.......................................PHRRYNPLTRSWVL.............CSPHR
Q15Y61_PSEA6/2-176S.KFDPVDH.......................................SHRRRNPLTNDWVL.............VSPHR
Q6C0K3_YARLI/1-190M.TLVASDI.......................................PHRRYNPLRQSWVL.............VSPHR
Q6BVI6_DEBHA/3-194E.LFDFTNH.......................................SHRRFNPLSNTYVL.............CSPHR
Q2GAY3_NOVAD/2-175T.RFSTDDH.......................................PHRRQNLLTGKWVL.............VSPHR
GALT_CLOAB/17-229G.LIQEDDKI....................................YSSN.MLAGLFNLDNFYFEEI...SDVPSTATAI
GALT_ENTFA/20-232G.DWTETDRY....................................YLTN.RIAKLVGCDFFEQPEA...VACEQEPLRV
Q30V51_DESAG/2-182G.LQPYKDI.......................................PHTRRNALTGEWVL.............VSPHR
A9KN46_CLOPH/31-257G.LIEEEDRI....................................YVRN.RILSELQLSDYTEDVQSTSSEAESNIPNI
GALT_LACS1/18-228E.NYTELDRN....................................YLYN.RILNLVGEGVEKLT......TTKNEIIDL
A0KQH7_AERHH/2-174...FNPVDH.......................................PHRRFNPLTGQYVL.............VSPHR
A4VT89_STRSY/18-226..DFEEMDAI....................................YLRN.RVLALVGDQVLTVQ......TDLEDLIEL
A5VME1_LACRD/16-220..TYEPLDRI....................................YVLN.KIRGFVGDEDVE..........AKDDEPV
E7KK61_YEASL/5-192..EFDFSSH.......................................SHRRYNPLTDSWIL.............VSPHR
G0RTP4_HYPJQ/7-208......DDI.......................................SHRRYNPLTDSWLL.............VSPHR
Q04GZ3_OENOB/18-225...YQELDRI....................................YVEN.RIHALIGDGNTVKE......KDDQLLNLR
Q5KLY2_CRYNJ/11-195...FEPTEH.......................................PHRRYNPLIGKHVL.............VSPHR
GALT_STRT2/18-226..DYEELDRI....................................YLTN.KVFTLVGEGVADVE......TDSSELIDL
Q5NEY1_FRATT/11-180..............................................KSSHRRKNILTNEWVL.............VSPHR
Q7MBX0_VIBVY/28-200...FDVAEH.......................................PHRRYNPLMGEWVL.............VSPHR
GALT2_STRR6/16-224..SFEEMDRI....................................YLTN.RVLSRVGEGVLEVE......TNLDKLIDL
GALT1_STRR6/18-225...YNEIDKI....................................YVKN.RVLALIGEEGTDRI......SDENDLKQI
GALT_CLOPE/21-230...IEDMDTV....................................YTRN.RLLSLFNENSYTPCE....EKLTLSFHET
GALT_LACLA/19-228..TIEPLDEL....................................YHRN.QLLHFLGLNDWAEVDK...EAHEKDSLIL
U5L509_9BACI/19-230..MIEERDRI....................................YARN.QIMSLLGLVEYPEHA....EAVEKAIPDV

PF16268

F5XH95_MICPN/8-422--LEDGTVR------------------------------------------QVGPLTGTYVW-------------TIPGR
C3PH27_CORA7/1-419--MADGTVK------------------------------------------QVNPFSGTEVW-------------TVPGR
B1VH78_CORU7/18-447--LPDGTIK------------------------------------------QVNPFSGTEVW-------------TVPGR
Q8NNU9_CORGL/1-424--MADGTIK------------------------------------------QIHPFTGTEVW-------------TVPGR
W5WQ34_9CORY/18-447--LPDGTIK------------------------------------------QVNPFSGTEVW-------------TVPGR
W5Y1J6_9CORY/15-448--MADGTVK------------------------------------------QVNPFSGTQVW-------------TVPGR
G0HAG7_CORVD/18-449--LPDGTIK------------------------------------------QVNPFSGTEVW-------------TVPGR
U3GXR8_9CORY/26-464--MADGTIK------------------------------------------QVNPFSGTEVW-------------TVPGR
Q6NGG7_CORDI/11-432--MSDGTIK------------------------------------------QVNPFSGTEVW-------------TVPGR
S5SVS2_9CORY/15-437--MTDGTIK------------------------------------------QVNPFSGTQVW-------------TVPGR
B3QVF6_CHLT3/10-436--MPDGTIK------------------------------------------QINPFTGSEVW-------------SVPGR
Q6A5P1_PROAC/10-435--LPDGTIK------------------------------------------QVNPFTGTKVW-------------TVPGR
Q8FP08_COREF/15-438--MADGTIK------------------------------------------QVHPFTGTEVW-------------TVPGR
F8E0G1_CORRG/18-447--LPDGTIK------------------------------------------QVNPFSGTEVW-------------TVPGR
C5CBF5_MICLC/33-463--LPDGTVK------------------------------------------QRNPFTGTEVW-------------TVPGR
I6XY80_PROPF/27-452--MADGTVK------------------------------------------QVGPLTGTEVW-------------TVPGR
R5PXK8_9PROT/14-442--MPDGTVK------------------------------------------QVNPFTGTQVW-------------TVPGR
D7BLX6_ARCHD/14-437--MADGTIK------------------------------------------QINPFSGTEVW-------------TIPGR
D9QB86_CORP2/15-442--MADGTIK------------------------------------------QVNPFSGTQVW-------------TVPGR
X5DSS5_9CORY/40-471--LPDGTIK------------------------------------------QVNPFSGTEVW-------------TVPSR
M1P829_9CORY/11-432--MADGTIK------------------------------------------QVNPLTGTEVW-------------TVPGR
D7GCR7_PROFC/13-438--MPDGTVK------------------------------------------QVNPLSGVEVW-------------TVPGR
D7WEZ1_9CORY/10-431--MADGTIK------------------------------------------QYNPFSGTQVW-------------TVPGR
C8XCI8_NAKMY/35-455--MSDGTLK------------------------------------------QINPFTGTQVW-------------TVPGR
C4LIB0_CORK4/15-440--LADGTIK------------------------------------------QVNPFTGTEVW-------------TVPGR
K7RWS7_PROA4/29-464--LKDGTIK------------------------------------------QVNPFTGVQVW-------------TVPGR
D6ZJH6_MOBCV/17-441--MADGTIK------------------------------------------QRNPLTGTQVW-------------TVTSR

PF11969

Q5TVU2_ANOGA/17-126-----------SLH....LK..ST........SKSIAMRDLY........PK...ARYHFLVLP.RK..........N--
A5DAJ7_PICGU/3-137-----------KAV....LF..HD........ETALIVRDAY........PK...SKFHYLVIP.RS.........KK--
A5DAR3_PICGU/136-257-----------ETF....IY..HDKD....PETGFVLLPDMK.......WDRLNMDALYLCCIV.NR.........TD--
Q297L1_DROPS/153-272-----------ERI....VF..EDND....PETGFILLPDLK.......WDGRNVENLYLLGIV.HK.........HN--
Q29LN6_DROPS/45-159-----------PPP....VL..EVQ......TDEYVIFKDKS........PA...ATYHYLAIP.KQ..........H--
HINT3_RAT/40-155-----------ETE....LLYCEN........KDLVCFKDIK........PA...ALHHYLVVP.KK..........H--
A0EGQ1_PARTE/118-231-----------ENI....VF..EN........QTFLILKDYVF......VNSQSLDDLHLLALP.FQ.........RD--
A1CEC1_ASPCL/149-272-----------EDV....IL..RDAGK..GPDDGFLMLPDLN.......WDRKTMGSLHLLGLP.LR.........RD--
A3DF72_CLOTH/3-110-----------STI....YY..ED........ERVIAIKDIN........PA...APVHVLIIP.KE..........H--
A3LWH2_PICST/136-257-----------ETF....VY..HDTD....PVTGFVLLPDMK.......WDTINMESLYLCAIV.NR.........MD--
A4S248_OSTLU/99-229-----------ERL....LH..CDDDFLLNVDSKWTTHPDCDGADRATWRAHSSVTDLYCLGLC.VR.........ED--
APTX_DROME/4-113-----------ENL....II..SS........EIAVVIADKF........PK...AQHHYLVLP.LA..........D--
APTX_DROME/229-339-----------RNF....LI..ES........DRAVVMKADY........PK...SQYHFRVVA.KE..........E--
A4XKP5_CALS8/3-110-----------SEI....VY..ED........EHVCAFKDIN........PT...APVHILVVP.KQ..........H--
A5D7U9_BOVIN/174-293-----------DRI....VF..ENPD....PSDGFVLIPDLK.......WNQQQLDDLYLIAIC.HR.........RG--
A5E770_LODEL/177-298-----------ETV....IY..HDK.....SPQGFVLLPDMK.......WDGINMENLYLCCIV.NR.........QD--
A5GQU3_SYNR3/125-230-----------AER....IH..ED........EHCIAFADIQ........PQ...APVHLLVIP.RQ..........H--
A5I635_CLOBH/3-110-----------SSK....VY..ED........ELVYAFNDID........PV...APHHVLIIP.KE..........H--
A6QUC5_AJECN/141-262-----------EDV....II..RVSD....PEEGFLLLPDLN.......WDRKTIGTLRLLCLV.ER.........RN--
A6VZM3_MARMS/2-109-----------ANI....LF..ED........DDVIAFEDIM........PK...APTHFLVIP.KR..........H--
A7HMY4_FERNB/3-108-----------SEK....VY..ED........NDFIVIKDIR........PV...APVHLLAIY.KK..........H--
A7S614_NEMVE/151-270-----------ERV....VF..EDGD....PETGFVLLPDMK.......WDQQQVENLYLIAIC.HK.........RG--
A7SFV5_NEMVE/10-122-----------TRI....IY..ED........EETLTFKDLR........PA...TDHHYLVIP.KQ..........H--
A7TKH2_VANPO/142-261-----------DRV....VY..QD........DDMVILPDMK.......WDGENMDAFYLVSIL.KR.........KD--
A7TQ97_VANPO/171-297-----------DRV....VY..KDFSE.DSKRDGFVILPNTK.......WDGVNLDSLYLVAIV.YR.........ND--
YHIT_CHLTR/2-108-----------CDK....VF..ED........ENFIVIKDKF........PQ...APVHLLIIP.KK..........H--
APTX_CHICK/142-252-----------KVQ....VY..KD........EKTVVIKDKY........PK...ARYHWLVLP.WD..........S--
APTX_DANRE/150-260-----------KMQ....VY..KD........DSVVVIKDKY........PK...ARYHWLVLP.WQ..........S--
APTX_XENTR/173-283-----------TMQ....VF..KD........DKVVVIKDKY........PK...ARYHWLVLP.WQ..........S--
APTX_CIOIN/206-317-----------ELV....VK..ED........EQIVVIKDKY........PK...AKYHWLILP.KD..........S--
Q0U2I6_PHANO/148-269-----------EDV....MY..RESD....PSKGFLLLPDLN.......WDRKTIGALHLLGLV.ER.........RD--
Q15X15_PSEA6/3-110-----------AEI....LY..ED........EMSLAFRDIN........PQ...APMHFLVIP.KK..........A--
Q16F07_AEDAE/8-123-----------ANH....II..RS........ELAVVIRDKY........PK...ARHHFLVLP.WA..........N--
Q16XY1_AEDAE/224-343-----------DRI....VY..EDPS....DKVGFILLPDLK.......WDGKTLEQLYLLALV.RP.........KG--
Q16YN6_AEDAE/11-125-----------NAS...IVY..EN........ERICIFKDIR........PA...AEHHLLAVP.KY..........H--
Q18227_CAEEL/10-129-----------LQL....K...EN........KSCVVINDIK........PK...AKNHYLVLS.KQ..........H--
Q1CY35_MYXXD/3-112-----------AKV....VY..RD........DVCVAFEDIN........PQ...APTHVLFIP.HK..........H--
Q1QZ40_CHRSD/2-109-----------PDV....VY..ED........EHVLAFNDIN........PQ...APTHVLIIP.KK..........H--
HINT3_XENTR/18-132-----------GAE....LL.HSD........DDLVCFKDIR........PA...VTHHYLVVP.KK..........H--
Q2H2H7_CHAGB/31-147-----------SNV....RY..FD........HEMVVVDDAN........AK...SPDHIILMP.RD.........TS--
Q2H304_CHAGB/151-275-----------EDV....IY..RTPYG.QDPEEGFLLLPDLN.......WDRKTLDALHLLGLV.ER.........RD--
HINT3_BOVIN/47-162-----------GTE....LLHCEN........EDLVCFKDIK........PA...APHHYLVVP.KK..........H--
Q3IJU5_PSEHT/4-111-----------ADI....IY..ED........EHTLAFKDIN........PQ...APFHALIIP.KK..........A--
A0A0D1DZS3_USTMA/46-158-----------.RI....VI..ED........EKLICFTDRS........PG...AAIHLLVIP.RN..........H--
Q54DF5_DICDI/36-141-----------.......IF............QNVIVFNDRT........PK...ATVHYLICP.RE..........H--
Y2839_DICDI/224-348-----------ESFLDVVLY..YD........DKTVAVLDKY........PK...AKHHYLVIP.RV..........E--
Q59S51_CANAL/134-254-----------ETF....VY..HDK.....SPTGFVLLPDMK.......WDGKNLDTLYLCCIV.NR.........LD--
Q5TUI6_ANOGA/154-273-----------ERI....LY..EDPC....DENGFILLPDLK.......WDGKTVEQLYLLALV.RR.........RG--
A8XGQ1_CAEBR/148-267-----------DKI....VY..EDPD....KNNGFLLLQDIK.......WDGKTIENLYVLAII.HR.........HG--
Q6BZT0_YARLI/136-263-----------EDV....VY..RK.......EDSFVLLPDMK.......WDRKNVNSLYLVAIS.LRNLEGQGESGKP--
Q6C515_YARLI/4-127-----------EKFPNDVTL..DT........PDFVVIKDAF........PK...SHIHYLVLP.KA..........V--
Q6C6M8_YARLI/30-153-----------QDV....IY..GDLD....QKTGFVLFIHQK.......WNERDFRELNLIAIA.YR.........HD--
Q6CJA1_KLULA/160-286-----------DRV....VF..KYFDQ.ESPKDGFVVLPDMK.......WDGVNMDALYLVAIV.HR.........DD--
Q6FLB9_CANGA/198-323-----------HRI....VY..KHLDP..HDEDGFLIFPDMK.......WDGVNLDALYLMAIV.YR.........ED--
Q6FWT2_CANGA/170-296-----------DRV....VY..KDYQE.DNKKDSFIVLPDMK.......WDGNNLESLYLVAIS.YR.........DD--
Q6IIA4_DROME/5-118-----------ST.....VLEVEN........DDFVIFQDIK........PA...SQHHYLAVT.KK..........H--
Q74ZD1_ASHGO/153-277-----------ERI....VY..KDFVE.TKPEDGIVLLPDMK.......WDGVNLDSLYLVAIA.YR.........ND--
Q7PHF8_ANOGA/7-116-----------KKQ....LF..VS........DLAVVIKDKY........PK...ALHHFLVLP.WK..........D--
Q7QJM2_ANOGA/10-124-----------ATD...IVF..QN........ERICIFKDIR........PA...SDFHYLAIP.NH..........H--
Q83DE2_COXBU/3-109-----------GEL....IY..ED........KQVVAFNDAA........PQ...APIHILVIP.HR..........H--
Q84VV6_ARATH/7-121-----------TRL....LH..TD........EKVIAFQDIK........PA...AQRHYLVIP.KE..........H--
Q8GYJ9_ARATH/75-183-----------SDI....VY..ED........ENVLAFRDIN........PQ...APVHVLVIP.KLR........DG--
Q8SUA2_ENCCU/116-232-----------EEI....MY..ED........EEVIMIPDYK.......WNPQTVDLLHFLVVF.KD.........PG--
Q97JJ3_CLOAB/3-110-----------SSK....VY..ED........EDVLAFNDIS........PA...APVHVLVIP.KK..........H--
BH140_ARATH/717-833-----------ERH........ENVVL..EYLDNIVVINDQY........PK...ARKHVLVLARQE..........S--
DCPS_SCHPO/141-261-----------ERI....VV..EDPD....PLNGFIVIPDLK.......WDRQTMSALNLMAIV.HA.........TD--
E7KRX8_YEASL/160-281-----------ERV....VY..KDFSE.ENKDDGFLILPDMK.......WDGMNLDSLYLVAIV.YR.........TD--
E7KUH0_YEASL/160-281-----------DRV....VY..KEYSS.RNKEDGFVILPDMK.......WDGINIDSLYLVAIV.YR.........DD--
F1R776_DANRE/159-276-----------DRI....VF..EDPD....PDAGFVLLPDFK.......WDQKQLQDLYLIAIV.HR.........RD--
F7CC42_XENTR/161-276-----------ERI....VY..ENPD....PANGFVLIPDFK.......WNQKQVEDLYLIAIC.HQ.........RG--
H3C365_TETNG/54-161-----------TEI....LF.SQD........EELLCFRDVK........PG...AETHFLVVT.RR..........H--
H3CJX6_TETNG/127-244-----------DRI....IY..EDPD....PDVGFVLLPDFK.......WNQKQVDDLYLIAIV.HQ.........KG--
H3DP42_TETNG/31-141-----------TEL....LH..CD........GEISCFRDIR........PG...APHHYLVVP.TK..........H--
Q0JBF2_ORYSJ/25-136-----------CNTV..LLY..SD........DRVMAFKDIN........PS...AFRHYLVIP.IE..........H--
Q5K774_CRYNJ/143-255-----------ERV....YY..RSE.....GDDGFVILPDLK.......WDETTKNALYLTCIV.QD.........RS--
Q9VQ59_DROME/32-141-----------PPI...LEV..ET........DEYVIFKDKY........PA...ARLHYLAIP.KE..........H--

PF01230

HINT1_RAT/24-121-----------AKI----IF--ED--------DRCLAFHDIS--------PQ---APTHFLVIP-KK---------.H..
HNT2_YEAST/12-107-----------EQV----FY--KS--------KYTYALVNLK--------PI---VPGHVLIVP-LR---------TT..
FHIT_HUMAN/11-105-----------SVV----FL--KT--------ELSFALVNRK--------PV---VPGHVLVCP-LR---------.P..
APH1_SCHPO/12-106-----------SQV----FY--RT--------KLSAAFVNLK--------PI---LPGHVLVIP-QR---------.A..
APTX_YEAST/15-139-----------DTV----TY--FD--------DKVSIIRDSF--------PK---SECHLLILP-RT---------MQ..
Q9I500_PSEAE/74-166-----------TLL----LG--DF--------PLSRLLLMND--------AR---YPWFILVPR-RE---------.D..
Q98BM9_RHILO/14-106-----------SEQ----VM--WL--------GLCELRVMND--------RR---WPWLVLVPQ-RP---------.G..
Y866_METJA/9-105-----------AKV----VY--ED--------EHVLAFLDIN--------PR---NKGHTLVVP-KK---------.H..
YHIT_MYCPN/19-116-----------SFK----VG--EN--------EHAFAFLDAF--------PV---ADGHTLVIP-KK---------.H..
APTX_SCHPO/44-156-----------KNV----IY--YD--------DDVVLVRDMF--------PK---SKMHLLLMT-RD---------PH..
YHIT_HELPY/9-104-----------CSK----IL--EN--------ERFLSFYDIN--------PK---AKVHALVIP-KQ---------.S..
HNT1_YEAST/32-125-----------SFK----LI--ET--------KYSYAFLDIQ--------PT---AEGHALIIP-KY---------.H..
Q9A2A9_CAUCR/9-106-----------SHA----VI--DL--------PLCEVRLQDD--------AR---YPWLVLLPR-QP---------.G..
YHIT_SYNY3/12-109-----------AAI----VY--ED--------DLCLAFKDVN--------PQ---APVHVLLIP-KK---------.P..
Y1390_SYNE7/12-109-----------ADI----VY--ED--------DLCLAFRDVA--------PQ---APVHILVIP-KQ---------.P..
YHI1_MYCLE/10-102-----------GRF----VY--ED--------DDVVAFLTIE--------PM---TQGHTLVVP-CA---------.E..
Y961_HAEIN/12-110-----------ANI----VY--QD--------ELVTAFRDIS--------PQ---AKTHILIIP-NK---------.V..
Q9JYE4_NEIMB/10-102-----------DVL----LQ--TP--------NLRVIAVHND--------SG---SPAFCRVIW-RK---------.H..
Q9KQC5_VIBCH/14-106-----------TDV----IG--HF--------PLCVALLHKD--------SA---VPWVILVPQ-RA---------.D..
ZB14_MAIZE/24-123-----------STV----VY--ED--------EKVLAFRDIN--------PQ---APTHILIIP-KV---------.KDG
HINT_CAEEL/28-125-----------AKI----IF--ED--------DEALAFHDVS--------PQ---APIHFLVIP-KR---------.R..
G8AG53_AZOBR/16-114-----------CKK----VL--ET--------EHALAFHDIN--------PQ---APTHILVIP-KG---------.A..
K7XM15_MYCHR/14-110-----------ATI----LY--ED--------DKVIAFLDKY--------AH---TKGHFLVVP-KN---------.Y..
YHI2_MYCTU/11-106-----------AIR----IY--ED--------GGYLAILDIR--------PF---TRGHTLVLP-KR---------.H..
Q32EW3_SHIDS/12-109-----------SDI----VY--QD--------DLVTAFRDIS--------PQ---APTHILIIP-NI---------.L..

PF04677

C3H64_ARATH/370-491-----------SHL----IVSVGE--------SFYCALPK.GSL...........VEDHILIIP-IE----------H--
C19L1_CAEEL/309-429-----------KHL----VVAIGN--------KCYAAMPK.GPL...........TEDHVMVLS-VG----------H--
C19L2_CAEEL/226-350-----------KHN----IIAVGI--------NTYLAVVEWDGL...........DDEHLIIVP-TQ----------H--
C19L2_DROME/460-584-----------KQL----LVSLGD--------KIYLSLPWYMGL...........QSGHCILTT-LQ----------H--
CWF19_SCHPO/399-523-----------LAP----VISLSH--------RAYVSLPTQPEL...........AKYHCLIVP-TG----------H--
DRN1_YEAST/256-389-----------DHM----IISIGK--------LVYLTTAK.GPLSVPK...GDMDISGHCLIIP-IE----------H--
MU161_SCHPO/334-470-----------LHL----IVAIGN--------EAYMALPK.GPLTTTASNTPALASSGHVLIIP-IA----------H--
Q93ZX4_ARATH/458-582-----------KHL----VVSIAN--------FTYLMLPQHQPL...........VQGHCCILP-MQ----------H--

PF02611

CDH_HELPY/24-243-----------CIE--------VKPD......AGYVVLKDIN-------------GPLQYLLMPTTH-------------
Q8P9Z9_XANCP/30-250-----------CAA--------VWPD....PQRQAVVLKDNH-------------GRFQYLLVPSVR-------------
E8V0N7_TERSS/35-269-----------CVS--------VDLA..RGEAAGFVVFKDKQ-------------GNTQYLVMPTAK-------------
A8GL49_SERP5/45-264-----------CAQ--------VDPQ......AGFVVFKDRN-------------GPLQYLLMPSAK-------------
E0SJ94_DICD3/33-253-----------CLE--------VNLQ......GHYALFKDRR-------------GPYHDLLIPTDR-------------
CDH_YERPE/33-252-----------CAE--------VNIP......AGFAVLKDRN-------------GPLQYLLIPTVP-------------
B8IMH8_METNO/37-256-----------CLA--------VDLG..DKDRPGTAVLRAPG-------------QATHVVVMPTER-------------
W0LHA3_9ENTR/26-254-----------CQQ--------IYMPPGQGKEQGFSVIQNPR-------------YPYHFILVPTAP-------------
B1M455_METRJ/29-249-----------CLS--------VDLG..DGTRPGSAVLRAPG-------------EPTHSVVMPTDT-------------
Q1LBK3_CUPMC/33-250-----------CVI--------VDRQ......RGFVLYKDMI-------------GASHYLVIPVRP-------------
Q6MQF2_BDEBA/30-256-----------CIE--------VNIA..QGEEKGYVVFKDRV-------------GDLQYLLMPTEK-------------
G8MBN7_9BURK/67-288-----------CAD--------VNLA......GGYAVLKDLV-------------GIAQYLLIPTAR-------------
A6TFQ8_KLEP7/24-243-----------CAE--------VNLK......GGYVLFKDRN-------------GPLQYLLMPTYR-------------
H2INV4_RAHAC/31-250-----------CAQ--------VDEQ......QGFVVLKDLN-------------GPLQYLLMPTAR-------------
B0U7T2_METS4/29-248-----------CLS--------VDLG..DGARPGTAVLRAPG-------------QRTHLVVMPTAS-------------
B2VF57_ERWT9/34-251-----------CRQ--------VNIA......NGYVVMKDRN-------------GPLQFLLIPVAK-------------
B9JRW8_AGRVS/27-242-----------CVH--------VNAG......EHYALLKDQR-------------GVAQHLLIPTDK-------------
D8IW24_HERSS/34-253-----------CAM--------VDLA......RGFVILKDLV-------------GPAQYLLMPTRR-------------
C5BB31_EDWI9/31-247-----------CAY--------LDRS......QGYALFKDRR-------------GALQYLLLPTVR-------------
A9HJU4_GLUDA/35-256-----------CAA--------VDTD......RGYAVLKDRR-------------GLAQYLVIATDR-------------
B2JLJ5_BURP8/29-246-----------CTS--------VDLQ......KRYAILKDIN-------------GNTQFLLIPTDR-------------
B1LSY8_METRJ/26-246-----------CLA--------VDLG..DAARPGTAVLRAPG-------------QPTHTVVMPTDS-------------
L0IYV5_MYCSM/29-248-----------CAR--------VDIG..AGEQRGSAVLKDLV-------------GATQFLLIPTER-------------
B8IPC5_METNO/27-247-----------CVL--------VKAG..DRTDPGYVLVRPPG-------------ARSHVLVVPTTP-------------
B2FII5_STRMK/27-247-----------CLR--------VETA....ADRRDVLVKDAH-------------GDYQFLLMPLDK-------------
CDH_CROS8/31-250-----------CAQ--------VNLP......AGYVVLKDIN-------------GPLQYLLMPTWK-------------
B8EQB5_METSB/40-259-----------CAR--------INLK..NGEADGWAVLKDIV-------------GRTQFLLIPTRR-------------
B2HIW3_MYCMM/43-260-----------CTL--------VDES......SGIALYKADG-------------DPYQFLLLPLAR-------------
W0HRX4_9ENTR/35-254-----------CSE--------VNTA......AGYVVLKDLV-------------GPLQFLLMPTEK-------------
E6WAG7_PANSA/33-250-----------CQQ--------VNVA......QGYVTLKDLN-------------GPLQYLLMPIEK-------------
B1M8V7_METRJ/69-294-----------CSL--------VDLA..GGVEKGYAILKDLR-------------GRAQFLLIPTAR-------------
D8MKK8_ERWBE/33-250-----------CRQ--------VDLR......NGYVVLKDRV-------------GPLQFLLMPVEK-------------
Q6D6W9_PECAS/32-251-----------CLG--------VNLA......EGYVLFDDRN-------------GPYHDLLLPTDK-------------
D2UA62_XANAP/30-247-----------FRA--------MDLA......QDYALLQDRD-------------GRAHVVLVPTRR-------------
CDH_MYCLE/38-255-----------CTL--------VDEQ......AGTALFKANY-------------DPNQYLLLPLAR-------------
Q13LU5_BURXL/41-259-----------CTS--------VDLD......KRYAILKDIV-------------GRSQHLLIPTDR-------------
Q7NQ26_CHRVO/27-251-----------CAE--------VALQ......RGVAVLKDRN-------------GPLQYLLIPTDK-------------
K7SS21_GLUOY/32-232-----------CAV--------YDPQ......DGYALLKDLY-------------GHGQYLLIPTKK-------------
Q0JZ98_CUPNH/25-246-----------CAQ--------VDRS......QGLVLYKDAI-------------GKSHYLVIPART-------------
H8L0L3_FRAAD/32-259-----------CAR--------VSGT..PGAPDSYAVLKDRD-------------GKAQYLLLPMQR-------------
CDH_ECOLI/31-250-----------CAE--------VKPN......AGYVVLKDLN-------------GPLQYLLMPTYR-------------
Q5FPM0_GLUOX/32-232-----------CTV--------YDEK......DGYALLKDKT-------------GRGQYLVIPTQK-------------
W0PFV2_9BURK/44-257-----------CKK--------VDTD......QGYVIFKDKN-------------GPLQYLHMPTQH-------------
I2BEE8_SHIBC/29-247-----------CHS--------VSMA......ENYVTLKDIN-------------GPLQYLLMPVAQ-------------
CDH_MYCTU/41-258-----------CTF--------VDEQ......SGTALYKADF-------------DPYQFLLIPLAR-------------
U3U143_9ENTR/33-250-----------CQQ--------VNLA......QGYVTLKDLN-------------GPLQYLLMPIAK-------------

PF02744

GAL7_CRYNJ/204-373-----------DYA----L.......REVKARERVVTLHESGWVAVVPYWAA---WPFEILLMPYKR----------H--
GAL7_HAEIN/183-348-----------DYV----K.......RELALKERIVVETEH.WIALVPYWAI---WPFETLLLP.KT----------H--
GALT_STRMU/231-435-----------NHY----QGGRHIFPMEIAELDSVFRFKD..FPDVTAGIVK---WPMSVIRLR.GA----------N--
GALT_BACSU/240-451-----------DHF----QGGAHDFPMARAEAEDVYELND..YPGVSLGLVK---WPMSVLRLQ.GD----------E--
GAL7_YEAST/198-366-----------DYV----K.......LESREKSRVVVENES.FIVVVPYWAI---WPFETLVIS.KK----------K--
GAL7_KLULA/195-363-----------DYV----N.......LELREKERIVCENDS.FLVVVPYWAV---WPFETMVLS.KR----------R--
GAL7_ECOLI/182-347-----------DYV----Q.......RELADGSRTVVETEH.WLAVVPYWAA---WPFETLLLP.KA----------H--
GALT_HUMAN/202-370-----------EYS----R.......QELLRKERLVLTSEH.WLVLVPFWAT---WPYQTLLLP.RR----------H--

PF16285

C0ZAZ1_BREBN/8-252-----------MNK----FPV--LEDTHQ-TVLI-ETDECQG--------------DWSVYSKEHVR-------------
B2TPI8_CLOBB/11-256-----------KNK----FPT--LRDTLQ-LVVI-ETYDCEL--------------NMGNYDSEYMK-------------
C9LU44_SELS3/8-252-----------KNK----YNV--IEDADQ-FVLI-ESKVCHS--------------DMPDYSAEHMH-------------
D9SRU9_CLOC7/9-253-----------KNK----YTT--FEDAFQ-TLII-ETDSCRE--------------NISTYSEEHMR-------------
Q81VH8_BACAN/8-251-----------KNK----FPT--LKDTFQ-TVLI-ETDNCED--------------HIATYTEEHMR-------------
U5LFA6_9BACI/8-252-----------KNK----FPV--LENTLQ-TVLI-ESDECSG--------------DISTYSLEHLE-------------

PF01087

GAL7_CRYNJ/15-198...........SLR----..P--WNGQKE-TPAI-PVETPHD--------......SKCYLCPGNKR-------------
Q7QA38_ANOGA/1-174...........MKR----..P--WSGQEE-NPQP-ENLPSFD--------......PTNPLCPGVTR-------------
A5DRG5_PICGU/6-197...........AKR----..P--WQGAKE-EVRK-IALPEFD--------......PKCYLCPSNIR-------------
Q9CM11_PASMU/4-178...........AKR----..P--WQGQQE-KVAE-DEKPSYD--------......PTCYLCPSNKR-------------
Q2H1V5_CHAGB/2-211...........TKR----..P--WQGQQE-APSK-NVLPEYD--------......PKCYLCPGNQR-------------
A4AQM0_MARSH/1-176...........TKR----..P--WQGKTE-KASL-DSKPKYD--------......PKCYLCPTNGR-------------
Q65CW7_BACLD/17-231...........LEK----LAA--YAVEHG-VI.T-DDLDAKD--------ML.AANVMNCFVARPSV-------------
A9WJH8_CHLAA/4-191...........TQR----..P--WLGQVE-TLPP-AELPSYD--------......PACYLCPGNTR-------------
A7MIY8_CROS8/2-176...........AKR----..P--WQGAQE-TPAK-QTLPQHD--------......PDCFLCPGNTR-------------
Q03XA5_LEUMM/18-235...........LDQ----LTA--VAEKNG-TL.A-LRQMNTD--------ML.GAQLMNFIVPRPSQ-------------
A3N102_ACTP2/3-177...........AKR----..P--WQGQQE-ETVA-DNKPSYD--------......PTCYLCPGNKR-------------
GALT_STRMU/16-225...........KDE----LVD--LAVVNG-KV.G-DLAEEKD--------CL.GAELMNFITPIPSQ-------------
A5DWA9_LODEL/21-211...........AKR----..P--WQGAKE-DVKK-TQLPEYD--------......PKCYLCPGNIR-------------
Q6D2C5_PECAS/1-175...........AKR----..P--WQGQQD-EPDR-ATPPPYD--------......PTCYLCAGNKR-------------
Q1IQZ6_KORVE/1-177...........TQR----..P--WQGQVE-KAPR-PAALEYD--------......PECYLCPGNAR-------------
Q6LQE3_PHOPR/15-189...........AKR----..P--WQGADE-TPEQ-AVDTQYD--------......SGCFLCPTNTR-------------
A8LEI8_FRASN/19-211...........DRR----..P--WSGESQ-AVSP-VAVARHD--------......PECGLCPGNLR-------------
Q59VY3_CANAL/21-210...........AKR----..P--WQGAKE-EIKK-SALPEYD--------......PKCYLCPGNIR-------------
A1L2D1_DANRE/7-181...........MKR----..P--WKGQVE-KPPE-DNIPRHD--------......PNNPLCPGSVR-------------
A7F8S7_SCLS1/1-208...........TKR----..P--WQGQQE-AASK-ITLPEYD--------......PACYLCPGNKR-------------
Q3XZ93_ENTFC/18-230...........LDQ----LVA--KARENG-VL.S-ELPAEQE--------IF.EAQLMDFLTPPPSV-------------
B1YII0_EXIS2/18-230...........LEE----MIE--QQITAG-KL.A-PRLDEKE--------RL.AAELMDVFVDRPSQ-------------
Q0RE52_FRAAA/14-191...........VRR----..P--WHGGRE-TAAT-PPAVAYD--------......PACHLCPGNER-------------
Q21LR9_SACD2/5-180...........SKR----..P--WQGQQE-PPST-DTPPSHD--------......PDCYLCAGNKR-------------
GALT_STACT/19-233...........AQF----WIQ--QMLNNG-LL.E-DVVYQKE--------IV.ETKLLDLITPKPST-------------
GALT_LACPL/16-224...........TDA----LVK--TAIQNG-KI.E-ATQSDED--------IL.ADQLMDLVTPLPSV-------------
A8WVF3_CAEBR/2-179...........INR----..P--WQGAKT-EKSG-SSEKNPD--------DVTSSITTNPLAPGGVR-------------
A2AMS2_MOUSE/3-177...........MKR----..P--WQGQVE-PQLL-KTVPRHD--------......PLNPLCPGATR-------------
GAL7_NEUCR/2-217...........TKR----..P--WQGQQE-APAL-NKLPEYD--------......PQCYLCPGNKR-------------
A7TJY6_VANPO/4-190...........AKR----..P--WLGQQE-TVGK-PNIPEYD--------......VNCYLCPGNKR-------------
A6RBX1_AJECN/45-253...........TKR----..P--WQGQQE-APSK-TELPVYD--------......PACYLCPGNKR-------------
GAL7_KLULA/1-189...........AKR----..P--WLGQQE-KPGR-NDAPDHD--------......DKCYLCPGTTR-------------
Q5KY03_GEOKA/19-233...........LDA----MID--WAYEQG-LLET-NTTTERD--------IW.DARLMDCVMPRPSE-------------
Q03PB0_LACBA/18-226...........VNA----LVQ--AAIDHG-QI.E-DAPSPKD--------IL.EAQLMDLMTPLPSA-------------
A2QCH5_ASPNC/2-209...........TKR----..P--WQGQQE-SPSK-TTLPTYD--------......PACYLCPGNKR-------------
A6WF46_KINRD/10-216...........NDR----..T--L.....-....-..MPPPD--------.....Q..DPLAPTVPG-------------
Q2J7D6_FRASC/3-201...........TRR----..P--WHGGQE-PPPV-PAAVAHD--------......PLCDLCPGNLR-------------
A3QFA6_SHELP/9-182...........SKR----..P--WQGQTE-ALDL-TTAPSYD--------......SECFLCPGNKR-------------
GALT_BACHD/21-236...........LEN----ILD--WAAENG-RLEA-NTVTYRD--------LL.DTKLMGALLGQPSE-------------
Q5WD06_BACSK/20-235...........LAP----ILD--WAADNG-LLEA-NTVTYRD--------LF.DTKLIDALLPRPST-------------
A0QYK5_MYCS2/3-199...........QDR----..T--Y.....-....-..LPAAD--------.....Q..CPLCPGPTG-------------
GALT_LACSS/20-231...........KEA----LVQ--LAVDHQ-RI.Q-DLAAERD--------IL.GAKLMDLVTPLPSA-------------
Q896X9_CLOTE/19-233...........LNN----MLK--YAIDND-II.E-DTGTDKD--------LF.DTRIMGVLTPRASE-------------
GALT_DROME/1-175...........TQR----..P--WSGQQE-KAQK-NELPEFD--------......PTNPLCPGVTR-------------
GAL7_SCHPO/4-195...........AKR----..P--WQGAKE-EIKK-DDTVKYD--------......PTCYLCPGNIR-------------
B8I4V5_CLOCE/19-234...........LER----IVD--YAGEAG-LFDK-DIYACRE--------LF.DTKVMGLMMPRESE-------------
A3LR66_PICST/19-206...........AKR----..P--WQGARE-EIKK-VALPNYD--------......PKCYLCPGNVR-------------
Q7N8Y8_PHOLL/4-178...........VKR----..P--WHGQDE-QPLI-DNIPNYD--------......EQCFLCPSNTR-------------
Q73SK2_MYCPA/2-203...........QDR----..T--Y.....-....-..KPPPD--------.....A..CPLCPGPTG-------------
A8FIP9_BACP2/20-233...........LMP----MLD--WAVETG-LIPE-GTDTYRD--------LL.DAKIMGCLVAPPSV-------------
Q3IH81_PSEHT/3-176...........AKR----..P--WQGQVE-TLDE-DVRESHD--------......ESCFLCAGNTR-------------
A0M3B7_GRAFK/1-176...........TKR----..P--WQGKTE-ETKV-IKKETHD--------......ASCYLCPGNTR-------------
A5FKW9_FLAJ1/2-179...........AKR----..P--WQGQNE-VISA-ETLPKHD--------......PDCYLCPGNVR-------------
A0A0D1E3L7_USTMA/31-214...........TKR----..P--WQGQEE-KPQG-TSLPAYD--------......EKCYLCPGNTR-------------
Q15Y61_PSEA6/2-176...........AKR----..P--WQGQVE-KPQQ-NDSAAHD--------......PSCYLCAGNTR-------------
Q6C0K3_YARLI/1-190...........AKR----..P--WQGQQE-EPTK-DTKPEYD--------......DKCYLCPRNAR-------------
Q6BVI6_DEBHA/3-194...........AKR----..P--WQGAKE-ELKK-SDLPSFD--------......PKCYLCPGNIR-------------
Q2GAY3_NOVAD/2-175...........AKR----..P--WQGETG-DPAP-TGGPSHD--------......PGCYLCPGNAR-------------
GALT_CLOAB/17-229...........LNQ----LLA--YAVKEN-LI.N-DTVAERD--------LF.DTKIMNCVMPRPSE-------------
GALT_ENTFA/20-232...........VEH----LLN--IAQANH-QI.D-DSITEAE--------QL.EAELMDFITPTPTI-------------
Q30V51_DESAG/2-182...........AMR----..P--WQGQQD-APDT-TVMPAYD--------......PQCYLCPGNLR-------------
A9KN46_CLOPH/31-257LETKVEDLEEILKV----LLD--YACEQK-LI.E-DSITYRD--------LY.DTKLMDCFTPYPRE-------------
GALT_LACS1/18-228...........KNE----LVE--YAVQHG-KV.G-ETLNEQD--------CL.GAELMNFITPLPSK-------------
A0KQH7_AERHH/2-174...........AKR----..P--WQGQVE-KVSQ-APSQAHD--------......PDCFLCAGNKR-------------
A4VT89_STRSY/18-226...........KDE----LLA--HGVRTG-FV.G-ELLEEQD--------MV.GSCLMDLMTPSPSQ-------------
A5VME1_LACRD/16-220...........VNQ----LVD--LAVKRG-KI.D-DGQTAKE--------IL.NDQLYDLMTPTPSV-------------
E7KK61_YEASL/5-192...........AKR----..P--WLGQQE-AAYK-PTAPLYD--------......PKCYLCPGNKR-------------
G0RTP4_HYPJQ/7-208...........TKR----..P--WQGQQE-GAAV-TTLPEYD--------......PKCYLCPGNSR-------------
Q04GZ3_OENOB/18-225...........TAL----.IE--TAIRNG-KI.E-NSLSDRD--------IL.DAELMDLLTPLPSV-------------
Q5KLY2_CRYNJ/11-195...........TKR----..P--WKGQTE-EPVL-TTLPEYE--------......ATCNLCPGNER-------------
GALT_STRT2/18-226...........KDQ----LLQ--AGVKAG-SV.G-ELNEEQD--------II.GAQLMDLITPRPSV-------------
Q5NEY1_FRATT/11-180...........LNR----..P--WQGQSE-ETQK-NTLPEYD--------......DKCYLCPTNIR-------------
Q7MBX0_VIBVY/28-200...........AKR----..P--WQGQQE-TLNV-ESLPSYE--------......KTCFLCPTNTR-------------
GALT2_STRR6/16-224...........KDQ----LVE--ETVRLE-TI.E-DSQTARE--------IL.GTELMDLVTPCPSQ-------------
GALT1_STRR6/18-225...........KDY----LVE--IALKNG-KI.K-DLIEEKE--------CL.GAELMNFIVPLPSR-------------
GALT_CLOPE/21-230...........LNE----LIN--IAIEKK-II.E-NALYSKD--------IF.SSDIMNIFLPTPSL-------------
GALT_LACLA/19-228...........MDQ----LLA--IANENN-VIEK-GQDEFYE--------....AALMNFITPRPSK-------------
U5L509_9BACI/19-230...........LED----LVG--FAAAEG-RI.A-GLESDKD--------IL.SSKIMDVLVPKPSS-------------

PF16268

F5XH95_MICPN/8-422-----------ANR------P..ISHAAA.SSHP.LVGDDAD--------RLCSFCPKRYLETTPEK-------------
C3PH27_CORA7/1-419-----------GNR------P..LSHPAK.DPQP.LGPDALT--------HSCAFCSGRMLDTPPEK-------------
B1VH78_CORU7/18-447-----------GHR------P..MEPYQL.AKDP.IA..DRD--------RASDFGIARKLDTPPEK-------------
Q8NNU9_CORGL/1-424-----------GNR------P..LSHPAS.TIVE.LSAHDHT--------SYCAFCSDNMLSTPPEK-------------
W5WQ34_9CORY/18-447-----------GNR------P..IAEHRS.GVEP.IG..DRD--------ATTAFGLKRKLDTPPEK-------------
W5Y1J6_9CORY/15-448-----------GNR------P..ISRPAV.SVEK.LEKGDAA--------SYCAFCADRHLETPPEK-------------
G0HAG7_CORVD/18-449-----------AHR------P..VPHHGP.AAFA.ITEDNRD--------TQTDFGIGNKLKTTPEK-------------
U3GXR8_9CORY/26-464-----------GNR------P..LGITRP.NPQP.LTPSAHT--------STCAFCSDNYLQTPPEK-------------
Q6NGG7_CORDI/11-432-----------GHR------P..LSTSQG.NITP.ITPSDHS--------NTCAFCSDRYLDTPPEK-------------
S5SVS2_9CORY/15-437-----------GQR------P..LSVPIP.NPAP.LGPGATT--------HTCAFCSGRPLDTPPEK-------------
B3QVF6_CHLT3/10-436-----------GNK------P..LANEIP.ETAKELPYKEKE--------DYCSFCESRYYETPPEK-------------
Q6A5P1_PROAC/10-435-----------GAR------P..LGKPAE.QTRE.LADHDRR--------AACVFCPDNYLSTPPEK-------------
Q8FP08_COREF/15-438-----------GNR------P..LSRPAP.DPVP.LSPEDHT--------SYCAFCPDNQLSTPPEK-------------
F8E0G1_CORRG/18-447-----------ANR------P..IAEHRP.EAND.IA..DRD--------ATTAFGLKRKLETPPEK-------------
C5CBF5_MICLC/33-463-----------GHR------P..LGLVRP.APQP.LDPAQHG--------RHCAFCEHRLLETPPEK-------------
I6XY80_PROPF/27-452-----------GNR------P..LGLQRP.EPRP.IDETAHG--------THCAFCERRYLETPPEK-------------
R5PXK8_9PROT/14-442-----------GNR------PNVKKDKAP.ETAP.VTPKEIE--------DYCHFCPKNYLKTPPEK-------------
D7BLX6_ARCHD/14-437-----------ANR------P..IEITHT.DVRP.IDPNRLG--------HSCAFCTQRILETPPEK-------------
D9QB86_CORP2/15-442-----------ANR------P..LTHLPA.DIHK.LTYQDHV--------STCAFCSDRQIETPPEK-------------
X5DSS5_9CORY/40-471-----------GHR------P..VRERPE.DVFD.ITDDNRD--------NQTDFGIADLLRTTPEK-------------
M1P829_9CORY/11-432-----------GNR------P..LSRPAT.DPTP.LGKHDFT--------HRCAFCEATPLATPPEK-------------
D7GCR7_PROFC/13-438-----------GNR------P..LATPVN.DPRA.LSADDFG--------HSCAFCADRMAETPPEK-------------
D7WEZ1_9CORY/10-431-----------GNR------P..LAVPKQ.EPHS.LEPHDFT--------DSCNFCADRKLKTPPEK-------------
C8XCI8_NAKMY/35-455-----------ARR------P..LRAPEPATTAP.LTDELRT--------GACAFCPEHYRQTPPEK-------------
C4LIB0_CORK4/15-440-----------GNR------P..ISHPTP.EEHP.VTVHDRD--------YECAFCSARYRETPPEK-------------
K7RWS7_PROA4/29-464-----------GSR------P..LNRPIP.NPRP.ITDADRV--------AACAFCQNRTLETPPEK-------------
D6ZJH6_MOBCV/17-441-----------GNR------PHFHREVVT.EPAPLLQPSDFT--------NTCAFCTDRYFDTPPEK-------------

PF11969

Q5TVU2_ANOGA/17-126I---------NTL-------------------------------HE......L.....T-------ID.DVA--------
A5DAJ7_PICGU/3-137I---------THK-------------------------------HP......FDVFKNN-------PT.LYD--------
A5DAR3_PICGU/136-257I---------TCV-------------------------------RD......L.....N-------GT.HID--------
Q297L1_DROPS/153-272I---------KSL-------------------------------RD......L.....N-------GS.HLP--------
Q29LN6_DROPS/45-159F---------DSF-------------------------------NA......L.....N-------KS.HIG--------
HINT3_RAT/40-155I---------GSC-------------------------------KD......L.....N-------KD.HIE--------
A0EGQ1_PARTE/118-231I---------KSL-------------------------------RD......L.....N-------QD.HVA--------
A1CEC1_ASPCL/149-272I---------WSL-------------------------------RD......L.....K-------KK.HVP--------
A3DF72_CLOTH/3-110I---------ANV-------------------------------KE......I.....N-------ES.NAQ--------
A3LWH2_PICST/136-257I---------SSV-------------------------------RD......L.....N-------SS.HIE--------
A4S248_OSTLU/99-229F---------KSL-------------------------------RD......A.....R-------AE.HLP--------
APTX_DROME/4-113I---------PSI-------------------------------FH......L.....N-------RS.HLS--------
APTX_DROME/229-339F---------RDI-------------------------------TQ......L.....T-------EA.QLP--------
A4XKP5_CALS8/3-110I---------ESL-------------------------------NH......L.....D-------NS.HKE--------
A5D7U9_BOVIN/174-293I---------KSL-------------------------------RD......L.....T-------AE.HLP--------
A5E770_LODEL/177-298I---------ASI-------------------------------RD......L.....R-------GEDHLT--------
A5GQU3_SYNR3/125-230I---------PSL-------------------------------KE......A.....Q-------PS.DSA--------
A5I635_CLOBH/3-110I---------SSL-------------------------------NE......L.....T-------EE.NSK--------
A6QUC5_AJECN/141-262I---------WSL-------------------------------RD......L.....K-------KK.HIP--------
A6VZM3_MARMS/2-109I---------STL-------------------------------ND......L.....T-------DE.DAP--------
A7HMY4_FERNB/3-108I---------ATI-------------------------------ND......L.....S-------EE.DSK--------
A7S614_NEMVE/151-270I---------KSL-------------------------------RD......L.....N-------EE.HIP--------
A7SFV5_NEMVE/10-122Y---------GNP-------------------------------KS......L.....T-------GD.DLP--------
A7TKH2_VANPO/142-261I---------LSL-------------------------------RD......I.....N-------KN.HYE--------
A7TQ97_VANPO/171-297L---------TSV-------------------------------RD......L.....K-------PS.DRD--------
YHIT_CHLTR/2-108I---------EKL-------------------------------QD......I.....Q-------GD.DFL--------
APTX_CHICK/142-252I---------SSL-------------------------------KS......V.....T-------RE.HLG--------
APTX_DANRE/150-260I---------SSL-------------------------------KA......L.....R-------SE.HVE--------
APTX_XENTR/173-283I---------ANL-------------------------------KV......L.....R-------AE.HLE--------
APTX_CIOIN/206-317I---------SST-------------------------------KN......L.....S-------TD.NIE--------
Q0U2I6_PHANO/148-269I---------WSV-------------------------------RD......L.....K-------KG.NVE--------
Q15X15_PSEA6/3-110I---------ATI-------------------------------ND......I.....E-------KE.DRE--------
Q16F07_AEDAE/8-123I---------DNV-------------------------------YEFSSLLQL.....I-------PV.HIP--------
Q16XY1_AEDAE/224-343I---------KSL-------------------------------RD......L.....T-------AA.HLP--------
Q16YN6_AEDAE/11-125L---------DDV-------------------------------RS......L.....T-------EA.ERP--------
Q18227_CAEEL/10-129I---------AKP-------------------------------TD......L.....T-------VA.DVP--------
Q1CY35_MYXXD/3-112I---------PTV-------------------------------ND......I.....T-------TE.DRE--------
Q1QZ40_CHRSD/2-109I---------ATL-------------------------------ND......I.....T-------PE.DLT--------
HINT3_XENTR/18-132V---------GTC-------------------------------KT......L.....T-------KD.HVQ--------
Q2H2H7_CHAGB/31-147I---------KEI-------------------------------AN......L.....T-------TE.HLP--------
Q2H304_CHAGB/151-275L---------WSL-------------------------------RD......L.....R-------KK.HIP--------
HINT3_BOVIN/47-162F---------ENC-------------------------------KY......L.....K-------KD.QIE--------
Q3IJU5_PSEHT/4-111I---------ATI-------------------------------ND......V.....T-------PE.NSH--------
A0A0D1DZS3_USTMA/46-158I---------ANV-------------------------------QS......L.....T-------HN.HTE--------
Q54DF5_DICDI/36-141I---------VSI-------------------------------KT......L.....T-------QK.DIP--------
Y2839_DICDI/224-348I---------NTL-------------------------------DE......L.....T-------PS.FIP--------
Q59S51_CANAL/134-254I---------SCV-------------------------------RD......L.....N-------DS.HID--------
Q5TUI6_ANOGA/154-273I---------RSL-------------------------------RD......L.....T-------AA.DLP--------
A8XGQ1_CAEBR/148-267L---------KSV-------------------------------RD......L.....T-------GD.DLE--------
Q6BZT0_YARLI/136-263I---------TSI-------------------------------RD......L.....N-------HS.HIQ--------
Q6C515_YARLI/4-127K---------PDT-------------------------------HP......LKA.FED-------DN.LYE--------
Q6C6M8_YARLI/30-153V---------HSL-------------------------------RD......L.....V-------PD.HVD--------
Q6CJA1_KLULA/160-286I---------KSL-------------------------------RD......L.....R-------PE.HQQ--------
Q6FLB9_CANGA/198-323I---------KSL-------------------------------RD......L.....N-------SS.HQE--------
Q6FWT2_CANGA/170-296I---------RSL-------------------------------RD......L.....K-------ME.DRD--------
Q6IIA4_DROME/5-118Y---------ASL-------------------------------KD......L.....N-------KS.HDS--------
Q74ZD1_ASHGO/153-277V---------RSL-------------------------------RD......L.....R-------PE.HKE--------
Q7PHF8_ANOGA/7-116I---------DSV-------------------------------YD......L.....S-------SD.DDG--------
Q7QJM2_ANOGA/10-124L---------ENV-------------------------------NS......L.....T-------AA.DKP--------
Q83DE2_COXBU/3-109I---------ETI-------------------------------ND......V.....T-------PG.DED--------
Q84VV6_ARATH/7-121I---------PTV-------------------------------ND......LQ...RR-------DE.DYS--------
Q8GYJ9_ARATH/75-183L---------TSL-------------------------------GK......A.....E-------PR.HVE--------
Q8SUA2_ENCCU/116-232L---------KTI-------------------------------RD......I.....R-------...DYQ--------
Q97JJ3_CLOAB/3-110I---------SSL-------------------------------ND......I.....N-------EE.NSK--------
BH140_ARATH/717-833L---------DGL-------------------------------ED......V.....R-------KE.NLQ--------
DCPS_SCHPO/141-261I---------ASI-------------------------------RD......L.....K-------YK.HIP--------
E7KRX8_YEASL/160-281I---------KTI-------------------------------RD......L.....R-------YS.DRQ--------
E7KUH0_YEASL/160-281I---------KSL-------------------------------RD......L.....N-------PN.HRD--------
F1R776_DANRE/159-276I---------KSL-------------------------------RD......L.....T-------AE.HLT--------
F7CC42_XENTR/161-276I---------RSL-------------------------------RD......L.....N-------AD.HLP--------
H3C365_TETNG/54-161I---------DNC-------------------------------RM......L.....Q-------TQ.HIP--------
H3CJX6_TETNG/127-244I---------KSL-------------------------------RG......L.....T-------SE.HLP--------
H3DP42_TETNG/31-141V---------GNC-------------------------------KS......L.....S-------KE.HVP--------
Q0JBF2_ORYSJ/25-136I---------PTV-------------------------------NN......LQ...RT-------TE.DHQ--------
Q5K774_CRYNJ/143-255I---------KSL-------------------------------RD......L.....K-------VS.HIS--------
Q9VQ59_DROME/32-141F---------DSL-------------------------------KA......L.....N-------KS.HVG--------

PF01230

HINT1_RAT/24-121I---------SQI-------------------------------SV------A-----DD....DDES-LLG--------
HNT2_YEAST/12-107V---------LNL-------------------------------SD------L-----T.......MP-ESQ--------
FHIT_HUMAN/11-105V---------ERF-------------------------------HD------L-----R.......PD-EVA--------
APH1_SCHPO/12-106V---------PRL-------------------------------KD------L-----T.......PS-ELT--------
APTX_YEAST/15-139L---------SRS-------------------------------HP------T-----KVIDAKFKNE-FES--------
Q9I500_PSEAE/74-166V---------TEL-------------------------------FQ------L-----D.......VD-DRQ--------
Q98BM9_RHILO/14-106A---------EEI-------------------------------HD------M-----T.......PL-DQA--------
Y866_METJA/9-105Y---------ERF-------------------------------DE------M-----P.......DD-ELC--------
YHIT_MYCPN/19-116A---------VNY-------------------------------SS------T-----D.......DE-SLK--------
APTX_SCHPO/44-156L---------THV-------------------------------HP------L-----E.........-IMM--------
YHIT_HELPY/9-104I---------QDF-------------------------------NG------I-----T.......PE-LMA--------
HNT1_YEAST/32-125G---------AKL-------------------------------HD------I-----P.......DE-FLT--------
Q9A2A9_CAUCR/9-106L---------REL-------------------------------ED------L-----T.......PA-ERA--------
YHIT_SYNY3/12-109L---------PQL-------------------------------SA------A-----TP....EDHA-LLG--------
Y1390_SYNE7/12-109I---------ANL-------------------------------LE------A-----TA....EHQA-LLG--------
YHI1_MYCLE/10-102I---------DQW-------------------------------QN------V-----D.......PA-IFG--------
Y961_HAEIN/12-110I---------PTV-------------------------------ND------V-----TE....QDEV-ALG--------
Q9JYE4_NEIMB/10-102I---------AEM-------------------------------TD------L-----S.......AA-ERG--------
Q9KQC5_VIBCH/14-106L---------REL-------------------------------HH------L-----P.......MD-EQQ--------
ZB14_MAIZE/24-123L---------TGL-------------------------------AK------A-----EE....RHIE-ILG--------
HINT_CAEEL/28-125I---------DML-------------------------------EN------A-----VD....SDAA-LIG--------
G8AG53_AZOBR/16-114Y---------VDM-------------------------------DD------F-----SAR...ATEA-EIA--------
K7XM15_MYCHR/14-110S---------RNL-------------------------------FS------I-----S.......DE-DLS--------
YHI2_MYCTU/11-106T---------VDL-------------------------------TD------T-----P.......PE-ALA--------
Q32EW3_SHIDS/12-109I---------PTV-------------------------------ND------V-----SA....EHEQ-ALG--------

PF04677

C3H64_ARATH/370-491L---------PNT------------------------------.LV------L-------------SP....--------
C19L1_CAEEL/309-429I---------QSQ------------------------------.VS------A-------------PV....--------
C19L2_CAEEL/226-350C---------SST------------------------------.IQ------L-------------DE....--------
C19L2_DROME/460-584V---------PCC------------------------------.TQ------L-------------DE....--------
CWF19_SCHPO/399-523R---------INT------------------------------.LS------C-------------DE....--------
DRN1_YEAST/256-389I---------PKL------------------------------DPS------K-------------NA....--------
MU161_SCHPO/334-470A---------SAL------------------------------.ST------L-------------SDTSYE--------
Q93ZX4_ARATH/458-582E---------AAS------------------------------.RS------V-------------DD....--------

PF02611

CDH_HELPY/24-243I---------SGI------------------------------ESP------LLLDPST-------PN-FFY--------
Q8P9Z9_XANCP/30-250V---------SGI------------------------------EDP------SLLQADA-------PN-YFA--------
E8V0N7_TERSS/35-269I---------TGI------------------------------EDP------AILEPNA-------TN-YFA--------
A8GL49_SERP5/45-264I---------TGI------------------------------ESP------EVLAATT-------PN-FFE--------
E0SJ94_DICD3/33-253I---------SGI------------------------------ESP------LLLQAGT-------PA-YFA--------
CDH_YERPE/33-252I---------SGI------------------------------ESP------QLLTATS-------PN-YFA--------
B8IMH8_METNO/37-256V---------VGL------------------------------EDP------QLQQRPG-------TA-YWQ--------
W0LHA3_9ENTR/26-254L---------SGI------------------------------ESP------QLLLDGR-------TD-YFG--------
B1M455_METRJ/29-249V---------PGL------------------------------EAP------VLRGPRG-------AA-YWR--------
Q1LBK3_CUPMC/33-250V---------SGV------------------------------DDA------RVWSDRE-------HN-AWA--------
Q6MQF2_BDEBA/30-256I---------TGM------------------------------ESP------EIRAADA-------TN-YFD--------
G8MBN7_9BURK/67-288V---------SGI------------------------------ESP------ELLEPNA-------PN-YFR--------
A6TFQ8_KLEP7/24-243I---------NGT------------------------------ESP------LLLDPLT-------PN-FFW--------
H2INV4_RAHAC/31-250I---------TGM------------------------------ESP------ALLEPST-------PN-FFS--------
B0U7T2_METS4/29-248V---------VGL------------------------------EAP------ELQTSTG-------NA-YWR--------
B2VF57_ERWT9/34-251I---------TGI------------------------------ETQ------KLLNPAT-------PN-FFA--------
B9JRW8_AGRVS/27-242I---------TGI------------------------------ESP------ALLDDKT-------PN-FFA--------
D8IW24_HERSS/34-253L---------TGI------------------------------ESP------ELLEPQA-------PN-YWA--------
C5BB31_EDWI9/31-247S---------SGI------------------------------DDP------QLLNPAT-------PN-YMA--------
A9HJU4_GLUDA/35-256V---------TGI------------------------------EDP------SILSPAA-------PD-YFG--------
B2JLJ5_BURP8/29-246V---------TGI------------------------------ESP------SVLDADA-------PD-YWA--------
B1LSY8_METRJ/26-246V---------SGI------------------------------EAS------VLQGPRG-------AA-YWR--------
L0IYV5_MYCSM/29-248I---------PGI------------------------------ESP------TLLEPDA-------PN-FFA--------
B8IPC5_METNO/27-247I---------IGI------------------------------EAP------ALQSAQG-------FA-YWR--------
B2FII5_STRMK/27-247V---------SGI------------------------------ESR------SLYQRGA-------PN-YFA--------
CDH_CROS8/31-250I---------NGV------------------------------ESP------LLLSDNT-------PN-FFW--------
B8EQB5_METSB/40-259L---------SGM------------------------------EDP------LLGGGEL-------PN-YWI--------
B2HIW3_MYCMM/43-260V---------SGI------------------------------EDQ------ALQEPST-------GK-YLY--------
W0HRX4_9ENTR/35-254I---------SGI------------------------------ESP------RLLSTST-------PN-FFY--------
E6WAG7_PANSA/33-250I---------TGM------------------------------ESP------LLLDPAT-------PN-LFA--------
B1M8V7_METRJ/69-294I---------TGI------------------------------ESP------VLLRPGT-------TN-YFA--------
D8MKK8_ERWBE/33-250I---------TGI------------------------------ESP------ALLNPAT-------PN-FFA--------
Q6D6W9_PECAS/32-251I---------SGI------------------------------ESP------ELLQQNT-------PN-FFM--------
D2UA62_XANAP/30-247I---------VGV------------------------------ESP------LLQRRET-------PN-YFW--------
CDH_MYCLE/38-255V---------TGI------------------------------EDP------ALQELAS-------PN-YLY--------
Q13LU5_BURXL/41-259I---------TGI------------------------------ESP------LVLAPHA-------QD-YWV--------
Q7NQ26_CHRVO/27-251V---------SGI------------------------------ESP------RLLGDGV-------PA-YWR--------
K7SS21_GLUOY/32-232V---------PGI------------------------------EDA------SLLQAET-------PN-YFA--------
Q0JZ98_CUPNH/25-246M---------TGI------------------------------DDA------RAWDGAG-------AN-PWA--------
H8L0L3_FRAAD/32-259T---------SGL------------------------------EAA------SLIKPQA-------HN-FLA--------
CDH_ECOLI/31-250I---------NGT------------------------------ESP------LLTDPST-------PN-FFW--------
Q5FPM0_GLUOX/32-232V---------PGV------------------------------EDP------VLLKPET-------PN-YFA--------
W0PFV2_9BURK/44-257V---------SGL------------------------------EDP------ALLQASR-------TP-YFA--------
I2BEE8_SHIBC/29-247I---------RGI------------------------------ESP------QLLSLDT-------AN-FFW--------
CDH_MYCTU/41-258I---------TGI------------------------------EDP------ALRESAG-------RN-YLY--------
U3U143_9ENTR/33-250I---------TGM------------------------------ESP------ILLEPTT-------PN-LFA--------

PF02744

GAL7_CRYNJ/204-373I---------PSI-------------------------------LQ------LTAE..........EQTGLAT.......
GAL7_HAEIN/183-348V---------KRL-------------------------------TE------LSDE..........QSKDLAV.......
GALT_STRMU/231-435K---------YSL-------------------------------VE------LAEIIRLAWRNYSDDTMNILAFTGDTPH
GALT_BACSU/240-451P---------GHV-------------------------------AE------AADHIFRTWQTYSDEKAGIAAYTGDTPH
GAL7_YEAST/198-366L---------ASI-------------------------------SQ------FNQM..........VKEDLAS.......
GAL7_KLULA/195-363I---------PSL-------------------------------NQ------FTDK..........EREDLAS.......
GAL7_ECOLI/182-347V---------LRI-------------------------------TD------LTDA..........QRSDLAL.......
GALT_HUMAN/202-370V---------RRL-------------------------------PE------LTPA..........ERDDLAS.......

PF16285

C0ZAZ1_BREBN/8-252ALLAFG----VEK-----WL-----------------------EME------QSKSYRS-------VL-FFK--------
B2TPI8_CLOBB/11-256ELISFG----LKH-----WL-----------------------AIE------KSNEYKS-------VI-FYK--------
C9LU44_SELS3/8-252RLIRFG----VHH-----WQ-----------------------KMQ------NSGKYET-------VI-FFK--------
D9SRU9_CLOC7/9-253ELLRFA----VSH-----WL-----------------------DMK------KRDEFKS-------VL-LFK--------
Q81VH8_BACAN/8-251SLIRFS----VKH-----WL-----------------------DLQ------KNEEFKS-------VI-LYK--------
U5LFA6_9BACI/8-252KLLSFG----LKH-----WI-----------------------EME------NSGRFTS-------VL-FFK--------

PF01087

GAL7_CRYNJ/15-198T....T----GQH-----NP-----------------------DY.------.KGIYVF-------EN-DFP--------
Q7QA38_ANOGA/1-174P....N----GTK-----NP-----------------------IY.------.ESTFVF-------TN-DFP--------
A5DRG5_PICGU/6-197A....T----GDT-----NP-----------------------KY.------.ESTFVF-------PN-DYP--------
Q9CM11_PASMU/4-178I....T----GEQ-----NP-----------------------DY.------.QKPFVF-------KN-DFS--------
Q2H1V5_CHAGB/2-211A....Q----GDS-----NP-----------------------QY.------.KNTFTF-------VN-DYS--------
A4AQM0_MARSH/1-176M....G----GAN-----NP-----------------------DY.------.KKPFSF-------VN-DFS--------
Q65CW7_BACLD/17-231I....N----AVF-----QQ-----------------------KY.------EQSPLAA-------TE-YFY--------
A9WJH8_CHLAA/4-191A....N----GVQ-----NP-----------------------PY.------.TETFVF-------EN-DFA--------
A7MIY8_CROS8/2-176V....T----GDK-----NP-----------------------QY.------.TGTYVF-------TN-DFA--------
Q03XA5_LEUMM/18-235V....R----KMF-----WE-----------------------HY.------QQSPRQA-------TD-YFF--------
A3N102_ACTP2/3-177I....T----GEQ-----NP-----------------------VY.------.SKPFVF-------KN-DFS--------
GALT_STRMU/16-225V....N----KAF-----WD-----------------------TN.------AKSPQKA-------IK-DFY--------
A5DWA9_LODEL/21-211A....T----GDV-----NP-----------------------KY.------.SATYVF-------PN-DYP--------
Q6D2C5_PECAS/1-175I....T----GDI-----NP-----------------------QY.------.QSTFVF-------TN-DFS--------
Q1IQZ6_KORVE/1-177A....G----GHR-----NP-----------------------PY.------.ISTFVF-------EN-DYA--------
Q6LQE3_PHOPR/15-189V....S----GDK-----NP-----------------------DY.------.TGTYVF-------NN-DHA--------
A8LEI8_FRASN/19-211AAAGLD----RIR-----NP-----------------------DY.------.AGPYVF-------AN-DFP--------
Q59VY3_CANAL/21-210A....T----GDM-----NP-----------------------KY.------.DATYIF-------PN-DYP--------
A1L2D1_DANRE/7-181A....N----GEL-----NP-----------------------EY.------.DSTFMF-------DN-DFP--------
A7F8S7_SCLS1/1-208A....Q----GDS-----NP-----------------------QY.------.KDTFVF-------VN-DYS--------
Q3XZ93_ENTFC/18-230V....N----AFF-----AQ-----------------------HY.------SKSPEEA-------TE-YFF--------
B1YII0_EXIS2/18-230I....T----STF-----HQ-----------------------LY.------AEHPQQA-------TD-YFY--------
Q0RE52_FRAAA/14-191A....G----GAR-----NP-----------------------DY.------.RGTYVF-------TN-DFP--------
Q21LR9_SACD2/5-180I....T----GEV-----NP-----------------------QY.------.SSTFVF-------TN-DFA--------
GALT_STACT/19-233I....N----REF-----WK-----------------------RY.------ESHPEKA-------TG-YFY--------
GALT_LACPL/16-224L....N----QRF-----WD-----------------------KY.------QVSPQTA-------TD-YFF--------
A8WVF3_CAEBR/2-179S....S----GAK-----NE-----------------------DY.------.LSTFVF-------EN-DFP--------
A2AMS2_MOUSE/3-177A....N----GEV-----NP-----------------------HY.------.DGTFLF-------DN-DFP--------
GAL7_NEUCR/2-217A....Q----GDS-----NP-----------------------HY.------.KNTFAF-------VN-DYS--------
A7TJY6_VANPO/4-190A....T----GNS-----TP-----------------------AY.------.ESTYIF-------QN-DYP--------
A6RBX1_AJECN/45-253A....Q----GDQ-----NP-----------------------QY.------.KNTFIF-------LN-DYS--------
GAL7_KLULA/1-189A....T----GEQ-----NP-----------------------DY.------.ESTYVF-------TN-GYP--------
Q5KY03_GEOKA/19-233V....I----RAF-----YE-----------------------RY.------RRDPQEA-------TD-WFY--------
Q03PB0_LACBA/18-226L....N----RGF-----WD-----------------------RY.------QQSPGAA-------TD-WFY--------
A2QCH5_ASPNC/2-209A....Q----GDT-----NP-----------------------KY.------.EKTFVF-------VN-DYS--------
A6WF46_KINRD/10-216GF..PT----EIA-----DS-----------------------S..------.YDVVAF-------EN-RFP--------
Q2J7D6_FRASC/3-201A....G----GER-----NP-----------------------SY.------.SGTYVF-------TN-DFP--------
A3QFA6_SHELP/9-182I....N----GEQ-----NP-----------------------KY.------.DTTFVF-------QN-DFA--------
GALT_BACHD/21-236T....I----RTF-----YE-----------------------RYE------QQGPEEA-------TK-VFY--------
Q5WD06_BACSK/20-235V....I----DHF-----FR-----------------------MCE------QQGPQAA-------TA-AFY--------
A0QYK5_MYCS2/3-199E...TS----EVP-----AP-----------------------D..------.YDVVVF-------EN-RFP--------
GALT_LACSS/20-231V....N----KRF-----WT-----------------------LY.------EKDPEKA-------LA-YFY--------
Q896X9_CLOTE/19-233I....V----RNF-----YN-----------------------IYH------KKGAKEA-------TN-YFY--------
GALT_DROME/1-175P....N----GIQ-----TP-----------------------EY.------.ESTYVF-------EN-DFP--------
GAL7_SCHPO/4-195A....T----GFE-----NP-----------------------KY.------.ETTYVF-------PN-DYP--------
B8I4V5_CLOCE/19-234I....I----RKF-----TD-----------------------LAE------KQSIKAA-------TD-YFY--------
A3LR66_PICST/19-206A....T----GDV-----NP-----------------------KF.------.EATFVF-------PN-DYP--------
Q7N8Y8_PHOLL/4-178I....S----GDK-----NP-----------------------AY.------.QGAFVF-------NN-DFS--------
Q73SK2_MYCPA/2-203L...TS----EVP-----AA-----------------------D..------.YDVVVF-------EN-RFP--------
A8FIP9_BACP2/20-233I....Y----AKF-----EE-----------------------KRK------QEGPKAA-------TS-WFY--------
Q3IH81_PSEHT/3-176I....N----GEV-----ND-----------------------NY.------.KKTYVF-------TN-DFA--------
A0M3B7_GRAFK/1-176A....S----GDT-----NP-----------------------DY.------.KEPYSF-------IN-DFS--------
A5FKW9_FLAJ1/2-179A....N----GVN-----NP-----------------------AY.------.KNSFVF-------DN-DFA--------
A0A0D1E3L7_USTMA/31-214A....T----GEK-----ND-----------------------DY.------.TSTFFF-------EN-DYA--------
Q15Y61_PSEA6/2-176I....N----GEV-----NP-----------------------EY.------.KDTFVF-------TN-DFA--------
Q6C0K3_YARLI/1-190I....N----GEM-----NP-----------------------DY.------.KDTFVF-------EN-DFS--------
Q6BVI6_DEBHA/3-194A....T----GDS-----NP-----------------------KY.------.ENTYIF-------PN-DYP--------
Q2GAY3_NOVAD/2-175T....S----GER-----NP-----------------------DY.------.PGAFAF-------DN-DFP--------
GALT_CLOAB/17-229V....I----NNF-----NR-----------------------LL.------NNSPKEA-------TS-YYY--------
GALT_ENTFA/20-232I....N----QKF-----MD-----------------------YY.------QESPRKA-------TD-YFY--------
Q30V51_DESAG/2-182T....G----GAR-----NP-----------------------HY.------.SGVFVF-------DN-DFQ--------
A9KN46_CLOPH/31-257V....V----KTF-----NA-----------------------LY.------QKDRVAA-------TD-YYY--------
GALT_LACS1/18-228V....N----QDF-----WQ-----------------------TYQ------QKSPEEA-------IQ-NFY--------
A0KQH7_AERHH/2-174V....T----GDQ-----NP-----------------------YY.------.RDTFVF-------TN-DFA--------
A4VT89_STRSY/18-226V....N----RDF-----WQ-----------------------TY.------QDSPEQA-------IS-DFY--------
A5VME1_LACRD/16-220V....N----HKF-----WE-----------------------KY.------QQSPSTA-------TD-WFY--------
E7KK61_YEASL/5-192A....T----GNL-----NP-----------------------RY.------.ESTYIF-------PN-DYA--------
G0RTP4_HYPJQ/7-208A....A----GDQ-----NP-----------------------NY.------.EQTFAF-------VN-DYS--------
Q04GZ3_OENOB/18-225I....N----ATF-----WN-----------------------LY.------QKSPKTA-------TD-YFY--------
Q5KLY2_CRYNJ/11-195S....N----GNK-----NP-----------------------KY.------.IDTFTF-------EN-DFP--------
GALT_STRT2/18-226V....N----RNF-----WD-----------------------TY.------KSNPEQA-------IA-DFY--------
Q5NEY1_FRATT/11-180A....N----GEV-----NP-----------------------DF.------.KETFVF-------EN-DFS--------
Q7MBX0_VIBVY/28-200I....S----GDV-----NP-----------------------DY.------.QGTFVF-------KN-DFA--------
GALT2_STRR6/16-224V....N----RDF-----WE-----------------------AY.------AYSPEQA-------IE-DFY--------
GALT1_STRR6/18-225L....N----DIF-----WS-----------------------SY.------DISPQEA-------VE-EFY--------
GALT_CLOPE/21-230I....N----KEF-----YK-----------------------RY.------AISPKES-------TD-YFY--------
GALT_LACLA/19-228I....N----QDF-----WE-----------------------KY.------KTSPDAA-------TQ-YFY--------
U5L509_9BACI/19-230V....N----KEF-----YD-----------------------KY.------EESPAKA-------TR-YFY--------

PF16268

F5XH95_MICPN/8-422SRLIGT....GLD.....AR..............IERGRLPARLQQ------GVAAARR-------FA-NLF--------
C3PH27_CORA7/1-419SRILA.....SGE.....................IQRGLLPHELDN------SQPLFRR-------VP-NLF--------
B1VH78_CORU7/18-447ARMVRDI...NGD.....IR..............IDRGVVASKLED------SEPLFRR-------VA-NLY--------
Q8NNU9_CORGL/1-424SRIIIDS...SGD.....FD..............ILPGALPGELSE------TTPEFRR-------VP-NLF--------
W5WQ34_9CORY/18-447SRLIIDE...DGE.....AH..............ILRGLPVSKLED------TTPLFRR-------VA-NLF--------
W5Y1J6_9CORY/15-448ARVIA.....RDV.....AEAA.GIEGEVLTDGYVLATKQLIDQQT------TPVAFRR-------VS-NLF--------
G0HAG7_CORVD/18-449ARLVIDD...NGE.....PR..............ILRGLTVSQLEQ------TDPLFRR-------VA-NLY--------
U3GXR8_9CORY/26-464ARVTIP....SAQ.....ATAT.SSSKAAQTKPRITTHTPARDLFD------SVADFRR-------VA-NLF--------
Q6NGG7_CORDI/11-432ARIVRD....DDG.....WT..............ILRGVLPDRLHD------SVPAFRR-------VS-NLF--------
S5SVS2_9CORY/15-437SRIIRH....EGR.....WR..............TLTDLLPGQYGD------SVAEFRR-------VP-NLF--------
B3QVF6_CHLT3/10-436ARIIKE....NGQ.....YK..............TLQAVPSSKYFE------TQAEFRR-------TP-NLF--------
Q6A5P1_PROAC/10-435TRLVK...................RAGGLVRGHDLIRCVPADRLDA------TVPEFRR-------VP-NLF--------
Q8FP08_COREF/15-438SRMVRTG...KGD.....FE..............VLAGGLPRDLDK------TVAEFRR-------VP-NLF--------
F8E0G1_CORRG/18-447SRLIVDA...DGK.....PR..............ILRGLKPSELEN------TTPLFRR-------VA-NLF--------
C5CBF5_MICLC/33-463SRIVST....RADDGAPAWQ..............ILRHLAAEQLGE------TTPAFRR-------VP-NLF--------
I6XY80_PROPF/27-452ARVVRS....GDE.....WE..............TLMGLPAEKLFT------TTAEFRC-------VP-NLF--------
R5PXK8_9PROT/14-442ARLVKTS...DGE.....FK..............ILKNLMAGQLFD------TTAEFRR-------IP-NLF--------
D7BLX6_ARCHD/14-437ARIVRK....RDD.....AV..............VYRGTNVDML.T------REWEFRR-------IP-NLF--------
D9QB86_CORP2/15-442ARMVQSSVKKNSD.....WE..............ILRGVGAEDLYA------TTAAFRR-------VP-NLF--------
X5DSS5_9CORY/40-471ARMVIDD...NGD.....PR..............ILRGLTVSDLSE------TDPLFRR-------VA-NLY--------
M1P829_9CORY/11-432SRMVRE....DGG.....WR..............TLSGLLPGELAG------HRAEFRR-------VP-NLF--------
D7GCR7_PROFC/13-438ARRVHG....ADG.....WQ..............TLTGVLPEHLHD------TVAEFRR-------IP-NLF--------
D7WEZ1_9CORY/10-431SRIVQR....DGG.....WE..............ILRDLLPHELDD------TQPMFRR-------VP-NLF--------
C8XCI8_NAKMY/35-455ARLVTG....TQG.....ER..............MIRHLRADQLFD------TVADFRR-------IP-NLF--------
C4LIB0_CORK4/15-440ARVVVD....NNK.....WT..............TFYRLKESQLDD------SVAEFRR-------VP-NLF--------
K7RWS7_PROA4/29-464SRLIST....LSD.....GAYGAGDSSEIMRGYRVLRHLPAGEVGS------TTAEFRR-------IP-NLF--------
D6ZJH6_MOBCV/17-441SRLVK.....GLD.....AKFH............KIEGLPAASMQD------MVAEFRR-------IP-NLF--------

PF11969

Q5TVU2_ANOGA/17-126-LLKDMY----------GLAQSVIKEG-G.............----------------..----------------.LDT
A5DAJ7_PICGU/3-137-IIATYV----------EKAKDMIMEE-MQLTQQFASDSPMT----------------NA----------------EYRA
A5DAR3_PICGU/136-257-FLKKLL----------AKLRQVTSEK-Y.S...........----------------..----------------.LAP
Q297L1_DROPS/153-272-LLRNIR----------QSAKDAISKR-Y.G...........----------------..----------------.LNP
Q29LN6_DROPS/45-159-LVLRME----------SGMVELLKSK-N.............----------------..----------------.VDP
HINT3_RAT/40-155-MVESMV----------TVGKTILERN-NFT...........----------------..----------------..DF
A0EGQ1_PARTE/118-231-MLEEMY----------TEGLKIISEK-Y.Q...........----------------..----------------.LES
A1CEC1_ASPCL/149-272-WLRYLR----------QRLLEGTVKM-YPE...........----------------..----------------.LEQ
A3DF72_CLOTH/3-110-ILIDIH----------KAANKVAEDL-GIA...........----------------.E----------------KGYR
A3LWH2_PICST/136-257-YLVNIQ----------KLIKKVATEK-F.A...........----------------..----------------.VQK
A4S248_OSTLU/99-229-LLRAML----------RKGRAVIEDI-Y.G...........----------------..----------------.VNA
APTX_DROME/4-113-LLEELH----------LLARNVV..E-VKG...........----------------..----------------.VRW
APTX_DROME/229-339-LLDHMM----------DLANQIIEKQ-KHL...........----------------..----------------..ES
A4XKP5_CALS8/3-110-LIGHIF----------VVAKELSDRF-GVK...........----------------.E----------------KGFR
A5D7U9_BOVIN/174-293-LLRNIL----------REGQEAILRR-Y.R...........----------------..----------------.VAA
A5E770_LODEL/177-298-WLAGIR----------NKIIDVCKQK-Y.E...........----------------..----------------.LSV
A5GQU3_SYNR3/125-230-LLGHLL----------LVAAKVAKEA-GL............----------------..----------------QDWR
A5I635_CLOBH/3-110-VISHIF----------MVAKKIAKDL-NIS...........----------------.E----------------EGYR
A6QUC5_AJECN/141-262-WLKHMR----------EKVLDGVVNV-YPQ...........----------------..----------------.LDR
A6VZM3_MARMS/2-109-VVGKLQ----------TTAAKIAKQK-GIS...........----------------.N----------------AGYR
A7HMY4_FERNB/3-108-NMWKLF----------EVIKKVTKDQ-NL............----------------..----------------ESYR
A7S614_NEMVE/151-270-LLKNIL----------NKGRDAIRTK-Y.N...........----------------..----------------.VPH
A7SFV5_NEMVE/10-122-LVEKLM----------DVGKKVLVQQ-NA............----------------..----------------..NT
A7TKH2_VANPO/142-261-FLNGIS----------ERIKDIIPKK-YNN...........----------------..----------------EIKS
A7TQ97_VANPO/171-297-WLININ----------NKIRSIVPAC-YNY...........----------------..----------------GVHA
YHIT_CHLTR/2-108-LLAEAG----------KIIQLMARNF-GIE...........----------------..----------------NGYR
APTX_CHICK/142-252-LLEHMH----------AVGQKMI.QQ-CPA...........----------------..----------------.KES
APTX_DANRE/150-260-LLKHMQ----------RVADQMV.EQ-CPD...........----------------..----------------.AHK
APTX_XENTR/173-283-LVQHMH----------AVGQKIA.KE-HSD...........----------------..----------------.SKC
APTX_CIOIN/206-317-LLKHIL----------KVGQELAAEV-KDK...........----------------..----------------.QPD
Q0U2I6_PHANO/148-269-WLKHMK----------IKMVEATCGL-YEG...........----------------..----------------.VER
Q15X15_PSEA6/3-110-VVGHLS----------WVASHILKEH-GLA...........----------------.E----------------QGFR
Q16F07_AEDAE/8-123-LLKEMF----------QLAKQAIEL.-.NR...........----------------..----------------.CHQ
Q16XY1_AEDAE/224-343-LLRNIK----------EGGTKAIKER-Y.G...........----------------..----------------.IDS
Q16YN6_AEDAE/11-125-LLDEMR----------QELGNVLKDQ-FQV...........----------------..----------------..DL
Q18227_CAEEL/10-129-LLEEME----------KTGRELLREH-LKKKG........E----------------AD----------------TVED
Q1CY35_MYXXD/3-112-LVGHLF----------IAAAKVAQER-GHAD..........----------------PS----------------DGYR
Q1QZ40_CHRSD/2-109-LVGRLQ----------HTAATLAREL-GFA...........----------------.E----------------DGYR
HINT3_XENTR/18-132-LIKTMM----------EVGKSTLQKN-NVT...........----------------..----------------..DL
Q2H2H7_CHAGB/31-147-LLYRFR----------HQSQIEIDRM-SME...........----------------.N----------------PSRI
Q2H304_CHAGB/151-275-WLRHMR----------AKFLDAATGV-YPS...........----------------..----------------.IER
HINT3_BOVIN/47-162-LIENMV----------TVGKAILERN-NFT...........----------------..----------------..DF
Q3IJU5_PSEHT/4-111-LVGNLY----------VVAAKLAKQL-NFA...........----------------.D----------------DGYR
A0A0D1DZS3_USTMA/46-158-LVRQMQ----------ALGNKALDLV-STS...........----------------..----------------.NCA
Q54DF5_DICDI/36-141-VLVEMK----------QVADQLIAEK-FPG...........----------------..----------------...Q
Y2839_DICDI/224-348-MLEHMY----------NVADAIINEI-ISKDN........D----------------DD----------------NLKK
Q59S51_CANAL/134-254-YLTNLQ----------KIVKEVTVNK-Y.G...........----------------..----------------.IKP
Q5TUI6_ANOGA/154-273-LLRNVQ----------TRGIAAIEKR-Y.G...........----------------..----------------.IGA
A8XGQ1_CAEBR/148-267-MLYNIR----------DKSLTAINEK-Y.G...........----------------..----------------.LQK
Q6BZT0_YARLI/136-263-WLKELR----------EDIYKVVKDK-Y.N...........----------------..----------------.VDR
Q6C515_YARLI/4-127-KTRAMV----------EKVEKMVAVE-FIRTK........G----------------YS----------------KDVK
Q6C6M8_YARLI/30-153-WLQSMR----------NQVVNILPEI-YGI...........----------------..----------------KMKS
Q6CJA1_KLULA/160-286-WLIDMK----------NKIRSVVPSC-YNY...........----------------..----------------LVPA
Q6FLB9_CANGA/198-323-WLKKLN----------TTLRTIVPAC-FNY...........----------------..----------------SIRP
Q6FWT2_CANGA/170-296-WLKNIY----------NKIRSIIPAC-YNY...........----------------..----------------AVHP
Q6IIA4_DROME/5-118-LVQLME----------NALKDLLVSK-GVS...........----------------..----------------...V
Q74ZD1_ASHGO/153-277-WLESIG----------KKIRAVVPGC-YNY...........----------------..----------------SIRA
Q7PHF8_ANOGA/7-116-LLQNMY----------ELGLKAV..G-TTG...........----------------..----------------.LTV
Q7QJM2_ANOGA/10-124-LLEELK----------RELVNYMQSS-RGI...........----------------..----------------..DP
Q83DE2_COXBU/3-109-LLGHMV----------VVATRLAHDK-NMA...........----------------.A----------------DGYR
Q84VV6_ARATH/7-121-LVRHML----------SVGQQLLQKD-APQ...........----------------..----------------....
Q8GYJ9_ARATH/75-183-VLGQLL----------HASKIVAEKE-GIL...........----------------..----------------DGFR
Q8SUA2_ENCCU/116-232-ILVDAR----------EKARNLLETR-FGL...........----------------..----------------..DF
Q97JJ3_CLOAB/3-110-VIAHVF----------VVISKLAKEL-GID...........----------------.E----------------DGFR
BH140_ARATH/717-833-LLQEMH----------NVGLKWVDRF-QNE...........----------------..----------------.DAS
DCPS_SCHPO/141-261-LLENIR----------NKVLTEVPKQ-F.S...........----------------..----------------.VDK
E7KRX8_YEASL/160-281-WLINLN----------NKIRSIVPGC-YNY...........----------------..----------------AVHP
E7KUH0_YEASL/160-281-WLIRLN----------KKIKTIIPQH-YDY...........----------------..----------------NVNP
F1R776_DANRE/159-276-LLTNIR----------SKGEETIQKK-Y.G...........----------------..----------------.VPP
F7CC42_XENTR/161-276-LLMNIL----------EEGKEAILKR-Y.G...........----------------..----------------.ITG
H3C365_TETNG/54-161-LVERMV----------EVARSVLEEN-KVH...........----------------..----------------..NS
H3CJX6_TETNG/127-244-LLKNVF----------QKGKETIMQK-Y.............----------------..----------------KLPA
H3DP42_TETNG/31-141-LVQRMV----------ELGKEILQKN-DVT...........----------------..----------------..DL
Q0JBF2_ORYSJ/25-136-LVSHML----------AVGRDLLNRD-AP............----------------..----------------..NS
Q5K774_CRYNJ/143-255-LLKNIR----------EKAAAEASKR-F.G...........----------------..----------------.VDA
Q9VQ59_DROME/32-141-LVRRME----------QGMMEFLRSQ-N.............----------------..----------------.VDP

PF01230

HINT1_RAT/24-121-HLMIVG----------KKCAADLGL.-................----------.....K----------------RGYR
HNT2_YEAST/12-107-DYFKTL----------QLIHRFIKWQ-Y...............----------....KA----------------DSIN
FHIT_HUMAN/11-105-DLFQTT----------QRVGTVVEKH-F...............----------....HG----------------TSLT
APH1_SCHPO/12-106-DLFTSV----------RKVQQVIEKV-F...............----------....SA----------------SASN
APTX_YEAST/15-139-YVNSAI----------DHIFRHFQEK-FRIKKSDDDKDPCWDD----------ILKDKN----------------KFVR
Q9I500_PSEAE/74-166-ALWREA----------TLLAEVLKDT-F...............----------....R.----------------....
Q98BM9_RHILO/14-106-MLTFET----------NMVAQALKKV-S...............----------....G.----------------....
Y866_METJA/9-105-NFIKGV----------KKTVEVLKKL-................----------....GF----------------DGYN
YHIT_MYCPN/19-116-AVSLLA----------KEMALKLQQR-L...............----------....QP----------------AGLN
APTX_SCHPO/44-156-KHRSLV----------EKLVSYVQGD-LSGLIFDEA...RNCL----------SQQLTN----------------EALC
YHIT_HELPY/9-104-QMTSFI----------FEVVEKLGI.-................----------....KE----------------KGYK
HNT1_YEAST/32-125-DAMPIA----------KRLAKAMK..-................----------.....L----------------DTYN
Q9A2A9_CAUCR/9-106-QLMEET----------IRAGSAVRAV-G...............----------....AL----------------LGLR
YHIT_SYNY3/12-109-HLLLKA----------KEVAADLGI.-................----------.....G----------------DQFR
Y1390_SYNE7/12-109-HLLLTV----------KAIAAQEGL.-................----------.....T----------------EGYR
YHI1_MYCLE/10-102-RVIAVS----------QLIGKGVCRA-F...............----------....NA----------------ERAG
Y961_HAEIN/12-110-RLFSVA----------AKLAKEEGV.-................----------....AE----------------DGYR
Q9JYE4_NEIMB/10-102-ELMEMV----------YKVEAAMRQV-F...............----------....R.----------------....
Q9KQC5_VIBCH/14-106-QFLVES----------QLVCQTLETL-F...............----------....S.----------------....
ZB14_MAIZE/24-123-YLLYVA----------KVVAKQEGL.-................----------.....E----------------DGYR
HINT_CAEEL/28-125-KLMVTA----------SKVAKQLGM.-................----------.....A----------------NGYR
G8AG53_AZOBR/16-114-GLFRAV----------GEVARGAGA.-................----------....AE----------------PGYR
K7XM15_MYCHR/14-110-YLIVKA----------REFALQEIKK-L...............----------....GA----------------TGFK
YHI2_MYCTU/11-106-DMVAIG----------QRIARAARAT-K...............----------....LA----------------DATH
Q32EW3_SHIDS/12-109-RMITVA----------AKIAEQEGI.-................----------....AE----------------DGYR

PF04677

C3H64_ARATH/370-491-EVESEL----------SRYQNGLRNC.YKS----------------------------Q----------------GNDA
C19L1_CAEEL/309-429-EVRDEI----------EKFKSAFTLM.ANK----------------------------Q----------------GKAL
C19L2_CAEEL/226-350-NVWDEM----------RLWRKGLVAV.WKS----------------------------Q----------------NRDC
C19L2_DROME/460-584-DAWEEI----------SNFRKALTRM.FAA----------------------------R----------------RQDV
CWF19_SCHPO/399-523-DEWDEI----------RNFMKCIALM.FDS----------------------------M----------------NLGV
DRN1_YEAST/256-389-ELTQSI----------LAYEASLVKMNYIK----------------------------F----------------DMCT
MU161_SCHPO/334-470-KTLNEM----------NRFRKAVTDM.YNA----------------------------C----------------DSDA
Q93ZX4_ARATH/458-582-NVWDEI----------RNFKKCLIMM.YAK----------------------------E----------------GKDA

PF02611

CDH_HELPY/24-243-LSWQAR----------DFMSKKYGQP--------------------------------I----------------PDYA
Q8P9Z9_XANCP/30-250-SAWSAR----------SFVASALAQP--------------------------------L----------------PRAY
E8V0N7_TERSS/35-269-DAWQAT----------ALVDQRLHQT--------------------------------L----------------PRTD
A8GL49_SERP5/45-264-QAWQAR----------HFMADKYGKA--------------------------------I----------------DDAD
E0SJ94_DICD3/33-253-AAWSYR----------DRLSRQMGKP--------------------------------I----------------GDDK
CDH_YERPE/33-252-DAWQAR----------YFMAEKYGAP--------------------------------I----------------DDTD
B8IMH8_METNO/37-256-AALAAR----------HYVTEALGGR--------------------------------L----------------TAYD
W0LHA3_9ENTR/26-254-YAWLMR----------NLLRFEYGKP--------------------------------V----------------PDEM
B1M455_METRJ/29-249-AALAAR----------PLVSDALKGR--------------------------------L----------------TPAE
Q1LBK3_CUPMC/33-250-FGWAAR----------DIVGKAIGRA--------------------------------L----------------PDTL
Q6MQF2_BDEBA/30-256-LAWKAR----------SYMEKKHGSA--------------------------------I----------------PVEA
G8MBN7_9BURK/67-288-DAWNAR----------GYVNRALRRT--------------------------------L----------------PRDE
A6TFQ8_KLEP7/24-243-QAWQGR----------EIMSQRHGAP--------------------------------V----------------PDNA
H2INV4_RAHAC/31-250-QAWNAR----------HFMADKYGKP--------------------------------I----------------DDSN
B0U7T2_METS4/29-248-AALTAR----------STVTEVLKGE--------------------------------L----------------PIDD
B2VF57_ERWT9/34-251-EAWRAR----------HFMEEKWGKR--------------------------------I----------------DDGI
B9JRW8_AGRVS/27-242-DAWNER----------AAVDAKLPHP--------------------------------L----------------SRDA
D8IW24_HERSS/34-253-YAWQQR----------ARVAQTLGRA--------------------------------L----------------SDEQ
C5BB31_EDWI9/31-247-LAWYSR----------PLLSQRYGQP--------------------------------I----------------ADSR
A9HJU4_GLUDA/35-256-AAWHQV----------DRSLARLGHT--------------------------------M----------------PRET
B2JLJ5_BURP8/29-246-DAWAAR----------QYVGSRIGLT--------------------------------F----------------PPNQ
B1LSY8_METRJ/26-246-AALAAR----------HYVSDALQGR--------------------------------L----------------PASA
L0IYV5_MYCSM/29-248-AAWDAR----------SFVNARAGID--------------------------------I----------------PRDW
B8IPC5_METNO/27-247-AALDSR----------RYIVDALKSR--------------------------------L----------------PLSD
B2FII5_STRMK/27-247-AAWQAR----------SHTEQALRQP--------------------------------L----------------PRNV
CDH_CROS8/31-250-QAWQAR----------RWMSEKRGSP--------------------------------V----------------PDSA
B8EQB5_METSB/40-259-PAWATR----------KLVADNAKKE--------------------------------L----------------ARDD
B2HIW3_MYCMM/43-260-EAWADR----------FAVTARLNNA--------------------------------L----------------PESH
W0HRX4_9ENTR/35-254-LAWQAR----------HFLSDRRGQA--------------------------------I----------------GDRF
E6WAG7_PANSA/33-250-DAWRER----------GLLAQRRGKP--------------------------------I----------------EDSV
B1M8V7_METRJ/69-294-KAWRAR----------TFVEGRLGHP--------------------------------L----------------DRRD
D8MKK8_ERWBE/33-250-EAWRSR----------HFMEEKRGAP--------------------------------I----------------DDSA
Q6D6W9_PECAS/32-251-QAWDRR----------GHLSREAGKP--------------------------------I----------------KDDY
D2UA62_XANAP/30-247-LAWRAR----------GALSELLGKA--------------------------------V----------------PDTA
CDH_MYCLE/38-255-NAWAAR----------GFVSSRLNNS--------------------------------L----------------PEPD
Q13LU5_BURXL/41-259-DAWNAR----------TYVEKSVKRT--------------------------------L----------------PDNQ
Q7NQ26_CHRVO/27-251-AAWQAR----------RYLDARRGQP--------------------------------L----------------PRLA
K7SS21_GLUOY/32-232-EAWAER----------QRVPAGYGFP--------------------------------V----------------PDEH
Q0JZ98_CUPNH/25-246-FGWAAR----------GIVGRSLGKA--------------------------------V----------------PDDM
H8L0L3_FRAAD/32-259-DAWALR----------DQVSAAADAA--------------------------------L----------------PRQA
CDH_ECOLI/31-250-LAWQAR----------DFMSKKYGQP--------------------------------V----------------PDRA
Q5FPM0_GLUOX/32-232-EAWAER----------GHVAQSYGFE--------------------------------I----------------PDAH
W0PFV2_9BURK/44-257-QAWHAR----------DYMDRLLGKA--------------------------------I----------------PVQE
I2BEE8_SHIBC/29-247-LAWQAR----------GLLSERYGQP--------------------------------I----------------PDSA
CDH_MYCTU/41-258-DAWAAR----------FLVTARLNNS--------------------------------L----------------PESD
U3U143_9ENTR/33-250-AAWQQR----------RLLAQKRSAP--------------------------------V----------------DDRV

PF02744

GAL7_CRYNJ/204-373.ILKDVL----------SRYDNLFS......----------------------------.----------------..CP
GAL7_HAEIN/183-348.ILKKLT----------TKYDNLFE......----------------------------.----------------..TS
GALT_STRMU/231-435HTVTPIA----------RKRDGQFELDIVLR----------------------------D----------------NHTT
GALT_BACSU/240-451NTVTPIA----------RRRGDLYELDIVLR----------------------------N----------------NRTD
GAL7_YEAST/198-366.ILKQLT----------IKYDNLFE......----------------------------.----------------..TS
GAL7_KLULA/195-363.IIRNLT----------IRYDNLFE......----------------------------.----------------..TS
GAL7_ECOLI/182-347.ALKKLT----------SRYDNLFQ......----------------------------.----------------..CS
GALT_HUMAN/202-370.IMKKLL----------TKYDNLFE......----------------------------.----------------..TS

PF16285

C0ZAZ1_BREBN/8-252-NHGPYS----------GGSIRHPHMQIVGLN-DFDYLDQVKDS----------DFIGMT----------------IDQE
B2TPI8_CLOBB/11-256-NHGPSS----------GGSIKHAHMQIVGLN-NIDYRENINEK----------YFEGIE----------------IFKS
C9LU44_SELS3/8-252-NFGPLS----------GGTLRHPHMQIVGFH-SLNENLTFDPL----------EFEGLT----------------IHEK
D9SRU9_CLOC7/9-253-NHGPYS----------GGSIAHSHMQIVGLK-NINYEENLKDE----------FFEGLT----------------IYET
Q81VH8_BACAN/8-251-NHGPFS----------GGSLHHAHMQIIGMK-YVNYLDNVEQD----------NFQGVI----------------VQKN
U5LFA6_9BACI/8-252-NHGPLS----------GGTIAHPHMQIVGLN-EVDYTENIREE----------EFEGLA----------------ISQK

PF01087

GAL7_CRYNJ/15-198-ALLP.D----------PLAVGTNKI.......SDD.......P..........LFQSEP----------------VRGR
Q7QA38_ANOGA/1-174-ALLE.Q----------VPEPPS..........SDD.......P..........LFQIAP----------------AQGT
A5DRG5_PICGU/6-197-AVRL.E----------QPDYEAEKS.......SGDGKDDLKSR..........LMHVQG----------------VKGQ
Q9CM11_PASMU/4-178-ALLE.E----------TPNPEK..........STD.......P..........LFQISK----------------AQGE
Q2H1V5_CHAGB/2-211-AVKE.Q----------QQEYNPEAN........KDDV...SSL..........LLRAQP----------------VTGR
A4AQM0_MARSH/1-176-ALLQ.D----------VEEKKY..........KNG..................LLYAES----------------ESGI
Q65CW7_BACLD/17-231-QLSK.N----------SNYIQTKRI.......EKN.......I..........SYQMDT----------------PYGT
A9WJH8_CHLAA/4-191-ALLP.D----------IPLDRVSVRLP...LADQHDA...GPV..........LLHAEA----------------ERGI
A7MIY8_CROS8/2-176-ALMT.D----------TPDAPQ..........SAD.......P..........LMRLES----------------ARGT
Q03XA5_LEUMM/18-235-DLSQ.R----------SNYIKTREI.......SQN.......I..........SYPVDT----------------QYGT
A3N102_ACTP2/3-177-ALLP.D----------TPAPEA..........GSD.......P..........LFQISH----------------TQGE
GALT_STRMU/16-225-ELSK.R----------NNYIKVTAI.......AKN.......I..........AFTTSS----------------VYGD
A5DWA9_LODEL/21-211-AVKM.D----------QPDYNDETTK.....DGQGSL...KKK..........LFKTQG----------------VKGN
Q6D2C5_PECAS/1-175-ALME.D----------TPDAPS..........GDD.......E..........LFRVQQ----------------ARGV
Q1IQZ6_KORVE/1-177-ALKP.D----------IVEFER..........NES.......G..........LLIAQS----------------ERGI
Q6LQE3_PHOPR/15-189-ALTV.D----------TPDAPQ..........SDN.......P..........LFRSES----------------ARGL
A8LEI8_FRASN/19-211-ALRP.P----------LSDERLEVRAESGIPPGRAGG...AEE..........LLRAEP----------------ETGV
Q59VY3_CANAL/21-210-AVRL.D----------QPEYKEDEQ......DKQNTL...KSR..........LLQTQG----------------VRGK
A1L2D1_DANRE/7-181-ALQP.D----------APDPGS..........DHH.......P..........LFQSKA----------------ARGV
A7F8S7_SCLS1/1-208-AVKE.V----------QAEYAQDGE........SKDL...SNI..........LLRAEP----------------VTGK
Q3XZ93_ENTFC/18-230-NLSK.K----------NDYIKTRAI.......AKN.......I..........KFPAES----------------EYGE
B1YII0_EXIS2/18-230-QLSQ.A----------NNYIQTKRI.......AKN.......I..........QYQADT----------------VYGE
Q0RE52_FRAAA/14-191-ALRP.A----------ESDPAPPGADP...GG.....................LLRSAP----------------AHGT
Q21LR9_SACD2/5-180-AVQK.E----------SHKAPE..........STN......KG..........LFVTQP----------------VSGT
GALT_STACT/19-233-QICK.R----------NHYVKEDAI.......AKN.......I..........HYYTET----------------EYGD
GALT_LACPL/16-224-NLSK.A----------NDYIKTRAI.......AKN.......V..........VFPAKT----------------PFGD
A8WVF3_CAEBR/2-179-SFTEFD----------GCAGKE..........ENS.......D..........LFKQQE----------------VRGV
A2AMS2_MOUSE/3-177-ALQP.D----------APDPGP..........SDH.......P..........LFRAEA----------------ARGV
GAL7_NEUCR/2-217-AVKE.E----------QQEYHPRKDAA...GDGDDDI...ASL..........LLQAQP----------------ATGR
A7TJY6_VANPO/4-190-AVKL.E----------QPDIDETD........ETDEI...KKR..........LFKVQS----------------VKGN
A6RBX1_AJECN/45-253-AVKE.E----------QAAYQRESV........DGDI...SSV..........FLQAEP----------------VTGR
GAL7_KLULA/1-189-AVKL.E----------QPDPELTVS.......NCDAL...KER..........LFKLKG----------------VKGN
Q5KY03_GEOKA/19-233-SLSQ.A----------SNYIQTARI.......ANN.......Q..........HWKVST----------------IYGE
Q03PB0_LACBA/18-226-QLSQ.V----------NNYIKTRNI.......AKN.......V..........VFPAKT----------------PAGE
A2QCH5_ASPNC/2-209-AVKE.E----------QAPYSPEG.........GEDL...ESF..........FLKAEP----------------VTGK
A6WF46_KINRD/10-216-SFSN.R----------IGGEDGFL........DGE.......R..........LWPTRP----------------AAGR
Q2J7D6_FRASC/3-201-ALRP.D----------PVRPAALLVAPPADPPVAPSA...DPAPVWPAGPGSGLLRSEP----------------ARGT
A3QFA6_SHELP/9-182-ALNS.D----------GPKA.Q..........GED.......P..........LFRFET----------------VEGE
GALT_BACHD/21-236-DFSK.Q----------VHYIRTDRI.......AKN.......E..........HWFSET----------------PYGQ
Q5WD06_BACSK/20-235-QFCQ.D----------AHYIRTDRI.......ALN.......E..........SWLAPT----------------PYGD
A0QYK5_MYCS2/3-199-SLSG.G----------GEFTLPDT........AGA..................EFLSAP----------------GHGR
GALT_LACSS/20-231-ELSQ.A----------NDYIKVAAI.......AKN.......I..........AYDVPT----------------KYGD
Q896X9_CLOTE/19-233-NIAK.A----------LNYIRCDRI.......NKN.......L..........SWKHDT----------------DYGD
GALT_DROME/1-175-ALVE.V----------VPVPPN..........NDD.......P..........LFQIAP----------------ARGN
GAL7_SCHPO/4-195-AVRV.D----------QPDYMQDESE....ITKGNTL...KTR..........MFKTEG----------------VKGK
B8I4V5_CLOCE/19-234-NLCI.A----------SNYIRTSQI.......AKN.......I..........KWTSDS----------------KYGQ
A3LR66_PICST/19-206-AVKL.D----------QPNYVEEE........SKDSL...KGK..........LLKTQG----------------VKGK
Q7N8Y8_PHOLL/4-178-ALML.D----------SPDLPP..........SCH.......P..........LFKAQG----------------VRGL
Q73SK2_MYCPA/2-203-SLSG.A----------APGLLA..........AGA.......D..........GFVSAP----------------AHGR
A8FIP9_BACP2/20-233-EMQK.H----------AHYIHTGRI.......AKN.......V..........QWFTPT----------------DDGV
Q3IH81_PSEHT/3-176-ALKI.D----------TPEF.K..........TDD.......P..........LFKMAT----------------EQGE
A0M3B7_GRAFK/1-176-SLLP.D----------APEIDF..........QDG..................LLKAES----------------EKGI
A5FKW9_FLAJ1/2-179-ALKQ.D----------EIIFEE..........DIK......HT..........FFKAEP----------------EQGI
A0A0D1E3L7_USTMA/31-214-ALKP.Q----------SVMEEK..........NQH.......P..........LLQSQP----------------ARGR
Q15Y61_PSEA6/2-176-ALMK.D----------TPASEQ..........END.......D..........LFTVEA----------------ARGT
Q6C0K3_YARLI/1-190-AVFE.K----------TAEVEKVVEEAQKEHTESTAL...DLD..........LLRKED----------------VFGY
Q6BVI6_DEBHA/3-194-AVRV.D----------QPDYIEDTEE....IEKSSPL...KAK..........LFKTQG----------------VKGK
Q2GAY3_NOVAD/2-175-ALMP.D----------NPAPEG..........GDP..................VFRVAE----------------ARGT
GALT_CLOAB/17-229-KLSI.A----------SNYIRKDRI.......DKN.......I..........TWKTPT----------------EYGD
GALT_ENTFA/20-232-QLCK.T----------NNYIKTKAI.......AKN.......I..........IFPMDS----------------PYGK
Q30V51_DESAG/2-182-ALKT.P----------GSRTAQSPP......RKND.......D..........LFAARP----------------ETGI
A9KN46_CLOPH/31-257-KLSQ.D----------SDYIRRYRI.......QKD.......V..........KWITKT----------------EYGD
GALT_LACS1/18-228-DLSK.R----------NDYIKTKAI.......AKN.......I..........YFPVET----------------SYGQ
A0KQH7_AERHH/2-174-ALMQ.D----------TPAASG..........QQD.......P..........LLKLEA----------------ARGT
A4VT89_STRSY/18-226-ELSK.R----------NDYIKMAAI.......AKN.......I..........YYPVST----------------EYGD
A5VME1_LACRD/16-220-NLCT.S----------NDYVKVAAI.......KKN.......V..........VFDKPT----------------KYGN
E7KK61_YEASL/5-192-AVRL.D----------QPILPQNDS.......NEDNL...KNR..........LLKVQS----------------VRGN
G0RTP4_HYPJQ/7-208-AVKE.Q----------QPDYEVDQS.......SDDL....ESL..........LLRAQG----------------VKGV
Q04GZ3_OENOB/18-225-KVSR.E----------NDYIKTQAI.......AKN.......I..........SFPVKS----------------DYGD
Q5KLY2_CRYNJ/11-195-ALLP.G----------PLPTLQQPSK....VNSSD.......S..........LFASEP----------------IRGR
GALT_STRT2/18-226-AQSK.R----------NDYVKVKAI.......AQN.......I..........AYKAPT----------------KYGD
Q5NEY1_FRATT/11-180-ALSK.E----------KIDKKL.EI........ND.......D..........LFQLSG----------------ATGI
Q7MBX0_VIBVY/28-200-ALTE.H----------TPDSPV..........SDD.......P..........LFQLHS----------------AKGE
GALT2_STRR6/16-224-QLSQ.K----------NDYIKLKAI.......AKN.......I..........AYRVPS----------------DYGE
GALT1_STRR6/18-225-KLSK.D----------SDYIKTSAI.......AKN.......I..........EFRAST----------------KYGE
GALT_CLOPE/21-230-SLSK.S----------SNYIRTDRI.......AKN.......I..........NFKAPS----------------KYGT
GALT_LACLA/19-228-ELAQ.Q----------VNQVKTRDI.......TRN.......I..........AFSHLT----------------KYGK
U5L509_9BACI/19-230-DLSR.N----------SNYIQTKSI.......AKN.......I..........NYKIAT----------------DYGE

PF16268

F5XH95_MICPN/8-422-EIVSTRSWRLNHGFRPSPAVLSWAEDYLADPLGIDHITAILGF----------RHRMGGPPAPARDDR.......AALI
C3PH27_CORA7/1-419-EIVSYDYWHENYGFTMDPDLARHKESYEADEAGRLHVLNVVRT----------KLKAAG.....KDAALDD....DSLL
B1VH78_CORU7/18-447-EILTYDYWALNYGYRMNPAAAKHMTDYLSEEAGCEHVENILRV----------KLAAAGTPKAEIDELFTEERRHQTLH
Q8NNU9_CORGL/1-424-EIVSFDYWHQNFGFDMDSETAMRMAQYLAIPEGREHVLAIVRT----------RLSAAG....EDPAHMTD....GELL
W5WQ34_9CORY/18-447-EILTYEYWSMNYGYRMSPASAKHMTDYLSEEAGIDHVEKILRM----------KWTAAGMPAAEIDEAFNDDNRMMTIQ
W5Y1J6_9CORY/15-448-EIVTFDYWEANYGFTPDASTQAWMDAYLADPAGREHVLTTVRT----------KRKAAG.....LEPNAPE....DELL
G0HAG7_CORVD/18-449-EILTYNYWTVNYGHRMDATAARHMAEYLAEDAGVEHIAGLLRT----------KMERAGVPAEEIEDAFSDEKTFQTVH
U3GXR8_9CORY/26-464-EIVTFDYWKANYGFIPSPEITAWRNNYIGNPQGLEHVRKIVAS----------KMNFSG.LSAPEIEALTD....EEIA
Q6NGG7_CORDI/11-432-EIVSYDYWRNNYGFSMDLETTDWMQSYISTEKGREHVLATVRT----------KLQAAG...IQDMPD..D....ATLL
S5SVS2_9CORY/15-437-EIVPYSYWVDNYGFLMNEDVHRRMERYLADPAGKQHVDAIIRT----------RLKANG.....RAPETVDPAGWHELE
B3QVF6_CHLT3/10-436-EIVSLDYWRKNYGYKMNQVQNAWREQYLSDSDGVKHICEVVDY----------KLSRMG.RSYDAIKSVPL....DEKL
Q6A5P1_PROAC/10-435-EILSWRYWQLNWGMSLPRAARDWQEEYLSNPSGEAHVRSVLNA----------KFKAVG..SDRRAEDLGP....QELR
Q8FP08_COREF/15-438-EIVTYEYWNKNFGFEMDPETAMRMATYLADPEGRRHVLSIVRT----------RMKAAG....EDGSSLTE....AELL
F8E0G1_CORRG/18-447-EILTYDYWSLNYGYRSSPAAAMHMAEYLAEDAGQDHVEKILRT----------KWAASGRPKEAIDALFSPATRMQTLN
C5CBF5_MICLC/33-463-EILSYDYWRLNHGYEPSPDARRRRDEYLATEAGRAHVRAVVAA----------KLRASG.RSAEEAAATSE....AELI
I6XY80_PROPF/27-452-EILSFDYWRANYGFELPESAARHQRAYLASPEGLEHVLRVAET----------KLRASG.RGAGQVAAMTR....EQRL
R5PXK8_9PROT/14-442-EIISFDYWEKNYGYVMNDQIAAHKEDYLEDPAGREHVLDIVQT----------KLKMSG.LSREEIDSISS....GRKL
D7BLX6_ARCHD/14-437-EILSFDYWAKNYDYRLPASARGRLEAYMADPAGRSHVMKVLRM----------KLRNTY..TDDEFGALTD....QDIV
D9QB86_CORP2/15-442-EIVSYDYWHDNYDYSLDSETQARMERYIASDLGRKHVLEIIKT----------KRKAAG.......NAVSTDYPENELL
X5DSS5_9CORY/40-471-EILTYDYWLVNYGHRMDATAARHMAEYLSEPEGREHVERLLRI----------RMEAAGRPAEDIDALFTEDTAVQSVN
M1P829_9CORY/11-432-EIVSYDYWAKNYGFRMDPETAARKAAYLADETGRAHVLDIART----------RLRAAG.....QDPDVSG....DELI
D7GCR7_PROFC/13-438-EIVGYPYWVANYDYKPSPAAMARYRAYRNDAGGREHLLAISRT----------KLAASG.LAPAQVRATPD....DELL
D7WEZ1_9CORY/10-431-EIVSYDYWAKNYGFHMDTSREDHMERYLADDAGRHHVFDVVRM----------RLKAGG.....HDDNLTE....EELL
C8XCI8_NAKMY/35-455-EIVSFDYWQLNYGHQLAPAQREAMADYLSTDAGRAHVAALVER----------RTQQPW.......AHMSQ....ADRE
C4LIB0_CORK4/15-440-EILGYEYWRANHGFAMDPETSTHMNDYLSEPAGRQHVLNIIAT----------RLRSAG.TPESEIKDTPE....TELL
K7RWS7_PROA4/29-464-EILSWEYWHENHGLELPSEARQWQEEYLSYPAGLAHVQRVLDA----------KFAAQG..LDLRAARLSP....DQLR
D6ZJH6_MOBCV/17-441-EIVSYDYWHENHNHYPTEAQNRRMADYLASAAGYDHVLHVVKM----------RLEASG...EDHLETIPD....DALL

PF11969

Q5TVU2_ANOGA/17-126KQFNFGYHLKP..HMKR-------LHL------HVISKD-----------------------------------------
A5DAJ7_PICGU/3-137RFIRAGVHAAP..SLAN-------FHI------HVISQD-----------------------------------------
A5DAR3_PICGU/136-257DQLRIFIHYQP..SYYH-------FHI------HVVNIT-----------------------------------------
Q297L1_DROPS/153-272NQLRMYFHYQP..SFYH-------LHV------HINPIR-----------------------------------------
Q29LN6_DROPS/45-159SKAIIGFHIPPFISVKH-------LHL------HGIYPP-----------------------------------------
HINT3_RAT/40-155TDVRMGFHVPPFCSVSH-------LHL------HVIAPA-----------------------------------------
A0EGQ1_PARTE/118-231KFVKVFVHYLP..SFYH-------FHV------HFTHSS-----------------------------------------
A1CEC1_ASPCL/149-272DQLKLYVHYQP..TYYH-------FHI------HVVNVM-----------------------------------------
A3DF72_CLOTH/3-110LITNCGVAAGQ..TVFH-------LHY------HLLG..-----------------------------------------
A3LWH2_PICST/136-257DELRIFIHYQP..SYYH-------FHL------HIVNVK-----------------------------------------
A4S248_OSTLU/99-229EEMRVFVHYPP..QFYH-------FHV------HYQALS-----------------------------------------
APTX_DROME/4-113QDFNVGFHAEP..SMQR-------LHL------HVISKD-----------------------------------------
APTX_DROME/229-339RNFLIGFKVNT..FWNR-------LNL------HVISND-----------------------------------------
A4XKP5_CALS8/3-110IVVNCGEDGGQ..TVNH-------LHF------HLLG..-----------------------------------------
A5D7U9_BOVIN/174-293DRLRVYLHYLP..SYYH-------LHV------HFTALG-----------------------------------------
A5E770_LODEL/177-298DGLRIFVHYQP..SYYH-------FHI------HVVTVK-----------------------------------------
A5GQU3_SYNR3/125-230TVINTGAEAGQ..TVFH-------LHV------HVIG..-----------------------------------------
A5I635_CLOBH/3-110VISNCGESAGQ..TVFH-------IHF------HLIA..-----------------------------------------
A6QUC5_AJECN/141-262DQLKLYLHYQP..TYYH-------LHI------HVVNIM-----------------------------------------
A6VZM3_MARMS/2-109VVMNCNEMGGQ..TVYH-------IHM------HVLG..-----------------------------------------
A7HMY4_FERNB/3-108IVQNNGKDAGQ..EVHH-------IHF------HIIG..-----------------------------------------
A7S614_NEMVE/151-270SQLRIYVHYQP..SYYH-------FHV------HFTHLK-----------------------------------------
A7SFV5_NEMVE/10-122EDTVIGFHWPPFNSIQH-------LHL------HVISDA-----------------------------------------
A7TKH2_VANPO/142-261DQLRIFIHYQP..SYYH-------FHI------HIVNIK-----------------------------------------
A7TQ97_VANPO/171-297DELRIFVHYQP..SYYY-------FHI------HIVNIK-----------------------------------------
YHIT_CHLTR/2-108VVVNNGLEGGQ..SVFH-------LHI------HLLG..-----------------------------------------
APTX_CHICK/142-252LEFRLGYHAIP..SMSQ-------LHL------HVISQD-----------------------------------------
APTX_DANRE/150-260LSFRLGYHAIP..SMSH-------VHL------HVISQD-----------------------------------------
APTX_XENTR/173-283APFQLGYHAIP..SMSH-------VHL------HVISQD-----------------------------------------
APTX_CIOIN/206-317VEFRFGYHAVA..SMSQ-------MHM------HVISQD-----------------------------------------
Q0U2I6_PHANO/148-269DQLKLYVHYQP..TYYH-------FHI------HIVHVA-----------------------------------------
Q15X15_PSEA6/3-110TVMNCNEYGGQ..TVYH-------IHL------HVLA..-----------------------------------------
Q16F07_AEDAE/8-123KEFAMGFHMRP..SMHR-------LHL------HVISKD-----------------------------------------
Q16XY1_AEDAE/224-343DHLRVYLHYQP..SFYH-------LHV------HFTYLK-----------------------------------------
Q16YN6_AEDAE/11-125AEVLFGFHVPPFTTVKH-------LHM------HGMGPV-----------------------------------------
Q18227_CAEEL/10-129M.LRIGFHLPPLLSVHH-------LHM------HIIYPI-----------------------------------------
Q1CY35_MYXXD/3-112VVMNTHAHAGQ..TVFH-------IHL------HLLA..-----------------------------------------
Q1QZ40_CHRSD/2-109VVMNCNDHGGQ..SVYH-------IHM------HLMG..-----------------------------------------
HINT3_XENTR/18-132EDIRLGFHYPPFCSISH-------LHL------HVLAPA-----------------------------------------
Q2H2H7_CHAGB/31-147PMFMTGFHTIP..SLFP-------LHC------HVQDWS-----------------------------------------
Q2H304_CHAGB/151-275DQLKLYVHYQP..TYYH-------LHI------HIVHVA-----------------------------------------
HINT3_BOVIN/47-162ENTRMGFHVSPFCSIAH-------LHL------HVLAPA-----------------------------------------
Q3IJU5_PSEHT/4-111VVMNCNEHGGQ..TVYH-------IHL------HMLA..-----------------------------------------
A0A0D1DZS3_USTMA/46-158PERRFGFHIPPIRSVDH-------LHL------HCLELP-----------------------------------------
Q54DF5_DICDI/36-141SGIVLGFHSPPFYSVKH-------LHL------HLLVPP-----------------------------------------
Y2839_DICDI/224-348SDFKLGFHAIP..SMKR-------LHL------HIISND-----------------------------------------
Q59S51_CANAL/134-254DQLRVFLHYQP..SYYH-------FHL------HIVNVQ-----------------------------------------
Q5TUI6_ANOGA/154-273SQLRIYLHYQP..TFYH-------LHM------HFTYLR-----------------------------------------
A8XGQ1_CAEBR/148-267DQIKCYFHYQP..SFYH-------LHV------HFINLK-----------------------------------------
Q6BZT0_YARLI/136-263SFLRVFVHYQP..SYYH-------LHV------HVVHIN-----------------------------------------
Q6C515_YARLI/4-127..IQSGIHSVP..SMNH-------VHV------HVMTTD-----------------------------------------
Q6C6M8_YARLI/30-153MQPVLYVPYPP..GKYH-------FHF------LIREKS-----------------------------------------
Q6CJA1_KLULA/160-286DQLRLFIHYQP..SYYH-------FHI------HIVNVR-----------------------------------------
Q6FLB9_CANGA/198-323DELRIFVHYHP..SFYH-------FHV------HIVNVK-----------------------------------------
Q6FWT2_CANGA/170-296DELRVFIHYQP..SYYH-------FHI------HIVNIK-----------------------------------------
Q6IIA4_DROME/5-118DDALFGFHLPPFITVKH-------LHM------HAISPR-----------------------------------------
Q74ZD1_ASHGO/153-277EQLRLYVHYQP..SYYH-------FHI------HIVNVR-----------------------------------------
Q7PHF8_ANOGA/7-116DRFDFGYHMKP..SMRR-------LHL------HVISKD-----------------------------------------
Q7QJM2_ANOGA/10-124SEASFGFHIPPFTSVKH-------LHM------HAIAPV-----------------------------------------
Q83DE2_COXBU/3-109LVMNCNRNGGQ..AVFH-------IHL------HLLG..-----------------------------------------
Q84VV6_ARATH/7-121SIHRFGFHQPPFNSVDH-------LHL------HCFALP-----------------------------------------
Q8GYJ9_ARATH/75-183VVINNGVEACQ..SVYH-------LHL------HVLG..-----------------------------------------
Q8SUA2_ENCCU/116-232NHVFMFFHYRP..TYFR-------LHL------HVMNIK-----------------------------------------
Q97JJ3_CLOAB/3-110VVSNCGEAAGQ..TVHH-------VHF------HLLG..-----------------------------------------
BH140_ARATH/717-833LIFRLGYHSVP..SMRQ-------LHL------HVISQD-----------------------------------------
DCPS_SCHPO/141-261NQLKMFVHYLP..SYYH-------LHV------HILHVD-----------------------------------------
E7KRX8_YEASL/160-281DELRILVHYQP..SYYH-------FHI------HIVNIK-----------------------------------------
E7KUH0_YEASL/160-281DELRVFIHYQP..SYYH-------FHV------HIVNIR-----------------------------------------
F1R776_DANRE/159-276SKLRVYFHYQP..SYYH-------LHV------HFTAVE-----------------------------------------
F7CC42_XENTR/161-276NKLRIYLHYQP..SYYH-------LHV------HFTVLG-----------------------------------------
H3C365_TETNG/54-161EDNRMGFHLPPFTSVPH-------LHL------HVLCPA-----------------------------------------
H3CJX6_TETNG/127-244SKLRVYLHYQP..SYYH-------LHV------HFTMLG-----------------------------------------
H3DP42_TETNG/31-141SDARFGFHWPPFCSVTH-------LHL------HVLAPA-----------------------------------------
Q0JBF2_ORYSJ/25-136EEQRFGFHQPPFNSVDH-------LHL------HCLALP-----------------------------------------
Q5K774_CRYNJ/143-255GNLRLFVHYHP..TYYH-------FHV------HIVHIR-----------------------------------------
Q9VQ59_DROME/32-141KEAIVGFHLPPFISVRH-------LHL------HGIFPP-----------------------------------------

PF01230

HINT1_RAT/24-121MVVNEGADGGQ--SVYH-------IHL------HVLGGR-----------------------------------------
HNT2_YEAST/12-107VAIQDGPEAGQ--SVPH-------LHT------HIIPRY-----------------------------------------
FHIT_HUMAN/11-105FSMQDGPEAGQ--TVKH-------VHV------HVLPRK-----------------------------------------
APH1_SCHPO/12-106IGIQDGVDAGQ--TVPH-------VHV------HIIPRK-----------------------------------------
APTX_YEAST/15-139NFVQVGIHSVP--SMAN-------LHI------HVISKD-----------------------------------------
Q9I500_PSEAE/74-166ADKMNVANLGN--VVSQ-------LHM------HVIVRR-----------------------------------------
Q98BM9_RHILO/14-106CTKINTGALGN--IVRQ-------LHI------HIVARS-----------------------------------------
Y866_METJA/9-105IVNNNGRVAGQ--EVNH-------VHF------HIIPRY-----------------------------------------
YHIT_MYCPN/19-116YVVNEGAKAGQ--EVFH-------YHM------HVVPKY-----------------------------------------
APTX_SCHPO/44-156NYIKVGFHAGP--SMNN-------LHL------HIMTLD-----------------------------------------
YHIT_HELPY/9-104LLTNVGKNAGQ--EVMH-------LHF------HILSGD-----------------------------------------
HNT1_YEAST/32-125VLQNNGKIAHQ--EVDH-------VHF------HLIPKR-----------------------------------------
Q9A2A9_CAUCR/9-106IDKLNIGALGN--VTAQ-------LHV------HVVGRR-----------------------------------------
YHIT_SYNY3/12-109LVINNGAEVGQ--TVFH-------LHL------HILGGR-----------------------------------------
Y1390_SYNE7/12-109TVINTGPAGGQ--TVYH-------LHI------HLLGGR-----------------------------------------
YHI1_MYCLE/10-102VII.....AGF--EVPH-------LHI------HVFPTH-----------------------------------------
Y961_HAEIN/12-110LIVNCNKHGGQ--EVFH-------LHM------HLVGGE-----------------------------------------
Q9JYE4_NEIMB/10-102PAKINLASLGN--VVPH-------LHW------HIIARF-----------------------------------------
Q9KQC5_VIBCH/14-106PDKLNLGALGN--MVPQ-------LHI------HHIARF-----------------------------------------
ZB14_MAIZE/24-123VVINDGPSGCQ--SVYH-------IHV------HLLGGR-----------------------------------------
HINT_CAEEL/28-125VVVNNGKDGAQ--SVFH-------LHL------HVLGGR-----------------------------------------
G8AG53_AZOBR/16-114ILSNCGEDANQ--EVPH-------LHI------HVFAGR-----------------------------------------
K7XM15_MYCHR/14-110LLINNEPDAEQ--SIFH-------THV------HIIPYY-----------------------------------------
YHI2_MYCTU/11-106IAINDGRAAFQ--TVFH-------VHL------HVLPPR-----------------------------------------
Q32EW3_SHIDS/12-109LIMNTNRHGGQ--EVYH-------IHM------HLLGGR-----------------------------------------

PF04677

C3H64_ARATH/370-491VFFELV...SK--RVSH-------ANL------QVVPVP-----------------------------------------
C19L1_CAEEL/309-429VTFER....NF--RTQH-------LQV------QMVMID-----------------------------------------
C19L2_CAEEL/226-350IFFEMSRHV.D--SNPH-------VFI------ECVPVE-----------------------------------------
C19L2_DROME/460-584VFYEIANKL.H--RRPH-------LSV------HCIPIP-----------------------------------------
CWF19_SCHPO/399-523IFYENAP.SPQ--RYMH-------TAI------ECIPVS-----------------------------------------
DRN1_YEAST/256-389IVFEIQ...SE--RSIH-------FHK------QVIPVP-----------------------------------------
MU161_SCHPO/334-470LVYEIS...RA--NGVH-------LHW------QMIPIP-----------------------------------------
Q93ZX4_ARATH/458-582VFLETVIGLSQ--QRRH-------CLI------ECIPIP-----------------------------------------

PF02611

CDH_HELPY/24-243ISLTINSSKGRSQNHFH-------IHI------SCISLEARKQLDNNLKKINSRWSPLP---------------------
Q8P9Z9_XANCP/30-250VSLALNSPYGRSQEQLH-------IHI------DCLRPDVYAALQREHAQIGPQWRALA---------------------
E8V0N7_TERSS/35-269LSVAINSVSGRSQDQLH-------LHV------DCMQPAVKSALQQVAPQIGTAWQTLP---------------------
A8GL49_SERP5/45-264ISLAINSAYGRTQNQLH-------IHI------SCLLPAVKTQLAQYAADYSERWEPLP---------------------
E0SJ94_DICD3/33-253LGLAINSLYGRTQGQLH-------IHI------SCLKPEVYQTLRARNANIGYDWVSLG---------------------
CDH_YERPE/33-252ISLAINSQYGRTQDQLH-------IHI------SCLKPQVKTALAAHSADFQQQWQPLP---------------------
B8IMH8_METNO/37-256VGLAVNSIGGRSQDQLH-------IHL------DCVQPSVQAALQHYASTIGSTWAAMP---------------------
W0LHA3_9ENTR/26-254LGMAINSAYGRSQNQLH-------IHL------TCLREDVYRQLQAERPYIQDKWLPLP---------------------
B1M455_METRJ/29-249VGLAVNSARGRSQDQLH-------IHL------DCLKPSVLKAVRAHGRQVRHTWSRFP---------------------
Q1LBK3_CUPMC/33-250LGLAINARAARSQDQLH-------IHL------DCISESARDFL..ASGAFDRQWRSL.---------------------
Q6MQF2_BDEBA/30-256VSLAINSQFGRSQNQLH-------IHV------SCVKPLVQQHLQEQSAKLKNGWSLLP---------------------
G8MBN7_9BURK/67-288VSLAINSASGRTQNQFH-------IHI------DCLAHDVAQTLRELGPTIGTDWAPLP---------------------
A6TFQ8_KLEP7/24-243VSLAINSRSGRTQNHFH-------IHI------SCLRPDVRAQLDKDAAAISSRWLPLP---------------------
H2INV4_RAHAC/31-250VSLAINSQYGRSQNQLH-------IHI------SCLLPQVKTTLSKDGGQMGYNWQELP---------------------
B0U7T2_METS4/29-248VGLAVNSTSGRSQDQLH-------IHV------DCLKPSIQVALQRYAQGIRRAWTRLP---------------------
B2VF57_ERWT9/34-251YSLAVNSRWGRTQNQLH-------IHI------SCLRPDIRQRLDALSSTLDTTWQT..---------------------
B9JRW8_AGRVS/27-242LSLAVNAQNARSQNQLH-------IHI------DCLSPDAHALLTKMANDIGTDWAPLP---------------------
D8IW24_HERSS/34-253LGVEVNSAAGRSQLHLH-------LHI------DCMRRDVAASLAAHRDDPLQQWRPW.---------------------
C5BB31_EDWI9/31-247LSLTINSRAGRTQDQLH-------IHL------SCTRQAVVSQLWKIYPTLGTQWQAVS---------------------
A9HJU4_GLUDA/35-256MALAINSQYGRSQNQLH-------IHI------DCLAPNIRVALHWARPQIGHGWTRL.---------------------
B2JLJ5_BURP8/29-246LGLEINSAYRRSQQQLH-------IHM------DCMHDSVIKDLARFATVEPGQWHWT.---------------------
B1LSY8_METRJ/26-246VGLEVNSVGGRSQDQLH-------IHL------DCMRRSVVAALKAHGDAVGESWAPFP---------------------
L0IYV5_MYCSM/29-248MSLAINSAVARSQNQLH-------IHI------DCVRADIRETVNRRIADVGPDWAPFP---------------------
B8IPC5_METNO/27-247VALAVNSKGGRSQDQLH-------IHL------DCVDPSVRATLDARSGLIGSKWTRLP---------------------
B2FII5_STRMK/27-247ASLALNSPHGRSQHQLH-------IHV------DCLRADVLQALDTHAAALGSRWAPLP---------------------
CDH_CROS8/31-250VSLTINSRMGRSQNHFH-------IHI------SCLRPDVRAQLDAAMNAIGSRWQPFP---------------------
B8EQB5_METSB/40-259IAMAINGAGARSQDQLH-------IHV------DCVRSDVRDELRKRAPEIGSDWADF.---------------------
B2HIW3_MYCMM/43-260LVLTINAKNARSQDQLH-------IHI------SCSSPATLATLKEVNAADYVRWKQLP---------------------
W0HRX4_9ENTR/35-254LSLAINSAYGRTQNQLH-------IHI------SCLRPDIRERLDNDAASISTDWQPLA---------------------
E6WAG7_PANSA/33-250LSLAINSQYGRTQNQLH-------IHI------SCLRPDVRQRLDLLAPQLNEQWQS..---------------------
B1M8V7_METRJ/69-294VSLAVNARLRRSQGQLH-------IHI------DCVRLDVRDALRRLAPTIGDRWAPLP---------------------
D8MKK8_ERWBE/33-250YALSINSERGRTQNQLH-------IHI------SCLRPDIRQQLDSLSPKLTSLWQS..---------------------
Q6D6W9_PECAS/32-251ISLAINSRYGRTQNQLH-------IHI------ACLRPEIYQTLNQQFPTLSGDWKALP---------------------
D2UA62_XANAP/30-247VAIVVNAQTAHLQNQLE-------LHI------ACLRADIRQRLASVGAHWNPRWSGY.---------------------
CDH_MYCLE/38-255IFLAINPKNARTQDQLH-------IHI------SCVSPTTAEILKQVNWAEYVGWKPLP---------------------
Q13LU5_BURXL/41-259LGLEINSQYRRSQNQLH-------IHI------DCMRGDISEALAQHAKDTPGKWRWD.---------------------
Q7NQ26_CHRVO/27-251LSLAINSEYGRSQNQLH-------IHI------SCTDPTVRQQVDDLADGLKRRWRQLP---------------------
K7SS21_GLUOY/32-232LSLAINSRDGRTQDQLH-------IHI------DCLTPYVRAEIDKYM..IGEAWTPV.---------------------
Q0JZ98_CUPNH/25-246LGLAINSRASRSQDQLH-------IHL------DCISSAARAVVNGAAGPIGTGWTTL.---------------------
H8L0L3_FRAAD/32-259FGLVINSAYGRSQNQLH-------IHA------DCMQPWLVRRLADPALSRGEDWQSID---------------------
CDH_ECOLI/31-250VSLAINSRTGRTQNHFH-------IHI------SCIRPDVRKQLDNNLANISSRWLPLP---------------------
Q5FPM0_GLUOX/32-232LSMAINSRPGRTQDQLH-------IHL------DCLTAYARAELDKNM..ITETWSLV.---------------------
W0PFV2_9BURK/44-257YALTVNSKSGRSQNHLH-------IHI------SCVRPALRDRLLGMHAQFDSRWRAVP---------------------
I2BEE8_SHIBC/29-247LSLAINSPSGRSQNQLH-------IHI------SCLRKDVRQQLDHWAADAGSRWSR.A---------------------
CDH_MYCTU/41-258VVLTINPKNARTQDQLH-------IHI------SCSSPTTSAALRNVDTSEYVGWKQLP---------------------
U3U143_9ENTR/33-250LSLAINAQYGRTQNQLH-------IHI------SCLRPDVRQQLDTLAPKLNAQWQT..---------------------

PF02744

GAL7_CRYNJ/204-373FPYSMGLHQSPLPPTDPT.SNSAQVHF------HFYPPLLRSATVRKFMV.GFELLGEA---------------------
GAL7_HAEIN/183-348FPYSMGFHAAPFNGEDN...EHWQLHA------HFYPPLLRSATVRKFMV.GYEMLGEN---------------------
GALT_STRMU/231-435AEYPDGV.................YHP------HIDVQHIKKENIGLIEVMGLAILPPR---------------------
GALT_BACSU/240-451EEHPLGI.................FHP------HQEVHHIKKENIGLIEVMGLAILPGR---------------------
GAL7_YEAST/198-366FPYSMGIHQAPLNATGDELSNSW.FHM------HFYPPLLRSATVRKFLV.GFELLGEP---------------------
GAL7_KLULA/195-363FPYSMGLHQASLNATEGELKAAW.FHM------HFYPPLLRSATVRKFLV.GFELLGQP---------------------
GAL7_ECOLI/182-347FPYSMGWHGAPFNGEEN...QHWQLHA------HFYPPLLRSATVRKFMV.GYEMLAET---------------------
GALT_HUMAN/202-370FPYSMGWHGAPTGSEAGANWNHWQLHA------HYYPPLLRSATVRKFMV.GYEMLAQA---------------------

PF16285

C0ZAZ1_BREBN/8-252AGVECNLSTHPRAGFFE-------YNVIL----SDFDR.LPKMADYLQILAHWILTHVN---------------------
B2TPI8_CLOBB/11-256ECCEVNLSTKPINGFSE-------FNVII----NDDLKNTFSLSEGIRKTVYYILNNYF---------------------
C9LU44_SELS3/8-252NDVDFNIATCPRIGFSE-------FNVVP----KTNEP.LDTVADDIQIAVDYLMHHFN---------------------
D9SRU9_CLOC7/9-253NGCVLNLSSKPKASFTE-------FNIII----DDLSF.LDIMADNIQKIVHYILNNFY---------------------
Q81VH8_BACAN/8-251KNIELNISDRPIIGFTE-------FNIIV----KDIEC.IDEMANYIQQTVRYILTDFH---------------------
U5LFA6_9BACI/8-252GRSLLNISTAPKIGFYE-------FNAKL----GDMEE.IGAFAAYIQAAVRYILHSFP---------------------

PF01087

GAL7_CRYNJ/15-198CKVICFHP-RHDLTMAA-------MRI......SEINHVLDGWKDVYAEEG...KIMQE.....................
Q7QA38_ANOGA/1-174CRVMCFHP-KSNKTLPL-------MTP......KEIRNVIDAWIAEFRT.......LAQ.....................
A5DRG5_PICGU/6-197CFVICFSP-NHSLTLPL-------MTN......QQIGKVVDTWQKLYLD.......TQSDS...................
Q9CM11_PASMU/4-178SRVICFSP-DHSKTLPL-------LTV......EEIHDVIKVWQEQLLE.......LGQ.....................
Q2H1V5_CHAGB/2-211CYVLTFSP-KHDITLAD-------MTA......AEILPVIQTWTRIYASHLSTTSPLKVQADKILATIP....ANPDGEV
A4AQM0_MARSH/1-176CKVVCFSP-DHSLTLPL-------MST......EEIADVISLWQQEYKE.......LGE.....................
Q65CW7_BACLD/17-231MDITINLS-KPE.....-------.........KDPEQIKRE...RAAA.......KQS.....................
A9WJH8_CHLAA/4-191CRVVCFSP-RHDLTLAQ-------MSQ......AEVRRVVDVWVDQYNE.......LGA.....................
A7MIY8_CROS8/2-176SRVICFSP-DHSKTLPE-------LTL......PALEEVVNTWQTQTAE.......LGK.....................
Q03XA5_LEUMM/18-235LQITINLS-KPE.....-------.........KDPKAIAAALKNKNQQ.........Q.....................
A3N102_ACTP2/3-177SRVICFSP-DHSKTLPQ-------LSV......AEIEQVVQVWQEQANE.......LKT.....................
GALT_STRMU/16-225IDITINLS-KPE.....-------.........KDPKAIAAA...KLAK.........T.....................
A5DWA9_LODEL/21-211CFVICFSP-KHNLTLPL-------MSL......EELSQVVQTWQNLYND.......LLQDS...................
Q6D2C5_PECAS/1-175SRVICFSP-DHSKSLPQ-------LSL......SALKAVIDTWSEQTAE.......LGK.....................
Q1IQZ6_KORVE/1-177CRVLCFSP-RHDLTLSR-------MDP......PAIRTVVDLWSQQYVE.......LGG.....................
Q6LQE3_PHOPR/15-189SRVVCFSP-DHSKTLPE-------LSV......PAIRSVVDTWNEQIEE.......LGQ.....................
A8LEI8_FRASN/19-211CRVLCFGP-WHDRHLAA-------MGD......GELAAVVDLWIGQAAE.......LGR.....................
Q59VY3_CANAL/21-210CFVICFSP-KHNLTLPL-------MKD......GEINNVVNAWQDLYGN.......LLQES...................
A1L2D1_DANRE/7-181CKVMCFHP-WSDITLPL-------MQP......AEIRKVIDKWADLTVE.......LGA.....................
A7F8S7_SCLS1/1-208CYVLTFSP-SHNLTLAD-------LTP......AQILPVIQTWTEIYAAHLSPSSPLASVAQPTTLA.......PSGHDV
Q3XZ93_ENTFC/18-230LEITINLS-KPE.....-------.........KDPKQIAAE...REAV.........K.....................
B1YII0_EXIS2/18-230IDITINLS-KPE.....-------.........KDPREIAAA...QTEI........VE.....................
Q0RE52_FRAAA/14-191CRVVCFGP-HHGRGLVD-------MSS......YEVRAVVDTWAAQEAE.......LSE.....................
Q21LR9_SACD2/5-180ARVICFSP-DHSRSLPL-------LSI......EELNAVVSCWQEQLTE.......LKE.....................
GALT_STACT/19-233LEITINLS-KPE.....-------.........KDAKEIAKA...REAK.........Q.....................
GALT_LACPL/16-224LEITINLS-KPE.....-------.........KDPKAIAAA...RNQP.........Q.....................
A8WVF3_CAEBR/2-179CRVICYHP-DSQKTLAQ-------MSL......EEIRTVINLWHQQYVE.......LCP.....................
A2AMS2_MOUSE/3-177CKVMCFHP-WSDVTLPL-------MSV......PEIRAVIDAWASVTEE.......LGA.....................
GAL7_NEUCR/2-217CYVLTFSA-KHDTTLAD-------MSA......TEIVPVIETWTRIYASHLSASHPLRDAAARSLSEIP...PNPDGEVE
A7TJY6_VANPO/4-190CFVICFSP-KHNLTIPQ-------MKV......DELVGVVNAWQSLYNT.......LDQER...................
A6RBX1_AJECN/45-253CYVLTFSA-SHNRTLAD-------LSP......AEIKPIIDAWTDLYISHLSPTSLLAATASLMPISP.....GSPISQI
GAL7_KLULA/1-189CYVICFSP-KHNLSFPQ-------MAQ......SEIMNVVKTWTNLFQT.......LEKEA...................
Q5KY03_GEOKA/19-233LDITINLA-KPE.....-------.........KDPKEIAKL...KEMP.........S.....................
Q03PB0_LACBA/18-226LEITINLS-KPE.....-------.........KDPKAIAAA...LTQK.........K.....................
A2QCH5_ASPNC/2-209CYVLTFSA-AHNLTLAD-------LSP......AEIVPVIDAWTEIYTAHLSPKSPLAAVAPATTLPP.....NSPTASL
A6WF46_KINRD/10-216CEVVCFSS-DTRGSFGT-------LDP......RRARTVLEAWIDRTET.......LNA.....................
Q2J7D6_FRASC/3-201CRVVCFGP-RHDRGLVD-------MTP......AEVRAVVDTWAAQEEE.......LSR.....................
A3QFA6_SHELP/9-182SRVLCFSP-DHSLTLAQ-------LDP......EAMQAVIAAWQSQSEL.......LGK.....................
GALT_BACHD/21-236LEITINLS-KPE.....-------.........KDPKAIAQA...KHLQ.........A.....................
Q5WD06_BACSK/20-235LEITINLS-KPE.....-------.........KDPVAIAAA...KKVA.........P.....................
A0QYK5_MYCS2/3-199CEVICFSS-DHTGAFSQ-------LPL......PHARLVVSAWRHRTAD.......LLS.....................
GALT_LACSS/20-231LEITINLS-KPE.....-------.........KDPKQIALA...KTMK.........Q.....................
Q896X9_CLOTE/19-233MEITINLS-KPE.....-------.........KDSKDIAKA...KNVP.........Q.....................
GALT_DROME/1-175CRVMCFHP-KSNLTLPT-------MSA......AEIVVVIDEWISQFNE.......LSA.....................
GAL7_SCHPO/4-195CFVICFCP-NHNLTLPL-------MSA......EAICNVVETWKHLYVT.......LKKES...................
B8I4V5_CLOCE/19-234LEITINLT-KPE.....-------.........KDPKTIAME...RMQP.........K.....................
A3LR66_PICST/19-206CFVICFSP-NHSLTLPV-------MSI......PEITNVVEAWTSLYNS.......LQREA...................
Q7N8Y8_PHOLL/4-178SRVICFSP-DHSKTLPE-------LPV......KHIRQLIDTWNEHIEI.......LGK.....................
Q73SK2_MYCPA/2-203CEVVCFSA-DHTGSFAG-------LPP......AHARLVVQAWRHRTAE.......LMD.....................
A8FIP9_BACP2/20-233LEITINLS-KPE.....-------.........KDPKAIAQA...KKLS.........Q.....................
Q3IH81_PSEHT/3-176SRVICFSP-DHSKTLPQ-------LSI......SAITDIVKTWQSQCLE.......LGE.....................
A0M3B7_GRAFK/1-176CKVVCFSP-DHSLTLPL-------MEV......EDITRVVKMWKKEYKE.......LGA.....................
A5FKW9_FLAJ1/2-179SRVVCFSP-RHDLTLPE-------MEV......SDIENIVKTWQKEYAE.......LGS.....................
A0A0D1E3L7_USTMA/31-214CYVICFNP-QHNLTLAQ-------LSTPPFSPDQHIVPIIRSWQKIYKQ.......IPA.....................
Q15Y61_PSEA6/2-176SRVICFSP-AHNKSLPE-------LPL......PALEKVVQTWRDQVAE.......LSK.....................
Q6C0K3_YARLI/1-190CQVICFSP-KHNVTLAT-------MTV......EQIEKVIETWQKMYTE........AQ.....................
Q6BVI6_DEBHA/3-194CFVICFSP-NHNLTLPL-------MSV......EDITSVIQSWRSLYKD.......LQKEA...................
Q2GAY3_NOVAD/2-175ARVICYSP-DHSKTMPD-------MDV......AAIRSLVNCWAQESET.......LGA.....................
GALT_CLOAB/17-229LDITINLS-KPE.....-------.........KDPRDIAKA...KLSK.........S.....................
GALT_ENTFA/20-232LEITINLS-KPE.....-------.........KDARKILAE...KKMS.........Q.....................
Q30V51_DESAG/2-182CRVVCYSP-RHDLTMAR-------MQP......AQAEAVITAWQQEYAA.......LCS.....................
A9KN46_CLOPH/31-257LDITINLS-KPE.....-------.........KDPKAIAAL...LHVA.........N.....................
GALT_LACS1/18-228LEITINLS-KPE.....-------.........KDPKQIALA...KKMK.........A.....................
A0KQH7_AERHH/2-174SRVICFSP-DHGKTLPE-------LPL......PAIEQVITTWMEQVAE.......LSA.....................
A4VT89_STRSY/18-226LEITINLS-KPE.....-------.........KDPKSIAAA...TKAE.........A.....................
A5VME1_LACRD/16-220LEITINLS-KPE.....-------.........KDPKAIAAA...AHDT.........A.....................
E7KK61_YEASL/5-192CFVICFSP-NHNLTIPQ-------MKQ......SDLVHIVNSWQALTDD.......LSREA...................
G0RTP4_HYPJQ/7-208CYVLTFSP-KHNVTLAD-------MSA......KDILPTINHWTRLYAN......HL.SPSNPLSAVAAQLQLPISKEEA
Q04GZ3_OENOB/18-225LEITINLS-KPE.....-------.........KDPKAIAAA...AKQK........NR.....................
Q5KLY2_CRYNJ/11-195CKVICFHP-KHDLTIAR-------MNV......DDVVRVIGEWKNVYVEEG...RMLQE.....................
GALT_STRT2/18-226LEITINLS-KPE.....-------.........KDPKAIAAA...KNAV.........A.....................
Q5NEY1_FRATT/11-180AKVICFSA-KHNLTMAS-------MQQ......KDIVKVVDLWASEVTE.......LSK.....................
Q7MBX0_VIBVY/28-200SRVICFSP-DHSRTLPE-------LAQ......EEIEQVITTWMTQTEE.......LGQ.....................
GALT2_STRR6/16-224LEITINLS-KPE.....-------.........KDPKEIAVA...KLVQ.........A.....................
GALT1_STRR6/18-225LEITINLS-KPE.....-------.........KDPKTIAAE...KLVK.........A.....................
GALT_CLOPE/21-230MDITINLS-KPE.....-------.........KDPKEIALA...RNSV.........K.....................
GALT_LACLA/19-228LEITINLS-KPE.....-------.........KDPKAIAAA...KLVK.........A.....................
U5L509_9BACI/19-230LDITINLS-KPE.....-------.........KDPQQIARE...REMK.......VVS.....................

PF16268

F5XH95_MICPN/8-422AATVDLLAGSHDVIVPR-------RHVVDGA--ATSDQLAASGTMTPAEHADVLSYTVD----------------TLADI
C3PH27_CORA7/1-419ALADGFFGGGHDVIISS-------RHFADGA--VDDSQLASSGTLSPDEHYLLTTFTAE----------------STREL
B1VH78_CORU7/18-447EMGAALFAGGHDVVIAR-------DHYVPGA--KTTDQLASSGEMSWEDHRLFIEFTVD----------------GMDQL
Q8NNU9_CORGL/1-424EKAPSYFAGGHDVIIGR-------RHFVDDA--TTSDQLASSGTLTVKEHEAFIRLTVD----------------GIRDL
W5WQ34_9CORY/18-447EKAPALFAGGHDVIIAR-------DHYVPGA--ETTDQLASSGQLSWQDHRHFIAFTVD----------------GMDQL
W5Y1J6_9CORY/15-448HQARAFFAGGHDLIIGG-------KHFVDGA--TTNDQLASSGMLSTDEHGALMAFTVA----------------SMHDL
G0HAG7_CORVD/18-449EKGGAFFGGGHDVILAR-------DHYIPGA--TSSDQLCGSGDLGWETHRLYIAFTVD----------------AMDRL
U3GXR8_9CORY/26-464KLGWPFFAGGHDLIIGR-------RHFVDGA--THDNQLASAGTLSVDEHRTLIRFTTE----------------AITDL
Q6NGG7_CORDI/11-432PQGEAFFGGGHDLIIGQ-------RHFVPDA--TQSDQLASAGTLSPDEHFAFIFFTVD----------------ALREA
S5SVS2_9CORY/15-437K...SYFAGGHDVIVAR-------RHFADGA--TDTSQLASSGSLTTEEHFGLILLTVE----------------SIADL
B3QVF6_CHLT3/10-436SIADAFFGGSHELIIAK-------RHYIDKA--RYDTQLYSSGEMTPEEHYQYFKFTTE----------------ALSDI
Q6A5P1_PROAC/10-435EASAAFFAGGHDVIVAR-------RHYTDEG--TTTADIAGSASLSVNEHRAFMALTVD----------------SMAQL
Q8FP08_COREF/15-438ERAPSYFSGGHDVIIAR-------RHFTDDA--TDDSQLASSGTLTSDEHAAFIRFTLD----------------GMRDL
F8E0G1_CORRG/18-447EQGIGLFAGGHDVIIAR-------DHFTPDA--TTTDQLASSGSLDWQTHRHFMAFTVD----------------GMDQL
C5CBF5_MICLC/33-463AASAAFFGGTHDVVIAR-------RHFVDGA--VDDHQLASSGTLTPDEHHAFLALTAD----------------AMRDL
I6XY80_PROPF/27-452EAASGFFGGGHDVIIAR-------RHFVDGA--VDDTQLAGSGTLTPEEHEKFIAFTID----------------SVRRS
R5PXK8_9PROT/14-442KMADNFFAGGHELIIGK-------RHYIEGA--TEDNAKASSGSMSPEMHYQYMNFTIA----------------ALKDI
D7BLX6_ARCHD/14-437ELAYPLFGGGHDLIVAR-------RHFVDGA--TDTSQLASAGTLTPQEHEWYIRLTVD----------------AMHDL
D9QB86_CORP2/15-442KDASAFFGGGHDVIIAR-------RHYTDDA--THSDQPASAGTLTYEEHEAFIRFTID----------------SLRDL
X5DSS5_9CORY/40-471ELGGPLFGGGHDIILAR-------DHYVPGA--TRSDQLLSSGEMSWSDHRLYIAFTVD----------------AMDRL
M1P829_9CORY/11-432DLADAYFGGGHDVIIAR-------RHFVDGA--THDNQLASSGTLTPEEHHAFISFTVD----------------AIADL
D7GCR7_PROFC/13-438DDAIGFFAGGHDVIVAR-------RHFVDGA--TDSSQLAGSGALSPDEHAEYMRFTVD----------------TLADL
D7WEZ1_9CORY/10-431AHVPAYFGGGHDVIIGS-------RHFVDGA--QDSSQLASSGTLTPDEHHAFIAFTID----------------SLRDL
C8XCI8_NAKMY/35-455AHVEDFFGGGHDVIVAR-------RHYPDDA--ENDGQLASSGTLTPDEHDSYLRFTID----------------AQRDL
C4LIB0_CORK4/15-440KRAPAYFAGGHDVIVAR-------RHFTDDA--TSSRQLASSGTLTPEEHYQFINFTAD----------------AMRDL
K7RWS7_PROA4/29-464SESAAFFAGGHDVVVAR-------RHYTDDA--TTTAGLAGSGTLSPLEHRAFTAATVS----------------TIADL
D6ZJH6_MOBCV/17-441QYATGLFAGGHDVIVAR-------RHYVDGA--TRADQNASAGTLSVAEHRAYIGYTIA----------------TLQDL

PF11969

Q5TVU2_ANOGA/17-126--------------------------------------------------------------------------------
A5DAJ7_PICGU/3-137--------------------------------------------------------------------------------
A5DAR3_PICGU/136-257--------------------------------------------------------------------------------
Q297L1_DROPS/153-272--------------------------------------------------------------------------------
Q29LN6_DROPS/45-159--------------------------------------------------------------------------------
HINT3_RAT/40-155--------------------------------------------------------------------------------
A0EGQ1_PARTE/118-231--------------------------------------------------------------------------------
A1CEC1_ASPCL/149-272--------------------------------------------------------------------------------
A3DF72_CLOTH/3-110--------------------------------------------------------------------------------
A3LWH2_PICST/136-257--------------------------------------------------------------------------------
A4S248_OSTLU/99-229--------------------------------------------------------------------------------
APTX_DROME/4-113--------------------------------------------------------------------------------
APTX_DROME/229-339--------------------------------------------------------------------------------
A4XKP5_CALS8/3-110--------------------------------------------------------------------------------
A5D7U9_BOVIN/174-293--------------------------------------------------------------------------------
A5E770_LODEL/177-298--------------------------------------------------------------------------------
A5GQU3_SYNR3/125-230--------------------------------------------------------------------------------
A5I635_CLOBH/3-110--------------------------------------------------------------------------------
A6QUC5_AJECN/141-262--------------------------------------------------------------------------------
A6VZM3_MARMS/2-109--------------------------------------------------------------------------------
A7HMY4_FERNB/3-108--------------------------------------------------------------------------------
A7S614_NEMVE/151-270--------------------------------------------------------------------------------
A7SFV5_NEMVE/10-122--------------------------------------------------------------------------------
A7TKH2_VANPO/142-261--------------------------------------------------------------------------------
A7TQ97_VANPO/171-297--------------------------------------------------------------------------------
YHIT_CHLTR/2-108--------------------------------------------------------------------------------
APTX_CHICK/142-252--------------------------------------------------------------------------------
APTX_DANRE/150-260--------------------------------------------------------------------------------
APTX_XENTR/173-283--------------------------------------------------------------------------------
APTX_CIOIN/206-317--------------------------------------------------------------------------------
Q0U2I6_PHANO/148-269--------------------------------------------------------------------------------
Q15X15_PSEA6/3-110--------------------------------------------------------------------------------
Q16F07_AEDAE/8-123--------------------------------------------------------------------------------
Q16XY1_AEDAE/224-343--------------------------------------------------------------------------------
Q16YN6_AEDAE/11-125--------------------------------------------------------------------------------
Q18227_CAEEL/10-129--------------------------------------------------------------------------------
Q1CY35_MYXXD/3-112--------------------------------------------------------------------------------
Q1QZ40_CHRSD/2-109--------------------------------------------------------------------------------
HINT3_XENTR/18-132--------------------------------------------------------------------------------
Q2H2H7_CHAGB/31-147--------------------------------------------------------------------------------
Q2H304_CHAGB/151-275--------------------------------------------------------------------------------
HINT3_BOVIN/47-162--------------------------------------------------------------------------------
Q3IJU5_PSEHT/4-111--------------------------------------------------------------------------------
A0A0D1DZS3_USTMA/46-158--------------------------------------------------------------------------------
Q54DF5_DICDI/36-141--------------------------------------------------------------------------------
Y2839_DICDI/224-348--------------------------------------------------------------------------------
Q59S51_CANAL/134-254--------------------------------------------------------------------------------
Q5TUI6_ANOGA/154-273--------------------------------------------------------------------------------
A8XGQ1_CAEBR/148-267--------------------------------------------------------------------------------
Q6BZT0_YARLI/136-263--------------------------------------------------------------------------------
Q6C515_YARLI/4-127--------------------------------------------------------------------------------
Q6C6M8_YARLI/30-153--------------------------------------------------------------------------------
Q6CJA1_KLULA/160-286--------------------------------------------------------------------------------
Q6FLB9_CANGA/198-323--------------------------------------------------------------------------------
Q6FWT2_CANGA/170-296--------------------------------------------------------------------------------
Q6IIA4_DROME/5-118--------------------------------------------------------------------------------
Q74ZD1_ASHGO/153-277--------------------------------------------------------------------------------
Q7PHF8_ANOGA/7-116--------------------------------------------------------------------------------
Q7QJM2_ANOGA/10-124--------------------------------------------------------------------------------
Q83DE2_COXBU/3-109--------------------------------------------------------------------------------
Q84VV6_ARATH/7-121--------------------------------------------------------------------------------
Q8GYJ9_ARATH/75-183--------------------------------------------------------------------------------
Q8SUA2_ENCCU/116-232--------------------------------------------------------------------------------
Q97JJ3_CLOAB/3-110--------------------------------------------------------------------------------
BH140_ARATH/717-833--------------------------------------------------------------------------------
DCPS_SCHPO/141-261--------------------------------------------------------------------------------
E7KRX8_YEASL/160-281--------------------------------------------------------------------------------
E7KUH0_YEASL/160-281--------------------------------------------------------------------------------
F1R776_DANRE/159-276--------------------------------------------------------------------------------
F7CC42_XENTR/161-276--------------------------------------------------------------------------------
H3C365_TETNG/54-161--------------------------------------------------------------------------------
H3CJX6_TETNG/127-244--------------------------------------------------------------------------------
H3DP42_TETNG/31-141--------------------------------------------------------------------------------
Q0JBF2_ORYSJ/25-136--------------------------------------------------------------------------------
Q5K774_CRYNJ/143-255--------------------------------------------------------------------------------
Q9VQ59_DROME/32-141--------------------------------------------------------------------------------

PF01230

HINT1_RAT/24-121--------------------------------------------------------------------------------
HNT2_YEAST/12-107--------------------------------------------------------------------------------
FHIT_HUMAN/11-105--------------------------------------------------------------------------------
APH1_SCHPO/12-106--------------------------------------------------------------------------------
APTX_YEAST/15-139--------------------------------------------------------------------------------
Q9I500_PSEAE/74-166--------------------------------------------------------------------------------
Q98BM9_RHILO/14-106--------------------------------------------------------------------------------
Y866_METJA/9-105--------------------------------------------------------------------------------
YHIT_MYCPN/19-116--------------------------------------------------------------------------------
APTX_SCHPO/44-156--------------------------------------------------------------------------------
YHIT_HELPY/9-104--------------------------------------------------------------------------------
HNT1_YEAST/32-125--------------------------------------------------------------------------------
Q9A2A9_CAUCR/9-106--------------------------------------------------------------------------------
YHIT_SYNY3/12-109--------------------------------------------------------------------------------
Y1390_SYNE7/12-109--------------------------------------------------------------------------------
YHI1_MYCLE/10-102--------------------------------------------------------------------------------
Y961_HAEIN/12-110--------------------------------------------------------------------------------
Q9JYE4_NEIMB/10-102--------------------------------------------------------------------------------
Q9KQC5_VIBCH/14-106--------------------------------------------------------------------------------
ZB14_MAIZE/24-123--------------------------------------------------------------------------------
HINT_CAEEL/28-125--------------------------------------------------------------------------------
G8AG53_AZOBR/16-114--------------------------------------------------------------------------------
K7XM15_MYCHR/14-110--------------------------------------------------------------------------------
YHI2_MYCTU/11-106--------------------------------------------------------------------------------
Q32EW3_SHIDS/12-109--------------------------------------------------------------------------------

PF04677

C3H64_ARATH/370-491--------------------------------------------------------------------------------
C19L1_CAEEL/309-429--------------------------------------------------------------------------------
C19L2_CAEEL/226-350--------------------------------------------------------------------------------
C19L2_DROME/460-584--------------------------------------------------------------------------------
CWF19_SCHPO/399-523--------------------------------------------------------------------------------
DRN1_YEAST/256-389--------------------------------------------------------------------------------
MU161_SCHPO/334-470--------------------------------------------------------------------------------
Q93ZX4_ARATH/458-582--------------------------------------------------------------------------------

PF02611

CDH_HELPY/24-243GGLNG..HKYLARRVTESELVQ..KSPFVMLNKEVP.NAYKRMGDYGLAV..VQQSDNS..FVLLATQFNPLTL......
Q8P9Z9_XANCP/30-250EPLLG..HVYLARTLPGDTLN...EDPIRLLASAIP..ADASLRDYSLVVAGAQLDEGQPGFVLLATRQDAATG......
E8V0N7_TERSS/35-269VRLRG..DEYRAMWLPGADLDT..RNPFRLLADSLS.DPAREMGNHTLVLVGAERL.GKDGFILLDGKAPALATAISSWL
A8GL49_SERP5/45-264GGLLG..HDYLVRRVTPEELHK..QGAFRLLADEVA.RSKGRMGSFGLAM..TALPGGD..FLLLATERSLLPF......
E0SJ94_DICD3/33-253QPLLG..HDYLAIKLNGSDLTR..TDPFKLLNQYVQ.TREDRMENYGLAL..TANTQGE..LILLAVRRDFIGL.....F
CDH_YERPE/33-252GGLLG..HDYWVRRITATELQQ..PGPFHLLADEMP.GAKEQMGRYGLAI..TALPSGD..FLLLANKASLITQ......
B8IMH8_METNO/37-256IALQG..SRFFALRVGADQMRD..LNPFAALGH.LP.GRRTELRDTSLAMISVSGESGTRDFVLLAYRDPE.........
W0LHA3_9ENTR/26-254DKLLR..HTYYARRVVQPAAMG..IYPIKSVADYFQ.LSPQQLAEYGVALVPTLFS.GQKGFILLTTKRGWDSG......
B1M455_METRJ/29-249VPLAG..DRYYALRVPEAEAAQ..FNPFAALHT.LP.GARPDLHRTSFAALATPPGDPEPGYILLAYRAPS.........
Q1LBK3_CUPMC/33-250.TFRG..KPVRVRLIPSDDPVLA.VDPFDVVREDL..GADGKIADRGVFLGYVRPLQGQAGFVVVDEPVDKAGG......
Q6MQF2_BDEBA/30-256QPLLG..HKYYARKVSEKELEK..GNAFQMLADGVP.GAKDHSGEFGLGLVAVKDKKKGHSLILLTSRFERGTN......
G8MBN7_9BURK/67-288VRLRG..HVYSAMRIDDADLTH..TDPFKLLAPYAA.SRGQTMGEQTLLLAGATRGDGAPVFILLNDHVQPG........
A6TFQ8_KLEP7/24-243GGLQG..HEYLARRVTEAELAQ..RSPFLMLAEEVP.EARQHMGRFALAM..AQQSDGS..LVLLATERNLLTL......
H2INV4_RAHAC/31-250DKLLG..HTYLARKVTQAELNE..KGAFRLLAEGVP.DAQKKMGHFGMAM..VSLPGGD..FLLLASERDLLKL......
B0U7T2_METS4/29-248MIVQG..SPLYAMRVEAPDVQI..FNPFAELTK.LP.GSSGSLSDVTFAAVSATNGV.RGDLYLLAYRQKY.........
B2VF57_ERWT9/34-251HRLGE..HDYQLRVVTRDEFKR..TSPFIRLAHELP.GARDHMGHYGLAV..AALGDGK..RVLMVVKRNVLLL......
B9JRW8_AGRVS/27-242GTVAG..HHFIAMKVEGDTLAG..YNPFLALAKTLK.DPSTEMASHNLVVVGASFASG.PGFIILSDIAPAATI......
D8IW24_HERSS/34-253.HFEG..HRYWVMRLPAEALAQ..HDPFKLAAARSA.YAAANMASQSLLLTGARFADGGSGFFLVNMPVNFDLQ......
C5BB31_EDWI9/31-247NGING..HPYWARRLSNETLAR..ESPFILLSRLN..GAHDDMAAYGLAL..LPAPDGQ..LILLATRRALWRG......
A9HJU4_GLUDA/35-256.VLND..HTYRATRIDGNSLDG..AYPFRRLAASLA.DPAREMGEHTLVVVGTVWPGGRPGFILLDDMVKPLSG......
B2JLJ5_BURP8/29-246.TLDG..NRYRVMRVLSLTGAD...DPFRIVARDR..QGSDAMAQQTILVTGAGPTD.KDGWLVVNSGPELDDG......
B1LSY8_METRJ/26-246VPLEE..VSYVAMRVPADAMAA..FNPFAALAR.VP.GWQGRLHDASFAAVEADPGDPRGGMILLAYREPE.........
L0IYV5_MYCSM/29-248EPLRG..HPYQAMAVEGDTFDV..TNPVQLLA.....KRADDMGLETLVVIGAYLPDGRPGFVLLASRADPAAG......
B8IPC5_METNO/27-247FGLEG..DHYYALRVGAMNARD..FNPFAALAH.LP.ATRGGLSATSLAVVATSPNDPHPGFYILAYQAPR.........
B2FII5_STRMK/27-247VLLRG..HQYQARLLAGAELT...ANPLNLLAYDL..AGVDDVGQWSLVVAGRDAVQGGPGFILLATRVDAGTG......
CDH_CROS8/31-250GSLRG..HDYLARRVSGEELSR..RSPFMMLAEEVP.QAREHMGRYSLAL..APLKDGA..FVLLATQRQLLQF......
B8EQB5_METSB/40-259.RMFG..QNYRARRMKGEEPQ...PDPFRLLAED...PRSLPLRDNSLAVIGASFADGAPGFIAIAQQAPGGA.......
B2HIW3_MYCMM/43-260VDLGG..HSYHVLAVNTDTLKS..KNLFRDIHDKVA.ADGKKMENASVALANVAPDR....FLLLVVEGTDEDP......
W0HRX4_9ENTR/35-254QPVLG..HEYLAKRISAAGLAA..QSPFLLLAREVP.EASEEMGEFGMAL..TPLPDGS..LVLLASQRSLLHR......
E6WAG7_PANSA/33-250ETLQN..HRYQIRTLTTAQLAQ..QSVFIRLATEVP.DARSEMGKYGMAL..AALPDGR..LALMAIERNWARL......
B1M8V7_METRJ/69-294EPLVG..RPFRAMRVLGDDLDA..ADPFDLLARDG..DARAAMGEHSLAVVGAEFPGGKPGFVLLDGLVTSRFG......
D8MKK8_ERWBE/33-250EQLAG..HTYQVRAVTRDEIKK..MSPFLRLAREIP.GAREEMYKYGIAV..AALPDGR..RVMMVIKRNLLLM......
Q6D6W9_PECAS/32-251VKING..HIYLAKTLTANELTQ..SDPFKTLDRYAQ.QRNESIGKYGLAM..VSMPAGE..KVLLASSLDVFNM......
D2UA62_XANAP/30-247.WLQG..HHYYLRTLSEEELIQ..RSPFIRLAEELP.ENPVKLERYGLAL..SRLQDGR..FVLLALPRTLLGR......
CDH_MYCLE/38-255VTLQD..HTYQALAVNRSTFES..KSLFRDIQTKVT.ADGNTMDHASVAVANIAPDQ....FLLLVAEGTEDQA......
Q13LU5_BURXL/41-259.TLDG..KRYRIMRVTALTQTD...NPFRIVAQDN..QGEGTMATQTILVTGAGPSAEQDGWLVVNSGIDVDNG......
Q7NQ26_CHRVO/27-251VELKG..HAYWARRVDADQNGDPLDDPFRLLANELP.GARAEMGRYGMAMLPARFADGEG.FVLLATRSDLLEI......
K7SS21_GLUOY/32-232.SLYG..HPYRARLVQTLD.....PSPFRLIGD.......TEMADHTIVVTPGHHGG....FVILDDVAHAL........
Q0JZ98_CUPNH/25-246.RLED..KPVRAIFVPASAPVLA.VDPFQLVRDGTKGGAAAAPPDRGIFVTYVRERQGGAGFVVIDQPVDSAAG......
H8L0L3_FRAAD/32-259LPLDGAIRHFQLRWLPGEQLS...VNPFRLLAEHL..SAGDDMASHSLVLIGGYDPRHRPGFFLLSGHHDAATG......
CDH_ECOLI/31-250GGLRG..HEYLARRVTESELVQ..RSPFMMLAEEVP.EAREHMGRYGLAM..VRQSDNS..FVLLATQRNLLTL......
Q5FPM0_GLUOX/32-232.SLYG..HPYRARIVPSLD.....PSPFRVIAA.......DDMSIHTLVITPAKHGG....FILLDDMAHVF........
W0PFV2_9BURK/44-257GGING..HAYQVRTLSLNELEQ..RGPIALTITSLP.QARQDMANVSLALYPLSEQQ....FLLFADHRYGA........
I2BEE8_SHIBC/29-247GNLAG..HPYLARKVSRETLVE..DGPFILLANEIP.GARQNMGAWSLAL..ASLGDNS..FVLLATERDYLTL......
CDH_MYCTU/41-258IDLGG..RRFQGLAVDTKAFES..RNLFRDIYLKVT.ADGKKMENASIAVANVAQDQ....FLLLLAEGTEDQP......
U3U143_9ENTR/33-250ATLLR..HRWLIHTLITAELAQ..QSVFIRLAEEVP.HARGEMGKYGLAL..AQLPDGR..LALLALERNWLKL......

PF02744

GAL7_CRYNJ/204-373QRDIVPEQAAVRLR........----------------------------------------------------------
GAL7_HAEIN/183-348QRDLTAEQAAERLR........----------------------------------------------------------
GALT_STRMU/231-435LKKELAEVEKYVLNQ.......----------------------------------------------------------
GALT_BACSU/240-451LQEEMKETAAALCSADPKTALE----------------------------------------------------------
GAL7_YEAST/198-366QRDLTSEQAAEKLR........----------------------------------------------------------
GAL7_KLULA/195-363QRDLTAEQAADRLK........----------------------------------------------------------
GAL7_ECOLI/182-347QRDLTAEQAAERLR........----------------------------------------------------------
GALT_HUMAN/202-370QRDLTPEQAAERLR........----------------------------------------------------------

PF16285

C0ZAZ1_BREBN/8-252---PRHQSYNFFFYHWGEKLIAKVVP-------------------------RFVTSPLYVGYSIPQVA------------
B2TPI8_CLOBB/11-256---AKCDSFNLFFYHWNNKIICKITP-------------------------RFVTSPLLLGYSLKQVS------------
C9LU44_SELS3/8-252---KRCNSYNIFFYQERGVLRAKIMP-------------------------RFATSPLFIGYNIRFRP------------
D9SRU9_CLOC7/9-253---VKCDSFNLFFYDWKGKLICKAVP-------------------------RFVTSPLFIGFSIGQVS------------
Q81VH8_BACAN/8-251---KGCSSYNLFFYHVSGKIICKVVP-------------------------RFVVSPLYVGYKIPQVS------------
U5LFA6_9BACI/8-252---FKCSSYNLFFYKLGEDIYAKIVP-------------------------RFVTTPIYIGYSIPQVP------------

PF01087

GAL7_CRYNJ/15-198...ESSDGCVQIFENRGAMMGCSAPH-------------------------P............................
Q7QA38_ANOGA/1-174.....RYQWVQIFENKGATMGCSNPH-------------------------P............................
A5DRG5_PICGU/6-197VEGKAPYKYLQIFENKGFAMGCSNPH-------------------------P............................
Q9CM11_PASMU/4-178.....KYQWVQIFENKGAAMGCSNPH-------------------------P............................
Q2H1V5_CHAGB/2-211DPPQNQLRYMQIFENKGAAMGCSNPH-------------------------P............................
A4AQM0_MARSH/1-176...NESINHVQIFENKGDVMGCSNPH-------------------------P............................
Q65CW7_BACLD/17-231...RSYPMCLLCKENEGYAGRIG..Y-------------------------PARANHRIIKVPLAGENWYFQYSPYAYYN
A9WJH8_CHLAA/4-191...IDWVQSVLIFENRGAMMGASNPH-------------------------P............................
A7MIY8_CROS8/2-176.....TYPWVQVFENKGAAMGCSNPH-------------------------P............................
Q03XA5_LEUMM/18-235...SQYPVSQLAKENEGYWGRLD..Y-------------------------AARTNHRVIPITLGHEKWYFQYSPYAYFN
A3N102_ACTP2/3-177.....RYQWVQIFENKGSMMGCSNPH-------------------------P............................
GALT_STRMU/16-225...SNYPKCQLCMENEGYQGRIN..Y-------------------------PARANHRIIRMNLGDEKWGFQYSPYAYFN
A5DWA9_LODEL/21-211KAKGLPYKYLQIFENKGFAMGCSNPH-------------------------P............................
Q6D2C5_PECAS/1-175.....RYPWVQVFENKGTMMGCSNPH-------------------------P............................
Q1IQZ6_KORVE/1-177...KSWINYVQIFENRGEMMGASNPH-------------------------P............................
Q6LQE3_PHOPR/15-189.....DYVWVQAFENKGSAMGCSQPH-------------------------P............................
A8LEI8_FRASN/19-211.....VWRWVQIFENRGAAMGASSPH-------------------------P............................
Q59VY3_CANAL/21-210NQDIAPYKYLQIFENKGAAMGCSNPH-------------------------P............................
A1L2D1_DANRE/7-181.....TYAWVQIFENKGAMMGCSNPH-------------------------P............................
A7F8S7_SCLS1/1-208GAPNQQYKWMQIFENKGAAMGCSNPH-------------------------P............................
Q3XZ93_ENTFC/18-230...VDYPTCMLCMENEGYRGRLN..Y-------------------------PARTNHRIIRMNLDGESWGFQYSPYAYYN
B1YII0_EXIS2/18-230...STYPTCLLCVENVGYAGRSN..H-------------------------PARANHRIVPLTLSGESWALQYSPYVYYN
Q0RE52_FRAAA/14-191.....RWRWVQVFENRGTAMGASNPH-------------------------P............................
Q21LR9_SACD2/5-180.....SCSWVQIFENKGAAMGCSNPH-------------------------P............................
GALT_STACT/19-233...SSYPANALCMENEGFVGSVT..Q-------------------------AARRNHRIVRLNLNHQPWGFQFSPYAYFP
GALT_LACPL/16-224...DGYPLCQLCMQNEGYLGRLG..Y-------------------------PARSNHRIIRLTLGGNTWGFQYSPYAYFN
A8WVF3_CAEBR/2-179.....KYDWVQIFENRGAVVGCSNMH-------------------------P............................
A2AMS2_MOUSE/3-177.....QYPWVQIFENKGAMMGCSNPH-------------------------P............................
GAL7_NEUCR/2-217PAKKQQLRYMQIFENKGAAMGCSNPH-------------------------P............................
A7TJY6_VANPO/4-190.KEGNPYKFLQIFENKGTAMGCSNLH-------------------------P............................
A6RBX1_AJECN/45-253SLPKHQLRYMQIFENKGSAMGCSNPH-------------------------P............................
GAL7_KLULA/1-189LEENKPYKYLQIFENKGTAMGCSNLH-------------------------P............................
Q5KY03_GEOKA/19-233...SSYPKCVLCKENEGYEGTWR..H-------------------------PARSNHRVIPITLLDEQWYFQYSPYVYYN
Q03PB0_LACBA/18-226...TSYPLDQLCMTNEGYLGRLG..Y-------------------------PARSNHRIVRMMLGGETWGFQYSPYAYFS
A2QCH5_ASPNC/2-209TKPKEQYRYMQIFENKGAAMGCSNPH-------------------------P............................
A6WF46_KINRD/10-216...TDGVEQVFVFENRGEEIGVTLPH-------------------------P............................
Q2J7D6_FRASC/3-201.....TWRWVQVFENRGTAMGASNPH-------------------------P............................
A3QFA6_SHELP/9-182.....KYLWVQVFENKGAAMGCSNPH-------------------------P............................
GALT_BACHD/21-236...SSYPKCLLCKENVGYRGRVN..H-------------------------PARQNLRVIPVELNQEQWYMQFSPYVYYN
Q5WD06_BACSK/20-235...SDYPKGLLAKENVGFAGRAT..H-------------------------PARQNLRLIPVTLGNEQWYMQFSPYVYYE
A0QYK5_MYCS2/3-199...RNGIEQVFCFENRGEAIGVTLNH-------------------------P............................
GALT_LACSS/20-231...TGYPKCQLCLENEGYAGRLD..F-------------------------PARRNHRIVRFDLEQQTWGFQYSPYAYFN
Q896X9_CLOTE/19-233...ISYPKCPLCLENVGYKGRLD..H-------------------------PARQNHRVIPVELEEEKWYLQYSPYVYYK
GALT_DROME/1-175.....KYAWVQIFENKGAAMGCSNPH-------------------------P............................
GAL7_SCHPO/4-195LEGPIRYKYLQIFENKGSAMGCSNPH-------------------------P............................
B8I4V5_CLOCE/19-234...SNYPECMLCIDNIGYAGRIN..F-------------------------PPRQTHRLMPVTLCGEQWYLQYSPYVYYN
A3LR66_PICST/19-206LSGNAPYKYLQIFENKGFAMGCSNPH-------------------------P............................
Q7N8Y8_PHOLL/4-178.....EYLWVQVFENKGEAMGCSQPH-------------------------P............................
Q73SK2_MYCPA/2-203...TPGIEQVFCFENRGEEIGVTLTH-------------------------P............................
A8FIP9_BACP2/20-233...KQYPLCLLCKENVGFEGRVN..H-------------------------PARQNHRIIPVSLSGESWFLQFSPYVYYN
Q3IH81_PSEHT/3-176.....KYNWVQVFENKGAMMGCSNPH-------------------------P............................
A0M3B7_GRAFK/1-176...VENINYVQIFENKGAIMGCSNPH-------------------------P............................
A5FKW9_FLAJ1/2-179...IKYINHVQIFENKGSVMGCSNPH-------------------------P............................
A0A0D1E3L7_USTMA/31-214..ENPFVKYIQIFENKGSAMGCSNPH-------------------------P............................
Q15Y61_PSEA6/2-176.....DYTWVQVFENKGAAMGCSNPH-------------------------P............................
Q6C0K3_YARLI/1-190...SRGIKYSLIFENKGATMGCSNPH-------------------------A............................
Q6BVI6_DEBHA/3-194QDGPVKYKYLQIFENRGFAMGCSNPH-------------------------P............................
Q2GAY3_NOVAD/2-175.....HFANVQIFENKGAMMGCSSPH-------------------------P............................
GALT_CLOAB/17-229...TSYPKCLLCKENEGFYGNIN..H-------------------------PARQTLRIIPLELNKSKWFLQYSPYTYYN
GALT_ENTFA/20-232...KKYPACMLCMENEGYYGRVN..Y-------------------------PARTNHRIIRLNLEDEAWGFQYSPYAYYN
Q30V51_DESAG/2-182...RQDIGYVQIFENRGAMMGCSNPH-------------------------P............................
A9KN46_CLOPH/31-257...TEYPACQLCKENEGYAGRVN..H-------------------------PARNTLRTIPITIQEDPWFLQYSPYVYYN
GALT_LACS1/18-228...SGYPLCQLCMENEGYQGRIN..Y-------------------------PARANHRIIRFDLDDKQWGFQYSPYAYFN
A0KQH7_AERHH/2-174.....QWEWVQVFENKGAVMGCSNPH-------------------------P............................
A4VT89_STRSY/18-226...SNYPKCLLCMENEGYQGRIN..H-------------------------PARANHRIIRLELGQEKWGFQYSPYAYYN
A5VME1_LACRD/16-220...KKYPQCALCMENEGYRGRLGQAA-------------------------RSNHRIIRITVGGQ..QWGFQYSPYAYFH
E7KK61_YEASL/5-192RENHKPFKYVQIFENKGTAMGCSNLH-------------------------P............................
G0RTP4_HYPJQ/7-208PVPKDNYRYMQIFENKGAAMGCSNPH-------------------------P............................
Q04GZ3_OENOB/18-225...SSYPLDQLCLENEGYLGRLD..Y-------------------------PARSNHRIIRLTLGGETWGFQYSPYAYFQ
Q5KLY2_CRYNJ/11-195...SSGQGYVQIFENRGAMMGASAPH-------------------------P............................
GALT_STRT2/18-226...SDYPKCQLCMENEGYLGRIN..H-------------------------PARSNHRVVRFQMEDKEWGFQYSPYAYFN
Q5NEY1_FRATT/11-180.....KYQWVQVFENKGSIMGCSNSH-------------------------P............................
Q7MBX0_VIBVY/28-200.....RYPWVQVFENKGESMGCSQPH-------------------------P............................
GALT2_STRR6/16-224...SNYPQCQLCLENEGYHGRVN..H-------------------------PARSNHRIIRFEMVGQEWGFQYSPYAYFN
GALT1_STRR6/18-225...TNYPKCLLCMENEGYQGRIN..Y-------------------------PARSNHRIIRLKLGDEVWGFQYSPYLYFN
GALT_CLOPE/21-230...SNYPKCLLCIENEGYEGTVT..H-------------------------PDRANHRMIRLDLNDRTWMLQYSPYLYYN
GALT_LACLA/19-228...SSYPACQLCLENEGFYGIGN..K-------------------------PARSNHRIIQVSINGEDWGFQYSPYAYFN
U5L509_9BACI/19-230...SNYPKCLLCAENEGYAGRPG..H-------------------------PARSNHRIIDLELSDEPWFLQYSPYVYYN

PF16268

F5XH95_MICPN/8-422FRAQPAAAYVAVFQNWLPPAGASLEHLHKQLVAIDSYGPQVRHEAALLSGDPQLYQHAVLDLAVKEHLVVAANDHAIALA
C3PH27_CORA7/1-419YQRNRYASYVAVFQNWLAPAGASFDHLHKQLVAIDALGMAAHQENAILRAHPNMYNDWAVGYAAKRNLVIAENDYAVLFA
B1VH78_CORU7/18-447YRANRYVRYVAAFQNWLEPSGATMEHLHKQLVAIDEHGLQNDWEISLVRNNPNMYNEWAVDYAARHNLVFAENEHAIAFA
Q8NNU9_CORGL/1-424YHRNRYAPYVVAFQNWLKPAGASFDHLHKQLVAIDERGRLIADELHHLRGNPNMYNELAVDYAGYHNLIIAENDHAVAFA
W5WQ34_9CORY/18-447YRANRYVRYVAAFQNWLAPAGASFEHLHKQLVAIDEHGLQNEMEIAQVRSNPNMYNEWAVDYASRHNLVFAENDHAVAFA
W5Y1J6_9CORY/15-448YQRNRYAPYVAVFQNWLKPAGASFDHLHKQLVAIDERGVQAEMEIARLRSNPNMYNEWAVDYAATQNLIIAENDHAVMFA
G0HAG7_CORVD/18-449YRANPYVRYVAAFQNWLAPAGASVEHLHKQLVAIDEHGLQNETEIAQVRSNPNMYNEWAVDYAGHHNLIFAENDHAIAFA
U3GXR8_9CORY/26-464YGSNRYVPYVAAFQNWLKPAGASFDHLHKQLVAIDERGVQQSQEIAQLRHNPNMYNEWAVDYAGYHNLVIAENDHAVCFA
Q6NGG7_CORDI/11-432YQRNRYAPYVAVFQNWLKPAGASFDHLHKQLVAIDERGVHGETEIAKLRNYPNMYNEWAVDYAGQRNLIIAENDHAVCFA
S5SVS2_9CORY/15-437YARNRYVPYVAAFQNWLAPAGASFDHLHKQLVAIDERGVQSALEIERLRRNPNMYNEWAVDYAGYHNLTIAENDHAVMVA
B3QVF6_CHLT3/10-436YTNNRYVRYVSVFQNWLKLAGASFDHIHKQLVGLDSWSLSIENQIQMVRDNPNIFNEYGPNFAIHHNLVFAENNYAIAYA
Q6A5P1_PROAC/10-435HRHNEHVRYVVVFQNWLKPAGASFDHLHKQVVAIDEVGADNESVLPKAVLDPGIFNRWGPDFAVEHGLVLACNDGAVMTV
Q8FP08_COREF/15-438YARNRYAPYVVAFQNWLKPAGASFDHLHKQLVAIDERGYQNDVELAQLRHNPNMYNEWGVDYAGYHNLIIAENDHAVAFA
F8E0G1_CORRG/18-447YRANRYVRYVAAFQNWLAPAGASFDHLHKQLVAIDEHGLQNETEIAQVRSNPNMYNEWAVDYAARHNLIIAENEHAIAFA
C5CBF5_MICLC/33-463YATTPAVRYVSVFQNWLKPAGASFDHLHKQLVAIDEVGAQNAAALDRLREDPQVFNHAALDVAVAHDLVIAANEHAVMFA
I6XY80_PROPF/27-452YENNRYARYVTVFQNWLKPAGASFDHLHKQLVAIDERGVQHEVALARLRQDPNLFNEVGPNYAGYHNLIVAENDHAVAFA
R5PXK8_9PROT/14-442YLNNRYVRYVTVFQNWLNQAGASFDHLHKQLVAIDCISASNENEFQLARENPNIYNDFAVNYAGYQNLIFAENDYAVAFA
D7BLX6_ARCHD/14-437YQQNRYARYVQVFQNWLKPAGASFDHLHKQLVAIDQRSVNGKLEVERVRQNPNLYNEAAVDYAGYHNLVLAENRHAVAIA
D9QB86_CORP2/15-442YSRNRYAPYVAVFQNWLKPAGASFDHLHKQLVAVDERGVHSEMEVQKLRQNPNMYNEWAVDFAAMHNLVIAENDHAICFA
X5DSS5_9CORY/40-471YRANPYVRYVAAFQNWLEPAGASIEHLHKQLVAIDEHGLQNETEIAQVRANPNMYNQWAVDYAGHHNLIVAENDHAIAFA
M1P829_9CORY/11-432YHRNRYVPYVAAFQNWLAPAGASFDHLHKQLVAIDERGVQAETEIERLRRNPNLYNEWAVDYAGYRNLIIAENDHAICFA
D7GCR7_PROFC/13-438YRQNRYARYVAVFQNWLRPAGASFDHLHKQLVAIDQHGTQAAGEVERLRSNPNIYNDLLLGTAVQHNLVIAENDSAIVFA
D7WEZ1_9CORY/10-431YERNRYAPYVSVFQNWLAPAGASFDHLHKQLVAIDERGVQADFEIDKLRQNPNIYNEWGINYASYHNLIIAENDHAVMTA
C8XCI8_NAKMY/35-455YATNPYVRYVAVFQNWLRPAGASFDHLHKQLVAIDERGMQAELEIQRARANPNVYNEFAVDYAAQHNLTVTENDHAVAFA
C4LIB0_CORK4/15-440YSRNRYARYVAVFQNWLKPAGASFDHLHKQLVAIDERGAQAELEIARLRSNPNMYNEWAVDYAGYHNLVIAENTHAIAFA
K7RWS7_PROA4/29-464YASNPEARYVVAFQNWLKPAGASFDHLHKQLVAIDEIGHSNDEVLSRVAADPAMFNQWGPDFAIDHNLVLAANDHAVAFV
D6ZJH6_MOBCV/17-441YKLNPAVKYVTAFQNWLRPAGASFDHLHKQLVAVDEYGVQIEAEAARVAADPAIYRRI.LHYVTHRQMMILGNDYAVGFA

PF11969

Q5TVU2_ANOGA/17-126----FDSPCL---KRRHH--------------------------------------------------------------
A5DAJ7_PICGU/3-137----FESPCL---KHKKH--------------------------------------------------------------
A5DAR3_PICGU/136-257----HPGLGE---GTNVG--------------------------------------------------------------
Q297L1_DROPS/153-272----NDAPGI---W..CE--------------------------------------------------------------
Q29LN6_DROPS/45-159----SEMSI.---WNRIN--------------------------------------------------------------
HINT3_RAT/40-155----KEFGF.---LSRVV--------------------------------------------------------------
A0EGQ1_PARTE/118-231----QMG...---..QAF--------------------------------------------------------------
A1CEC1_ASPCL/149-272----LEA.GA---TQATG--------------------------------------------------------------
A3DF72_CLOTH/3-110----......---GVDMG--------------------------------------------------------------
A3LWH2_PICST/136-257----HPGLGD---GIAVG--------------------------------------------------------------
A4S248_OSTLU/99-229----AKEQGC---A..CE--------------------------------------------------------------
APTX_DROME/4-113----FVSTSL---KTKKH--------------------------------------------------------------
APTX_DROME/229-339----FYSMAM---KRISH--------------------------------------------------------------
A4XKP5_CALS8/3-110----......---GRKFS--------------------------------------------------------------
A5D7U9_BOVIN/174-293----FEAPGA---G..VE--------------------------------------------------------------
A5E770_LODEL/177-298----HPGLGD---GANIG--------------------------------------------------------------
A5GQU3_SYNR3/125-230----......---GRPLA--------------------------------------------------------------
A5I635_CLOBH/3-110----......---GRNLQ--------------------------------------------------------------
A6QUC5_AJECN/141-262----LEG.GT---TQSTG--------------------------------------------------------------
A6VZM3_MARMS/2-109----......---GRAMT--------------------------------------------------------------
A7HMY4_FERNB/3-108----......---GRKLG--------------------------------------------------------------
A7S614_NEMVE/151-270----FDAPGS---G..SG--------------------------------------------------------------
A7SFV5_NEMVE/10-122----SQMRF.---ASRHI--------------------------------------------------------------
A7TKH2_VANPO/142-261----HLGLGN---GIVAG--------------------------------------------------------------
A7TQ97_VANPO/171-297----HAGLED---NMAAG--------------------------------------------------------------
YHIT_CHLTR/2-108----......---GGLLG--------------------------------------------------------------
APTX_CHICK/142-252----FDSPAL---KTKKH--------------------------------------------------------------
APTX_DANRE/150-260----FDSPCL---KNKKH--------------------------------------------------------------
APTX_XENTR/173-283----FDSPCL---KNKKH--------------------------------------------------------------
APTX_CIOIN/206-317----FQSSSF---KTKKH--------------------------------------------------------------
Q0U2I6_PHANO/148-269----LEA.GN---TQATG--------------------------------------------------------------
Q15X15_PSEA6/3-110----......---GKPLG--------------------------------------------------------------
Q16F07_AEDAE/8-123----FVSARL---KTVKH--------------------------------------------------------------
Q16XY1_AEDAE/224-343----HDPPGI---H..CE--------------------------------------------------------------
Q16YN6_AEDAE/11-125----GSMGF.---ISRMI--------------------------------------------------------------
Q18227_CAEEL/10-129----SDMGLI---SRKLT--------------------------------------------------------------
Q1CY35_MYXXD/3-112----......---GRPLG--------------------------------------------------------------
Q1QZ40_CHRSD/2-109----......---GRRFT--------------------------------------------------------------
HINT3_XENTR/18-132----SQLGF.---LSRMI--------------------------------------------------------------
Q2H2H7_CHAGB/31-147----LSTDKM---FNARH--------------------------------------------------------------
Q2H304_CHAGB/151-275----LEA.GA---TQATG--------------------------------------------------------------
HINT3_BOVIN/47-162----DQLSF.---MSRLV--------------------------------------------------------------
Q3IJU5_PSEHT/4-111----......---GKEMG--------------------------------------------------------------
A0A0D1DZS3_USTMA/46-158----FKSQW.---KAIKY--------------------------------------------------------------
Q54DF5_DICDI/36-141----FTPKF.---.KKHS--------------------------------------------------------------
Y2839_DICDI/224-348----YNTKYL---KNNKH--------------------------------------------------------------
Q59S51_CANAL/134-254----HPGLGD---GIAIG--------------------------------------------------------------
Q5TUI6_ANOGA/154-273----YDPPGA---G..CE--------------------------------------------------------------
A8XGQ1_CAEBR/148-267----YDAPAS---T..TM--------------------------------------------------------------
Q6BZT0_YARLI/136-263----NEGLGS---SQLVG--------------------------------------------------------------
Q6C515_YARLI/4-127----LSSPRL---KNRTH--------------------------------------------------------------
Q6C6M8_YARLI/30-153----SPILQE---ELRSG--------------------------------------------------------------
Q6CJA1_KLULA/160-286----HSGLGD---GIAVG--------------------------------------------------------------
Q6FLB9_CANGA/198-323----HPGIGE---EMGQG--------------------------------------------------------------
Q6FWT2_CANGA/170-296----HPGLGN---GISTG--------------------------------------------------------------
Q6IIA4_DROME/5-118----TQMTF.---LSKMI--------------------------------------------------------------
Q74ZD1_ASHGO/153-277----HPGVGA---D..AG--------------------------------------------------------------
Q7PHF8_ANOGA/7-116----YYSPCL---SHRYH--------------------------------------------------------------
Q7QJM2_ANOGA/10-124----SKMGF.---ISRMI--------------------------------------------------------------
Q83DE2_COXBU/3-109----......---GRQMH--------------------------------------------------------------
Q84VV6_ARATH/7-121----YVPRWK---AIKYK--------------------------------------------------------------
Q8GYJ9_ARATH/75-183----......---GRQMK--------------------------------------------------------------
Q8SUA2_ENCCU/116-232----MAHEG.---NVSCT--------------------------------------------------------------
Q97JJ3_CLOAB/3-110----......---KKKFT--------------------------------------------------------------
BH140_ARATH/717-833----FNSDSL---KNKKH--------------------------------------------------------------
DCPS_SCHPO/141-261----HET.GD---GSAVG--------------------------------------------------------------
E7KRX8_YEASL/160-281----HPGLGN---.....--------------------------------------------------------------
E7KUH0_YEASL/160-281----HPGVGE---.....--------------------------------------------------------------
F1R776_DANRE/159-276----YNVPGC---G....--------------------------------------------------------------
F7CC42_XENTR/161-276----HDAPG.---.....--------------------------------------------------------------
H3C365_TETNG/54-161----SKMN..---.....--------------------------------------------------------------
H3CJX6_TETNG/127-244----YEAPGC---G....--------------------------------------------------------------
H3DP42_TETNG/31-141----SQMGFM---S....--------------------------------------------------------------
Q0JBF2_ORYSJ/25-136----FTPSWR---.....--------------------------------------------------------------
Q5K774_CRYNJ/143-255----HDNL..---.....--------------------------------------------------------------
Q9VQ59_DROME/32-141----ADMSF.---.....--------------------------------------------------------------

PF01230

HINT1_RAT/24-121----QM--------------------------------------------------------------------------
HNT2_YEAST/12-107----KI--------------------------------------------------------------------------
FHIT_HUMAN/11-105----AG--------------------------------------------------------------------------
APH1_SCHPO/12-106----KA--------------------------------------------------------------------------
APTX_YEAST/15-139----FH--------------------------------------------------------------------------
Q9I500_PSEAE/74-166----RG--------------------------------------------------------------------------
Q98BM9_RHILO/14-106----EG--------------------------------------------------------------------------
Y866_METJA/9-105----EG--------------------------------------------------------------------------
YHIT_MYCPN/19-116----ET--------------------------------------------------------------------------
APTX_SCHPO/44-156----HV--------------------------------------------------------------------------
YHIT_HELPY/9-104----KH--------------------------------------------------------------------------
HNT1_YEAST/32-125----DE--------------------------------------------------------------------------
Q9A2A9_CAUCR/9-106----GD--------------------------------------------------------------------------
YHIT_SYNY3/12-109----PF--------------------------------------------------------------------------
Y1390_SYNE7/12-109----SL--------------------------------------------------------------------------
YHI1_MYCLE/10-102----SL--------------------------------------------------------------------------
Y961_HAEIN/12-110----PL--------------------------------------------------------------------------
Q9JYE4_NEIMB/10-102----EN--------------------------------------------------------------------------
Q9KQC5_VIBCH/14-106----TH--------------------------------------------------------------------------
ZB14_MAIZE/24-123----QM--------------------------------------------------------------------------
HINT_CAEEL/28-125----QL--------------------------------------------------------------------------
G8AG53_AZOBR/16-114----R.--------------------------------------------------------------------------
K7XM15_MYCHR/14-110----K.--------------------------------------------------------------------------
YHI2_MYCTU/11-106----N.--------------------------------------------------------------------------
Q32EW3_SHIDS/12-109----P.--------------------------------------------------------------------------

PF04677

C3H64_ARATH/370-491----SSRARL..LPNIFS--------------------------------------------------------------
C19L1_CAEEL/309-429----KSSSKA..LKSSFT--------------------------------------------------------------
C19L2_CAEEL/226-350----QEIGDM..ASIYFK--------------------------------------------------------------
C19L2_DROME/460-584----ASQGEM..APFYFK--------------------------------------------------------------
CWF19_SCHPO/399-523----KRILSL..APAYFR--------------------------------------------------------------
DRN1_YEAST/256-389----KYLVLKFCSALDRQ--------------------------------------------------------------
MU161_SCHPO/334-470----KISSHR..IESVFL--------------------------------------------------------------
Q93ZX4_ARATH/458-582----QEIAKE..GPLYFK--------------------------------------------------------------

PF02611

CDH_HELPY/24-243NR..ASAEEIQDHECAIL--------------------------------------------------------------
Q8P9Z9_XANCP/30-250NR..ASGEELQDHACGLV--------------------------------------------------------------
E8V0N7_TERSS/35-269RLGYGAGGKLQDHQCRVA--------------------------------------------------------------
A8GL49_SERP5/45-264TL..ASSEEIQDHDCRVL--------------------------------------------------------------
E0SJ94_DICD3/33-253NR..GSAEEILDVNCALA--------------------------------------------------------------
CDH_YERPE/33-252DR..ASAEELQDHTCQVL--------------------------------------------------------------
B8IMH8_METNO/37-256....AHAEKLLDHACTA.--------------------------------------------------------------
W0LHA3_9ENTR/26-254NR..ASVESLLDKECAIL--------------------------------------------------------------
B1M455_METRJ/29-249....ASAEDVMDHSCAVA--------------------------------------------------------------
Q1LBK3_CUPMC/33-250AN..GHASDFLDRGCKLG--------------------------------------------------------------
Q6MQF2_BDEBA/30-256NY..GSVEEIQDHSCPQ.--------------------------------------------------------------
G8MBN7_9BURK/67-288NW..ASSEELQDHTCSLA--------------------------------------------------------------
A6TFQ8_KLEP7/24-243NR..ASAEEIQDHRCAIL--------------------------------------------------------------
H2INV4_RAHAC/31-250NN..ASTEEIQDHKCAVL--------------------------------------------------------------
B0U7T2_METS4/29-248....SAAEKVLDHSCSLT--------------------------------------------------------------
B2VF57_ERWT9/34-251NL..ASAEELQDHSCALL--------------------------------------------------------------
B9JRW8_AGRVS/27-242GF..SGGEDVQDHSCQI.--------------------------------------------------------------
D8IW24_HERSS/34-253EQ..GSAEVLMDHDCR..--------------------------------------------------------------
C5BB31_EDWI9/31-247SL..ASIEEIQDHRCP..--------------------------------------------------------------
A9HJU4_GLUDA/35-256DR..AEGEELQDHACRIG--------------------------------------------------------------
B2JLJ5_BURP8/29-246S...GSAEPLLDHACEIG--------------------------------------------------------------
B1LSY8_METRJ/26-246....ASAEYLMDHSCRMA--------------------------------------------------------------
L0IYV5_MYCSM/29-248NP..GAGEELQDHT....--------------------------------------------------------------
B8IPC5_METNO/27-247....AHAEALLDHQCEIA--------------------------------------------------------------
B2FII5_STRMK/27-247NE..ASAEELQDHACSVL--------------------------------------------------------------
CDH_CROS8/31-250NL..AHSEELQDHDCALL--------------------------------------------------------------
B8EQB5_METSB/40-259....THLEDLQDHFCKVA--------------------------------------------------------------
B2HIW3_MYCMM/43-260....VAAETLQDHDCSVA--------------------------------------------------------------
W0HRX4_9ENTR/35-254NT..GSIEEIQDHSCVIL--------------------------------------------------------------
E6WAG7_PANSA/33-250NS..GSAEELQDHRCQIL--------------------------------------------------------------
B1M8V7_METRJ/69-294RA..ANGEILQDHTCGLT--------------------------------------------------------------
D8MKK8_ERWBE/33-250NR..GSAEELQDHSCSIL--------------------------------------------------------------
Q6D6W9_PECAS/32-251SL..GSVEEIQDFSCALA--------------------------------------------------------------
D2UA62_XANAP/30-247GATLGATRELQDDTCT..--------------------------------------------------------------
CDH_MYCLE/38-255....IAAEELQDHNCSIA--------------------------------------------------------------
Q13LU5_BURXL/41-259S...GSAEGLLDHACRVA--------------------------------------------------------------
Q7NQ26_CHRVO/27-251NR..GSAEELQDHDCRIL--------------------------------------------------------------
K7SS21_GLUOY/32-232DR..ASGEEVQDHKCKID--------------------------------------------------------------
Q0JZ98_CUPNH/25-246SN..GHASDFLDRRCRLA--------------------------------------------------------------
H8L0L3_FRAAD/32-259DS..ANADRLQDLACHIV--------------------------------------------------------------
CDH_ECOLI/31-250NR..ASAEEIQDHQCEIL--------------------------------------------------------------
Q5FPM0_GLUOX/32-232DH..GSGEELQDHECHLD--------------------------------------------------------------
W0PFV2_9BURK/44-257....SAEGDFQDHRCP..--------------------------------------------------------------
I2BEE8_SHIBC/29-247NF..ASAEELQDHDCGIL--------------------------------------------------------------
CDH_MYCTU/41-258....VAAETLQDHDCSIT--------------------------------------------------------------
U3U143_9ENTR/33-250NR..GSAEELQDHQCRLL--------------------------------------------------------------

PF02744

GAL7_CRYNJ/204-373----.ESLP...HKRATL--------------------------------------------------------------
GAL7_HAEIN/183-348----..ALS.EVHYKERT--------------------------------------------------------------
GALT_STRMU/231-435----YNEMA.DYHKDWAD--------------------------------------------------------------
GALT_BACSU/240-451----QNPLT.AKHSEWAL--------------------------------------------------------------
GAL7_YEAST/198-366----..NLDGQIHYLQRL--------------------------------------------------------------
GAL7_KLULA/195-363----..ALSGEVHYLAKL--------------------------------------------------------------
GAL7_ECOLI/182-347----..AVS.DIHFRESG--------------------------------------------------------------
GALT_HUMAN/202-370----..ALP.EVHYHLGQ--------------------------------------------------------------

PF16285

C0ZAZ1_BREBN/8-252-NN------LEDMVAQLQRRYF----------------------------------------------------------
B2TPI8_CLOBB/11-256-NS------LEEIAGNLKELYF----------------------------------------------------------
C9LU44_SELS3/8-252-SN------LEDLRNNVRKIYF----------------------------------------------------------
D9SRU9_CLOC7/9-253-NN------QDKIVEHVKQLYF----------------------------------------------------------
Q81VH8_BACAN/8-251-TK------LEDVKIQLAE.YF----------------------------------------------------------
U5LFA6_9BACI/8-252-NN------LEWMKEDIRAKYF----------------------------------------------------------

PF01087

GAL7_CRYNJ/15-198.HG------QVWTTSFVP--------------------------------------------------------------
Q7QA38_ANOGA/1-174.HC------QIWACSFLP--------------------------------------------------------------
A5DRG5_PICGU/6-197.HG------QAWCLDVIP--------------------------------------------------------------
Q9CM11_PASMU/4-178.HG------QIWANSFLP--------------------------------------------------------------
Q2H1V5_CHAGB/2-211.HC------QIWTTSTLP--------------------------------------------------------------
A4AQM0_MARSH/1-176.HG------QIWAQRNVP--------------------------------------------------------------
Q65CW7_BACLD/17-231EHS------ILFSEQHRP--------------------------------------------------------------
A9WJH8_CHLAA/4-191.HG------QIWANEQLP--------------------------------------------------------------
A7MIY8_CROS8/2-176.HG------QIWANSFLP--------------------------------------------------------------
Q03XA5_LEUMM/18-235EHA------IVLSENLRP--------------------------------------------------------------
A3N102_ACTP2/3-177.HG------QIWASNFLP--------------------------------------------------------------
GALT_STRMU/16-225EHC------IFLNTEHVP--------------------------------------------------------------
A5DWA9_LODEL/21-211.HG------QAWCLDIVP--------------------------------------------------------------
Q6D2C5_PECAS/1-175.HG------QVWANDFLP--------------------------------------------------------------
Q1IQZ6_KORVE/1-177.HG------QIWANSSVP--------------------------------------------------------------
Q6LQE3_PHOPR/15-189.HG------QIWANSFLP--------------------------------------------------------------
A8LEI8_FRASN/19-211.HG------QVWASASLP--------------------------------------------------------------
Q59VY3_CANAL/21-210.HG------QAWCLDVIP--------------------------------------------------------------
A1L2D1_DANRE/7-181.HC------QVWASNFLP--------------------------------------------------------------
A7F8S7_SCLS1/1-208.HG------QIWTTTGLP--------------------------------------------------------------
Q3XZ93_ENTFC/18-230EHS------IILSEQHRP--------------------------------------------------------------
B1YII0_EXIS2/18-230EHS------IILSQEHRD--------------------------------------------------------------
Q0RE52_FRAAA/14-191.HG------QIWACDALP--------------------------------------------------------------
Q21LR9_SACD2/5-180.HG------QIWATDQIP--------------------------------------------------------------
GALT_STACT/19-233EHS------IVLSEAHEP--------------------------------------------------------------
GALT_LACPL/16-224EHS------IFLDQEHRP--------------------------------------------------------------
A8WVF3_CAEBR/2-179.HG------QLWASNYLP--------------------------------------------------------------
A2AMS2_MOUSE/3-177.HC------QVWASSFLP--------------------------------------------------------------
GAL7_NEUCR/2-217.HC------QIWTTSTLP--------------------------------------------------------------
A7TJY6_VANPO/4-190.HG------QAWCLDVVP--------------------------------------------------------------
A6RBX1_AJECN/45-253.HG------QVWALSCLP--------------------------------------------------------------
GAL7_KLULA/1-189.HG------QAWCLDSIP--------------------------------------------------------------
Q5KY03_GEOKA/19-233EHC------IVFHAEHVP--------------------------------------------------------------
Q03PB0_LACBA/18-226EHA------IFLSQIHRP--------------------------------------------------------------
A2QCH5_ASPNC/2-209.HG------QVWTTSSLP--------------------------------------------------------------
A6WF46_KINRD/10-216.HG------QIYGYPFLT--------------------------------------------------------------
Q2J7D6_FRASC/3-201.HG------QIWACDALP--------------------------------------------------------------
A3QFA6_SHELP/9-182.HG------QIWAHNHLP--------------------------------------------------------------
GALT_BACHD/21-236EHA------IVFSGEHVP--------------------------------------------------------------
Q5WD06_BACSK/20-235EHA------IVLFEKQRP--------------------------------------------------------------
A0QYK5_MYCS2/3-199.HG------QIYGYPYLT--------------------------------------------------------------
GALT_LACSS/20-231EHS------IFLDGKHEP--------------------------------------------------------------
Q896X9_CLOTE/19-233EHS------ILFYEKHVP--------------------------------------------------------------
GALT_DROME/1-175.HC------QIWSCSFLP--------------------------------------------------------------
GAL7_SCHPO/4-195.HG------QAWCLDVIP--------------------------------------------------------------
B8I4V5_CLOCE/19-234EHC------IVLSEKHVP--------------------------------------------------------------
A3LR66_PICST/19-206.HG------QAWCLDVVP--------------------------------------------------------------
Q7N8Y8_PHOLL/4-178.HG------QIWANSFLP--------------------------------------------------------------
Q73SK2_MYCPA/2-203.HG------QIYGYPYLT--------------------------------------------------------------
A8FIP9_BACP2/20-233EHC------IVFKGKHEP--------------------------------------------------------------
Q3IH81_PSEHT/3-176.HG------QIWSQQQLP--------------------------------------------------------------
A0M3B7_GRAFK/1-176.HG------QIWSQSSVP--------------------------------------------------------------
A5FKW9_FLAJ1/2-179.HG------QIWAQSSLP--------------------------------------------------------------
A0A0D1E3L7_USTMA/31-214.HG------QVWSLDYIP--------------------------------------------------------------
Q15Y61_PSEA6/2-176.HG------QVWANDFIP--------------------------------------------------------------
Q6C0K3_YARLI/1-190.HG------QVWNTSIVP--------------------------------------------------------------
Q6BVI6_DEBHA/3-194.HG------QAWCLDTIP--------------------------------------------------------------
Q2GAY3_NOVAD/2-175.HG------QIWASDFIP--------------------------------------------------------------
GALT_CLOAB/17-229EHC------IILNNEHIP--------------------------------------------------------------
GALT_ENTFA/20-232EHA------IFLDQQHRE--------------------------------------------------------------
Q30V51_DESAG/2-182.HG------QIWASSSVP--------------------------------------------------------------
A9KN46_CLOPH/31-257EHC------IVFRGEHSP--------------------------------------------------------------
GALT_LACS1/18-228EHC------IFLDTIHEP--------------------------------------------------------------
A0KQH7_AERHH/2-174.HG------QLWGSDFLP--------------------------------------------------------------
A4VT89_STRSY/18-226EHA------IFLNQEHVP--------------------------------------------------------------
A5VME1_LACRD/16-220EHC------IFLDSKHEP--------------------------------------------------------------
E7KK61_YEASL/5-192.HG------QAWCLESIP--------------------------------------------------------------
G0RTP4_HYPJQ/7-208.HC------QAWTTSTMP--------------------------------------------------------------
Q04GZ3_OENOB/18-225EHS------IFLSKIHRP--------------------------------------------------------------
Q5KLY2_CRYNJ/11-195.HG------QVWSLSYVP--------------------------------------------------------------
GALT_STRT2/18-226EHS------IFFYGKHEP--------------------------------------------------------------
Q5NEY1_FRATT/11-180.HG------QIWACDFLP--------------------------------------------------------------
Q7MBX0_VIBVY/28-200.HG------QIWANSFIP--------------------------------------------------------------
GALT2_STRR6/16-224EHC------IFLDGQHRP--------------------------------------------------------------
GALT1_STRR6/18-225EHA------IFLNSQHVP--------------------------------------------------------------
GALT_CLOPE/21-230EHC------IILSEDHVP--------------------------------------------------------------
GALT_LACLA/19-228EHS------ILLNAKHQP--------------------------------------------------------------
U5L509_9BACI/19-230EHC------IVLCGEHR.--------------------------------------------------------------

PF16268

F5XH95_MICPN/8-422GVGHRYPSLEVYSTSLHQLPWEQSVAERASMADLLHALHAATGPAVPTNEEWHYRPPGLDRPMPWRIVLKWRISVPAGFE
C3PH27_CORA7/1-419GFGHRYPTLEIFSKSPRCEPWDQNPDEVRGMSDLIHAAHAAVGPDVACNEEWHHRPPSVDLPQPWRVMIKLRVSTLAGFE
B1VH78_CORU7/18-447GFGHRWPTLEVFSKSATTEPWLMTPEERAGVADLVHACHIASGPSIPCNEEWLHRPMDVDVPMPWRIVIKWRVSTLAGFE
Q8NNU9_CORGL/1-424GFGHRYPTIEIYSKSAIPEPWLQSDEEIQAMSNLIHACHAATGADVPCNEEWVHKPIDVDMPMPWHVMIKWRVSTLAGFE
W5WQ34_9CORY/18-447GFGHRWPTLEVFSKSATTEPWLMSAEERDGVADLVHACHVAAGPHVSCNEEWLHRPLDVDIPMPWRIVIKWRVSTVAGFE
W5Y1J6_9CORY/15-448GFGHRYPTLEIFSTSSTAEPWKQTPEEVRGMSDMVHAAHAATGPDVPCNEEWHHKPADLDMPMPWRIMLKWRVSNLAGFE
G0HAG7_CORVD/18-449GFGHRGPTLEVFSKSATTEPWLMKDEERDAVSDLVHACHVAAGTETPSNEEWLHRPLDVDVPMPWRIVIKWRTSTLAGFE
U3GXR8_9CORY/26-464GFGHRYPTLEIFSKSACGFPWEQSDEERDAMADLIHACHAAAGPDIPCNEEWHHTPIDLDITMPWRVMIKWRVSTLAGFE
Q6NGG7_CORDI/11-432GFGHRYPTLEVFSRSATPEPWLQTNEEIKAMSDLIHACHAAAGPHVPCNEEWHHKPIDLDIAMPWRVMIKWRVSTLAGFE
S5SVS2_9CORY/15-437GVGHRFPTLEIYSKSPTPEPWLQTQEEIRAMSDMVHAAHAAAGADVPCNEEWHHKPIDLDMPMPWRINIKWRVSTLAGFE
B3QVF6_CHLT3/10-436AIGHRYPTIAIYSKSNHPRPQEHSDEEIRGVSDLVHACHVGMGNQISCNEEWNYTPIDSVYNMPWRILIKWRINIPAGFE
Q6A5P1_PROAC/10-435GFGHRYPSVEVWSTSRVDQPWRVDDEGIDAVSDLLHAAHVAVSDDVPANEEWHYRPMGTGVPVPWRIILKLRTSTLAGFE
Q8FP08_COREF/15-438GFGHRYPTLEIYSRSPVSEPWLQSGEEVRAMSDLIHACHAATGPDVPCNEEWHHKPVDVDMPMPWRVTIKWRVSTLAGFE
F8E0G1_CORRG/18-447GFGHRWPTLEVFSKSGTTEPWLMSDAERDAVSDLVHACHVAAGPHIACNEEWLHRPLDVDVPMPWRIVIKWRVSTMAGFE
C5CBF5_MICLC/33-463GFGHRYPTVEVYSTSPVGQPWRQSAAELRALSDLLHAAHAATGPDVPSNEEWHTRPPGVASPMPWRVMLKWRVSTLAGFE
I6XY80_PROPF/27-452GFGHRYPTLEIYSCSEFSDPWEQTAEEVRGMSDLIHAMHAATGVDVACNEEWHYRPIDVALPMPWRVMLKWRVSTLAGFE
R5PXK8_9PROT/14-442DFGHRYPTLSIYSKAEKNQPWNQTPEQIRGMSDIVHACHASMGSEIPCNEEWYYRPPAVDIPSPWHILIKWRISNPAGFE
D7BLX6_ARCHD/14-437GFGHRYPTLEVWSKSPVCQPWEHSDDERRGMSDLIHAMHAATGADVPTNEEWHCKPIDADVSMPWKVLIKWRVSTLAGFE
D9QB86_CORP2/15-442GFGHRFPTLEVFSKSAVSEPWLQSSEEIRDMSDLVHACHAGAGPQVPCNEEWHHKPVDVDIPMPWRIMIKWRVSTLAGFE
X5DSS5_9CORY/40-471GFGHRWPTLEVFSRSGTTEPWLISDDERDAMADLVHACHVAAGPHMPSNEEWLHRPLDVDVPMPWRIMIKWRDSTMAGFE
M1P829_9CORY/11-432GFGHRFPTLEVYSKSRQPHPWLQSEEEVRGMSDLLHACHAAAGADVPCNEEWLHKPIDLDLPMPWRVRIKWRVSTLAGFE
D7GCR7_PROFC/13-438GFGHRYPTLEIYSKSATCEPWNQSDKELDDMSALVHACHAATGMDVPSNEEWHHRAPDMDVPMPWRINLKWRVSTLAGFE
D7WEZ1_9CORY/10-431GIGHRYPTMNIYSKSATPEPWLQTADEVRGMSDLIHAAHAATGPEVPSNEEWHHKPIDLDMPMPWHINLKWRVSTLAGFE
C8XCI8_NAKMY/35-455GFGHRYPTLEIFSRSERPQPWLHSTTELRGMSDLIHALHAASGPGVPCNEEWHHKPPDGDVPMPWRVLIKWRLSTIAGFE
C4LIB0_CORK4/15-440GFGHRYPTIEIYSRSATCEPWKLSEEEMRDMSDLIHACHAATGSDVPCNEEWHHKPIDLDIPMPWRVMIKWRASNLAGFE
K7RWS7_PROA4/29-464GFGHRYPTVEVWSTSARDQPWKMTTEEVDAVSDLLHAMHLAVGADVPSNEEWHYRPVGVEMPMPWRILLKLRVSTLAGFE
D6ZJH6_MOBCV/17-441DFGHRYQTIAVWPLGPALLPWEYTREQVDGISDVLHALHCAVGPAVPTNEEWYHRPVDLDVPLRFRILLKQRTSTLAGFE

PF11969

Q5TVU2_ANOGA/17-126---------------------------------------------------
A5DAJ7_PICGU/3-137---------------------------------------------------
A5DAR3_PICGU/136-257---------------------------------------------------
Q297L1_DROPS/153-272---------------------------------------------------
Q29LN6_DROPS/45-159---------------------------------------------------
HINT3_RAT/40-155---------------------------------------------------
A0EGQ1_PARTE/118-231---------------------------------------------------
A1CEC1_ASPCL/149-272---------------------------------------------------
A3DF72_CLOTH/3-110---------------------------------------------------
A3LWH2_PICST/136-257---------------------------------------------------
A4S248_OSTLU/99-229---------------------------------------------------
APTX_DROME/4-113---------------------------------------------------
APTX_DROME/229-339---------------------------------------------------
A4XKP5_CALS8/3-110---------------------------------------------------
A5D7U9_BOVIN/174-293---------------------------------------------------
A5E770_LODEL/177-298---------------------------------------------------
A5GQU3_SYNR3/125-230---------------------------------------------------
A5I635_CLOBH/3-110---------------------------------------------------
A6QUC5_AJECN/141-262---------------------------------------------------
A6VZM3_MARMS/2-109---------------------------------------------------
A7HMY4_FERNB/3-108---------------------------------------------------
A7S614_NEMVE/151-270---------------------------------------------------
A7SFV5_NEMVE/10-122---------------------------------------------------
A7TKH2_VANPO/142-261---------------------------------------------------
A7TQ97_VANPO/171-297---------------------------------------------------
YHIT_CHLTR/2-108---------------------------------------------------
APTX_CHICK/142-252---------------------------------------------------
APTX_DANRE/150-260---------------------------------------------------
APTX_XENTR/173-283---------------------------------------------------
APTX_CIOIN/206-317---------------------------------------------------
Q0U2I6_PHANO/148-269---------------------------------------------------
Q15X15_PSEA6/3-110---------------------------------------------------
Q16F07_AEDAE/8-123---------------------------------------------------
Q16XY1_AEDAE/224-343---------------------------------------------------
Q16YN6_AEDAE/11-125---------------------------------------------------
Q18227_CAEEL/10-129---------------------------------------------------
Q1CY35_MYXXD/3-112---------------------------------------------------
Q1QZ40_CHRSD/2-109---------------------------------------------------
HINT3_XENTR/18-132---------------------------------------------------
Q2H2H7_CHAGB/31-147---------------------------------------------------
Q2H304_CHAGB/151-275---------------------------------------------------
HINT3_BOVIN/47-162---------------------------------------------------
Q3IJU5_PSEHT/4-111---------------------------------------------------
A0A0D1DZS3_USTMA/46-158---------------------------------------------------
Q54DF5_DICDI/36-141---------------------------------------------------
Y2839_DICDI/224-348---------------------------------------------------
Q59S51_CANAL/134-254---------------------------------------------------
Q5TUI6_ANOGA/154-273---------------------------------------------------
A8XGQ1_CAEBR/148-267---------------------------------------------------
Q6BZT0_YARLI/136-263---------------------------------------------------
Q6C515_YARLI/4-127---------------------------------------------------
Q6C6M8_YARLI/30-153---------------------------------------------------
Q6CJA1_KLULA/160-286---------------------------------------------------
Q6FLB9_CANGA/198-323---------------------------------------------------
Q6FWT2_CANGA/170-296---------------------------------------------------
Q6IIA4_DROME/5-118---------------------------------------------------
Q74ZD1_ASHGO/153-277---------------------------------------------------
Q7PHF8_ANOGA/7-116---------------------------------------------------
Q7QJM2_ANOGA/10-124---------------------------------------------------
Q83DE2_COXBU/3-109---------------------------------------------------
Q84VV6_ARATH/7-121---------------------------------------------------
Q8GYJ9_ARATH/75-183---------------------------------------------------
Q8SUA2_ENCCU/116-232---------------------------------------------------
Q97JJ3_CLOAB/3-110---------------------------------------------------
BH140_ARATH/717-833---------------------------------------------------
DCPS_SCHPO/141-261---------------------------------------------------
E7KRX8_YEASL/160-281---------------------------------------------------
E7KUH0_YEASL/160-281---------------------------------------------------
F1R776_DANRE/159-276---------------------------------------------------
F7CC42_XENTR/161-276---------------------------------------------------
H3C365_TETNG/54-161---------------------------------------------------
H3CJX6_TETNG/127-244---------------------------------------------------
H3DP42_TETNG/31-141---------------------------------------------------
Q0JBF2_ORYSJ/25-136---------------------------------------------------
Q5K774_CRYNJ/143-255---------------------------------------------------
Q9VQ59_DROME/32-141---------------------------------------------------

PF01230

HINT1_RAT/24-121---------------------------------------------------
HNT2_YEAST/12-107---------------------------------------------------
FHIT_HUMAN/11-105---------------------------------------------------
APH1_SCHPO/12-106---------------------------------------------------
APTX_YEAST/15-139---------------------------------------------------
Q9I500_PSEAE/74-166---------------------------------------------------
Q98BM9_RHILO/14-106---------------------------------------------------
Y866_METJA/9-105---------------------------------------------------
YHIT_MYCPN/19-116---------------------------------------------------
APTX_SCHPO/44-156---------------------------------------------------
YHIT_HELPY/9-104---------------------------------------------------
HNT1_YEAST/32-125---------------------------------------------------
Q9A2A9_CAUCR/9-106---------------------------------------------------
YHIT_SYNY3/12-109---------------------------------------------------
Y1390_SYNE7/12-109---------------------------------------------------
YHI1_MYCLE/10-102---------------------------------------------------
Y961_HAEIN/12-110---------------------------------------------------
Q9JYE4_NEIMB/10-102---------------------------------------------------
Q9KQC5_VIBCH/14-106---------------------------------------------------
ZB14_MAIZE/24-123---------------------------------------------------
HINT_CAEEL/28-125---------------------------------------------------
G8AG53_AZOBR/16-114---------------------------------------------------
K7XM15_MYCHR/14-110---------------------------------------------------
YHI2_MYCTU/11-106---------------------------------------------------
Q32EW3_SHIDS/12-109---------------------------------------------------

PF04677

C3H64_ARATH/370-491---------------------------------------------------
C19L1_CAEEL/309-429---------------------------------------------------
C19L2_CAEEL/226-350---------------------------------------------------
C19L2_DROME/460-584---------------------------------------------------
CWF19_SCHPO/399-523---------------------------------------------------
DRN1_YEAST/256-389---------------------------------------------------
MU161_SCHPO/334-470---------------------------------------------------
Q93ZX4_ARATH/458-582---------------------------------------------------

PF02611

CDH_HELPY/24-243---------------------------------------------------
Q8P9Z9_XANCP/30-250---------------------------------------------------
E8V0N7_TERSS/35-269---------------------------------------------------
A8GL49_SERP5/45-264---------------------------------------------------
E0SJ94_DICD3/33-253---------------------------------------------------
CDH_YERPE/33-252---------------------------------------------------
B8IMH8_METNO/37-256---------------------------------------------------
W0LHA3_9ENTR/26-254---------------------------------------------------
B1M455_METRJ/29-249---------------------------------------------------
Q1LBK3_CUPMC/33-250---------------------------------------------------
Q6MQF2_BDEBA/30-256---------------------------------------------------
G8MBN7_9BURK/67-288---------------------------------------------------
A6TFQ8_KLEP7/24-243---------------------------------------------------
H2INV4_RAHAC/31-250---------------------------------------------------
B0U7T2_METS4/29-248---------------------------------------------------
B2VF57_ERWT9/34-251---------------------------------------------------
B9JRW8_AGRVS/27-242---------------------------------------------------
D8IW24_HERSS/34-253---------------------------------------------------
C5BB31_EDWI9/31-247---------------------------------------------------
A9HJU4_GLUDA/35-256---------------------------------------------------
B2JLJ5_BURP8/29-246---------------------------------------------------
B1LSY8_METRJ/26-246---------------------------------------------------
L0IYV5_MYCSM/29-248---------------------------------------------------
B8IPC5_METNO/27-247---------------------------------------------------
B2FII5_STRMK/27-247---------------------------------------------------
CDH_CROS8/31-250---------------------------------------------------
B8EQB5_METSB/40-259---------------------------------------------------
B2HIW3_MYCMM/43-260---------------------------------------------------
W0HRX4_9ENTR/35-254---------------------------------------------------
E6WAG7_PANSA/33-250---------------------------------------------------
B1M8V7_METRJ/69-294---------------------------------------------------
D8MKK8_ERWBE/33-250---------------------------------------------------
Q6D6W9_PECAS/32-251---------------------------------------------------
D2UA62_XANAP/30-247---------------------------------------------------
CDH_MYCLE/38-255---------------------------------------------------
Q13LU5_BURXL/41-259---------------------------------------------------
Q7NQ26_CHRVO/27-251---------------------------------------------------
K7SS21_GLUOY/32-232---------------------------------------------------
Q0JZ98_CUPNH/25-246---------------------------------------------------
H8L0L3_FRAAD/32-259---------------------------------------------------
CDH_ECOLI/31-250---------------------------------------------------
Q5FPM0_GLUOX/32-232---------------------------------------------------
W0PFV2_9BURK/44-257---------------------------------------------------
I2BEE8_SHIBC/29-247---------------------------------------------------
CDH_MYCTU/41-258---------------------------------------------------
U3U143_9ENTR/33-250---------------------------------------------------

PF02744

GAL7_CRYNJ/204-373---------------------------------------------------
GAL7_HAEIN/183-348---------------------------------------------------
GALT_STRMU/231-435---------------------------------------------------
GALT_BACSU/240-451---------------------------------------------------
GAL7_YEAST/198-366---------------------------------------------------
GAL7_KLULA/195-363---------------------------------------------------
GAL7_ECOLI/182-347---------------------------------------------------
GALT_HUMAN/202-370---------------------------------------------------

PF16285

C0ZAZ1_BREBN/8-252---------------------------------------------------
B2TPI8_CLOBB/11-256---------------------------------------------------
C9LU44_SELS3/8-252---------------------------------------------------
D9SRU9_CLOC7/9-253---------------------------------------------------
Q81VH8_BACAN/8-251---------------------------------------------------
U5LFA6_9BACI/8-252---------------------------------------------------

PF01087

GAL7_CRYNJ/15-198---------------------------------------------------
Q7QA38_ANOGA/1-174---------------------------------------------------
A5DRG5_PICGU/6-197---------------------------------------------------
Q9CM11_PASMU/4-178---------------------------------------------------
Q2H1V5_CHAGB/2-211---------------------------------------------------
A4AQM0_MARSH/1-176---------------------------------------------------
Q65CW7_BACLD/17-231---------------------------------------------------
A9WJH8_CHLAA/4-191---------------------------------------------------
A7MIY8_CROS8/2-176---------------------------------------------------
Q03XA5_LEUMM/18-235---------------------------------------------------
A3N102_ACTP2/3-177---------------------------------------------------
GALT_STRMU/16-225---------------------------------------------------
A5DWA9_LODEL/21-211---------------------------------------------------
Q6D2C5_PECAS/1-175---------------------------------------------------
Q1IQZ6_KORVE/1-177---------------------------------------------------
Q6LQE3_PHOPR/15-189---------------------------------------------------
A8LEI8_FRASN/19-211---------------------------------------------------
Q59VY3_CANAL/21-210---------------------------------------------------
A1L2D1_DANRE/7-181---------------------------------------------------
A7F8S7_SCLS1/1-208---------------------------------------------------
Q3XZ93_ENTFC/18-230---------------------------------------------------
B1YII0_EXIS2/18-230---------------------------------------------------
Q0RE52_FRAAA/14-191---------------------------------------------------
Q21LR9_SACD2/5-180---------------------------------------------------
GALT_STACT/19-233---------------------------------------------------
GALT_LACPL/16-224---------------------------------------------------
A8WVF3_CAEBR/2-179---------------------------------------------------
A2AMS2_MOUSE/3-177---------------------------------------------------
GAL7_NEUCR/2-217---------------------------------------------------
A7TJY6_VANPO/4-190---------------------------------------------------
A6RBX1_AJECN/45-253---------------------------------------------------
GAL7_KLULA/1-189---------------------------------------------------
Q5KY03_GEOKA/19-233---------------------------------------------------
Q03PB0_LACBA/18-226---------------------------------------------------
A2QCH5_ASPNC/2-209---------------------------------------------------
A6WF46_KINRD/10-216---------------------------------------------------
Q2J7D6_FRASC/3-201---------------------------------------------------
A3QFA6_SHELP/9-182---------------------------------------------------
GALT_BACHD/21-236---------------------------------------------------
Q5WD06_BACSK/20-235---------------------------------------------------
A0QYK5_MYCS2/3-199---------------------------------------------------
GALT_LACSS/20-231---------------------------------------------------
Q896X9_CLOTE/19-233---------------------------------------------------
GALT_DROME/1-175---------------------------------------------------
GAL7_SCHPO/4-195---------------------------------------------------
B8I4V5_CLOCE/19-234---------------------------------------------------
A3LR66_PICST/19-206---------------------------------------------------
Q7N8Y8_PHOLL/4-178---------------------------------------------------
Q73SK2_MYCPA/2-203---------------------------------------------------
A8FIP9_BACP2/20-233---------------------------------------------------
Q3IH81_PSEHT/3-176---------------------------------------------------
A0M3B7_GRAFK/1-176---------------------------------------------------
A5FKW9_FLAJ1/2-179---------------------------------------------------
A0A0D1E3L7_USTMA/31-214---------------------------------------------------
Q15Y61_PSEA6/2-176---------------------------------------------------
Q6C0K3_YARLI/1-190---------------------------------------------------
Q6BVI6_DEBHA/3-194---------------------------------------------------
Q2GAY3_NOVAD/2-175---------------------------------------------------
GALT_CLOAB/17-229---------------------------------------------------
GALT_ENTFA/20-232---------------------------------------------------
Q30V51_DESAG/2-182---------------------------------------------------
A9KN46_CLOPH/31-257---------------------------------------------------
GALT_LACS1/18-228---------------------------------------------------
A0KQH7_AERHH/2-174---------------------------------------------------
A4VT89_STRSY/18-226---------------------------------------------------
A5VME1_LACRD/16-220---------------------------------------------------
E7KK61_YEASL/5-192---------------------------------------------------
G0RTP4_HYPJQ/7-208---------------------------------------------------
Q04GZ3_OENOB/18-225---------------------------------------------------
Q5KLY2_CRYNJ/11-195---------------------------------------------------
GALT_STRT2/18-226---------------------------------------------------
Q5NEY1_FRATT/11-180---------------------------------------------------
Q7MBX0_VIBVY/28-200---------------------------------------------------
GALT2_STRR6/16-224---------------------------------------------------
GALT1_STRR6/18-225---------------------------------------------------
GALT_CLOPE/21-230---------------------------------------------------
GALT_LACLA/19-228---------------------------------------------------
U5L509_9BACI/19-230---------------------------------------------------

PF16268

F5XH95_MICPN/8-422GGTKIYVNTIDPWTLRDRMLAALHTLRRDRLIAP.LRIGDEVL........
C3PH27_CORA7/1-419GGTKVYINTIDPWGLRDRVVDAMFRLRERGEIASGIAIATECELKRNSLRY
B1VH78_CORU7/18-447GGTKIYINTITPQELCELVLHRLEAAQAAGRLAPGIKLGEDIEHAPNKLKY
Q8NNU9_CORGL/1-424GGTKVYLNTLSPHKVRDRVVKEMYRLRDEELIASDLRIAMECSVERNSLKY
W5WQ34_9CORY/18-447GGTKIYINTISPADLKDRVLSALEEAREDGRLAPGIRLGDECAHTPNMLKY
W5Y1J6_9CORY/15-448GGTKIYLNTLSPWNIRDRIVSTMYALRDEGRVSPDLRIATECKVKRNSLRY
G0HAG7_CORVD/18-449GGTKIFINTISPKALKKQVLAALLTAREEGRLAPDLRLGNECVFQRSTLKY
U3GXR8_9CORY/26-464GGTKIYLNTLSPQGLRDRMVSAMYELRDQGHIARNIRIATECLLPRNSLRY
Q6NGG7_CORDI/11-432GSTKVYLNTLSPWDVRDRVVPRLYELRDSGAIDGSIRIATECSVRRNSLLY
S5SVS2_9CORY/15-437GGTKIYVNTLSPTDIRDRVVPQLYALRDARRIDEGIRIAMECATGRNMLRY
B3QVF6_CHLT3/10-436GNTGIYINPISPHQLRDKMVPRLYEMRAQGLIAFGVSIAEECPCKFNCLTY
Q6A5P1_PROAC/10-435GGTKIYVNTISPTTLAAMLLPKLFEARAAGRIAA.MNLGDECEIPRGVL..
Q8FP08_COREF/15-438GGTKIYLNTLSPQNVRDRVVRELYRLRDEGWIDEEMRIATECSVQRNSLRY
F8E0G1_CORRG/18-447GGTKIYINTITPGQLKDRVLTALQKAQDEGRLAPGISLGEECTMRPNSLKY
C5CBF5_MICLC/33-463GATKINVNTLSPWDVRDRVLARLRELRAAGALADGVRIGADARARPGALRY
I6XY80_PROPF/27-452GATKIYLNTISPVMLRDRVVEKLLALREAGRLAPEIRIATETRCRPNPLRY
R5PXK8_9PROT/14-442AVTKIFINTIDPWQLRDRIVQNLFALRNEGKIAKGIKIAAECDCTPNCLLY
D7BLX6_ARCHD/14-437GGTKIYVNTIDPWALRDRVVPRLLELRAEGAIAHNISIASECSNEPNSLKY
D9QB86_CORP2/15-442GGTKIYLNTLSPWDVRDRIVHELYSLRDQGRISPNIRIATECAVQRNSLKY
X5DSS5_9CORY/40-471GGTKIFINTLSPAGLKAKVLARLEDARDRGRLAPGIRLGDEVDFHRNSLRY
M1P829_9CORY/11-432GGTKIYVNTLSPYNIRDRVVSAMYGLRDGGRIARGIRISTECPAERNCLKY
D7GCR7_PROFC/13-438GGTKIYLNTIDPWHLRDRVVPRLHALRRQGRLADNILLDIECPAQYNSLMY
D7WEZ1_9CORY/10-431GGTKVYVNTLSPYDIRDRMVSNLYRLREEGRLADRLRIATECSPVRNALRY
C8XCI8_NAKMY/35-455GGTKIYLNTIDPQTLRDIVTADLLRLREQGAIADTLRIGPECARVPNSLRY
C4LIB0_CORK4/15-440GSTKVYLNTISPENIRQRMSKRLSQLREEGRLADSVRIAGELTYRRNSLKY
K7RWS7_PROA4/29-464GSTKVYVNTISPASLAARLLPRLLDARKAGKLAE.MRIGAECDLPRGVL..
D6ZJH6_MOBCV/17-441GSTRIYLNSVDPWTLGDEMVTLLEKKREQGLIAPSLRLGNEYRLPKDSL..

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window