Sequence alignment for CL0265

PF16285

D5DD06_BACMD/8-254--FNSAIGS-------------------------------------QKPETIVNRQNPCPFCDVESLTGII---------
C0ZAZ1_BREBN/8-252--FNMQIGR-------------------------------------KKPVSVNNTETACPFCDRNSLTDVL---------
B2TPI8_CLOBB/11-256--FINSIGK-------------------------------------NKPNSFNNNNTECPFCNRNKLTDII---------
C9LU44_SELS3/8-252--FNTTLGK-------------------------------------KKPENIINKTAPCPFCDRENLSGIV---------
D9SRU9_CLOC7/9-253--FISNISI-------------------------------------KKPNTIINQTTVCPFCHKENLTDIF---------
Q81VH8_BACAN/8-251--FLNDIGK-------------------------------------QKPESIRNRSAACPFCDRENLTDIL---------
U5LFA6_9BACI/8-252--FNTSIGV-------------------------------------KKPNSIRDKEQGCPFCEREKLTDIL---------

PF01087

GAL7_CRYNJ/15-198T.PVSINDH.......................................VHRRFNPLLGKHVL.........---------
Q7QA38_ANOGA/1-174M..FDPTDH.......................................QHRRYNPLNGQWVL.........---------
A5DRG5_PICGU/6-197T.EFDFTNH.......................................SHRRHNPLTDTYVL.........---------
Q9CM11_PASMU/4-178S.RFEPTEH.......................................PHRRYNPLTDQWVL.........---------
Q2H1V5_CHAGB/2-211P.DQVLDDI.......................................SHRRYNPLTGSWLL.........---------
A4AQM0_MARSH/1-176M.DIDFNEN.......................................PHRRFNILTGEWIL.........---------
Q65CW7_BACLD/17-231G.FIEPADVN....................................YARN.QVMNLLGLESFPEEAT...A---------
A9WJH8_CHLAA/4-191E.QQELFLR.......................................PHRRLNRLTGEWVL.........---------
A7MIY8_CROS8/2-176E.QFNPVDH.......................................PHRRYNPLTGQWIL.........---------
Q03XA5_LEUMM/18-235S.DYTIDDEI....................................YLVN.QIMGLVGETNHNTTPRL.VD---------
A3N102_ACTP2/3-177Q.QFILNDH.......................................PHRRFNPLKNQWIL.........---------
GALT_STRMU/16-225S.DYAELDAT....................................YLSN.RILALVGEDNAQQD......---------
A5DWA9_LODEL/21-211S.EFDFTNH.......................................SHRRYNPLTNRYVL.........---------
Q6D2C5_PECAS/1-175M.QFEPTEH.......................................PHRRFNPLKGEWIL.........---------
Q1IQZ6_KORVE/1-177M.SDATKST.......................................PHRRFNPLTGEWIL.........---------
Q6LQE3_PHOPR/15-189D.AFDATDH.......................................PHRRYNPLTGQWVL.........---------
A8LEI8_FRASN/19-211R.GSGVPST.......................................PHRRFDPLRGRWVL.........---------
Q59VY3_CANAL/21-210Q.EFDFTNH.......................................SHRRLNLLTNKFVL.........---------
A1L2D1_DANRE/7-181P.TFDPKEH.......................................QHLRYNPLRDSWVL.........---------
A7F8S7_SCLS1/1-208MPEKILDDI.......................................SHRRFNPLRGTWLL.........---------
Q3XZ93_ENTFC/18-230G.GWMEMDRL....................................YLQN.RLLGMVGEDALESIEV...R---------
B1YII0_EXIS2/18-230R.LIEPEDTV....................................YARN.RLLSLLGEAAYVDPG....T---------
Q0RE52_FRAAA/14-191A.VESMDDT.......................................THRRFNPLTGRWVL.........---------
Q21LR9_SACD2/5-180L.AFDPNDH.......................................SHRRKNPLTGEWVL.........---------
GALT_STACT/19-233G.DYEREDNY....................................YLQN.LILEITKAESIDETKNN.NG---------
GALT_LACPL/16-224S.QYTELDRI....................................YVHN.RVLGLVGEGDPIAA......---------
A8WVF3_CAEBR/2-179S.....KIN.......................................NFRRYNPLIDEWII.........---------
A2AMS2_MOUSE/3-177A.TFRASEH.......................................QHIRYNPLQDEWVL.........---------
GAL7_NEUCR/2-217T.DKVLDDI.......................................SHRRYNPLNGSWLL.........---------
A7TJY6_VANPO/4-190A.KFDYTDN.......................................SHRRYNPLTDSWVL.........---------
A6RBX1_AJECN/45-253V.ESVLDDI.......................................SHRRYNILRGSYVL.........---------
GAL7_KLULA/1-189M.SFDLTDH.......................................SHARYNPLTDSWIL.........---------
Q5KY03_GEOKA/19-233G.LLAPEDVV....................................YARN.RLLATLRLTEWQPAEV..KD---------
Q03PB0_LACBA/18-226A.PYTELDRQ....................................YVTN.RILALIGEGSVPTA......---------
A2QCH5_ASPNC/2-209V.EHVLDDI.......................................SHRRFNPLRGSYIL.........---------
A6WF46_KINRD/10-216R.KTSTRMADGRELIYFDDTEPWLSGERARDAVDHRPLRPADETLRGGSQVRFDPLTGDWIA.........---------
Q2J7D6_FRASC/3-201G.FVAMDDI.......................................THRRFNPLTGRWVL.........---------
A3QFA6_SHELP/9-182S.QFSTDEH.......................................PHRRFNPLTGEWVL.........---------
GALT_BACHD/21-236G.LITKWDID....................................ASRN.RVLDVLDLDELEPVEQ..VD---------
Q5WD06_BACSK/20-235K.LLPLADVD....................................YSRN.QLLDRLGLDAPMIGET..LP---------
A0QYK5_MYCS2/3-199Q.PLRWTLADGREQLYFSLPGHTP........APVGDRRPLPPRGNQQSELRFDRQTGQWVV.........---------
GALT_LACSS/20-231T.TYTAEDEQ....................................YLFN.VVLDLVGEGDETPVV....A---------
Q896X9_CLOTE/19-233N.LIEEIDKV....................................AARN.SLLELFKLDEPYKEDV..EF---------
GALT_DROME/1-175M.QFVASEH.......................................PHRRLNPLNGQWVL.........---------
GAL7_SCHPO/4-195K.KFDFTEY.......................................SHRRYNPLTDSYVL.........---------
B8I4V5_CLOCE/19-234G.MISKLDKI....................................IARN.QLLDLLKLNEPFYGEI..PD---------
A3LR66_PICST/19-206N.EFDFTNH.......................................SHRRFNPLSNTYVL.........---------
Q7N8Y8_PHOLL/4-178I.AFNPIEH.......................................PHRRYNPLTGQWVL.........---------
Q73SK2_MYCPA/2-203G.PTRAKLADGRDLLFFSLPGHRASPV..EDRRPLPPRTAETVAPGGQSQLRFDRSTGQWVI.........---------
A8FIP9_BACP2/20-233K.LITSLDIE....................................YTRN.RLLEVLRLDEAETRT....V---------
Q3IH81_PSEHT/3-176T.IFDPTEH.......................................PHRRYNPLIDEWVL.........---------
A0M3B7_GRAFK/1-176M.KTELNNT.......................................PHRRYNILTGEWIL.........---------
A5FKW9_FLAJ1/2-179K.NFDINED.......................................PHRRFNPLINEWVL.........---------
Q4PDD8_USTMA/31-214V.EFDATEH.......................................PHRRYNPLTRSWVL.........---------
Q15Y61_PSEA6/2-176S.KFDPVDH.......................................SHRRRNPLTNDWVL.........---------
Q6C0K3_YARLI/1-190M.TLVASDI.......................................PHRRYNPLRQSWVL.........---------
Q6BVI6_DEBHA/3-194E.LFDFTNH.......................................SHRRFNPLSNTYVL.........---------
Q2GAY3_NOVAD/2-175T.RFSTDDH.......................................PHRRQNLLTGKWVL.........---------
GALT_CLOAB/17-229G.LIQEDDKI....................................YSSN.MLAGLFNLDNFYFEEI...S---------
GALT_ENTFA/20-232G.DWTETDRY....................................YLTN.RIAKLVGCDFFEQPEA...V---------
Q30V51_DESAG/2-182G.LQPYKDI.......................................PHTRRNALTGEWVL.........---------
A9KN46_CLOPH/31-257G.LIEEEDRI....................................YVRN.RILSELQLSDYTEDVQSTSS---------
GALT_LACS1/18-228E.NYTELDRN....................................YLYN.RILNLVGEGVEKLT......---------
A0KQH7_AERHH/2-174...FNPVDH.......................................PHRRFNPLTGQYVL.........---------
A4VT89_STRSY/18-226..DFEEMDAI....................................YLRN.RVLALVGDQVLTVQ......---------
A5VME1_LACRD/16-220..TYEPLDRI....................................YVLN.KIRGFVGDEDVE........---------
E7KK61_YEASL/5-192..EFDFSSH.......................................SHRRYNPLTDSWIL.........---------
G0RTP4_HYPJQ/7-208......DDI.......................................SHRRYNPLTDSWLL.........---------
Q04GZ3_OENOB/18-225...YQELDRI....................................YVEN.RIHALIGDGNTVKE......---------
Q5KLY2_CRYNJ/11-195...FEPTEH.......................................PHRRYNPLIGKHVL.........---------
GALT_STRT2/18-226..DYEELDRI....................................YLTN.KVFTLVGEGVADVE......---------
Q5NEY1_FRATT/11-180..............................................KSSHRRKNILTNEWVL.........---------
Q7MBX0_VIBVY/28-200...FDVAEH.......................................PHRRYNPLMGEWVL.........---------
GALT2_STRR6/16-224..SFEEMDRI....................................YLTN.RVLSRVGEGVLEVE......---------
GALT1_STRR6/18-225...YNEIDKI....................................YVKN.RVLALIGEEGTDRI......---------
GALT_CLOPE/21-230...IEDMDTV....................................YTRN.RLLSLFNENSYTPCE....E---------
GALT_LACLA/19-228..TIEPLDEL....................................YHRN.QLLHFLGLNDWAEVDK...E---------
U5L509_9BACI/19-230..MIEERDRI....................................YARN.QIMSLLGLVEYPEHA....E---------

PF16268

F5XH95_MICPN/8-422--LEDGTVR------------------------------------------QVGPLTGTYVWTIPGRANRP..ISHAAA.
C3PH27_CORA7/1-419--MADGTVK------------------------------------------QVNPFSGTEVWTVPGRGNRP..LSHPAK.
B1VH78_CORU7/18-447--LPDGTIK------------------------------------------QVNPFSGTEVWTVPGRGHRP..MEPYQL.
Q8NNU9_CORGL/1-424--MADGTIK------------------------------------------QIHPFTGTEVWTVPGRGNRP..LSHPAS.
W5WQ34_9CORY/18-447--LPDGTIK------------------------------------------QVNPFSGTEVWTVPGRGNRP..IAEHRS.
W5Y1J6_9CORY/15-448--MADGTVK------------------------------------------QVNPFSGTQVWTVPGRGNRP..ISRPAV.
G0HAG7_CORVD/18-449--LPDGTIK------------------------------------------QVNPFSGTEVWTVPGRAHRP..VPHHGP.
U3GXR8_9CORY/26-464--MADGTIK------------------------------------------QVNPFSGTEVWTVPGRGNRP..LGITRP.
Q6NGG7_CORDI/11-432--MSDGTIK------------------------------------------QVNPFSGTEVWTVPGRGHRP..LSTSQG.
S5SVS2_9CORY/15-437--MTDGTIK------------------------------------------QVNPFSGTQVWTVPGRGQRP..LSVPIP.
B3QVF6_CHLT3/10-436--MPDGTIK------------------------------------------QINPFTGSEVWSVPGRGNKP..LANEIP.
Q6A5P1_PROAC/10-435--LPDGTIK------------------------------------------QVNPFTGTKVWTVPGRGARP..LGKPAE.
Q8FP08_COREF/15-438--MADGTIK------------------------------------------QVHPFTGTEVWTVPGRGNRP..LSRPAP.
F8E0G1_CORRG/18-447--LPDGTIK------------------------------------------QVNPFSGTEVWTVPGRANRP..IAEHRP.
C5CBF5_MICLC/33-463--LPDGTVK------------------------------------------QRNPFTGTEVWTVPGRGHRP..LGLVRP.
I6XY80_PROPF/27-452--MADGTVK------------------------------------------QVGPLTGTEVWTVPGRGNRP..LGLQRP.
R5PXK8_9PROT/14-442--MPDGTVK------------------------------------------QVNPFTGTQVWTVPGRGNRPNVKKDKAP.
D7BLX6_ARCHD/14-437--MADGTIK------------------------------------------QINPFSGTEVWTIPGRANRP..IEITHT.
D9QB86_CORP2/15-442--MADGTIK------------------------------------------QVNPFSGTQVWTVPGRANRP..LTHLPA.
X5DSS5_9CORY/40-471--LPDGTIK------------------------------------------QVNPFSGTEVWTVPSRGHRP..VRERPE.
M1P829_9CORY/11-432--MADGTIK------------------------------------------QVNPLTGTEVWTVPGRGNRP..LSRPAT.
D7GCR7_PROFC/13-438--MPDGTVK------------------------------------------QVNPLSGVEVWTVPGRGNRP..LATPVN.
D7WEZ1_9CORY/10-431--MADGTIK------------------------------------------QYNPFSGTQVWTVPGRGNRP..LAVPKQ.
C8XCI8_NAKMY/35-455--MSDGTLK------------------------------------------QINPFTGTQVWTVPGRARRP..LRAPEPA
C4LIB0_CORK4/15-440--LADGTIK------------------------------------------QVNPFTGTEVWTVPGRGNRP..ISHPTP.
K7RWS7_PROA4/29-464--LKDGTIK------------------------------------------QVNPFTGVQVWTVPGRGSRP..LNRPIP.
D6ZJH6_MOBCV/17-441--MADGTIK------------------------------------------QRNPLTGTQVWTVTSRGNRPHFHREVVT.

PF11969

Q5TVU2_ANOGA/17-126----------------------------------------------------------SYQ--LV---------------
A5DAJ7_PICGU/3-137----------------------------------------------------------RHA--FQ---------------
A5DAR3_PICGU/136-257----------------------------------------------------------KWV--YN---------------
Q293N2_DROPS/5-112----------------------------------------------------------NLI--NT---------------
Q293N2_DROPS/220-329----------------------------------------------------------NEL--RK---------------
Q297L1_DROPS/153-272----------------------------------------------------------EWV--YN---------------
Q29LN6_DROPS/45-159----------------------------------------------------------ECL--FC---------------
HINT3_RAT/40-155----------------------------------------------------------NCV--FC---------------
A0EGQ1_PARTE/118-231----------------------------------------------------------DWV--YN---------------
A1CEC1_ASPCL/149-272----------------------------------------------------------NWV--FN---------------
A3DF72_CLOTH/3-110----------------------------------------------------------NCV--FC---------------
A3LWH2_PICST/136-257----------------------------------------------------------KWV--YN---------------
A4S248_OSTLU/99-229----------------------------------------------------------AWV--RK---------------
APTX_DROME/4-113----------------------------------------------------------SSA--LI---------------
APTX_DROME/229-339----------------------------------------------------------RDE--LQ---------------
A4XKP5_CALS8/3-110----------------------------------------------------------ECI--FC---------------
A5D7U9_BOVIN/174-293----------------------------------------------------------QWV--YN---------------
A5E770_LODEL/177-298----------------------------------------------------------QWV--YN---------------
A5GQU3_SYNR3/125-230----------------------------------------------------------PTI--FG---------------
A5I635_CLOBH/3-110----------------------------------------------------------NCI--FC---------------
A6QUC5_AJECN/141-262----------------------------------------------------------NWV--YN---------------
A6VZM3_MARMS/2-109----------------------------------------------------------DCL--FC---------------
A7HMY4_FERNB/3-108----------------------------------------------------------DCV--FC---------------
A7S614_NEMVE/151-270----------------------------------------------------------QWV--YN---------------
A7SFV5_NEMVE/10-122----------------------------------------------------------KCV--FC---------------
A7TKH2_VANPO/142-261----------------------------------------------------------KWV--EN---------------
A7TQ97_VANPO/171-297----------------------------------------------------------SWV--NE---------------
YHIT_CHLTR/2-108----------------------------------------------------------TTI--FE---------------
APTX_CHICK/142-252----------------------------------------------------------SQG--LK---------------
APTX_DANRE/150-260----------------------------------------------------------SQG--LK---------------
APTX_XENTR/173-283----------------------------------------------------------SQG--LK---------------
APTX_CIOIN/206-317----------------------------------------------------------SQG--LK---------------
Q0U2I6_PHANO/148-269----------------------------------------------------------NWV--FN---------------
Q15X15_PSEA6/3-110----------------------------------------------------------ETI--FT---------------
Q16F07_AEDAE/8-123----------------------------------------------------------SYA--LI---------------
Q16XY1_AEDAE/224-343----------------------------------------------------------EWL--YN---------------
Q16YN6_AEDAE/11-125----------------------------------------------------------RCI--FC---------------
Q18227_CAEEL/10-129----------------------------------------------------------GCK--FC---------------
Q1CY35_MYXXD/3-112----------------------------------------------------------DCL--FC---------------
Q1QZ40_CHRSD/2-109----------------------------------------------------------ECL--FC---------------
HINT3_XENTR/18-132----------------------------------------------------------SCI--FC---------------
Q2H2H7_CHAGB/31-147----------------------------------------------------------SPL--YD---------------
Q2H304_CHAGB/151-275----------------------------------------------------------NWA--FN---------------
HINT3_BOVIN/47-162----------------------------------------------------------KCV--FC---------------
Q3IJU5_PSEHT/4-111----------------------------------------------------------ETI--FT---------------
Q4PA08_USTMA/46-158----------------------------------------------------------KCV--FC---------------
Q54DF5_DICDI/36-141----------------------------------------------------------GCP--FC---------------
Y2839_DICDI/224-348----------------------------------------------------------NVG--LS---------------
Q59S51_CANAL/134-254----------------------------------------------------------KWV--YN---------------
Q5TUI6_ANOGA/154-273----------------------------------------------------------EWL--YN---------------
A8XGQ1_CAEBR/148-267----------------------------------------------------------NWV--YN---------------
Q6BZT0_YARLI/136-263----------------------------------------------------------QWV--HN---------------
Q6C515_YARLI/4-127----------------------------------------------------------KYA--LG---------------
Q6C6M8_YARLI/30-153----------------------------------------------------------KWA--DG---------------
Q6CJA1_KLULA/160-286----------------------------------------------------------QWV--QN---------------
Q6FLB9_CANGA/198-323----------------------------------------------------------KWV--NN---------------
Q6FWT2_CANGA/170-296----------------------------------------------------------AWV--NN---------------
Q6IIA4_DROME/5-118----------------------------------------------------------NCI--FC---------------
Q74ZD1_ASHGO/153-277----------------------------------------------------------QWV--HN---------------
Q7PHF8_ANOGA/7-116----------------------------------------------------------SDG--LI---------------
Q7QJM2_ANOGA/10-124----------------------------------------------------------NCI--FC---------------
Q83DE2_COXBU/3-109----------------------------------------------------------ACV--FC---------------
Q84VV6_ARATH/7-121----------------------------------------------------------ACI--FC---------------
Q8GYJ9_ARATH/75-183----------------------------------------------------------PTI--FD---------------
Q8SUA2_ENCCU/116-232----------------------------------------------------------NWM--DN---------------
Q97JJ3_CLOAB/3-110----------------------------------------------------------ECI--FC---------------
BH140_ARATH/717-833----------------------------------------------------------ALA--LH---------------
DCPS_SCHPO/141-261----------------------------------------------------------QWV--EN---------------
E7KRX8_YEASL/160-281----------------------------------------------------------KWV--NN---------------
E7KUH0_YEASL/160-281----------------------------------------------------------KWV--NN---------------
F1R776_DANRE/159-276----------------------------------------------------------QWV--YN---------------
F7CC42_XENTR/161-276----------------------------------------------------------QWV--YN---------------
H3C365_TETNG/54-161----------------------------------------------------------.CP--FC---------------
H3CJX6_TETNG/127-244----------------------------------------------------------QWV--YN---------------
H3DP42_TETNG/31-141----------------------------------------------------------KCI--FC---------------
Q0JBF2_ORYSJ/25-136----------------------------------------------------------.CV--FC---------------
Q5K774_CRYNJ/143-255----------------------------------------------------------.WV--YE---------------
Q9VQ59_DROME/32-141----------------------------------------------------------KCF--FC---------------

PF01230

HINT1_RAT/24-121--------------------------------------------------------------------------------
HNT2_YEAST/12-107--------------------------------------------------------------------------------
FHIT_HUMAN/11-105--------------------------------------------------------------------------------
APH1_SCHPO/12-106--------------------------------------------------------------------------------
APTX_YEAST/15-139--------------------------------------------------------------------------------
Q9I500_PSEAE/74-166--------------------------------------------------------------------------------
Q98BM9_RHILO/14-106--------------------------------------------------------------------------------
Y866_METJA/9-105--------------------------------------------------------------------------------
YHIT_MYCPN/19-116--------------------------------------------------------------------------------
APTX_SCHPO/44-156--------------------------------------------------------------------------------
YHIT_HELPY/9-104--------------------------------------------------------------------------------
HNT1_YEAST/32-125--------------------------------------------------------------------------------
Q9A2A9_CAUCR/9-106--------------------------------------------------------------------------------
YHIT_SYNY3/12-109--------------------------------------------------------------------------------
Y1390_SYNE7/12-109--------------------------------------------------------------------------------
YHI1_MYCLE/10-102--------------------------------------------------------------------------------
Y961_HAEIN/12-110--------------------------------------------------------------------------------
Q9JYE4_NEIMB/10-102--------------------------------------------------------------------------------
Q9KQC5_VIBCH/14-106--------------------------------------------------------------------------------
ZB14_MAIZE/24-123--------------------------------------------------------------------------------
HINT_CAEEL/28-125--------------------------------------------------------------------------------
G8AG53_AZOBR/16-114--------------------------------------------------------------------------------
K7XM15_MYCHR/14-110--------------------------------------------------------------------------------
YHI2_MYCTU/11-106--------------------------------------------------------------------------------
Q32EW3_SHIDS/12-109--------------------------------------------------------------------------------

PF04677

C3H64_ARATH/370-491----------------------------------------------RKPRSENANRSKECW--FC---------------
C19L1_CAEEL/309-429----------------------------------------------GNDGPRNKQPVGPCW--FC---------------
C19L2_CAEEL/226-350----------------------------------------------IKEHKRIERSFDDCS--RC---------------
C19L2_DROME/460-584----------------------------------------------IREHEKLVATLDNCE--RC---------------
CWF19_SCHPO/399-523----------------------------------------------GGDLKKINHVLDTCP--LC---------------
DRN1_YEAST/256-389----------------------------------------------NENKKIRTILPSSCH--FC---------------
MU161_SCHPO/334-470----------------------------------------------SLNNRRSKVGPGSCF--FC---------------
Q93ZX4_ARATH/458-582----------------------------------------------.NRVKRIMTQQERCL--FC---------------

PF02611

CDH_HELPY/24-243------------------------------------------------PNVLRKIVFEKCL..PN---------------
G9AY12_PANAN/24-250------------------------------------------------SDALWAVTDNVCM..VN---------------
Q8P9Z9_XANCP/30-250------------------------------------------------PDALWRIVTTHCL....---------------
E8V0N7_TERSS/35-269------------------------------------------------GDVLWQIVHEDCV..PD---------------
A8GL49_SERP5/45-264------------------------------------------------SSALWRIVSQQCL..PN---------------
E0SJ94_DICD3/33-253------------------------------------------------GNALWEFVGQQCV..PN---------------
CDH_YERPE/33-252------------------------------------------------ADALWKIISQQCI..PH---------------
B8IMH8_METNO/37-256------------------------------------------------RNLLW.VTLQTCI..LT---------------
W0LHA3_SERFO/26-254------------------------------------------------SNALWNVVDKLCM..VN---------------
B1M455_METRJ/29-249------------------------------------------------RDVLW.AALKTCV..LA---------------
Q1LBK3_RALME/33-250------------------------------------------------RDSLWKNVQERCL..TP---------------
Q6MQF2_BDEBA/30-256------------------------------------------------SDALWNLISTQCL..PL---------------
G8MBN7_9BURK/67-288------------------------------------------------PNALWEIVHDYCE..PA---------------
A6TFQ8_KLEP7/24-243------------------------------------------------PDALRKIVLQQCV..PH---------------
H2INV4_RAHAC/31-250------------------------------------------------PNALWNIVSTKCV..PN---------------
B0U7T2_METS4/29-248------------------------------------------------RDVLW.VALQGCI..LA---------------
B2VF57_ERWT9/34-251------------------------------------------------SEKLWQIVSQQCL..PG---------------
B9JRW8_AGRVS/27-242------------------------------------------------PDALWKIVHDKCV....---------------
D8IW24_HERSS/34-253------------------------------------------------PHKLWEITSQQCV..PH---------------
C5BB31_EDWI9/31-247------------------------------------------------SDALWRIVSQQCL..PH---------------
A9HJU4_GLUDA/35-256------------------------------------------------PNVLWSIVHDRCV..PN---------------
B2JLJ5_BURP8/29-246------------------------------------------------PNALWKIVDHQCV..PA---------------
B1LSY8_METRJ/26-246------------------------------------------------RDVLW.VALQGCV..LA---------------
L0IYV5_MYCSM/29-248------------------------------------------------PNALWTIVHDQCV..PD---------------
B8IPC5_METNO/27-247------------------------------------------------RDSLW.LVVRSCL..GA---------------
B2FII5_STRMK/27-247------------------------------------------------SDALWRLIERDCR....---------------
CDH_CROS8/31-250------------------------------------------------PDALRHIVMQQCL..PG---------------
B8EQB5_METSB/40-259------------------------------------------------SNALWTIVHGPCT..FN---------------
B2HIW3_MYCMM/43-260------------------------------------------------RDQLWKIVHDRCE..RD---------------
W0HRX4_9ENTR/35-254------------------------------------------------PDALWRIVSEECV..PH---------------
E6WAG7_PANSA/33-250------------------------------------------------SNALWQIISEKCL..PG---------------
B1M8V7_METRJ/69-294------------------------------------------------.GALWAIVHGACV..PH---------------
D8MKK8_ERWBE/33-250------------------------------------------------SDALWKIVSQKCV..PN---------------
G2I2H3_GLUMN/36-254------------------------------------------------PDILWHIVHERCTIKPD---------------
Q6D6W9_PECAS/32-251------------------------------------------------SNALWEIVSEQCV..PN---------------
D2UA62_XANAP/30-247------------------------------------------------ADTVWRVVHRQCA..SD---------------
CDH_MYCLE/38-255------------------------------------------------RDALWKIVHDRCE..LG---------------
Q13LU5_BURXL/41-259------------------------------------------------SNALWKIVDLRCV..PS---------------
Q7NQ26_CHRVO/27-251------------------------------------------------GDALWRIVGGQCV..PA---------------
K7SS21_GLUOY/32-232------------------------------------------------RNKLWELVGSRCA..KD---------------
R9VP92_9ENTR/32-251------------------------------------------------PDALRHIVTEQCL..PN---------------
Q0JZ98_CUPNH/25-246------------------------------------------------RDGLWRNVQQRCL..GS---------------
H8L0L3_FRAAD/32-259------------------------------------------------PSQLW.LLLQRCA..VQ---------------
CDH_ECOLI/31-250------------------------------------------------SDTLRKIVLEECL..PN---------------
Q5FPM0_GLUOX/32-232------------------------------------------------RGALWKVVHGRCA..PD---------------
W0PFV2_9BURK/44-257------------------------------------------------.DILWHFVHDQCV..PN---------------
I2BEE8_SHIBC/29-247------------------------------------------------PDALWQIVSRQCV..PG---------------
CDH_MYCTU/41-258------------------------------------------------REALWKIVHDRCE..FG---------------
U3U143_9ENTR/33-250------------------------------------------------ADALWQIVSEKCV..PD---------------
D5CGT2_ENTCC/45-264------------------------------------------------PNALRHIVLDQCV..PN---------------

PF02744

GAL7_CRYNJ/204-373----------------------------------------------E........IENFVR--YA---------------
GAL7_HAEIN/183-348----------------------------------------------E........DRTQRD--YL---------------
GALT_STRMU/231-435----------------------------------------------NTFRQLLDIVDIFPG--YF---------------
GALT_BACSU/240-451----------------------------------------------KTFERLLSFLGQYPH--YF---------------
GAL7_YEAST/198-366----------------------------------------------E........LKSFDK--YK---------------
GAL7_KLULA/195-363----------------------------------------------E........FDHFEK--YE---------------
GAL7_ECOLI/182-347----------------------------------------------E........DRLQKE--YF---------------
GALT_HUMAN/202-370----------------------------------------------E........ERSQQA--YK---------------

PF16285

D5DD06_BACMD/8-254EKQG-----------------------------------------------------------SIIWL-----------K
C0ZAZ1_BREBN/8-252EQRG-----------------------------------------------------------SMIWL-----------M
B2TPI8_CLOBB/11-256QENG-----------------------------------------------------------PFVLL-----------K
C9LU44_SELS3/8-252DTDG-----------------------------------------------------------DLVLL-----------K
D9SRU9_CLOC7/9-253DEKG-----------------------------------------------------------VFIFL-----------K
Q81VH8_BACAN/8-251ATEG-----------------------------------------------------------PIIWL-----------K
U5LFA6_9BACI/8-252AVED-----------------------------------------------------------NIILL-----------K

PF01087

GAL7_CRYNJ/15-198....-----------------------------------------------------------VSPHR...........S
Q7QA38_ANOGA/1-174....-----------------------------------------------------------VSPHR...........M
A5DRG5_PICGU/6-197....-----------------------------------------------------------CSPHR...........A
Q9CM11_PASMU/4-178....-----------------------------------------------------------VSPHR...........A
Q2H1V5_CHAGB/2-211....-----------------------------------------------------------VSPHR...........T
A4AQM0_MARSH/1-176....-----------------------------------------------------------VSPHR...........T
Q65CW7_BACLD/17-231ASGD-----------------------------------------------------------SIPDL...........L
A9WJH8_CHLAA/4-191....-----------------------------------------------------------VSPHR...........T
A7MIY8_CROS8/2-176....-----------------------------------------------------------VSPHR...........A
Q03XA5_LEUMM/18-235DDSV-----------------------------------------------------------TTLAL...........L
A3N102_ACTP2/3-177....-----------------------------------------------------------VSPHR...........A
GALT_STRMU/16-225TNQS-----------------------------------------------------------NLIAL...........K
A5DWA9_LODEL/21-211....-----------------------------------------------------------CSPHR...........A
Q6D2C5_PECAS/1-175....-----------------------------------------------------------VSPHR...........A
Q1IQZ6_KORVE/1-177....-----------------------------------------------------------VSPHR...........T
Q6LQE3_PHOPR/15-189....-----------------------------------------------------------VSPHR...........A
A8LEI8_FRASN/19-211....-----------------------------------------------------------VSAGR...........D
Q59VY3_CANAL/21-210....-----------------------------------------------------------CSPHR...........A
A1L2D1_DANRE/7-181....-----------------------------------------------------------VSAHR...........M
A7F8S7_SCLS1/1-208....-----------------------------------------------------------VSPHR...........T
Q3XZ93_ENTFC/18-230PVKE-----------------------------------------------------------ESVDL...........L
B1YII0_EXIS2/18-230VGTR-----------------------------------------------------------PIPDL...........L
Q0RE52_FRAAA/14-191....-----------------------------------------------------------VSPGR...........V
Q21LR9_SACD2/5-180....-----------------------------------------------------------VSPHR...........S
GALT_STACT/19-233LVNP-----------------------------------------------------------TSNEI...........A
GALT_LACPL/16-224.SDD-----------------------------------------------------------QLTSL...........T
A8WVF3_CAEBR/2-179....-----------------------------------------------------------VAVNR...........I
A2AMS2_MOUSE/3-177....-----------------------------------------------------------VSAHR...........M
GAL7_NEUCR/2-217....-----------------------------------------------------------VSPHR...........T
A7TJY6_VANPO/4-190....-----------------------------------------------------------VSPHR...........A
A6RBX1_AJECN/45-253....-----------------------------------------------------------VSPHR...........T
GAL7_KLULA/1-189....-----------------------------------------------------------VSPHR...........A
Q5KY03_GEOKA/19-233VPLA-----------------------------------------------------------SPAPV...........L
Q03PB0_LACBA/18-226.TAN-----------------------------------------------------------EPIDL...........V
A2QCH5_ASPNC/2-209....-----------------------------------------------------------VSPHR...........T
A6WF46_KINRD/10-216....-----------------------------------------------------------MASHR...........N
Q2J7D6_FRASC/3-201....-----------------------------------------------------------VSPGR...........T
A3QFA6_SHELP/9-182....-----------------------------------------------------------LSPHR...........S
GALT_BACHD/21-236VECE-----------------------------------------------------------MPYPI...........L
Q5WD06_BACSK/20-235ETNE-----------------------------------------------------------PIYDI...........L
A0QYK5_MYCS2/3-199....-----------------------------------------------------------IAALR...........Q
GALT_LACSS/20-231QETT-----------------------------------------------------------TLIDL...........K
Q896X9_CLOTE/19-233EDIN-----------------------------------------------------------TATDI...........L
GALT_DROME/1-175....-----------------------------------------------------------VCPHR...........T
GAL7_SCHPO/4-195....-----------------------------------------------------------CSPHR...........A
B8I4V5_CLOCE/19-234EYIE-----------------------------------------------------------FPTEI...........L
A3LR66_PICST/19-206....-----------------------------------------------------------CSPHR...........A
Q7N8Y8_PHOLL/4-178....-----------------------------------------------------------VSPHR...........V
Q73SK2_MYCPA/2-203....-----------------------------------------------------------IAALR...........Q
A8FIP9_BACP2/20-233PGEE-----------------------------------------------------------DLEDI...........L
Q3IH81_PSEHT/3-176....-----------------------------------------------------------VSPHR...........A
A0M3B7_GRAFK/1-176....-----------------------------------------------------------VSPHR...........T
A5FKW9_FLAJ1/2-179....-----------------------------------------------------------VSPHR...........A
Q4PDD8_USTMA/31-214....-----------------------------------------------------------CSPHR...........T
Q15Y61_PSEA6/2-176....-----------------------------------------------------------VSPHR...........A
Q6C0K3_YARLI/1-190....-----------------------------------------------------------VSPHR...........A
Q6BVI6_DEBHA/3-194....-----------------------------------------------------------CSPHR...........A
Q2GAY3_NOVAD/2-175....-----------------------------------------------------------VSPHR...........A
GALT_CLOAB/17-229DVPS-----------------------------------------------------------TATAI...........L
GALT_ENTFA/20-232ACEQ-----------------------------------------------------------EPLRV...........V
Q30V51_DESAG/2-182....-----------------------------------------------------------VSPHR...........A
A9KN46_CLOPH/31-257EAES-----------------------------------------------------------NIPNILETKVEDLEEIL
GALT_LACS1/18-228TTKN-----------------------------------------------------------EIIDL...........K
A0KQH7_AERHH/2-174....-----------------------------------------------------------VSPHR...........A
A4VT89_STRSY/18-226TDLE-----------------------------------------------------------DLIEL...........K
A5VME1_LACRD/16-220..AK-----------------------------------------------------------DDEPV...........V
E7KK61_YEASL/5-192....-----------------------------------------------------------VSPHR...........A
G0RTP4_HYPJQ/7-208....-----------------------------------------------------------VSPHR...........T
Q04GZ3_OENOB/18-225KDDQ-----------------------------------------------------------LLNLR...........T
Q5KLY2_CRYNJ/11-195....-----------------------------------------------------------VSPHR...........T
GALT_STRT2/18-226TDSS-----------------------------------------------------------ELIDL...........K
Q5NEY1_FRATT/11-180....-----------------------------------------------------------VSPHR...........L
Q7MBX0_VIBVY/28-200....-----------------------------------------------------------VSPHR...........A
GALT2_STRR6/16-224TNLD-----------------------------------------------------------KLIDL...........K
GALT1_STRR6/18-225SDEN-----------------------------------------------------------DLKQI...........K
GALT_CLOPE/21-230KLTL-----------------------------------------------------------SFHET...........L
GALT_LACLA/19-228AHEK-----------------------------------------------------------DSLIL...........M
U5L509_9BACI/19-230AVEK-----------------------------------------------------------AIPDV...........L

PF16268

F5XH95_MICPN/8-422SSHP.LVGDDADRLCSFCPKRYLETTPEKSRLIGT....GLD.....AR..............IERGRLPARLQQGVAAA
C3PH27_CORA7/1-419DPQP.LGPDALTHSCAFCSGRMLDTPPEKSRILA.....SGE.....................IQRGLLPHELDNSQPLF
B1VH78_CORU7/18-447AKDP.IA..DRDRASDFGIARKLDTPPEKARMVRDI...NGD.....IR..............IDRGVVASKLEDSEPLF
Q8NNU9_CORGL/1-424TIVE.LSAHDHTSYCAFCSDNMLSTPPEKSRIIIDS...SGD.....FD..............ILPGALPGELSETTPEF
W5WQ34_9CORY/18-447GVEP.IG..DRDATTAFGLKRKLDTPPEKSRLIIDE...DGE.....AH..............ILRGLPVSKLEDTTPLF
W5Y1J6_9CORY/15-448SVEK.LEKGDAASYCAFCADRHLETPPEKARVIA.....RDV.....AEAA.GIEGEVLTDGYVLATKQLIDQQTTPVAF
G0HAG7_CORVD/18-449AAFA.ITEDNRDTQTDFGIGNKLKTTPEKARLVIDD...NGE.....PR..............ILRGLTVSQLEQTDPLF
U3GXR8_9CORY/26-464NPQP.LTPSAHTSTCAFCSDNYLQTPPEKARVTIP....SAQ.....ATAT.SSSKAAQTKPRITTHTPARDLFDSVADF
Q6NGG7_CORDI/11-432NITP.ITPSDHSNTCAFCSDRYLDTPPEKARIVRD....DDG.....WT..............ILRGVLPDRLHDSVPAF
S5SVS2_9CORY/15-437NPAP.LGPGATTHTCAFCSGRPLDTPPEKSRIIRH....EGR.....WR..............TLTDLLPGQYGDSVAEF
B3QVF6_CHLT3/10-436ETAKELPYKEKEDYCSFCESRYYETPPEKARIIKE....NGQ.....YK..............TLQAVPSSKYFETQAEF
Q6A5P1_PROAC/10-435QTRE.LADHDRRAACVFCPDNYLSTPPEKTRLVK...................RAGGLVRGHDLIRCVPADRLDATVPEF
Q8FP08_COREF/15-438DPVP.LSPEDHTSYCAFCPDNQLSTPPEKSRMVRTG...KGD.....FE..............VLAGGLPRDLDKTVAEF
F8E0G1_CORRG/18-447EAND.IA..DRDATTAFGLKRKLETPPEKSRLIVDA...DGK.....PR..............ILRGLKPSELENTTPLF
C5CBF5_MICLC/33-463APQP.LDPAQHGRHCAFCEHRLLETPPEKSRIVST....RADDGAPAWQ..............ILRHLAAEQLGETTPAF
I6XY80_PROPF/27-452EPRP.IDETAHGTHCAFCERRYLETPPEKARVVRS....GDE.....WE..............TLMGLPAEKLFTTTAEF
R5PXK8_9PROT/14-442ETAP.VTPKEIEDYCHFCPKNYLKTPPEKARLVKTS...DGE.....FK..............ILKNLMAGQLFDTTAEF
D7BLX6_ARCHD/14-437DVRP.IDPNRLGHSCAFCTQRILETPPEKARIVRK....RDD.....AV..............VYRGTNVDML.TREWEF
D9QB86_CORP2/15-442DIHK.LTYQDHVSTCAFCSDRQIETPPEKARMVQSSVKKNSD.....WE..............ILRGVGAEDLYATTAAF
X5DSS5_9CORY/40-471DVFD.ITDDNRDNQTDFGIADLLRTTPEKARMVIDD...NGD.....PR..............ILRGLTVSDLSETDPLF
M1P829_9CORY/11-432DPTP.LGKHDFTHRCAFCEATPLATPPEKSRMVRE....DGG.....WR..............TLSGLLPGELAGHRAEF
D7GCR7_PROFC/13-438DPRA.LSADDFGHSCAFCADRMAETPPEKARRVHG....ADG.....WQ..............TLTGVLPEHLHDTVAEF
D7WEZ1_9CORY/10-431EPHS.LEPHDFTDSCNFCADRKLKTPPEKSRIVQR....DGG.....WE..............ILRDLLPHELDDTQPMF
C8XCI8_NAKMY/35-455TTAP.LTDELRTGACAFCPEHYRQTPPEKARLVTG....TQG.....ER..............MIRHLRADQLFDTVADF
C4LIB0_CORK4/15-440EEHP.VTVHDRDYECAFCSARYRETPPEKARVVVD....NNK.....WT..............TFYRLKESQLDDSVAEF
K7RWS7_PROA4/29-464NPRP.ITDADRVAACAFCQNRTLETPPEKSRLIST....LSD.....GAYGAGDSSEIMRGYRVLRHLPAGEVGSTTAEF
D6ZJH6_MOBCV/17-441EPAPLLQPSDFTNTCAFCTDRYFDTPPEKSRLVK.....GLD.....AKFH............KIEGLPAASMQDMVAEF

PF11969

Q5TVU2_ANOGA/17-126---------------------------------------------------------------R..E-------LND..E
A5DAJ7_PICGU/3-137---------------------------------------------------------------PYID-------DPP.AH
A5DAR3_PICGU/136-257---------------------------------------------------------------ILFE-------GKE..S
Q293N2_DROPS/5-112---------------------------------------------------------------I...-------.AD..Q
Q293N2_DROPS/220-329---------------------------------------------------------------KILD-------KNH...
Q297L1_DROPS/153-272---------------------------------------------------------------ILEH-------KKE..T
Q29LN6_DROPS/45-159---------------------------------------------------------------DFAN-------GKQ..G
HINT3_RAT/40-155---------------------------------------------------------------RVAA-------GQE..P
A0EGQ1_PARTE/118-231---------------------------------------------------------------ILEK-------KKE..V
A1CEC1_ASPCL/149-272---------------------------------------------------------------ILEG-------RTE..Q
A3DF72_CLOTH/3-110---------------------------------------------------------------KIIK-------REL..P
A3LWH2_PICST/136-257---------------------------------------------------------------ILFE-------GKE..S
A4S248_OSTLU/99-229---------------------------------------------------------------ILSL-------EKE..R
APTX_DROME/4-113---------------------------------------------------------------K..D-------ISK..P
APTX_DROME/229-339---------------------------------------------------------------R..K-------LND..K
A4XKP5_CALS8/3-110---------------------------------------------------------------KIVN-------KQI..P
A5D7U9_BOVIN/174-293---------------------------------------------------------------ILDK-------KAE..A
A5E770_LODEL/177-298---------------------------------------------------------------ILYH-------GKE..A
A5GQU3_SYNR3/125-230---------------------------------------------------------------RILR-------GEI..P
A5I635_CLOBH/3-110---------------------------------------------------------------KILK-------GEI..P
A6QUC5_AJECN/141-262---------------------------------------------------------------IIEG-------RKE..Q
A6VZM3_MARMS/2-109---------------------------------------------------------------KIVK-------GDI..P
A7HMY4_FERNB/3-108---------------------------------------------------------------KIID-------GQI..P
A7S614_NEMVE/151-270---------------------------------------------------------------ILEK-------KAE..T
A7SFV5_NEMVE/10-122---------------------------------------------------------------KISS-------KEQ..E
A7TKH2_VANPO/142-261---------------------------------------------------------------ILYN-------GAE..S
A7TQ97_VANPO/171-297---------------------------------------------------------------ILYE-------DVE..A
YHIT_CHLTR/2-108---------------------------------------------------------------RIIE-------GAV..E
APTX_CHICK/142-252---------------------------------------------------------------S..S-------MQD..P
APTX_DANRE/150-260---------------------------------------------------------------A..S-------MQD..P
APTX_XENTR/173-283---------------------------------------------------------------A..S-------MQD..P
APTX_CIOIN/206-317---------------------------------------------------------------A..S-------MED..P
Q0U2I6_PHANO/148-269---------------------------------------------------------------IIEG-------RTE..Q
Q15X15_PSEA6/3-110---------------------------------------------------------------KIIN-------KEI..P
Q16F07_AEDAE/8-123---------------------------------------------------------------R..D-------INS..P
Q16XY1_AEDAE/224-343---------------------------------------------------------------ILEH-------RKE..K
Q16YN6_AEDAE/11-125---------------------------------------------------------------KIVT-------GQD..P
Q18227_CAEEL/10-129---------------------------------------------------------------DIVK-------NKK..E
Q1CY35_MYXXD/3-112---------------------------------------------------------------KIRD-------GLI..P
Q1QZ40_CHRSD/2-109---------------------------------------------------------------KMVN-------RDI..E
HINT3_XENTR/18-132---------------------------------------------------------------RIAN-------KQE..S
Q2H2H7_CHAGB/31-147---------------------------------------------------------------ICDN-------PER..Y
Q2H304_CHAGB/151-275---------------------------------------------------------------IIEG-------TKE..A
HINT3_BOVIN/47-162---------------------------------------------------------------RIAA-------HQD..P
Q3IJU5_PSEHT/4-111---------------------------------------------------------------KIIN-------REI..P
Q4PA08_USTMA/46-158---------------------------------------------------------------NVTP-------DRF...
Q54DF5_DICDI/36-141---------------------------------------------------------------DYPN-------DKI...
Y2839_DICDI/224-348---------------------------------------------------------------ALVY-------FCN.KP
Q59S51_CANAL/134-254---------------------------------------------------------------ILFE-------GKE..S
Q5TUI6_ANOGA/154-273---------------------------------------------------------------VLEH-------RKE..K
A8XGQ1_CAEBR/148-267---------------------------------------------------------------CLEK-------RSE..V
Q6BZT0_YARLI/136-263---------------------------------------------------------------ILYH-------GKE..A
Q6C515_YARLI/4-127---------------------------------------------------------------Q..Y-------IKS..P
Q6C6M8_YARLI/30-153---------------------------------------------------------------VLYR-------DES..P
Q6CJA1_KLULA/160-286---------------------------------------------------------------ILYN-------GAE..S
Q6FLB9_CANGA/198-323---------------------------------------------------------------ILYN-------GAE..D
Q6FWT2_CANGA/170-296---------------------------------------------------------------ILYG-------EAE..A
Q6IIA4_DROME/5-118---------------------------------------------------------------LISD-------GRI..P
Q74ZD1_ASHGO/153-277---------------------------------------------------------------ILYN-------GAE..A
Q7PHF8_ANOGA/7-116---------------------------------------------------------------H..A-------ISN..V
Q7QJM2_ANOGA/10-124---------------------------------------------------------------KIAT-------GND..P
Q83DE2_COXBU/3-109---------------------------------------------------------------KIAK-------GEI...
Q84VV6_ARATH/7-121---------------------------------------------------------------EIVR-------NPT..T
Q8GYJ9_ARATH/75-183---------------------------------------------------------------KIIA-------KEI..P
Q8SUA2_ENCCU/116-232---------------------------------------------------------------LIAQ-------DRSDLN
Q97JJ3_CLOAB/3-110---------------------------------------------------------------KIIK-------GEI..P
BH140_ARATH/717-833---------------------------------------------------------------SIAM-------H....P
DCPS_SCHPO/141-261---------------------------------------------------------------ILTH-------KAE..A
E7KRX8_YEASL/160-281---------------------------------------------------------------ILYE-------GAE..S
E7KUH0_YEASL/160-281---------------------------------------------------------------ILYE-------GAE..D
F1R776_DANRE/159-276---------------------------------------------------------------ILEK-------KAE..A
F7CC42_XENTR/161-276---------------------------------------------------------------ILEK-------KAE..A
H3C365_TETNG/54-161---------------------------------------------------------------QIAD-------KQT..N
H3CJX6_TETNG/127-244---------------------------------------------------------------ILEK-------KAE..A
H3DP42_TETNG/31-141---------------------------------------------------------------KIVN-------KEL..E
Q0JBF2_ORYSJ/25-136---------------------------------------------------------------PIAR-------RDP..A
Q5K774_CRYNJ/143-255---------------------------------------------------------------ILEG-------RKE..A
Q9VQ59_DROME/32-141---------------------------------------------------------------DFAH-------RRQ.GP

PF01230

HINT1_RAT/24-121------------------------------------------------------------------R-------KEI--P
HNT2_YEAST/12-107------------------------------------------------------------------V-------T..--.
FHIT_HUMAN/11-105------------------------------------------------------------------K-------P..--.
APH1_SCHPO/12-106------------------------------------------------------------------V-------G..--.
APTX_YEAST/15-139------------------------------------------------------------------E-------TVN--D
Q9I500_PSEAE/74-166------------------------------------------------------------------R-------LEQ--D
Q98BM9_RHILO/14-106------------------------------------------------------------------R-------LEA--D
Y866_METJA/9-105------------------------------------------------------------------N-------GEI--P
YHIT_MYCPN/19-116------------------------------------------------------------------E-------GNV--K
APTX_SCHPO/44-156------------------------------------------------------------------S-------PES--Y
YHIT_HELPY/9-104------------------------------------------------------------------Q-------GEI--P
HNT1_YEAST/32-125------------------------------------------------------------------K-------SEI--P
Q9A2A9_CAUCR/9-106------------------------------------------------------------------A-------FVA--T
YHIT_SYNY3/12-109------------------------------------------------------------------R-------REI--P
Y1390_SYNE7/12-109------------------------------------------------------------------R-------REI--P
YHI1_MYCLE/10-102------------------------------------------------------------------N-------REL--P
Y961_HAEIN/12-110------------------------------------------------------------------R-------KEI--P
Q9JYE4_NEIMB/10-102------------------------------------------------------------------T-------AQN--E
Q9KQC5_VIBCH/14-106------------------------------------------------------------------Q-------LQK--D
ZB14_MAIZE/24-123------------------------------------------------------------------K-------KEI--P
HINT_CAEEL/28-125------------------------------------------------------------------R-------KEI--P
G8AG53_AZOBR/16-114------------------------------------------------------------------R-------GEI--P
K7XM15_MYCHR/14-110------------------------------------------------------------------K-------REE--P
YHI2_MYCTU/11-106------------------------------------------------------------------.-------GEA--P
Q32EW3_SHIDS/12-109------------------------------------------------------------------R-------REI--P

PF04677

C3H64_ARATH/370-491---------------------------------------------------------------LSSP-------SV---E
C19L1_CAEEL/309-429---------------------------------------------------------------LSNV-------DA---E
C19L2_CAEEL/226-350---------------------------------------------------------------IDSS-------RL---K
C19L2_DROME/460-584---------------------------------------------------------------FDSA-------KL---D
CWF19_SCHPO/399-523---------------------------------------------------------------LNYE-------TQ---P
DRN1_YEAST/256-389---------------------------------------------------------------FSNP-------NL---E
MU161_SCHPO/334-470---------------------------------------------------------------LSNP-------NV---A
Q93ZX4_ARATH/458-582---------------------------------------------------------------FENP-------KR---P

PF02611

CDH_HELPY/24-243---------------------------------------------------------------YEKN-------QN.PSP
G9AY12_PANAN/24-250---------------------------------------------------------------YHYT-------GH.PSP
Q8P9Z9_XANCP/30-250---------------------------------------------------------------.QAG-------PV.PDD
E8V0N7_TERSS/35-269---------------------------------------------------------------MQAN-------HL.ASP
A8GL49_SERP5/45-264---------------------------------------------------------------QQAN-------NN.PAP
E0SJ94_DICD3/33-253---------------------------------------------------------------QQKN-------NS.PAP
CDH_YERPE/33-252---------------------------------------------------------------MTTE-------DD.PRP
B8IMH8_METNO/37-256---------------------------------------------------------------KRMT-------GR.ALP
W0LHA3_SERFO/26-254---------------------------------------------------------------YQQK-------HD.PAP
B1M455_METRJ/29-249---------------------------------------------------------------KRLA-------NR.TFP
Q1LBK3_RALME/33-250---------------------------------------------------------------ATPT-------HS...D
Q6MQF2_BDEBA/30-256---------------------------------------------------------------HKIG-------EE.KNP
G8MBN7_9BURK/67-288---------------------------------------------------------------AEGA-------RV.QQK
A6TFQ8_KLEP7/24-243---------------------------------------------------------------QQQQ-------QN.PSP
H2INV4_RAHAC/31-250---------------------------------------------------------------QRSN-------GK.PDP
B0U7T2_METS4/29-248---------------------------------------------------------------KKTT-------GG.AFP
B2VF57_ERWT9/34-251---------------------------------------------------------------QQLK-------SD.PQP
B9JRW8_AGRVS/27-242---------------------------------------------------------------....-------.VATAP
D8IW24_HERSS/34-253---------------------------------------------------------------MQAS-------GQ.PQP
C5BB31_EDWI9/31-247---------------------------------------------------------------QQAS-------GD.PAP
A9HJU4_GLUDA/35-256---------------------------------------------------------------QAGE-------NT.PAP
B2JLJ5_BURP8/29-246---------------------------------------------------------------ARAS-------GR.PGF
B1LSY8_METRJ/26-246---------------------------------------------------------------KKAA-------GR.SFP
L0IYV5_MYCSM/29-248---------------------------------------------------------------QLAS-------GD.PAP
B8IPC5_METNO/27-247---------------------------------------------------------------ERLT-------GL.PFP
B2FII5_STRMK/27-247---------------------------------------------------------------..GP-------EGPRGD
CDH_CROS8/31-250---------------------------------------------------------------ERER-------QE.PAP
B8EQB5_METSB/40-259---------------------------------------------------------------ETHF-------NS.PAP
B2HIW3_MYCMM/43-260---------------------------------------------------------------YQRT-------GA.YAP
W0HRX4_9ENTR/35-254---------------------------------------------------------------QLQR-------GD.PSP
E6WAG7_PANSA/33-250---------------------------------------------------------------MMQK-------GN.PAP
B1M8V7_METRJ/69-294---------------------------------------------------------------ERRG-------QG.PAP
D8MKK8_ERWBE/33-250---------------------------------------------------------------QNQN-------ND.PTP
G2I2H3_GLUMN/36-254---------------------------------------------------------------EQGT-------....VP
Q6D6W9_PECAS/32-251---------------------------------------------------------------QQHS-------GN.PAP
D2UA62_XANAP/30-247---------------------------------------------------------------ASCS-------GE.AMP
CDH_MYCLE/38-255---------------------------------------------------------------YQHT-------GA.YAP
Q13LU5_BURXL/41-259---------------------------------------------------------------QQAT-------GT.PGQ
Q7NQ26_CHRVO/27-251---------------------------------------------------------------QQAQ-------GQ.PGP
K7SS21_GLUOY/32-232---------------------------------------------------------------AQH.-------....QP
R9VP92_9ENTR/32-251---------------------------------------------------------------MREH-------NS.PKP
Q0JZ98_CUPNH/25-246---------------------------------------------------------------TAAA-------HP...D
H8L0L3_FRAAD/32-259---------------------------------------------------------------AKAG-------HQPPLP
CDH_ECOLI/31-250---------------------------------------------------------------QQQN-------QN.PSP
Q5FPM0_GLUOX/32-232---------------------------------------------------------------AAH.-------....KP
W0PFV2_9BURK/44-257---------------------------------------------------------------QQAG-------NQPPAP
I2BEE8_SHIBC/29-247---------------------------------------------------------------QQQH-------QD.PAP
CDH_MYCTU/41-258---------------------------------------------------------------YRRT-------GA.YAP
U3U143_9ENTR/33-250---------------------------------------------------------------MTQR-------GN.PAS
D5CGT2_ENTCC/45-264---------------------------------------------------------------QIQH-------RN.PAP

PF02744

GAL7_CRYNJ/204-373---------------------------------------------------------------SGRS.......GSHMLL
GAL7_HAEIN/183-348---------------------------------------------------------------LKH........GSVMLV
GALT_STRMU/231-435---------------------------------------------------------------AGSNSDLPIVGGSILSH
GALT_BACSU/240-451---------------------------------------------------------------IGSNADLPIVGGSILSH
GAL7_YEAST/198-366---------------------------------------------------------------REH........NTDLFA
GAL7_KLULA/195-363---------------------------------------------------------------HQH........GAHLLE
GAL7_ECOLI/182-347---------------------------------------------------------------AEQ........KSPMLV
GALT_HUMAN/202-370---------------------------------------------------------------SQH........GEPLLM

PF16285

D5DD06_BACMD/8-254NKFPV---------LQDAYQTVIIETDECSS--------------ELSI-------------------------------
C0ZAZ1_BREBN/8-252NKFPV---------LEDTHQTVLIETDECQG--------------DWSV-------------------------------
B2TPI8_CLOBB/11-256NKFPT---------LRDTLQLVVIETYDCEL--------------NMGN-------------------------------
C9LU44_SELS3/8-252NKYNV---------IEDADQFVLIESKVCHS--------------DMPD-------------------------------
D9SRU9_CLOC7/9-253NKYTT---------FEDAFQTLIIETDSCRE--------------NIST-------------------------------
Q81VH8_BACAN/8-251NKFPT---------LKDTFQTVLIETDNCED--------------HIAT-------------------------------
U5LFA6_9BACI/8-252NKFPV---------LENTLQTVLIESDECSG--------------DIST-------------------------------

PF01087

GAL7_CRYNJ/15-198LR..P---------WNGQKETPAIPVETPHD--------......SKCY-------------------------------
Q7QA38_ANOGA/1-174KR..P---------WSGQEENPQPENLPSFD--------......PTNP-------------------------------
A5DRG5_PICGU/6-197KR..P---------WQGAKEEVRKIALPEFD--------......PKCY-------------------------------
Q9CM11_PASMU/4-178KR..P---------WQGQQEKVAEDEKPSYD--------......PTCY-------------------------------
Q2H1V5_CHAGB/2-211KR..P---------WQGQQEAPSKNVLPEYD--------......PKCY-------------------------------
A4AQM0_MARSH/1-176KR..P---------WQGKTEKASLDSKPKYD--------......PKCY-------------------------------
Q65CW7_BACLD/17-231EKLAA---------YAVEHGVI.TDDLDAKD--------ML.AANVMNC-------------------------------
A9WJH8_CHLAA/4-191QR..P---------WLGQVETLPPAELPSYD--------......PACY-------------------------------
A7MIY8_CROS8/2-176KR..P---------WQGAQETPAKQTLPQHD--------......PDCF-------------------------------
Q03XA5_LEUMM/18-235DQLTA---------VAEKNGTL.ALRQMNTD--------ML.GAQLMNF-------------------------------
A3N102_ACTP2/3-177KR..P---------WQGQQEETVADNKPSYD--------......PTCY-------------------------------
GALT_STRMU/16-225DELVD---------LAVVNGKV.GDLAEEKD--------CL.GAELMNF-------------------------------
A5DWA9_LODEL/21-211KR..P---------WQGAKEDVKKTQLPEYD--------......PKCY-------------------------------
Q6D2C5_PECAS/1-175KR..P---------WQGQQDEPDRATPPPYD--------......PTCY-------------------------------
Q1IQZ6_KORVE/1-177QR..P---------WQGQVEKAPRPAALEYD--------......PECY-------------------------------
Q6LQE3_PHOPR/15-189KR..P---------WQGADETPEQAVDTQYD--------......SGCF-------------------------------
A8LEI8_FRASN/19-211RR..P---------WSGESQAVSPVAVARHD--------......PECG-------------------------------
Q59VY3_CANAL/21-210KR..P---------WQGAKEEIKKSALPEYD--------......PKCY-------------------------------
A1L2D1_DANRE/7-181KR..P---------WKGQVEKPPEDNIPRHD--------......PNNP-------------------------------
A7F8S7_SCLS1/1-208KR..P---------WQGQQEAASKITLPEYD--------......PACY-------------------------------
Q3XZ93_ENTFC/18-230DQLVA---------KARENGVL.SELPAEQE--------IF.EAQLMDF-------------------------------
B1YII0_EXIS2/18-230EEMIE---------QQITAGKL.APRLDEKE--------RL.AAELMDV-------------------------------
Q0RE52_FRAAA/14-191RR..P---------WHGGRETAATPPAVAYD--------......PACH-------------------------------
Q21LR9_SACD2/5-180KR..P---------WQGQQEPPSTDTPPSHD--------......PDCY-------------------------------
GALT_STACT/19-233QFWIQ---------QMLNNGLL.EDVVYQKE--------IV.ETKLLDL-------------------------------
GALT_LACPL/16-224DALVK---------TAIQNGKI.EATQSDED--------IL.ADQLMDL-------------------------------
A8WVF3_CAEBR/2-179NR..P---------WQGAKTEKSGSSEKNPD--------DVTSSITTNP-------------------------------
A2AMS2_MOUSE/3-177KR..P---------WQGQVEPQLLKTVPRHD--------......PLNP-------------------------------
GAL7_NEUCR/2-217KR..P---------WQGQQEAPALNKLPEYD--------......PQCY-------------------------------
A7TJY6_VANPO/4-190KR..P---------WLGQQETVGKPNIPEYD--------......VNCY-------------------------------
A6RBX1_AJECN/45-253KR..P---------WQGQQEAPSKTELPVYD--------......PACY-------------------------------
GAL7_KLULA/1-189KR..P---------WLGQQEKPGRNDAPDHD--------......DKCY-------------------------------
Q5KY03_GEOKA/19-233DAMID---------WAYEQGLLETNTTTERD--------IW.DARLMDC-------------------------------
Q03PB0_LACBA/18-226NALVQ---------AAIDHGQI.EDAPSPKD--------IL.EAQLMDL-------------------------------
A2QCH5_ASPNC/2-209KR..P---------WQGQQESPSKTTLPTYD--------......PACY-------------------------------
A6WF46_KINRD/10-216DR..T---------L...........MPPPD--------.....Q..DP-------------------------------
Q2J7D6_FRASC/3-201RR..P---------WHGGQEPPPVPAAVAHD--------......PLCD-------------------------------
A3QFA6_SHELP/9-182KR..P---------WQGQTEALDLTTAPSYD--------......SECF-------------------------------
GALT_BACHD/21-236ENILD---------WAAENGRLEANTVTYRD--------LL.DTKLMGA-------------------------------
Q5WD06_BACSK/20-235APILD---------WAADNGLLEANTVTYRD--------LF.DTKLIDA-------------------------------
A0QYK5_MYCS2/3-199DR..T---------Y...........LPAAD--------.....Q..CP-------------------------------
GALT_LACSS/20-231EALVQ---------LAVDHQRI.QDLAAERD--------IL.GAKLMDL-------------------------------
Q896X9_CLOTE/19-233NNMLK---------YAIDNDII.EDTGTDKD--------LF.DTRIMGV-------------------------------
GALT_DROME/1-175QR..P---------WSGQQEKAQKNELPEFD--------......PTNP-------------------------------
GAL7_SCHPO/4-195KR..P---------WQGAKEEIKKDDTVKYD--------......PTCY-------------------------------
B8I4V5_CLOCE/19-234ERIVD---------YAGEAGLFDKDIYACRE--------LF.DTKVMGL-------------------------------
A3LR66_PICST/19-206KR..P---------WQGAREEIKKVALPNYD--------......PKCY-------------------------------
Q7N8Y8_PHOLL/4-178KR..P---------WHGQDEQPLIDNIPNYD--------......EQCF-------------------------------
Q73SK2_MYCPA/2-203DR..T---------Y...........KPPPD--------.....A..CP-------------------------------
A8FIP9_BACP2/20-233MPMLD---------WAVETGLIPEGTDTYRD--------LL.DAKIMGC-------------------------------
Q3IH81_PSEHT/3-176KR..P---------WQGQVETLDEDVRESHD--------......ESCF-------------------------------
A0M3B7_GRAFK/1-176KR..P---------WQGKTEETKVIKKETHD--------......ASCY-------------------------------
A5FKW9_FLAJ1/2-179KR..P---------WQGQNEVISAETLPKHD--------......PDCY-------------------------------
Q4PDD8_USTMA/31-214KR..P---------WQGQEEKPQGTSLPAYD--------......EKCY-------------------------------
Q15Y61_PSEA6/2-176KR..P---------WQGQVEKPQQNDSAAHD--------......PSCY-------------------------------
Q6C0K3_YARLI/1-190KR..P---------WQGQQEEPTKDTKPEYD--------......DKCY-------------------------------
Q6BVI6_DEBHA/3-194KR..P---------WQGAKEELKKSDLPSFD--------......PKCY-------------------------------
Q2GAY3_NOVAD/2-175KR..P---------WQGETGDPAPTGGPSHD--------......PGCY-------------------------------
GALT_CLOAB/17-229NQLLA---------YAVKENLI.NDTVAERD--------LF.DTKIMNC-------------------------------
GALT_ENTFA/20-232EHLLN---------IAQANHQI.DDSITEAE--------QL.EAELMDF-------------------------------
Q30V51_DESAG/2-182MR..P---------WQGQQDAPDTTVMPAYD--------......PQCY-------------------------------
A9KN46_CLOPH/31-257KVLLD---------YACEQKLI.EDSITYRD--------LY.DTKLMDC-------------------------------
GALT_LACS1/18-228NELVE---------YAVQHGKV.GETLNEQD--------CL.GAELMNF-------------------------------
A0KQH7_AERHH/2-174KR..P---------WQGQVEKVSQAPSQAHD--------......PDCF-------------------------------
A4VT89_STRSY/18-226DELLA---------HGVRTGFV.GELLEEQD--------MV.GSCLMDL-------------------------------
A5VME1_LACRD/16-220NQLVD---------LAVKRGKI.DDGQTAKE--------IL.NDQLYDL-------------------------------
E7KK61_YEASL/5-192KR..P---------WLGQQEAAYKPTAPLYD--------......PKCY-------------------------------
G0RTP4_HYPJQ/7-208KR..P---------WQGQQEGAAVTTLPEYD--------......PKCY-------------------------------
Q04GZ3_OENOB/18-225AL.IE---------TAIRNGKI.ENSLSDRD--------IL.DAELMDL-------------------------------
Q5KLY2_CRYNJ/11-195KR..P---------WKGQTEEPVLTTLPEYE--------......ATCN-------------------------------
GALT_STRT2/18-226DQLLQ---------AGVKAGSV.GELNEEQD--------II.GAQLMDL-------------------------------
Q5NEY1_FRATT/11-180NR..P---------WQGQSEETQKNTLPEYD--------......DKCY-------------------------------
Q7MBX0_VIBVY/28-200KR..P---------WQGQQETLNVESLPSYE--------......KTCF-------------------------------
GALT2_STRR6/16-224DQLVE---------ETVRLETI.EDSQTARE--------IL.GTELMDL-------------------------------
GALT1_STRR6/18-225DYLVE---------IALKNGKI.KDLIEEKE--------CL.GAELMNF-------------------------------
GALT_CLOPE/21-230NELIN---------IAIEKKII.ENALYSKD--------IF.SSDIMNI-------------------------------
GALT_LACLA/19-228DQLLA---------IANENNVIEKGQDEFYE--------....AALMNF-------------------------------
U5L509_9BACI/19-230EDLVG---------FAAAEGRI.AGLESDKD--------IL.SSKIMDV-------------------------------

PF16268

F5XH95_MICPN/8-422RRFANLFEIVSTRSWRLNHGFRPSPAVLSWA--------EDYLADPLGIDHITAILGFRHRMGGPPAPARDDR.......
C3PH27_CORA7/1-419RRVPNLFEIVSYDYWHENYGFTMDPDLARHK--------ESYEADEAGRLHVLNVVRTKLKAAG.....KDAALDD....
B1VH78_CORU7/18-447RRVANLYEILTYDYWALNYGYRMNPAAAKHM--------TDYLSEEAGCEHVENILRVKLAAAGTPKAEIDELFTEERRH
Q8NNU9_CORGL/1-424RRVPNLFEIVSFDYWHQNFGFDMDSETAMRM--------AQYLAIPEGREHVLAIVRTRLSAAG....EDPAHMTD....
W5WQ34_9CORY/18-447RRVANLFEILTYEYWSMNYGYRMSPASAKHM--------TDYLSEEAGIDHVEKILRMKWTAAGMPAAEIDEAFNDDNRM
W5Y1J6_9CORY/15-448RRVSNLFEIVTFDYWEANYGFTPDASTQAWM--------DAYLADPAGREHVLTTVRTKRKAAG.....LEPNAPE....
G0HAG7_CORVD/18-449RRVANLYEILTYNYWTVNYGHRMDATAARHM--------AEYLAEDAGVEHIAGLLRTKMERAGVPAEEIEDAFSDEKTF
U3GXR8_9CORY/26-464RRVANLFEIVTFDYWKANYGFIPSPEITAWR--------NNYIGNPQGLEHVRKIVASKMNFSG.LSAPEIEALTD....
Q6NGG7_CORDI/11-432RRVSNLFEIVSYDYWRNNYGFSMDLETTDWM--------QSYISTEKGREHVLATVRTKLQAAG...IQDMPD..D....
S5SVS2_9CORY/15-437RRVPNLFEIVPYSYWVDNYGFLMNEDVHRRM--------ERYLADPAGKQHVDAIIRTRLKANG.....RAPETVDPAGW
B3QVF6_CHLT3/10-436RRTPNLFEIVSLDYWRKNYGYKMNQVQNAWR--------EQYLSDSDGVKHICEVVDYKLSRMG.RSYDAIKSVPL....
Q6A5P1_PROAC/10-435RRVPNLFEILSWRYWQLNWGMSLPRAARDWQ--------EEYLSNPSGEAHVRSVLNAKFKAVG..SDRRAEDLGP....
Q8FP08_COREF/15-438RRVPNLFEIVTYEYWNKNFGFEMDPETAMRM--------ATYLADPEGRRHVLSIVRTRMKAAG....EDGSSLTE....
F8E0G1_CORRG/18-447RRVANLFEILTYDYWSLNYGYRSSPAAAMHM--------AEYLAEDAGQDHVEKILRTKWAASGRPKEAIDALFSPATRM
C5CBF5_MICLC/33-463RRVPNLFEILSYDYWRLNHGYEPSPDARRRR--------DEYLATEAGRAHVRAVVAAKLRASG.RSAEEAAATSE....
I6XY80_PROPF/27-452RCVPNLFEILSFDYWRANYGFELPESAARHQ--------RAYLASPEGLEHVLRVAETKLRASG.RGAGQVAAMTR....
R5PXK8_9PROT/14-442RRIPNLFEIISFDYWEKNYGYVMNDQIAAHK--------EDYLEDPAGREHVLDIVQTKLKMSG.LSREEIDSISS....
D7BLX6_ARCHD/14-437RRIPNLFEILSFDYWAKNYDYRLPASARGRL--------EAYMADPAGRSHVMKVLRMKLRNTY..TDDEFGALTD....
D9QB86_CORP2/15-442RRVPNLFEIVSYDYWHDNYDYSLDSETQARM--------ERYIASDLGRKHVLEIIKTKRKAAG.......NAVSTDYPE
X5DSS5_9CORY/40-471RRVANLYEILTYDYWLVNYGHRMDATAARHM--------AEYLSEPEGREHVERLLRIRMEAAGRPAEDIDALFTEDTAV
M1P829_9CORY/11-432RRVPNLFEIVSYDYWAKNYGFRMDPETAARK--------AAYLADETGRAHVLDIARTRLRAAG.....QDPDVSG....
D7GCR7_PROFC/13-438RRIPNLFEIVGYPYWVANYDYKPSPAAMARY--------RAYRNDAGGREHLLAISRTKLAASG.LAPAQVRATPD....
D7WEZ1_9CORY/10-431RRVPNLFEIVSYDYWAKNYGFHMDTSREDHM--------ERYLADDAGRHHVFDVVRMRLKAGG.....HDDNLTE....
C8XCI8_NAKMY/35-455RRIPNLFEIVSFDYWQLNYGHQLAPAQREAM--------ADYLSTDAGRAHVAALVERRTQQPW.......AHMSQ....
C4LIB0_CORK4/15-440RRVPNLFEILGYEYWRANHGFAMDPETSTHM--------NDYLSEPAGRQHVLNIIATRLRSAG.TPESEIKDTPE....
K7RWS7_PROA4/29-464RRIPNLFEILSWEYWHENHGLELPSEARQWQ--------EEYLSYPAGLAHVQRVLDAKFAAQG..LDLRAARLSP....
D6ZJH6_MOBCV/17-441RRIPNLFEIVSYDYWHENHNHYPTEAQNRRM--------ADYLASAAGYDHVLHVVKMRLEASG...EDHLETIPD....

PF11969

Q5TVU2_ANOGA/17-126SLH....LK..ST........SKSIAMRDLY........PK...ARYHF-------------------------------
A5DAJ7_PICGU/3-137KAV....LF..HD........ETALIVRDAY........PK...SKFHY-------------------------------
A5DAR3_PICGU/136-257ETF....IY..HDKD....PETGFVLLPDMK.......WDRLNMDALYL-------------------------------
Q293N2_DROPS/5-112ANW....II..SS........DVAIVIADKY........PK...AQHHY-------------------------------
Q293N2_DROPS/220-329..I....LI..ES........DRAVVVKADY........PK...AQYHF-------------------------------
Q297L1_DROPS/153-272ERI....VF..EDND....PETGFILLPDLK.......WDGRNVENLYL-------------------------------
Q29LN6_DROPS/45-159PPP....VL..EVQ......TDEYVIFKDKS........PA...ATYHY-------------------------------
HINT3_RAT/40-155ETE....LLYCEN........KDLVCFKDIK........PA...ALHHY-------------------------------
A0EGQ1_PARTE/118-231ENI....VF..EN........QTFLILKDYVF......VNSQSLDDLHL-------------------------------
A1CEC1_ASPCL/149-272EDV....IL..RDAGK..GPDDGFLMLPDLN.......WDRKTMGSLHL-------------------------------
A3DF72_CLOTH/3-110STI....YY..ED........ERVIAIKDIN........PA...APVHV-------------------------------
A3LWH2_PICST/136-257ETF....VY..HDTD....PVTGFVLLPDMK.......WDTINMESLYL-------------------------------
A4S248_OSTLU/99-229ERL....LH..CDDDFLLNVDSKWTTHPDCDGADRATWRAHSSVTDLYC-------------------------------
APTX_DROME/4-113ENL....II..SS........EIAVVIADKF........PK...AQHHY-------------------------------
APTX_DROME/229-339RNF....LI..ES........DRAVVMKADY........PK...SQYHF-------------------------------
A4XKP5_CALS8/3-110SEI....VY..ED........EHVCAFKDIN........PT...APVHI-------------------------------
A5D7U9_BOVIN/174-293DRI....VF..ENPD....PSDGFVLIPDLK.......WNQQQLDDLYL-------------------------------
A5E770_LODEL/177-298ETV....IY..HDK.....SPQGFVLLPDMK.......WDGINMENLYL-------------------------------
A5GQU3_SYNR3/125-230AER....IH..ED........EHCIAFADIQ........PQ...APVHL-------------------------------
A5I635_CLOBH/3-110SSK....VY..ED........ELVYAFNDID........PV...APHHV-------------------------------
A6QUC5_AJECN/141-262EDV....II..RVSD....PEEGFLLLPDLN.......WDRKTIGTLRL-------------------------------
A6VZM3_MARMS/2-109ANI....LF..ED........DDVIAFEDIM........PK...APTHF-------------------------------
A7HMY4_FERNB/3-108SEK....VY..ED........NDFIVIKDIR........PV...APVHL-------------------------------
A7S614_NEMVE/151-270ERV....VF..EDGD....PETGFVLLPDMK.......WDQQQVENLYL-------------------------------
A7SFV5_NEMVE/10-122TRI....IY..ED........EETLTFKDLR........PA...TDHHY-------------------------------
A7TKH2_VANPO/142-261DRV....VY..QD........DDMVILPDMK.......WDGENMDAFYL-------------------------------
A7TQ97_VANPO/171-297DRV....VY..KDFSE.DSKRDGFVILPNTK.......WDGVNLDSLYL-------------------------------
YHIT_CHLTR/2-108CDK....VF..ED........ENFIVIKDKF........PQ...APVHL-------------------------------
APTX_CHICK/142-252KVQ....VY..KD........EKTVVIKDKY........PK...ARYHW-------------------------------
APTX_DANRE/150-260KMQ....VY..KD........DSVVVIKDKY........PK...ARYHW-------------------------------
APTX_XENTR/173-283TMQ....VF..KD........DKVVVIKDKY........PK...ARYHW-------------------------------
APTX_CIOIN/206-317ELV....VK..ED........EQIVVIKDKY........PK...AKYHW-------------------------------
Q0U2I6_PHANO/148-269EDV....MY..RESD....PSKGFLLLPDLN.......WDRKTIGALHL-------------------------------
Q15X15_PSEA6/3-110AEI....LY..ED........EMSLAFRDIN........PQ...APMHF-------------------------------
Q16F07_AEDAE/8-123ANH....II..RS........ELAVVIRDKY........PK...ARHHF-------------------------------
Q16XY1_AEDAE/224-343DRI....VY..EDPS....DKVGFILLPDLK.......WDGKTLEQLYL-------------------------------
Q16YN6_AEDAE/11-125NAS...IVY..EN........ERICIFKDIR........PA...AEHHL-------------------------------
Q18227_CAEEL/10-129LQL....K...EN........KSCVVINDIK........PK...AKNHY-------------------------------
Q1CY35_MYXXD/3-112AKV....VY..RD........DVCVAFEDIN........PQ...APTHV-------------------------------
Q1QZ40_CHRSD/2-109PDV....VY..ED........EHVLAFNDIN........PQ...APTHV-------------------------------
HINT3_XENTR/18-132GAE....LL.HSD........DDLVCFKDIR........PA...VTHHY-------------------------------
Q2H2H7_CHAGB/31-147SNV....RY..FD........HEMVVVDDAN........AK...SPDHI-------------------------------
Q2H304_CHAGB/151-275EDV....IY..RTPYG.QDPEEGFLLLPDLN.......WDRKTLDALHL-------------------------------
HINT3_BOVIN/47-162GTE....LLHCEN........EDLVCFKDIK........PA...APHHY-------------------------------
Q3IJU5_PSEHT/4-111ADI....IY..ED........EHTLAFKDIN........PQ...APFHA-------------------------------
Q4PA08_USTMA/46-158.RI....VI..ED........EKLICFTDRS........PG...AAIHL-------------------------------
Q54DF5_DICDI/36-141.......IF............QNVIVFNDRT........PK...ATVHY-------------------------------
Y2839_DICDI/224-348ESFLDVVLY..YD........DKTVAVLDKY........PK...AKHHY-------------------------------
Q59S51_CANAL/134-254ETF....VY..HDK.....SPTGFVLLPDMK.......WDGKNLDTLYL-------------------------------
Q5TUI6_ANOGA/154-273ERI....LY..EDPC....DENGFILLPDLK.......WDGKTVEQLYL-------------------------------
A8XGQ1_CAEBR/148-267DKI....VY..EDPD....KNNGFLLLQDIK.......WDGKTIENLYV-------------------------------
Q6BZT0_YARLI/136-263EDV....VY..RK.......EDSFVLLPDMK.......WDRKNVNSLYL-------------------------------
Q6C515_YARLI/4-127EKFPNDVTL..DT........PDFVVIKDAF........PK...SHIHY-------------------------------
Q6C6M8_YARLI/30-153QDV....IY..GDLD....QKTGFVLFIHQK.......WNERDFRELNL-------------------------------
Q6CJA1_KLULA/160-286DRV....VF..KYFDQ.ESPKDGFVVLPDMK.......WDGVNMDALYL-------------------------------
Q6FLB9_CANGA/198-323HRI....VY..KHLDP..HDEDGFLIFPDMK.......WDGVNLDALYL-------------------------------
Q6FWT2_CANGA/170-296DRV....VY..KDYQE.DNKKDSFIVLPDMK.......WDGNNLESLYL-------------------------------
Q6IIA4_DROME/5-118ST.....VLEVEN........DDFVIFQDIK........PA...SQHHY-------------------------------
Q74ZD1_ASHGO/153-277ERI....VY..KDFVE.TKPEDGIVLLPDMK.......WDGVNLDSLYL-------------------------------
Q7PHF8_ANOGA/7-116KKQ....LF..VS........DLAVVIKDKY........PK...ALHHF-------------------------------
Q7QJM2_ANOGA/10-124ATD...IVF..QN........ERICIFKDIR........PA...SDFHY-------------------------------
Q83DE2_COXBU/3-109GEL....IY..ED........KQVVAFNDAA........PQ...APIHI-------------------------------
Q84VV6_ARATH/7-121TRL....LH..TD........EKVIAFQDIK........PA...AQRHY-------------------------------
Q8GYJ9_ARATH/75-183SDI....VY..ED........ENVLAFRDIN........PQ...APVHV-------------------------------
Q8SUA2_ENCCU/116-232EEI....MY..ED........EEVIMIPDYK.......WNPQTVDLLHF-------------------------------
Q97JJ3_CLOAB/3-110SSK....VY..ED........EDVLAFNDIS........PA...APVHV-------------------------------
BH140_ARATH/717-833ERH........ENVVL..EYLDNIVVINDQY........PK...ARKHV-------------------------------
DCPS_SCHPO/141-261ERI....VV..EDPD....PLNGFIVIPDLK.......WDRQTMSALNL-------------------------------
E7KRX8_YEASL/160-281ERV....VY..KDFSE.ENKDDGFLILPDMK.......WDGMNLDSLYL-------------------------------
E7KUH0_YEASL/160-281DRV....VY..KEYSS.RNKEDGFVILPDMK.......WDGINIDSLYL-------------------------------
F1R776_DANRE/159-276DRI....VF..EDPD....PDAGFVLLPDFK.......WDQKQLQDLYL-------------------------------
F7CC42_XENTR/161-276ERI....VY..ENPD....PANGFVLIPDFK.......WNQKQVEDLYL-------------------------------
H3C365_TETNG/54-161TEI....LF.SQD........EELLCFRDVK........PG...AETHF-------------------------------
H3CJX6_TETNG/127-244DRI....IY..EDPD....PDVGFVLLPDFK.......WNQKQVDDLYL-------------------------------
H3DP42_TETNG/31-141TEL....LH..CD........GEISCFRDIR........PG...APHHY-------------------------------
Q0JBF2_ORYSJ/25-136CNTV..LLY..SD........DRVMAFKDIN........PS...AFRHY-------------------------------
Q5K774_CRYNJ/143-255ERV....YY..RSE.....GDDGFVILPDLK.......WDETTKNALYL-------------------------------
Q9VQ59_DROME/32-141PPI...LEV..ET........DEYVIFKDKY........PA...ARLHY-------------------------------

PF01230

HINT1_RAT/24-121AKI----IF--ED--------DRCLAFHDIS--------PQ---APTHF-------------------------------
HNT2_YEAST/12-107EQV----FY--KS--------KYTYALVNLK--------PI---VPGHV-------------------------------
FHIT_HUMAN/11-105SVV----FL--KT--------ELSFALVNRK--------PV---VPGHV-------------------------------
APH1_SCHPO/12-106SQV----FY--RT--------KLSAAFVNLK--------PI---LPGHV-------------------------------
APTX_YEAST/15-139DTV----TY--FD--------DKVSIIRDSF--------PK---SECHL-------------------------------
Q9I500_PSEAE/74-166TLL----LG--DF--------PLSRLLLMND--------AR---YPWFI-------------------------------
Q98BM9_RHILO/14-106SEQ----VM--WL--------GLCELRVMND--------RR---WPWLV-------------------------------
Y866_METJA/9-105AKV----VY--ED--------EHVLAFLDIN--------PR---NKGHT-------------------------------
YHIT_MYCPN/19-116SFK----VG--EN--------EHAFAFLDAF--------PV---ADGHT-------------------------------
APTX_SCHPO/44-156KNV----IY--YD--------DDVVLVRDMF--------PK---SKMHL-------------------------------
YHIT_HELPY/9-104CSK----IL--EN--------ERFLSFYDIN--------PK---AKVHA-------------------------------
HNT1_YEAST/32-125SFK----LI--ET--------KYSYAFLDIQ--------PT---AEGHA-------------------------------
Q9A2A9_CAUCR/9-106SHA----VI--DL--------PLCEVRLQDD--------AR---YPWLV-------------------------------
YHIT_SYNY3/12-109AAI----VY--ED--------DLCLAFKDVN--------PQ---APVHV-------------------------------
Y1390_SYNE7/12-109ADI----VY--ED--------DLCLAFRDVA--------PQ---APVHI-------------------------------
YHI1_MYCLE/10-102GRF----VY--ED--------DDVVAFLTIE--------PM---TQGHT-------------------------------
Y961_HAEIN/12-110ANI----VY--QD--------ELVTAFRDIS--------PQ---AKTHI-------------------------------
Q9JYE4_NEIMB/10-102DVL----LQ--TP--------NLRVIAVHND--------SG---SPAFC-------------------------------
Q9KQC5_VIBCH/14-106TDV----IG--HF--------PLCVALLHKD--------SA---VPWVI-------------------------------
ZB14_MAIZE/24-123STV----VY--ED--------EKVLAFRDIN--------PQ---APTHI-------------------------------
HINT_CAEEL/28-125AKI----IF--ED--------DEALAFHDVS--------PQ---APIHF-------------------------------
G8AG53_AZOBR/16-114CKK----VL--ET--------EHALAFHDIN--------PQ---APTHI-------------------------------
K7XM15_MYCHR/14-110ATI----LY--ED--------DKVIAFLDKY--------AH---TKGHF-------------------------------
YHI2_MYCTU/11-106AIR----IY--ED--------GGYLAILDIR--------PF---TRGHT-------------------------------
Q32EW3_SHIDS/12-109SDI----VY--QD--------DLVTAFRDIS--------PQ---APTHI-------------------------------

PF04677

C3H64_ARATH/370-491SHL----IVSVGE--------SFYCALPK.GSL...........VEDHI-------------------------------
C19L1_CAEEL/309-429KHL----VVAIGN--------KCYAAMPK.GPL...........TEDHV-------------------------------
C19L2_CAEEL/226-350KHN----IIAVGI--------NTYLAVVEWDGL...........DDEHL-------------------------------
C19L2_DROME/460-584KQL----LVSLGD--------KIYLSLPWYMGL...........QSGHC-------------------------------
CWF19_SCHPO/399-523LAP----VISLSH--------RAYVSLPTQPEL...........AKYHC-------------------------------
DRN1_YEAST/256-389DHM----IISIGK--------LVYLTTAK.GPLSVPK...GDMDISGHC-------------------------------
MU161_SCHPO/334-470LHL----IVAIGN--------EAYMALPK.GPLTTTASNTPALASSGHV-------------------------------
Q93ZX4_ARATH/458-582KHL----VVSIAN--------FTYLMLPQHQPL...........VQGHC-------------------------------

PF02611

CDH_HELPY/24-243CIE--------VKPD......AGYVVLKDIN-------------GPLQY-------------------------------
G9AY12_PANAN/24-250CQQ--------IYIP..EGKRQGFSIIQNPR-------------YPYHF-------------------------------
Q8P9Z9_XANCP/30-250CAA--------VWPD....PQRQAVVLKDNH-------------GRFQY-------------------------------
E8V0N7_TERSS/35-269CVS--------VDLA..RGEAAGFVVFKDKQ-------------GNTQY-------------------------------
A8GL49_SERP5/45-264CAQ--------VDPQ......AGFVVFKDRN-------------GPLQY-------------------------------
E0SJ94_DICD3/33-253CLE--------VNLQ......GHYALFKDRR-------------GPYHD-------------------------------
CDH_YERPE/33-252CAE--------VNIP......AGFAVLKDRN-------------GPLQY-------------------------------
B8IMH8_METNO/37-256CLA--------VDLG..DKDRPGTAVLRAPG-------------QATHV-------------------------------
W0LHA3_SERFO/26-254CQQ--------IYMPPGQGKEQGFSVIQNPR-------------YPYHF-------------------------------
B1M455_METRJ/29-249CLS--------VDLG..DGTRPGSAVLRAPG-------------EPTHS-------------------------------
Q1LBK3_RALME/33-250CVI--------VDRQ......RGFVLYKDMI-------------GASHY-------------------------------
Q6MQF2_BDEBA/30-256CIE--------VNIA..QGEEKGYVVFKDRV-------------GDLQY-------------------------------
G8MBN7_9BURK/67-288CAD--------VNLA......GGYAVLKDLV-------------GIAQY-------------------------------
A6TFQ8_KLEP7/24-243CAE--------VNLK......GGYVLFKDRN-------------GPLQY-------------------------------
H2INV4_RAHAC/31-250CAQ--------VDEQ......QGFVVLKDLN-------------GPLQY-------------------------------
B0U7T2_METS4/29-248CLS--------VDLG..DGARPGTAVLRAPG-------------QRTHL-------------------------------
B2VF57_ERWT9/34-251CRQ--------VNIA......NGYVVMKDRN-------------GPLQF-------------------------------
B9JRW8_AGRVS/27-242CVH--------VNAG......EHYALLKDQR-------------GVAQH-------------------------------
D8IW24_HERSS/34-253CAM--------VDLA......RGFVILKDLV-------------GPAQY-------------------------------
C5BB31_EDWI9/31-247CAY--------LDRS......QGYALFKDRR-------------GALQY-------------------------------
A9HJU4_GLUDA/35-256CAA--------VDTD......RGYAVLKDRR-------------GLAQY-------------------------------
B2JLJ5_BURP8/29-246CTS--------VDLQ......KRYAILKDIN-------------GNTQF-------------------------------
B1LSY8_METRJ/26-246CLA--------VDLG..DAARPGTAVLRAPG-------------QPTHT-------------------------------
L0IYV5_MYCSM/29-248CAR--------VDIG..AGEQRGSAVLKDLV-------------GATQF-------------------------------
B8IPC5_METNO/27-247CVL--------VKAG..DRTDPGYVLVRPPG-------------ARSHV-------------------------------
B2FII5_STRMK/27-247CLR--------VETA....ADRRDVLVKDAH-------------GDYQF-------------------------------
CDH_CROS8/31-250CAQ--------VNLP......AGYVVLKDIN-------------GPLQY-------------------------------
B8EQB5_METSB/40-259CAR--------INLK..NGEADGWAVLKDIV-------------GRTQF-------------------------------
B2HIW3_MYCMM/43-260CTL--------VDES......SGIALYKADG-------------DPYQF-------------------------------
W0HRX4_9ENTR/35-254CSE--------VNTA......AGYVVLKDLV-------------GPLQF-------------------------------
E6WAG7_PANSA/33-250CQQ--------VNVA......QGYVTLKDLN-------------GPLQY-------------------------------
B1M8V7_METRJ/69-294CSL--------VDLA..GGVEKGYAILKDLR-------------GRAQF-------------------------------
D8MKK8_ERWBE/33-250CRQ--------VDLR......NGYVVLKDRV-------------GPLQF-------------------------------
G2I2H3_GLUMN/36-254CEE--------TNVR......AGYAVLKDHT-------------GPAQY-------------------------------
Q6D6W9_PECAS/32-251CLG--------VNLA......EGYVLFDDRN-------------GPYHD-------------------------------
D2UA62_XANAP/30-247FRA--------MDLA......QDYALLQDRD-------------GRAHV-------------------------------
CDH_MYCLE/38-255CTL--------VDEQ......AGTALFKANY-------------DPNQY-------------------------------
Q13LU5_BURXL/41-259CTS--------VDLD......KRYAILKDIV-------------GRSQH-------------------------------
Q7NQ26_CHRVO/27-251CAE--------VALQ......RGVAVLKDRN-------------GPLQY-------------------------------
K7SS21_GLUOY/32-232CAV--------YDPQ......DGYALLKDLY-------------GHGQY-------------------------------
R9VP92_9ENTR/32-251CAQ--------VNLK......GGYVLMKDRN-------------GPLQF-------------------------------
Q0JZ98_CUPNH/25-246CAQ--------VDRS......QGLVLYKDAI-------------GKSHY-------------------------------
H8L0L3_FRAAD/32-259CAR--------VSGT..PGAPDSYAVLKDRD-------------GKAQY-------------------------------
CDH_ECOLI/31-250CAE--------VKPN......AGYVVLKDLN-------------GPLQY-------------------------------
Q5FPM0_GLUOX/32-232CTV--------YDEK......DGYALLKDKT-------------GRGQY-------------------------------
W0PFV2_9BURK/44-257CKK--------VDTD......QGYVIFKDKN-------------GPLQY-------------------------------
I2BEE8_SHIBC/29-247CHS--------VSMA......ENYVTLKDIN-------------GPLQY-------------------------------
CDH_MYCTU/41-258CTF--------VDEQ......SGTALYKADF-------------DPYQF-------------------------------
U3U143_9ENTR/33-250CQQ--------VNLA......QGYVTLKDLN-------------GPLQY-------------------------------
D5CGT2_ENTCC/45-264CAQ--------VKPD......AGYVVFKDRN-------------GPLQY-------------------------------

PF02744

GAL7_CRYNJ/204-373DYA----L.......REVKARERVVTLHESGWVAVVPYWAA---WPFEI-------------------------------
GAL7_HAEIN/183-348DYV----K.......RELALKERIVVETEH.WIALVPYWAI---WPFET-------------------------------
GALT_STRMU/231-435NHY----QGGRHIFPMEIAELDSVFRFKD..FPDVTAGIVK---WPMSV-------------------------------
GALT_BACSU/240-451DHF----QGGAHDFPMARAEAEDVYELND..YPGVSLGLVK---WPMSV-------------------------------
GAL7_YEAST/198-366DYV----K.......LESREKSRVVVENES.FIVVVPYWAI---WPFET-------------------------------
GAL7_KLULA/195-363DYV----N.......LELREKERIVCENDS.FLVVVPYWAV---WPFET-------------------------------
GAL7_ECOLI/182-347DYV----Q.......RELADGSRTVVETEH.WLAVVPYWAA---WPFET-------------------------------
GALT_HUMAN/202-370EYS----R.......QELLRKERLVLTSEH.WLVLVPFWAT---WPYQT-------------------------------

PF16285

D5DD06_BACMD/8-254---------------------------------------YPKEHLY-------------TLLSFATERWI------SMMN
C0ZAZ1_BREBN/8-252---------------------------------------YSKEHVR-------------ALLAFGVEKWL------EMEQ
B2TPI8_CLOBB/11-256---------------------------------------YDSEYMK-------------ELISFGLKHWL------AIEK
C9LU44_SELS3/8-252---------------------------------------YSAEHMH-------------RLIRFGVHHWQ------KMQN
D9SRU9_CLOC7/9-253---------------------------------------YSEEHMR-------------ELLRFAVSHWL------DMKK
Q81VH8_BACAN/8-251---------------------------------------YTEEHMR-------------SLIRFSVKHWL------DLQK
U5LFA6_9BACI/8-252---------------------------------------YSLEHLE-------------KLLSFGLKHWI------EMEN

PF01087

GAL7_CRYNJ/15-198---------------------------------------LCPGNKR-------------T....TGQHNP------DY..
Q7QA38_ANOGA/1-174---------------------------------------LCPGVTR-------------P....NGTKNP------IY..
A5DRG5_PICGU/6-197---------------------------------------LCPSNIR-------------A....TGDTNP------KY..
Q9CM11_PASMU/4-178---------------------------------------LCPSNKR-------------I....TGEQNP------DY..
Q2H1V5_CHAGB/2-211---------------------------------------LCPGNQR-------------A....QGDSNP------QY..
A4AQM0_MARSH/1-176---------------------------------------LCPTNGR-------------M....GGANNP------DY..
Q65CW7_BACLD/17-231---------------------------------------FVARPSV-------------I....NAVFQQ------KY.E
A9WJH8_CHLAA/4-191---------------------------------------LCPGNTR-------------A....NGVQNP------PY..
A7MIY8_CROS8/2-176---------------------------------------LCPGNTR-------------V....TGDKNP------QY..
Q03XA5_LEUMM/18-235---------------------------------------IVPRPSQ-------------V....RKMFWE------HY.Q
A3N102_ACTP2/3-177---------------------------------------LCPGNKR-------------I....TGEQNP------VY..
GALT_STRMU/16-225---------------------------------------ITPIPSQ-------------V....NKAFWD------TN.A
A5DWA9_LODEL/21-211---------------------------------------LCPGNIR-------------A....TGDVNP------KY..
Q6D2C5_PECAS/1-175---------------------------------------LCAGNKR-------------I....TGDINP------QY..
Q1IQZ6_KORVE/1-177---------------------------------------LCPGNAR-------------A....GGHRNP------PY..
Q6LQE3_PHOPR/15-189---------------------------------------LCPTNTR-------------V....SGDKNP------DY..
A8LEI8_FRASN/19-211---------------------------------------LCPGNLR-------------AAAGLDRIRNP------DY..
Q59VY3_CANAL/21-210---------------------------------------LCPGNIR-------------A....TGDMNP------KY..
A1L2D1_DANRE/7-181---------------------------------------LCPGSVR-------------A....NGELNP------EY..
A7F8S7_SCLS1/1-208---------------------------------------LCPGNKR-------------A....QGDSNP------QY..
Q3XZ93_ENTFC/18-230---------------------------------------LTPPPSV-------------V....NAFFAQ------HY.S
B1YII0_EXIS2/18-230---------------------------------------FVDRPSQ-------------I....TSTFHQ------LY.A
Q0RE52_FRAAA/14-191---------------------------------------LCPGNER-------------A....GGARNP------DY..
Q21LR9_SACD2/5-180---------------------------------------LCAGNKR-------------I....TGEVNP------QY..
GALT_STACT/19-233---------------------------------------ITPKPST-------------I....NREFWK------RY.E
GALT_LACPL/16-224---------------------------------------VTPLPSV-------------L....NQRFWD------KY.Q
A8WVF3_CAEBR/2-179---------------------------------------LAPGGVR-------------S....SGAKNE------DY..
A2AMS2_MOUSE/3-177---------------------------------------LCPGATR-------------A....NGEVNP------HY..
GAL7_NEUCR/2-217---------------------------------------LCPGNKR-------------A....QGDSNP------HY..
A7TJY6_VANPO/4-190---------------------------------------LCPGNKR-------------A....TGNSTP------AY..
A6RBX1_AJECN/45-253---------------------------------------LCPGNKR-------------A....QGDQNP------QY..
GAL7_KLULA/1-189---------------------------------------LCPGTTR-------------A....TGEQNP------DY..
Q5KY03_GEOKA/19-233---------------------------------------VMPRPSE-------------V....IRAFYE------RY.R
Q03PB0_LACBA/18-226---------------------------------------MTPLPSA-------------L....NRGFWD------RY.Q
A2QCH5_ASPNC/2-209---------------------------------------LCPGNKR-------------A....QGDTNP------KY..
A6WF46_KINRD/10-216---------------------------------------LAPTVPG-------------GF..PTEIADS------S...
Q2J7D6_FRASC/3-201---------------------------------------LCPGNLR-------------A....GGERNP------SY..
A3QFA6_SHELP/9-182---------------------------------------LCPGNKR-------------I....NGEQNP------KY..
GALT_BACHD/21-236---------------------------------------LLGQPSE-------------T....IRTFYE------RYEQ
Q5WD06_BACSK/20-235---------------------------------------LLPRPST-------------V....IDHFFR------MCEQ
A0QYK5_MYCS2/3-199---------------------------------------LCPGPTG-------------E...TSEVPAP------D...
GALT_LACSS/20-231---------------------------------------VTPLPSA-------------V....NKRFWT------LY.E
Q896X9_CLOTE/19-233---------------------------------------LTPRASE-------------I....VRNFYN------IYHK
GALT_DROME/1-175---------------------------------------LCPGVTR-------------P....NGIQTP------EY..
GAL7_SCHPO/4-195---------------------------------------LCPGNIR-------------A....TGFENP------KY..
B8I4V5_CLOCE/19-234---------------------------------------MMPRESE-------------I....IRKFTD------LAEK
A3LR66_PICST/19-206---------------------------------------LCPGNVR-------------A....TGDVNP------KF..
Q7N8Y8_PHOLL/4-178---------------------------------------LCPSNTR-------------I....SGDKNP------AY..
Q73SK2_MYCPA/2-203---------------------------------------LCPGPTG-------------L...TSEVPAA------D...
A8FIP9_BACP2/20-233---------------------------------------LVAPPSV-------------I....YAKFEE------KRKQ
Q3IH81_PSEHT/3-176---------------------------------------LCAGNTR-------------I....NGEVND------NY..
A0M3B7_GRAFK/1-176---------------------------------------LCPGNTR-------------A....SGDTNP------DY..
A5FKW9_FLAJ1/2-179---------------------------------------LCPGNVR-------------A....NGVNNP------AY..
Q4PDD8_USTMA/31-214---------------------------------------LCPGNTR-------------A....TGEKND------DY..
Q15Y61_PSEA6/2-176---------------------------------------LCAGNTR-------------I....NGEVNP------EY..
Q6C0K3_YARLI/1-190---------------------------------------LCPRNAR-------------I....NGEMNP------DY..
Q6BVI6_DEBHA/3-194---------------------------------------LCPGNIR-------------A....TGDSNP------KY..
Q2GAY3_NOVAD/2-175---------------------------------------LCPGNAR-------------T....SGERNP------DY..
GALT_CLOAB/17-229---------------------------------------VMPRPSE-------------V....INNFNR------LL.N
GALT_ENTFA/20-232---------------------------------------ITPTPTI-------------I....NQKFMD------YY.Q
Q30V51_DESAG/2-182---------------------------------------LCPGNLR-------------T....GGARNP------HY..
A9KN46_CLOPH/31-257---------------------------------------FTPYPRE-------------V....VKTFNA------LY.Q
GALT_LACS1/18-228---------------------------------------ITPLPSK-------------V....NQDFWQ------TYQQ
A0KQH7_AERHH/2-174---------------------------------------LCAGNKR-------------V....TGDQNP------YY..
A4VT89_STRSY/18-226---------------------------------------MTPSPSQ-------------V....NRDFWQ------TY.Q
A5VME1_LACRD/16-220---------------------------------------MTPTPSV-------------V....NHKFWE------KY.Q
E7KK61_YEASL/5-192---------------------------------------LCPGNKR-------------A....TGNLNP------RY..
G0RTP4_HYPJQ/7-208---------------------------------------LCPGNSR-------------A....AGDQNP------NY..
Q04GZ3_OENOB/18-225---------------------------------------LTPLPSV-------------I....NATFWN------LY.Q
Q5KLY2_CRYNJ/11-195---------------------------------------LCPGNER-------------S....NGNKNP------KY..
GALT_STRT2/18-226---------------------------------------ITPRPSV-------------V....NRNFWD------TY.K
Q5NEY1_FRATT/11-180---------------------------------------LCPTNIR-------------A....NGEVNP------DF..
Q7MBX0_VIBVY/28-200---------------------------------------LCPTNTR-------------I....SGDVNP------DY..
GALT2_STRR6/16-224---------------------------------------VTPCPSQ-------------V....NRDFWE------AY.A
GALT1_STRR6/18-225---------------------------------------IVPLPSR-------------L....NDIFWS------SY.D
GALT_CLOPE/21-230---------------------------------------FLPTPSL-------------I....NKEFYK------RY.A
GALT_LACLA/19-228---------------------------------------ITPRPSK-------------I....NQDFWE------KY.K
U5L509_9BACI/19-230---------------------------------------LVPKPSS-------------V....NKEFYD------KY.E

PF16268

F5XH95_MICPN/8-422AALIAATVDLLAGSHDVIVPRRHVVDGAATSDQLAASGTMTPAEHA-------------DVLSYTVDTLA------DIFR
C3PH27_CORA7/1-419DSLLALADGFFGGGHDVIISSRHFADGAVDDSQLASSGTLSPDEHY-------------LLTTFTAESTR------ELYQ
B1VH78_CORU7/18-447QTLHEMGAALFAGGHDVVIARDHYVPGAKTTDQLASSGEMSWEDHR-------------LFIEFTVDGMD------QLYR
Q8NNU9_CORGL/1-424GELLEKAPSYFAGGHDVIIGRRHFVDDATTSDQLASSGTLTVKEHE-------------AFIRLTVDGIR------DLYH
W5WQ34_9CORY/18-447MTIQEKAPALFAGGHDVIIARDHYVPGAETTDQLASSGQLSWQDHR-------------HFIAFTVDGMD------QLYR
W5Y1J6_9CORY/15-448DELLHQARAFFAGGHDLIIGGKHFVDGATTNDQLASSGMLSTDEHG-------------ALMAFTVASMH------DLYQ
G0HAG7_CORVD/18-449QTVHEKGGAFFGGGHDVILARDHYIPGATSSDQLCGSGDLGWETHR-------------LYIAFTVDAMD------RLYR
U3GXR8_9CORY/26-464EEIAKLGWPFFAGGHDLIIGRRHFVDGATHDNQLASAGTLSVDEHR-------------TLIRFTTEAIT------DLYG
Q6NGG7_CORDI/11-432ATLLPQGEAFFGGGHDLIIGQRHFVPDATQSDQLASAGTLSPDEHF-------------AFIFFTVDALR------EAYQ
S5SVS2_9CORY/15-437HELEK...SYFAGGHDVIVARRHFADGATDTSQLASSGSLTTEEHF-------------GLILLTVESIA------DLYA
B3QVF6_CHLT3/10-436DEKLSIADAFFGGSHELIIAKRHYIDKARYDTQLYSSGEMTPEEHY-------------QYFKFTTEALS------DIYT
Q6A5P1_PROAC/10-435QELREASAAFFAGGHDVIVARRHYTDEGTTTADIAGSASLSVNEHR-------------AFMALTVDSMA------QLHR
Q8FP08_COREF/15-438AELLERAPSYFSGGHDVIIARRHFTDDATDDSQLASSGTLTSDEHA-------------AFIRFTLDGMR------DLYA
F8E0G1_CORRG/18-447QTLNEQGIGLFAGGHDVIIARDHFTPDATTTDQLASSGSLDWQTHR-------------HFMAFTVDGMD------QLYR
C5CBF5_MICLC/33-463AELIAASAAFFGGTHDVVIARRHFVDGAVDDHQLASSGTLTPDEHH-------------AFLALTADAMR------DLYA
I6XY80_PROPF/27-452EQRLEAASGFFGGGHDVIIARRHFVDGAVDDTQLAGSGTLTPEEHE-------------KFIAFTIDSVR------RSYE
R5PXK8_9PROT/14-442GRKLKMADNFFAGGHELIIGKRHYIEGATEDNAKASSGSMSPEMHY-------------QYMNFTIAALK------DIYL
D7BLX6_ARCHD/14-437QDIVELAYPLFGGGHDLIVARRHFVDGATDTSQLASAGTLTPQEHE-------------WYIRLTVDAMH------DLYQ
D9QB86_CORP2/15-442NELLKDASAFFGGGHDVIIARRHYTDDATHSDQPASAGTLTYEEHE-------------AFIRFTIDSLR------DLYS
X5DSS5_9CORY/40-471QSVNELGGPLFGGGHDIILARDHYVPGATRSDQLLSSGEMSWSDHR-------------LYIAFTVDAMD------RLYR
M1P829_9CORY/11-432DELIDLADAYFGGGHDVIIARRHFVDGATHDNQLASSGTLTPEEHH-------------AFISFTVDAIA------DLYH
D7GCR7_PROFC/13-438DELLDDAIGFFAGGHDVIVARRHFVDGATDSSQLAGSGALSPDEHA-------------EYMRFTVDTLA------DLYR
D7WEZ1_9CORY/10-431EELLAHVPAYFGGGHDVIIGSRHFVDGAQDSSQLASSGTLTPDEHH-------------AFIAFTIDSLR------DLYE
C8XCI8_NAKMY/35-455ADREAHVEDFFGGGHDVIVARRHYPDDAENDGQLASSGTLTPDEHD-------------SYLRFTIDAQR------DLYA
C4LIB0_CORK4/15-440TELLKRAPAYFAGGHDVIVARRHFTDDATSSRQLASSGTLTPEEHY-------------QFINFTADAMR------DLYS
K7RWS7_PROA4/29-464DQLRSESAAFFAGGHDVVVARRHYTDDATTTAGLAGSGTLSPLEHR-------------AFTAATVSTIA------DLYA
D6ZJH6_MOBCV/17-441DALLQYATGLFAGGHDVIVARRHYVDGATRADQNASAGTLSVAEHR-------------AYIGYTIATLQ------DLYK

PF11969

Q5TVU2_ANOGA/17-126---------------------------------------LVLP.RK..........N--I----NTL-HE......L...
A5DAJ7_PICGU/3-137---------------------------------------LVIP.RS.........KK--I----THK-HP......FDVF
A5DAR3_PICGU/136-257---------------------------------------CCIV.NR.........TD--I----TCV-RD......L...
Q293N2_DROPS/5-112---------------------------------------LVLP.KA..........E--I----SSV-FN......L...
Q293N2_DROPS/220-329---------------------------------------RVVA.KE..........D--I----EDV-TK......L...
Q297L1_DROPS/153-272---------------------------------------LGIV.HK.........HN--I----KSL-RD......L...
Q29LN6_DROPS/45-159---------------------------------------LAIP.KQ..........H--F----DSF-NA......L...
HINT3_RAT/40-155---------------------------------------LVVP.KK..........H--I----GSC-KD......L...
A0EGQ1_PARTE/118-231---------------------------------------LALP.FQ.........RD--I----KSL-RD......L...
A1CEC1_ASPCL/149-272---------------------------------------LGLP.LR.........RD--I----WSL-RD......L...
A3DF72_CLOTH/3-110---------------------------------------LIIP.KE..........H--I----ANV-KE......I...
A3LWH2_PICST/136-257---------------------------------------CAIV.NR.........MD--I----SSV-RD......L...
A4S248_OSTLU/99-229---------------------------------------LGLC.VR.........ED--F----KSL-RD......A...
APTX_DROME/4-113---------------------------------------LVLP.LA..........D--I----PSI-FH......L...
APTX_DROME/229-339---------------------------------------RVVA.KE..........E--F----RDI-TQ......L...
A4XKP5_CALS8/3-110---------------------------------------LVVP.KQ..........H--I----ESL-NH......L...
A5D7U9_BOVIN/174-293---------------------------------------IAIC.HR.........RG--I----KSL-RD......L...
A5E770_LODEL/177-298---------------------------------------CCIV.NR.........QD--I----ASI-RD......L...
A5GQU3_SYNR3/125-230---------------------------------------LVIP.RQ..........H--I----PSL-KE......A...
A5I635_CLOBH/3-110---------------------------------------LIIP.KE..........H--I----SSL-NE......L...
A6QUC5_AJECN/141-262---------------------------------------LCLV.ER.........RN--I----WSL-RD......L...
A6VZM3_MARMS/2-109---------------------------------------LVIP.KR..........H--I----STL-ND......L...
A7HMY4_FERNB/3-108---------------------------------------LAIY.KK..........H--I----ATI-ND......L...
A7S614_NEMVE/151-270---------------------------------------IAIC.HK.........RG--I----KSL-RD......L...
A7SFV5_NEMVE/10-122---------------------------------------LVIP.KQ..........H--Y----GNP-KS......L...
A7TKH2_VANPO/142-261---------------------------------------VSIL.KR.........KD--I----LSL-RD......I...
A7TQ97_VANPO/171-297---------------------------------------VAIV.YR.........ND--L----TSV-RD......L...
YHIT_CHLTR/2-108---------------------------------------LIIP.KK..........H--I----EKL-QD......I...
APTX_CHICK/142-252---------------------------------------LVLP.WD..........S--I----SSL-KS......V...
APTX_DANRE/150-260---------------------------------------LVLP.WQ..........S--I----SSL-KA......L...
APTX_XENTR/173-283---------------------------------------LVLP.WQ..........S--I----ANL-KV......L...
APTX_CIOIN/206-317---------------------------------------LILP.KD..........S--I----SST-KN......L...
Q0U2I6_PHANO/148-269---------------------------------------LGLV.ER.........RD--I----WSV-RD......L...
Q15X15_PSEA6/3-110---------------------------------------LVIP.KK..........A--I----ATI-ND......I...
Q16F07_AEDAE/8-123---------------------------------------LVLP.WA..........N--I----DNV-YEFSSLLQL...
Q16XY1_AEDAE/224-343---------------------------------------LALV.RP.........KG--I----KSL-RD......L...
Q16YN6_AEDAE/11-125---------------------------------------LAVP.KY..........H--L----DDV-RS......L...
Q18227_CAEEL/10-129---------------------------------------LVLS.KQ..........H--I----AKP-TD......L...
Q1CY35_MYXXD/3-112---------------------------------------LFIP.HK..........H--I----PTV-ND......I...
Q1QZ40_CHRSD/2-109---------------------------------------LIIP.KK..........H--I----ATL-ND......I...
HINT3_XENTR/18-132---------------------------------------LVVP.KK..........H--V----GTC-KT......L...
Q2H2H7_CHAGB/31-147---------------------------------------ILMP.RD.........TS--I----KEI-AN......L...
Q2H304_CHAGB/151-275---------------------------------------LGLV.ER.........RD--L----WSL-RD......L...
HINT3_BOVIN/47-162---------------------------------------LVVP.KK..........H--F----ENC-KY......L...
Q3IJU5_PSEHT/4-111---------------------------------------LIIP.KK..........A--I----ATI-ND......V...
Q4PA08_USTMA/46-158---------------------------------------LVIP.RN..........H--I----ANV-QS......L...
Q54DF5_DICDI/36-141---------------------------------------LICP.RE..........H--I----VSI-KT......L...
Y2839_DICDI/224-348---------------------------------------LVIP.RV..........E--I----NTL-DE......L...
Q59S51_CANAL/134-254---------------------------------------CCIV.NR.........LD--I----SCV-RD......L...
Q5TUI6_ANOGA/154-273---------------------------------------LALV.RR.........RG--I----RSL-RD......L...
A8XGQ1_CAEBR/148-267---------------------------------------LAII.HR.........HG--L----KSV-RD......L...
Q6BZT0_YARLI/136-263---------------------------------------VAIS.LRNLEGQGESGKP--I----TSI-RD......L...
Q6C515_YARLI/4-127---------------------------------------LVLP.KA..........V--K----PDT-HP......LKA.
Q6C6M8_YARLI/30-153---------------------------------------IAIA.YR.........HD--V----HSL-RD......L...
Q6CJA1_KLULA/160-286---------------------------------------VAIV.HR.........DD--I----KSL-RD......L...
Q6FLB9_CANGA/198-323---------------------------------------MAIV.YR.........ED--I----KSL-RD......L...
Q6FWT2_CANGA/170-296---------------------------------------VAIS.YR.........DD--I----RSL-RD......L...
Q6IIA4_DROME/5-118---------------------------------------LAVT.KK..........H--Y----ASL-KD......L...
Q74ZD1_ASHGO/153-277---------------------------------------VAIA.YR.........ND--V----RSL-RD......L...
Q7PHF8_ANOGA/7-116---------------------------------------LVLP.WK..........D--I----DSV-YD......L...
Q7QJM2_ANOGA/10-124---------------------------------------LAIP.NH..........H--L----ENV-NS......L...
Q83DE2_COXBU/3-109---------------------------------------LVIP.HR..........H--I----ETI-ND......V...
Q84VV6_ARATH/7-121---------------------------------------LVIP.KE..........H--I----PTV-ND......LQ..
Q8GYJ9_ARATH/75-183---------------------------------------LVIP.KLR........DG--L----TSL-GK......A...
Q8SUA2_ENCCU/116-232---------------------------------------LVVF.KD.........PG--L----KTI-RD......I...
Q97JJ3_CLOAB/3-110---------------------------------------LVIP.KK..........H--I----SSL-ND......I...
BH140_ARATH/717-833---------------------------------------LVLARQE..........S--L----DGL-ED......V...
DCPS_SCHPO/141-261---------------------------------------MAIV.HA.........TD--I----ASI-RD......L...
E7KRX8_YEASL/160-281---------------------------------------VAIV.YR.........TD--I----KTI-RD......L...
E7KUH0_YEASL/160-281---------------------------------------VAIV.YR.........DD--I----KSL-RD......L...
F1R776_DANRE/159-276---------------------------------------IAIV.HR.........RD--I----KSL-RD......L...
F7CC42_XENTR/161-276---------------------------------------IAIC.HQ.........RG--I----RSL-RD......L...
H3C365_TETNG/54-161---------------------------------------LVVT.RR..........H--I----DNC-RM......L...
H3CJX6_TETNG/127-244---------------------------------------IAIV.HQ.........KG--I----KSL-RG......L...
H3DP42_TETNG/31-141---------------------------------------LVVP.TK..........H--V----GNC-KS......L...
Q0JBF2_ORYSJ/25-136---------------------------------------LVIP.IE..........H--I----PTV-NN......LQ..
Q5K774_CRYNJ/143-255---------------------------------------TCIV.QD.........RS--I----KSL-RD......L...
Q9VQ59_DROME/32-141---------------------------------------LAIP.KE..........H--F----DSL-KA......L...

PF01230

HINT1_RAT/24-121---------------------------------------LVIP-KK---------.H..I----SQI-SV------A---
HNT2_YEAST/12-107---------------------------------------LIVP-LR---------TT..V----LNL-SD------L---
FHIT_HUMAN/11-105---------------------------------------LVCP-LR---------.P..V----ERF-HD------L---
APH1_SCHPO/12-106---------------------------------------LVIP-QR---------.A..V----PRL-KD------L---
APTX_YEAST/15-139---------------------------------------LILP-RT---------MQ..L----SRS-HP------T---
Q9I500_PSEAE/74-166---------------------------------------LVPR-RE---------.D..V----TEL-FQ------L---
Q98BM9_RHILO/14-106---------------------------------------LVPQ-RP---------.G..A----EEI-HD------M---
Y866_METJA/9-105---------------------------------------LVVP-KK---------.H..Y----ERF-DE------M---
YHIT_MYCPN/19-116---------------------------------------LVIP-KK---------.H..A----VNY-SS------T---
APTX_SCHPO/44-156---------------------------------------LLMT-RD---------PH..L----THV-HP------L---
YHIT_HELPY/9-104---------------------------------------LVIP-KQ---------.S..I----QDF-NG------I---
HNT1_YEAST/32-125---------------------------------------LIIP-KY---------.H..G----AKL-HD------I---
Q9A2A9_CAUCR/9-106---------------------------------------LLPR-QP---------.G..L----REL-ED------L---
YHIT_SYNY3/12-109---------------------------------------LLIP-KK---------.P..L----PQL-SA------A---
Y1390_SYNE7/12-109---------------------------------------LVIP-KQ---------.P..I----ANL-LE------A---
YHI1_MYCLE/10-102---------------------------------------LVVP-CA---------.E..I----DQW-QN------V---
Y961_HAEIN/12-110---------------------------------------LIIP-NK---------.V..I----PTV-ND------V---
Q9JYE4_NEIMB/10-102---------------------------------------RVIW-RK---------.H..I----AEM-TD------L---
Q9KQC5_VIBCH/14-106---------------------------------------LVPQ-RA---------.D..L----REL-HH------L---
ZB14_MAIZE/24-123---------------------------------------LIIP-KV---------.KDGL----TGL-AK------A---
HINT_CAEEL/28-125---------------------------------------LVIP-KR---------.R..I----DML-EN------A---
G8AG53_AZOBR/16-114---------------------------------------LVIP-KG---------.A..Y----VDM-DD------F---
K7XM15_MYCHR/14-110---------------------------------------LVVP-KN---------.Y..S----RNL-FS------I---
YHI2_MYCTU/11-106---------------------------------------LVLP-KR---------.H..T----VDL-TD------T---
Q32EW3_SHIDS/12-109---------------------------------------LIIP-NI---------.L..I----PTV-ND------V---

PF04677

C3H64_ARATH/370-491---------------------------------------LIIP-IE----------H--L----PNT.LV------L---
C19L1_CAEEL/309-429---------------------------------------MVLS-VG----------H--I----QSQ.VS------A---
C19L2_CAEEL/226-350---------------------------------------IIVP-TQ----------H--C----SST.IQ------L---
C19L2_DROME/460-584---------------------------------------ILTT-LQ----------H--V----PCC.TQ------L---
CWF19_SCHPO/399-523---------------------------------------LIVP-TG----------H--R----INT.LS------C---
DRN1_YEAST/256-389---------------------------------------LIIP-IE----------H--I----PKLDPS------K---
MU161_SCHPO/334-470---------------------------------------LIIP-IA----------H--A----SAL.ST------L---
Q93ZX4_ARATH/458-582---------------------------------------CILP-MQ----------H--E----AAS.RS------V---

PF02611

CDH_HELPY/24-243---------------------------------------LLMPTTH-------------I----SGIESP------LLLD
G9AY12_PANAN/24-250---------------------------------------ILVPTVP-------------V----SGIESP------WLFM
Q8P9Z9_XANCP/30-250---------------------------------------LLVPSVR-------------V----SGIEDP------SLLQ
E8V0N7_TERSS/35-269---------------------------------------LVMPTAK-------------I----TGIEDP------AILE
A8GL49_SERP5/45-264---------------------------------------LLMPSAK-------------I----TGIESP------EVLA
E0SJ94_DICD3/33-253---------------------------------------LLIPTDR-------------I----SGIESP------LLLQ
CDH_YERPE/33-252---------------------------------------LLIPTVP-------------I----SGIESP------QLLT
B8IMH8_METNO/37-256---------------------------------------VVMPTER-------------V----VGLEDP------QLQQ
W0LHA3_SERFO/26-254---------------------------------------ILVPTAP-------------L----SGIESP------QLLL
B1M455_METRJ/29-249---------------------------------------VVMPTDT-------------V----PGLEAP------VLRG
Q1LBK3_RALME/33-250---------------------------------------LVIPVRP-------------V----SGVDDA------RVWS
Q6MQF2_BDEBA/30-256---------------------------------------LLMPTEK-------------I----TGMESP------EIRA
G8MBN7_9BURK/67-288---------------------------------------LLIPTAR-------------V----SGIESP------ELLE
A6TFQ8_KLEP7/24-243---------------------------------------LLMPTYR-------------I----NGTESP------LLLD
H2INV4_RAHAC/31-250---------------------------------------LLMPTAR-------------I----TGMESP------ALLE
B0U7T2_METS4/29-248---------------------------------------VVMPTAS-------------V----VGLEAP------ELQT
B2VF57_ERWT9/34-251---------------------------------------LLIPVAK-------------I----TGIETQ------KLLN
B9JRW8_AGRVS/27-242---------------------------------------LLIPTDK-------------I----TGIESP------ALLD
D8IW24_HERSS/34-253---------------------------------------LLMPTRR-------------L----TGIESP------ELLE
C5BB31_EDWI9/31-247---------------------------------------LLLPTVR-------------S----SGIDDP------QLLN
A9HJU4_GLUDA/35-256---------------------------------------LVIATDR-------------V----TGIEDP------SILS
B2JLJ5_BURP8/29-246---------------------------------------LLIPTDR-------------V----TGIESP------SVLD
B1LSY8_METRJ/26-246---------------------------------------VVMPTDS-------------V----SGIEAS------VLQG
L0IYV5_MYCSM/29-248---------------------------------------LLIPTER-------------I----PGIESP------TLLE
B8IPC5_METNO/27-247---------------------------------------LVVPTTP-------------I----IGIEAP------ALQS
B2FII5_STRMK/27-247---------------------------------------LLMPLDK-------------V----SGIESR------SLYQ
CDH_CROS8/31-250---------------------------------------LLMPTWK-------------I----NGVESP------LLLS
B8EQB5_METSB/40-259---------------------------------------LLIPTRR-------------L----SGMEDP------LLGG
B2HIW3_MYCMM/43-260---------------------------------------LLLPLAR-------------V----SGIEDQ------ALQE
W0HRX4_9ENTR/35-254---------------------------------------LLMPTEK-------------I----SGIESP------RLLS
E6WAG7_PANSA/33-250---------------------------------------LLMPIEK-------------I----TGMESP------LLLD
B1M8V7_METRJ/69-294---------------------------------------LLIPTAR-------------I----TGIESP------VLLR
D8MKK8_ERWBE/33-250---------------------------------------LLMPVEK-------------I----TGIESP------ALLN
G2I2H3_GLUMN/36-254---------------------------------------LLIPTQR-------------V----TGMEDP------AIIK
Q6D6W9_PECAS/32-251---------------------------------------LLLPTDK-------------I----SGIESP------ELLQ
D2UA62_XANAP/30-247---------------------------------------VLVPTRR-------------I----VGVESP------LLQR
CDH_MYCLE/38-255---------------------------------------LLLPLAR-------------V----TGIEDP------ALQE
Q13LU5_BURXL/41-259---------------------------------------LLIPTDR-------------I----TGIESP------LVLA
Q7NQ26_CHRVO/27-251---------------------------------------LLIPTDK-------------V----SGIESP------RLLG
K7SS21_GLUOY/32-232---------------------------------------LLIPTKK-------------V----PGIEDA------SLLQ
R9VP92_9ENTR/32-251---------------------------------------LLMPTYR-------------I----NGTESP------LLLQ
Q0JZ98_CUPNH/25-246---------------------------------------LVIPART-------------M----TGIDDA------RAWD
H8L0L3_FRAAD/32-259---------------------------------------LLLPMQR-------------T----SGLEAA------SLIK
CDH_ECOLI/31-250---------------------------------------LLMPTYR-------------I----NGTESP------LLTD
Q5FPM0_GLUOX/32-232---------------------------------------LVIPTQK-------------V----PGVEDP------VLLK
W0PFV2_9BURK/44-257---------------------------------------LHMPTQH-------------V----SGLEDP------ALLQ
I2BEE8_SHIBC/29-247---------------------------------------LLMPVAQ-------------I----RGIESP------QLLS
CDH_MYCTU/41-258---------------------------------------LLIPLAR-------------I----TGIEDP------ALRE
U3U143_9ENTR/33-250---------------------------------------LLMPIAK-------------I----TGMESP------ILLE
D5CGT2_ENTCC/45-264---------------------------------------LLMPTYR-------------I----NGTESP------LLTK

PF02744

GAL7_CRYNJ/204-373---------------------------------------LLMPYKR----------H--I----PSI-LQ------LTAE
GAL7_HAEIN/183-348---------------------------------------LLLP.KT----------H--V----KRL-TE------LSDE
GALT_STRMU/231-435---------------------------------------IRLR.GA----------N--K----YSL-VE------LAEI
GALT_BACSU/240-451---------------------------------------LRLQ.GD----------E--P----GHV-AE------AADH
GAL7_YEAST/198-366---------------------------------------LVIS.KK----------K--L----ASI-SQ------FNQM
GAL7_KLULA/195-363---------------------------------------MVLS.KR----------R--I----PSL-NQ------FTDK
GAL7_ECOLI/182-347---------------------------------------LLLP.KA----------H--V----LRI-TD------LTDA
GALT_HUMAN/202-370---------------------------------------LLLP.RR----------H--V----RRL-PE------LTPA

PF16285

D5DD06_BACMD/8-254SGE-------YA-SVL---------FFKNHGPMSGGSLRHP--------HMQIIGLN-EMDVNENVKLE----------Q
C0ZAZ1_BREBN/8-252SKS-------YR-SVL---------FFKNHGPYSGGSIRHP--------HMQIVGLN-DFDYLDQVKDS----------D
B2TPI8_CLOBB/11-256SNE-------YK-SVI---------FYKNHGPSSGGSIKHA--------HMQIVGLN-NIDYRENINEK----------Y
C9LU44_SELS3/8-252SGK-------YE-TVI---------FFKNFGPLSGGTLRHP--------HMQIVGFH-SLNENLTFDPL----------E
D9SRU9_CLOC7/9-253RDE-------FK-SVL---------LFKNHGPYSGGSIAHS--------HMQIVGLK-NINYEENLKDE----------F
Q81VH8_BACAN/8-251NEE-------FK-SVI---------LYKNHGPFSGGSLHHA--------HMQIIGMK-YVNYLDNVEQD----------N
U5LFA6_9BACI/8-252SGR-------FT-SVL---------FFKNHGPLSGGTIAHP--------HMQIVGLN-EVDYTENIREE----------E

PF01087

GAL7_CRYNJ/15-198KGI-------YV-FEN---------DFPALLP.DPLAVGTN--------KI.......SDD.......P..........L
Q7QA38_ANOGA/1-174EST-------FV-FTN---------DFPALLE.QVPEPPS.--------.........SDD.......P..........L
A5DRG5_PICGU/6-197EST-------FV-FPN---------DYPAVRL.EQPDYEAE--------KS.......SGDGKDDLKSR..........L
Q9CM11_PASMU/4-178QKP-------FV-FKN---------DFSALLE.ETPNPEK.--------.........STD.......P..........L
Q2H1V5_CHAGB/2-211KNT-------FT-FVN---------DYSAVKE.QQQEYNPE--------AN........KDDV...SSL..........L
A4AQM0_MARSH/1-176KKP-------FS-FVN---------DFSALLQ.DVEEKKY.--------.........KNG..................L
Q65CW7_BACLD/17-231QSP-------LA-ATE---------YFYQLSK.NSNYIQTK--------RI.......EKN.......I..........S
A9WJH8_CHLAA/4-191TET-------FV-FEN---------DFAALLP.DIPLDRVS--------VRLP...LADQHDA...GPV..........L
A7MIY8_CROS8/2-176TGT-------YV-FTN---------DFAALMT.DTPDAPQ.--------.........SAD.......P..........L
Q03XA5_LEUMM/18-235QSP-------RQ-ATD---------YFFDLSQ.RSNYIKTR--------EI.......SQN.......I..........S
A3N102_ACTP2/3-177SKP-------FV-FKN---------DFSALLP.DTPAPEA.--------.........GSD.......P..........L
GALT_STRMU/16-225KSP-------QK-AIK---------DFYELSK.RNNYIKVT--------AI.......AKN.......I..........A
A5DWA9_LODEL/21-211SAT-------YV-FPN---------DYPAVKM.DQPDYNDE--------TTK.....DGQGSL...KKK..........L
Q6D2C5_PECAS/1-175QST-------FV-FTN---------DFSALME.DTPDAPS.--------.........GDD.......E..........L
Q1IQZ6_KORVE/1-177IST-------FV-FEN---------DYAALKP.DIVEFER.--------.........NES.......G..........L
Q6LQE3_PHOPR/15-189TGT-------YV-FNN---------DHAALTV.DTPDAPQ.--------.........SDN.......P..........L
A8LEI8_FRASN/19-211AGP-------YV-FAN---------DFPALRP.PLSDERLE--------VRAESGIPPGRAGG...AEE..........L
Q59VY3_CANAL/21-210DAT-------YI-FPN---------DYPAVRL.DQPEYKED--------EQ......DKQNTL...KSR..........L
A1L2D1_DANRE/7-181DST-------FM-FDN---------DFPALQP.DAPDPGS.--------.........DHH.......P..........L
A7F8S7_SCLS1/1-208KDT-------FV-FVN---------DYSAVKE.VQAEYAQD--------GE........SKDL...SNI..........L
Q3XZ93_ENTFC/18-230KSP-------EE-ATE---------YFFNLSK.KNDYIKTR--------AI.......AKN.......I..........K
B1YII0_EXIS2/18-230EHP-------QQ-ATD---------YFYQLSQ.ANNYIQTK--------RI.......AKN.......I..........Q
Q0RE52_FRAAA/14-191RGT-------YV-FTN---------DFPALRP.AESDPAPP--------GADP...GG.....................L
Q21LR9_SACD2/5-180SST-------FV-FTN---------DFAAVQK.ESHKAPE.--------.........STN......KG..........L
GALT_STACT/19-233SHP-------EK-ATG---------YFYQICK.RNHYVKED--------AI.......AKN.......I..........H
GALT_LACPL/16-224VSP-------QT-ATD---------YFFNLSK.ANDYIKTR--------AI.......AKN.......V..........V
A8WVF3_CAEBR/2-179LST-------FV-FEN---------DFPSFTEFDGCAGKE.--------.........ENS.......D..........L
A2AMS2_MOUSE/3-177DGT-------FL-FDN---------DFPALQP.DAPDPGP.--------.........SDH.......P..........L
GAL7_NEUCR/2-217KNT-------FA-FVN---------DYSAVKE.EQQEYHPR--------KDAA...GDGDDDI...ASL..........L
A7TJY6_VANPO/4-190EST-------YI-FQN---------DYPAVKL.EQPDIDET--------D........ETDEI...KKR..........L
A6RBX1_AJECN/45-253KNT-------FI-FLN---------DYSAVKE.EQAAYQRE--------SV........DGDI...SSV..........F
GAL7_KLULA/1-189EST-------YV-FTN---------GYPAVKL.EQPDPELT--------VS.......NCDAL...KER..........L
Q5KY03_GEOKA/19-233RDP-------QE-ATD---------WFYSLSQ.ASNYIQTA--------RI.......ANN.......Q..........H
Q03PB0_LACBA/18-226QSP-------GA-ATD---------WFYQLSQ.VNNYIKTR--------NI.......AKN.......V..........V
A2QCH5_ASPNC/2-209EKT-------FV-FVN---------DYSAVKE.EQAPYSPE--------G.........GEDL...ESF..........F
A6WF46_KINRD/10-216YDV-------VA-FEN---------RFPSFSN.RIGGEDGF--------L........DGE.......R..........L
Q2J7D6_FRASC/3-201SGT-------YV-FTN---------DFPALRP.DPVRPAAL--------LVAPPADPPVAPSA...DPAPVWPAGPGSGL
A3QFA6_SHELP/9-182DTT-------FV-FQN---------DFAALNS.DGPKA.Q.--------.........GED.......P..........L
GALT_BACHD/21-236QGP-------EE-ATK---------VFYDFSK.QVHYIRTD--------RI.......AKN.......E..........H
Q5WD06_BACSK/20-235QGP-------QA-ATA---------AFYQFCQ.DAHYIRTD--------RI.......ALN.......E..........S
A0QYK5_MYCS2/3-199YDV-------VV-FEN---------RFPSLSG.GGEFTLPD--------T........AGA..................E
GALT_LACSS/20-231KDP-------EK-ALA---------YFYELSQ.ANDYIKVA--------AI.......AKN.......I..........A
Q896X9_CLOTE/19-233KGA-------KE-ATN---------YFYNIAK.ALNYIRCD--------RI.......NKN.......L..........S
GALT_DROME/1-175EST-------YV-FEN---------DFPALVE.VVPVPPN.--------.........NDD.......P..........L
GAL7_SCHPO/4-195ETT-------YV-FPN---------DYPAVRV.DQPDYMQD--------ESE....ITKGNTL...KTR..........M
B8I4V5_CLOCE/19-234QSI-------KA-ATD---------YFYNLCI.ASNYIRTS--------QI.......AKN.......I..........K
A3LR66_PICST/19-206EAT-------FV-FPN---------DYPAVKL.DQPNYVEE--------E........SKDSL...KGK..........L
Q7N8Y8_PHOLL/4-178QGA-------FV-FNN---------DFSALML.DSPDLPP.--------.........SCH.......P..........L
Q73SK2_MYCPA/2-203YDV-------VV-FEN---------RFPSLSG.AAPGLLA.--------.........AGA.......D..........G
A8FIP9_BACP2/20-233EGP-------KA-ATS---------WFYEMQK.HAHYIHTG--------RI.......AKN.......V..........Q
Q3IH81_PSEHT/3-176KKT-------YV-FTN---------DFAALKI.DTPEF.K.--------.........TDD.......P..........L
A0M3B7_GRAFK/1-176KEP-------YS-FIN---------DFSSLLP.DAPEIDF.--------.........QDG..................L
A5FKW9_FLAJ1/2-179KNS-------FV-FDN---------DFAALKQ.DEIIFEE.--------.........DIK......HT..........F
Q4PDD8_USTMA/31-214TST-------FF-FEN---------DYAALKP.QSVMEEK.--------.........NQH.......P..........L
Q15Y61_PSEA6/2-176KDT-------FV-FTN---------DFAALMK.DTPASEQ.--------.........END.......D..........L
Q6C0K3_YARLI/1-190KDT-------FV-FEN---------DFSAVFE.KTAEVEKV--------VEEAQKEHTESTAL...DLD..........L
Q6BVI6_DEBHA/3-194ENT-------YI-FPN---------DYPAVRV.DQPDYIED--------TEE....IEKSSPL...KAK..........L
Q2GAY3_NOVAD/2-175PGA-------FA-FDN---------DFPALMP.DNPAPEG.--------.........GDP..................V
GALT_CLOAB/17-229NSP-------KE-ATS---------YYYKLSI.ASNYIRKD--------RI.......DKN.......I..........T
GALT_ENTFA/20-232ESP-------RK-ATD---------YFYQLCK.TNNYIKTK--------AI.......AKN.......I..........I
Q30V51_DESAG/2-182SGV-------FV-FDN---------DFQALKT.PGSRTAQS--------PP......RKND.......D..........L
A9KN46_CLOPH/31-257KDR-------VA-ATD---------YYYKLSQ.DSDYIRRY--------RI.......QKD.......V..........K
GALT_LACS1/18-228KSP-------EE-AIQ---------NFYDLSK.RNDYIKTK--------AI.......AKN.......I..........Y
A0KQH7_AERHH/2-174RDT-------FV-FTN---------DFAALMQ.DTPAASG.--------.........QQD.......P..........L
A4VT89_STRSY/18-226DSP-------EQ-AIS---------DFYELSK.RNDYIKMA--------AI.......AKN.......I..........Y
A5VME1_LACRD/16-220QSP-------ST-ATD---------WFYNLCT.SNDYVKVA--------AI.......KKN.......V..........V
E7KK61_YEASL/5-192EST-------YI-FPN---------DYAAVRL.DQPILPQN--------DS.......NEDNL...KNR..........L
G0RTP4_HYPJQ/7-208EQT-------FA-FVN---------DYSAVKE.QQPDYEVD--------QS.......SDDL....ESL..........L
Q04GZ3_OENOB/18-225KSP-------KT-ATD---------YFYKVSR.ENDYIKTQ--------AI.......AKN.......I..........S
Q5KLY2_CRYNJ/11-195IDT-------FT-FEN---------DFPALLP.GPLPTLQQ--------PSK....VNSSD.......S..........L
GALT_STRT2/18-226SNP-------EQ-AIA---------DFYAQSK.RNDYVKVK--------AI.......AQN.......I..........A
Q5NEY1_FRATT/11-180KET-------FV-FEN---------DFSALSK.EKIDKKL.--------EI........ND.......D..........L
Q7MBX0_VIBVY/28-200QGT-------FV-FKN---------DFAALTE.HTPDSPV.--------.........SDD.......P..........L
GALT2_STRR6/16-224YSP-------EQ-AIE---------DFYQLSQ.KNDYIKLK--------AI.......AKN.......I..........A
GALT1_STRR6/18-225ISP-------QE-AVE---------EFYKLSK.DSDYIKTS--------AI.......AKN.......I..........E
GALT_CLOPE/21-230ISP-------KE-STD---------YFYSLSK.SSNYIRTD--------RI.......AKN.......I..........N
GALT_LACLA/19-228TSP-------DA-ATQ---------YFYELAQ.QVNQVKTR--------DI.......TRN.......I..........A
U5L509_9BACI/19-230ESP-------AK-ATR---------YFYDLSR.NSNYIQTK--------SI.......AKN.......I..........N

PF16268

F5XH95_MICPN/8-422AQP-------AAAYVA---------VFQNWLPPAGASLEHL--------HKQLVAID-SYGPQVRHEAA----------L
C3PH27_CORA7/1-419RNR-------YASYVA---------VFQNWLAPAGASFDHL--------HKQLVAID-ALGMAAHQENA----------I
B1VH78_CORU7/18-447ANR-------YVRYVA---------AFQNWLEPSGATMEHL--------HKQLVAID-EHGLQNDWEIS----------L
Q8NNU9_CORGL/1-424RNR-------YAPYVV---------AFQNWLKPAGASFDHL--------HKQLVAID-ERGRLIADELH----------H
W5WQ34_9CORY/18-447ANR-------YVRYVA---------AFQNWLAPAGASFEHL--------HKQLVAID-EHGLQNEMEIA----------Q
W5Y1J6_9CORY/15-448RNR-------YAPYVA---------VFQNWLKPAGASFDHL--------HKQLVAID-ERGVQAEMEIA----------R
G0HAG7_CORVD/18-449ANP-------YVRYVA---------AFQNWLAPAGASVEHL--------HKQLVAID-EHGLQNETEIA----------Q
U3GXR8_9CORY/26-464SNR-------YVPYVA---------AFQNWLKPAGASFDHL--------HKQLVAID-ERGVQQSQEIA----------Q
Q6NGG7_CORDI/11-432RNR-------YAPYVA---------VFQNWLKPAGASFDHL--------HKQLVAID-ERGVHGETEIA----------K
S5SVS2_9CORY/15-437RNR-------YVPYVA---------AFQNWLAPAGASFDHL--------HKQLVAID-ERGVQSALEIE----------R
B3QVF6_CHLT3/10-436NNR-------YVRYVS---------VFQNWLKLAGASFDHI--------HKQLVGLD-SWSLSIENQIQ----------M
Q6A5P1_PROAC/10-435HNE-------HVRYVV---------VFQNWLKPAGASFDHL--------HKQVVAID-EVGADNESVLP----------K
Q8FP08_COREF/15-438RNR-------YAPYVV---------AFQNWLKPAGASFDHL--------HKQLVAID-ERGYQNDVELA----------Q
F8E0G1_CORRG/18-447ANR-------YVRYVA---------AFQNWLAPAGASFDHL--------HKQLVAID-EHGLQNETEIA----------Q
C5CBF5_MICLC/33-463TTP-------AVRYVS---------VFQNWLKPAGASFDHL--------HKQLVAID-EVGAQNAAALD----------R
I6XY80_PROPF/27-452NNR-------YARYVT---------VFQNWLKPAGASFDHL--------HKQLVAID-ERGVQHEVALA----------R
R5PXK8_9PROT/14-442NNR-------YVRYVT---------VFQNWLNQAGASFDHL--------HKQLVAID-CISASNENEFQ----------L
D7BLX6_ARCHD/14-437QNR-------YARYVQ---------VFQNWLKPAGASFDHL--------HKQLVAID-QRSVNGKLEVE----------R
D9QB86_CORP2/15-442RNR-------YAPYVA---------VFQNWLKPAGASFDHL--------HKQLVAVD-ERGVHSEMEVQ----------K
X5DSS5_9CORY/40-471ANP-------YVRYVA---------AFQNWLEPAGASIEHL--------HKQLVAID-EHGLQNETEIA----------Q
M1P829_9CORY/11-432RNR-------YVPYVA---------AFQNWLAPAGASFDHL--------HKQLVAID-ERGVQAETEIE----------R
D7GCR7_PROFC/13-438QNR-------YARYVA---------VFQNWLRPAGASFDHL--------HKQLVAID-QHGTQAAGEVE----------R
D7WEZ1_9CORY/10-431RNR-------YAPYVS---------VFQNWLAPAGASFDHL--------HKQLVAID-ERGVQADFEID----------K
C8XCI8_NAKMY/35-455TNP-------YVRYVA---------VFQNWLRPAGASFDHL--------HKQLVAID-ERGMQAELEIQ----------R
C4LIB0_CORK4/15-440RNR-------YARYVA---------VFQNWLKPAGASFDHL--------HKQLVAID-ERGAQAELEIA----------R
K7RWS7_PROA4/29-464SNP-------EARYVV---------AFQNWLKPAGASFDHL--------HKQLVAID-EIGHSNDEVLS----------R
D6ZJH6_MOBCV/17-441LNP-------AVKYVT---------AFQNWLRPAGASFDHL--------HKQLVAVD-EYGVQIEAEAA----------R

PF11969

Q5TVU2_ANOGA/17-126..T-------ID.DVA---------LLKDMYGLAQSVIKEG-G.............------...LDTK----------Q
A5DAJ7_PICGU/3-137KNN-------PT.LYD---------IIATYVEKAKDMIMEE-MQLTQQFASDSPMT------NAEYRAR----------F
A5DAR3_PICGU/136-257..N-------GT.HID---------FLKKLLAKLRQVTSEK-Y.S...........------...LAPD----------Q
Q293N2_DROPS/5-112..T-------RE.HLP---------LLEELHLLARNVVEVR-GQL...........------.....WN----------D
Q293N2_DROPS/220-329..T-------SD.HLP---------LLDHMMELAVQIIGKQ-D.H...........------...LPSR----------N
Q297L1_DROPS/153-272..N-------GS.HLP---------LLRNIRQSAKDAISKR-Y.G...........------...LNPN----------Q
Q29LN6_DROPS/45-159..N-------KS.HIG---------LVLRMESGMVELLKSK-N.............------...VDPS----------K
HINT3_RAT/40-155..N-------KD.HIE---------MVESMVTVGKTILERN-NFT...........------....DFT----------D
A0EGQ1_PARTE/118-231..N-------QD.HVA---------MLEEMYTEGLKIISEK-Y.Q...........------...LESK----------F
A1CEC1_ASPCL/149-272..K-------KK.HVP---------WLRYLRQRLLEGTVKM-YPE...........------...LEQD----------Q
A3DF72_CLOTH/3-110..N-------ES.NAQ---------ILIDIHKAANKVAEDL-GIA...........------.EKGYRL----------I
A3LWH2_PICST/136-257..N-------SS.HIE---------YLVNIQKLIKKVATEK-F.A...........------...VQKD----------E
A4S248_OSTLU/99-229..R-------AE.HLP---------LLRAMLRKGRAVIEDI-Y.G...........------...VNAE----------E
APTX_DROME/4-113..N-------RS.HLS---------LLEELHLLARNVV..E-VKG...........------...VRWQ----------D
APTX_DROME/229-339..T-------EA.QLP---------LLDHMMDLANQIIEKQ-KHL...........------....ESR----------N
A4XKP5_CALS8/3-110..D-------NS.HKE---------LIGHIFVVAKELSDRF-GVK...........------.EKGFRI----------V
A5D7U9_BOVIN/174-293..T-------AE.HLP---------LLRNILREGQEAILRR-Y.R...........------...VAAD----------R
A5E770_LODEL/177-298..R-------GEDHLT---------WLAGIRNKIIDVCKQK-Y.E...........------...LSVD----------G
A5GQU3_SYNR3/125-230..Q-------PS.DSA---------LLGHLLLVAAKVAKEA-GL............------..QDWRT----------V
A5I635_CLOBH/3-110..T-------EE.NSK---------VISHIFMVAKKIAKDL-NIS...........------.EEGYRV----------I
A6QUC5_AJECN/141-262..K-------KK.HIP---------WLKHMREKVLDGVVNV-YPQ...........------...LDRD----------Q
A6VZM3_MARMS/2-109..T-------DE.DAP---------VVGKLQTTAAKIAKQK-GIS...........------.NAGYRV----------V
A7HMY4_FERNB/3-108..S-------EE.DSK---------NMWKLFEVIKKVTKDQ-NL............------..ESYRI----------V
A7S614_NEMVE/151-270..N-------EE.HIP---------LLKNILNKGRDAIRTK-Y.N...........------...VPHS----------Q
A7SFV5_NEMVE/10-122..T-------GD.DLP---------LVEKLMDVGKKVLVQQ-NA............------....NTE----------D
A7TKH2_VANPO/142-261..N-------KN.HYE---------FLNGISERIKDIIPKK-YNN...........------..EIKSD----------Q
A7TQ97_VANPO/171-297..K-------PS.DRD---------WLININNKIRSIVPAC-YNY...........------..GVHAD----------E
YHIT_CHLTR/2-108..Q-------GD.DFL---------LLAEAGKIIQLMARNF-GIE...........------..NGYRV----------V
APTX_CHICK/142-252..T-------RE.HLG---------LLEHMHAVGQKMI.QQ-CPA...........------...KESL----------E
APTX_DANRE/150-260..R-------SE.HVE---------LLKHMQRVADQMV.EQ-CPD...........------...AHKL----------S
APTX_XENTR/173-283..R-------AE.HLE---------LVQHMHAVGQKIA.KE-HSD...........------...SKCA----------P
APTX_CIOIN/206-317..S-------TD.NIE---------LLKHILKVGQELAAEV-KDK...........------...QPDV----------E
Q0U2I6_PHANO/148-269..K-------KG.NVE---------WLKHMKIKMVEATCGL-YEG...........------...VERD----------Q
Q15X15_PSEA6/3-110..E-------KE.DRE---------VVGHLSWVASHILKEH-GLA...........------.EQGFRT----------V
Q16F07_AEDAE/8-123..I-------PV.HIP---------LLKEMFQLAKQAIEL.-.NR...........------...CHQK----------E
Q16XY1_AEDAE/224-343..T-------AA.HLP---------LLRNIKEGGTKAIKER-Y.G...........------...IDSD----------H
Q16YN6_AEDAE/11-125..T-------EA.ERP---------LLDEMRQELGNVLKDQ-FQV...........------....DLA----------E
Q18227_CAEEL/10-129..T-------VA.DVP---------LLEEMEKTGRELLREH-LKKKG........E------ADTVEDM----------.
Q1CY35_MYXXD/3-112..T-------TE.DRE---------LVGHLFIAAAKVAQER-GHAD..........------PSDGYRV----------V
Q1QZ40_CHRSD/2-109..T-------PE.DLT---------LVGRLQHTAATLAREL-GFA...........------.EDGYRV----------V
HINT3_XENTR/18-132..T-------KD.HVQ---------LIKTMMEVGKSTLQKN-NVT...........------....DLE----------D
Q2H2H7_CHAGB/31-147..T-------TE.HLP---------LLYRFRHQSQIEIDRM-SME...........------.NPSRIP----------M
Q2H304_CHAGB/151-275..R-------KK.HIP---------WLRHMRAKFLDAATGV-YPS...........------...IERD----------Q
HINT3_BOVIN/47-162..K-------KD.QIE---------LIENMVTVGKAILERN-NFT...........------....DFE----------N
Q3IJU5_PSEHT/4-111..T-------PE.NSH---------LVGNLYVVAAKLAKQL-NFA...........------.DDGYRV----------V
Q4PA08_USTMA/46-158..T-------HN.HTE---------LVRQMQALGNKALDLV-STS...........------...NCAP----------E
Q54DF5_DICDI/36-141..T-------QK.DIP---------VLVEMKQVADQLIAEK-FPG...........------.....QS----------G
Y2839_DICDI/224-348..T-------PS.FIP---------MLEHMYNVADAIINEI-ISKDN........D------DDNLKKS----------D
Q59S51_CANAL/134-254..N-------DS.HID---------YLTNLQKIVKEVTVNK-Y.G...........------...IKPD----------Q
Q5TUI6_ANOGA/154-273..T-------AA.DLP---------LLRNVQTRGIAAIEKR-Y.G...........------...IGAS----------Q
A8XGQ1_CAEBR/148-267..T-------GD.DLE---------MLYNIRDKSLTAINEK-Y.G...........------...LQKD----------Q
Q6BZT0_YARLI/136-263..N-------HS.HIQ---------WLKELREDIYKVVKDK-Y.N...........------...VDRS----------F
Q6C515_YARLI/4-127FED-------DN.LYE---------KTRAMVEKVEKMVAVE-FIRTK........G------YSKDVK.----------.
Q6C6M8_YARLI/30-153..V-------PD.HVD---------WLQSMRNQVVNILPEI-YGI...........------..KMKSM----------Q
Q6CJA1_KLULA/160-286..R-------PE.HQQ---------WLIDMKNKIRSVVPSC-YNY...........------..LVPAD----------Q
Q6FLB9_CANGA/198-323..N-------SS.HQE---------WLKKLNTTLRTIVPAC-FNY...........------..SIRPD----------E
Q6FWT2_CANGA/170-296..K-------ME.DRD---------WLKNIYNKIRSIIPAC-YNY...........------..AVHPD----------E
Q6IIA4_DROME/5-118..N-------KS.HDS---------LVQLMENALKDLLVSK-GVS...........------.....VD----------D
Q74ZD1_ASHGO/153-277..R-------PE.HKE---------WLESIGKKIRAVVPGC-YNY...........------..SIRAE----------Q
Q7PHF8_ANOGA/7-116..S-------SD.DDG---------LLQNMYELGLKAV..G-TTG...........------...LTVD----------R
Q7QJM2_ANOGA/10-124..T-------AA.DKP---------LLEELKRELVNYMQSS-RGI...........------....DPS----------E
Q83DE2_COXBU/3-109..T-------PG.DED---------LLGHMVVVATRLAHDK-NMA...........------.ADGYRL----------V
Q84VV6_ARATH/7-121.RR-------DE.DYS---------LVRHMLSVGQQLLQKD-APQ...........------......S----------I
Q8GYJ9_ARATH/75-183..E-------PR.HVE---------VLGQLLHASKIVAEKE-GIL...........------..DGFRV----------V
Q8SUA2_ENCCU/116-232..R-------...DYQ---------ILVDAREKARNLLETR-FGL...........------....DFN----------H
Q97JJ3_CLOAB/3-110..N-------EE.NSK---------VIAHVFVVISKLAKEL-GID...........------.EDGFRV----------V
BH140_ARATH/717-833..R-------KE.NLQ---------LLQEMHNVGLKWVDRF-QNE...........------...DASL----------I
DCPS_SCHPO/141-261..K-------YK.HIP---------LLENIRNKVLTEVPKQ-F.S...........------...VDKN----------Q
E7KRX8_YEASL/160-281..R-------YS.DRQ---------WLINLNNKIRSIVPGC-YNY...........------..AVHPD----------E
E7KUH0_YEASL/160-281..N-------PN.HRD---------WLIRLNKKIKTIIPQH-YDY...........------..NVNPD----------E
F1R776_DANRE/159-276..T-------AE.HLT---------LLTNIRSKGEETIQKK-Y.G...........------...VPPS----------K
F7CC42_XENTR/161-276..N-------AD.HLP---------LLMNILEEGKEAILKR-Y.G...........------...ITGN----------K
H3C365_TETNG/54-161..Q-------TQ.HIP---------LVERMVEVARSVLEEN-KVH...........------....NSE----------D
H3CJX6_TETNG/127-244..T-------SE.HLP---------LLKNVFQKGKETIMQK-Y.............------..KLPAS----------K
H3DP42_TETNG/31-141..S-------KE.HVP---------LVQRMVELGKEILQKN-DVT...........------....DLS----------D
Q0JBF2_ORYSJ/25-136.RT-------TE.DHQ---------LVSHMLAVGRDLLNRD-AP............------....NSE----------E
Q5K774_CRYNJ/143-255..K-------VS.HIS---------LLKNIREKAAAEASKR-F.G...........------...VDAG----------N
Q9VQ59_DROME/32-141..N-------KS.HVG---------LVRRMEQGMMEFLRSQ-N.............------...VDPK----------E

PF01230

HINT1_RAT/24-121--DD....DDES-LLG---------HLMIVGKKCAADLGL.-.....................KRGYRM----------V
HNT2_YEAST/12-107--T.......MP-ESQ---------DYFKTLQLIHRFIKWQ-Y...................KADSINV----------A
FHIT_HUMAN/11-105--R.......PD-EVA---------DLFQTTQRVGTVVEKH-F...................HGTSLTF----------S
APH1_SCHPO/12-106--T.......PS-ELT---------DLFTSVRKVQQVIEKV-F...................SASASNI----------G
APTX_YEAST/15-139--KVIDAKFKNE-FES---------YVNSAIDHIFRHFQEK-FRIKKSDDDKDPCWDDILKDKNKFVRN----------F
Q9I500_PSEAE/74-166--D.......VD-DRQ---------ALWREATLLAEVLKDT-F...................R.....A----------D
Q98BM9_RHILO/14-106--T.......PL-DQA---------MLTFETNMVAQALKKV-S...................G.....C----------T
Y866_METJA/9-105--P.......DD-ELC---------NFIKGVKKTVEVLKKL-....................GFDGYNI----------V
YHIT_MYCPN/19-116--D.......DE-SLK---------AVSLLAKEMALKLQQR-L...................QPAGLNY----------V
APTX_SCHPO/44-156--E.........-IMM---------KHRSLVEKLVSYVQGD-LSGLIFDEA...RNCLSQQLTNEALCN----------Y
YHIT_HELPY/9-104--T.......PE-LMA---------QMTSFIFEVVEKLGI.-....................KEKGYKL----------L
HNT1_YEAST/32-125--P.......DE-FLT---------DAMPIAKRLAKAMK..-.....................LDTYNV----------L
Q9A2A9_CAUCR/9-106--T.......PA-ERA---------QLMEETIRAGSAVRAV-G...................ALLGLRI----------D
YHIT_SYNY3/12-109--TP....EDHA-LLG---------HLLLKAKEVAADLGI.-.....................GDQFRL----------V
Y1390_SYNE7/12-109--TA....EHQA-LLG---------HLLLTVKAIAAQEGL.-.....................TEGYRT----------V
YHI1_MYCLE/10-102--D.......PA-IFG---------RVIAVSQLIGKGVCRA-F...................NAERAGV----------I
Y961_HAEIN/12-110--TE....QDEV-ALG---------RLFSVAAKLAKEEGV.-....................AEDGYRL----------I
Q9JYE4_NEIMB/10-102--S.......AA-ERG---------ELMEMVYKVEAAMRQV-F...................R.....P----------A
Q9KQC5_VIBCH/14-106--P.......MD-EQQ---------QFLVESQLVCQTLETL-F...................S.....P----------D
ZB14_MAIZE/24-123--EE....RHIE-ILG---------YLLYVAKVVAKQEGL.-.....................EDGYRV----------V
HINT_CAEEL/28-125--VD....SDAA-LIG---------KLMVTASKVAKQLGM.-.....................ANGYRV----------V
G8AG53_AZOBR/16-114--SAR...ATEA-EIA---------GLFRAVGEVARGAGA.-....................AEPGYRI----------L
K7XM15_MYCHR/14-110--S.......DE-DLS---------YLIVKAREFALQEIKK-L...................GATGFKL----------L
YHI2_MYCTU/11-106--P.......PE-ALA---------DMVAIGQRIARAARAT-K...................LADATHI----------A
Q32EW3_SHIDS/12-109--SA....EHEQ-ALG---------RMITVAAKIAEQEGI.-....................AEDGYRL----------I

PF04677

C3H64_ARATH/370-491----------SP....---------EVESELSRYQNGLRNC.YKS------------------QGNDAV----------F
C19L1_CAEEL/309-429----------PV....---------EVRDEIEKFKSAFTLM.ANK------------------QGKALV----------T
C19L2_CAEEL/226-350----------DE....---------NVWDEMRLWRKGLVAV.WKS------------------QNRDCI----------F
C19L2_DROME/460-584----------DE....---------DAWEEISNFRKALTRM.FAA------------------RRQDVV----------F
CWF19_SCHPO/399-523----------DE....---------DEWDEIRNFMKCIALM.FDS------------------MNLGVI----------F
DRN1_YEAST/256-389----------NA....---------ELTQSILAYEASLVKMNYIK------------------FDMCTI----------V
MU161_SCHPO/334-470----------SDTSYE---------KTLNEMNRFRKAVTDM.YNA------------------CDSDAL----------V
Q93ZX4_ARATH/458-582----------DD....---------NVWDEIRNFKKCLIMM.YAK------------------EGKDAV----------F

PF02611

CDH_HELPY/24-243PST-------PN-FFY---------LSWQARDFMSKKYGQP----------------------IPDYAI----------S
G9AY12_PANAN/24-250PGR-------PD-YFG---------NAWLMRYQLMSQYGRP----------------------VPEDML----------G
Q8P9Z9_XANCP/30-250ADA-------PN-YFA---------SAWSARSFVASALAQP----------------------LPRAYV----------S
E8V0N7_TERSS/35-269PNA-------TN-YFA---------DAWQATALVDQRLHQT----------------------LPRTDL----------S
A8GL49_SERP5/45-264ATT-------PN-FFE---------QAWQARHFMADKYGKA----------------------IDDADI----------S
E0SJ94_DICD3/33-253AGT-------PA-YFA---------AAWSYRDRLSRQMGKP----------------------IGDDKL----------G
CDH_YERPE/33-252ATS-------PN-YFA---------DAWQARYFMAEKYGAP----------------------IDDTDI----------S
B8IMH8_METNO/37-256RPG-------TA-YWQ---------AALAARHYVTEALGGR----------------------LTAYDV----------G
W0LHA3_SERFO/26-254DGR-------TD-YFG---------YAWLMRNLLRFEYGKP----------------------VPDEML----------G
B1M455_METRJ/29-249PRG-------AA-YWR---------AALAARPLVSDALKGR----------------------LTPAEV----------G
Q1LBK3_RALME/33-250DRE-------HN-AWA---------FGWAARDIVGKAIGRA----------------------LPDTLL----------G
Q6MQF2_BDEBA/30-256ADA-------TN-YFD---------LAWKARSYMEKKHGSA----------------------IPVEAV----------S
G8MBN7_9BURK/67-288PNA-------PN-YFR---------DAWNARGYVNRALRRT----------------------LPRDEV----------S
A6TFQ8_KLEP7/24-243PLT-------PN-FFW---------QAWQGREIMSQRHGAP----------------------VPDNAV----------S
H2INV4_RAHAC/31-250PST-------PN-FFS---------QAWNARHFMADKYGKP----------------------IDDSNV----------S
B0U7T2_METS4/29-248STG-------NA-YWR---------AALTARSTVTEVLKGE----------------------LPIDDV----------G
B2VF57_ERWT9/34-251PAT-------PN-FFA---------EAWRARHFMEEKWGKR----------------------IDDGIY----------S
B9JRW8_AGRVS/27-242DKT-------PN-FFA---------DAWNERAAVDAKLPHP----------------------LSRDAL----------S
D8IW24_HERSS/34-253PQA-------PN-YWA---------YAWQQRARVAQTLGRA----------------------LSDEQL----------G
C5BB31_EDWI9/31-247PAT-------PN-YMA---------LAWYSRPLLSQRYGQP----------------------IADSRL----------S
A9HJU4_GLUDA/35-256PAA-------PD-YFG---------AAWHQVDRSLARLGHT----------------------MPRETM----------A
B2JLJ5_BURP8/29-246ADA-------PD-YWA---------DAWAARQYVGSRIGLT----------------------FPPNQL----------G
B1LSY8_METRJ/26-246PRG-------AA-YWR---------AALAARHYVSDALQGR----------------------LPASAV----------G
L0IYV5_MYCSM/29-248PDA-------PN-FFA---------AAWDARSFVNARAGID----------------------IPRDWM----------S
B8IPC5_METNO/27-247AQG-------FA-YWR---------AALDSRRYIVDALKSR----------------------LPLSDV----------A
B2FII5_STRMK/27-247RGA-------PN-YFA---------AAWQARSHTEQALRQP----------------------LPRNVA----------S
CDH_CROS8/31-250DNT-------PN-FFW---------QAWQARRWMSEKRGSP----------------------VPDSAV----------S
B8EQB5_METSB/40-259GEL-------PN-YWI---------PAWATRKLVADNAKKE----------------------LARDDI----------A
B2HIW3_MYCMM/43-260PST-------GK-YLY---------EAWADRFAVTARLNNA----------------------LPESHL----------V
W0HRX4_9ENTR/35-254TST-------PN-FFY---------LAWQARHFLSDRRGQA----------------------IGDRFL----------S
E6WAG7_PANSA/33-250PAT-------PN-LFA---------DAWRERGLLAQRRGKP----------------------IEDSVL----------S
B1M8V7_METRJ/69-294PGT-------TN-YFA---------KAWRARTFVEGRLGHP----------------------LDRRDV----------S
D8MKK8_ERWBE/33-250PAT-------PN-FFA---------EAWRSRHFMEEKRGAP----------------------IDDSAY----------A
G2I2H3_GLUMN/36-254KDA-------PD-YFA---------YAWKQTERVNRHLAHP----------------------LPMDDM----------T
Q6D6W9_PECAS/32-251QNT-------PN-FFM---------QAWDRRGHLSREAGKP----------------------IKDDYI----------S
D2UA62_XANAP/30-247RET-------PN-YFW---------LAWRARGALSELLGKA----------------------VPDTAV----------A
CDH_MYCLE/38-255LAS-------PN-YLY---------NAWAARGFVSSRLNNS----------------------LPEPDI----------F
Q13LU5_BURXL/41-259PHA-------QD-YWV---------DAWNARTYVEKSVKRT----------------------LPDNQL----------G
Q7NQ26_CHRVO/27-251DGV-------PA-YWR---------AAWQARRYLDARRGQP----------------------LPRLAL----------S
K7SS21_GLUOY/32-232AET-------PN-YFA---------EAWAERQRVPAGYGFP----------------------VPDEHL----------S
R9VP92_9ENTR/32-251PTT-------PN-FFW---------QAWQSRDVMSKLRGST----------------------VPDNAI----------S
Q0JZ98_CUPNH/25-246GAG-------AN-PWA---------FGWAARGIVGRSLGKA----------------------VPDDML----------G
H8L0L3_FRAAD/32-259PQA-------HN-FLA---------DAWALRDQVSAAADAA----------------------LPRQAF----------G
CDH_ECOLI/31-250PST-------PN-FFW---------LAWQARDFMSKKYGQP----------------------VPDRAV----------S
Q5FPM0_GLUOX/32-232PET-------PN-YFA---------EAWAERGHVAQSYGFE----------------------IPDAHL----------S
W0PFV2_9BURK/44-257ASR-------TP-YFA---------QAWHARDYMDRLLGKA----------------------IPVQEY----------A
I2BEE8_SHIBC/29-247LDT-------AN-FFW---------LAWQARGLLSERYGQP----------------------IPDSAL----------S
CDH_MYCTU/41-258SAG-------RN-YLY---------DAWAARFLVTARLNNS----------------------LPESDV----------V
U3U143_9ENTR/33-250PTT-------PN-LFA---------AAWQQRRLLAQKRSAP----------------------VDDRVL----------S
D5CGT2_ENTCC/45-264PQT-------PN-FFW---------LAWQARSFMSMKHGSE----------------------VPDSAI----------S

PF02744

GAL7_CRYNJ/204-373..........EQTGLAT........ILKDVLSRYDNLFS......------------------...CPF----------P
GAL7_HAEIN/183-348..........QSKDLAV........ILKKLTTKYDNLFE......------------------...TSF----------P
GALT_STRMU/231-435IRLAWRNYSDDTMNILAFTGDTPHHTVTPIARKRDGQFELDIVLR------------------DNHTTA----------E
GALT_BACSU/240-451IFRTWQTYSDEKAGIAAYTGDTPHNTVTPIARRRGDLYELDIVLR------------------NNRTDE----------E
GAL7_YEAST/198-366..........VKEDLAS........ILKQLTIKYDNLFE......------------------...TSF----------P
GAL7_KLULA/195-363..........EREDLAS........IIRNLTIRYDNLFE......------------------...TSF----------P
GAL7_ECOLI/182-347..........QRSDLAL........ALKKLTSRYDNLFQ......------------------...CSF----------P
GALT_HUMAN/202-370..........ERDDLAS........IMKKLLTKYDNLFE......------------------...TSF----------P

PF16285

D5DD06_BACMD/8-254FEGVTIAQNEHVTFN-------LSVKPRMGF----------FEFNVITDQLDKELHA-------FAD-------------
C0ZAZ1_BREBN/8-252FIGMTIDQEAGVECN-------LSTHPRAGF----------FEYNVILSDFDR.LPK-------MAD-------------
B2TPI8_CLOBB/11-256FEGIEIFKSECCEVN-------LSTKPINGF----------SEFNVIINDDLKNTFS-------LSE-------------
C9LU44_SELS3/8-252FEGLTIHEKNDVDFN-------IATCPRIGF----------SEFNVVPKTNEP.LDT-------VAD-------------
D9SRU9_CLOC7/9-253FEGLTIYETNGCVLN-------LSSKPKASF----------TEFNIIIDDLSF.LDI-------MAD-------------
Q81VH8_BACAN/8-251FQGVIVQKNKNIELN-------ISDRPIIGF----------TEFNIIVKDIEC.IDE-------MAN-------------
U5LFA6_9BACI/8-252FEGLAISQKGRSLLN-------ISTAPKIGF----------YEFNAKLGDMEE.IGA-------FAA-------------

PF01087

GAL7_CRYNJ/15-198FQSEPVRGRCKVICF-------HPRHDLTMAAMRI......SEINHVLDGWKDVYAEEG...KIMQE.............
Q7QA38_ANOGA/1-174FQIAPAQGTCRVMCF-------HPKSNKTLPLMTP......KEIRNVIDAWIAEFRT.......LAQ.............
A5DRG5_PICGU/6-197MHVQGVKGQCFVICF-------SPNHSLTLPLMTN......QQIGKVVDTWQKLYLD.......TQSDS...........
Q9CM11_PASMU/4-178FQISKAQGESRVICF-------SPDHSKTLPLLTV......EEIHDVIKVWQEQLLE.......LGQ.............
Q2H1V5_CHAGB/2-211LRAQPVTGRCYVLTF-------SPKHDITLADMTA......AEILPVIQTWTRIYASHLSTTSPLKVQADKILATIP...
A4AQM0_MARSH/1-176LYAESESGICKVVCF-------SPDHSLTLPLMST......EEIADVISLWQQEYKE.......LGE.............
Q65CW7_BACLD/17-231YQMDTPYGTMDITIN-------LSKPE..............KDPEQIKRE...RAAA.......KQS.............
A9WJH8_CHLAA/4-191LHAEAERGICRVVCF-------SPRHDLTLAQMSQ......AEVRRVVDVWVDQYNE.......LGA.............
A7MIY8_CROS8/2-176MRLESARGTSRVICF-------SPDHSKTLPELTL......PALEEVVNTWQTQTAE.......LGK.............
Q03XA5_LEUMM/18-235YPVDTQYGTLQITIN-------LSKPE..............KDPKAIAAALKNKNQQ.........Q.............
A3N102_ACTP2/3-177FQISHTQGESRVICF-------SPDHSKTLPQLSV......AEIEQVVQVWQEQANE.......LKT.............
GALT_STRMU/16-225FTTSSVYGDIDITIN-------LSKPE..............KDPKAIAAA...KLAK.........T.............
A5DWA9_LODEL/21-211FKTQGVKGNCFVICF-------SPKHNLTLPLMSL......EELSQVVQTWQNLYND.......LLQDS...........
Q6D2C5_PECAS/1-175FRVQQARGVSRVICF-------SPDHSKSLPQLSL......SALKAVIDTWSEQTAE.......LGK.............
Q1IQZ6_KORVE/1-177LIAQSERGICRVLCF-------SPRHDLTLSRMDP......PAIRTVVDLWSQQYVE.......LGG.............
Q6LQE3_PHOPR/15-189FRSESARGLSRVVCF-------SPDHSKTLPELSV......PAIRSVVDTWNEQIEE.......LGQ.............
A8LEI8_FRASN/19-211LRAEPETGVCRVLCF-------GPWHDRHLAAMGD......GELAAVVDLWIGQAAE.......LGR.............
Q59VY3_CANAL/21-210LQTQGVRGKCFVICF-------SPKHNLTLPLMKD......GEINNVVNAWQDLYGN.......LLQES...........
A1L2D1_DANRE/7-181FQSKAARGVCKVMCF-------HPWSDITLPLMQP......AEIRKVIDKWADLTVE.......LGA.............
A7F8S7_SCLS1/1-208LRAEPVTGKCYVLTF-------SPSHNLTLADLTP......AQILPVIQTWTEIYAAHLSPSSPLASVAQPTTLA.....
Q3XZ93_ENTFC/18-230FPAESEYGELEITIN-------LSKPE..............KDPKQIAAE...REAV.........K.............
B1YII0_EXIS2/18-230YQADTVYGEIDITIN-------LSKPE..............KDPREIAAA...QTEI........VE.............
Q0RE52_FRAAA/14-191LRSAPAHGTCRVVCF-------GPHHGRGLVDMSS......YEVRAVVDTWAAQEAE.......LSE.............
Q21LR9_SACD2/5-180FVTQPVSGTARVICF-------SPDHSRSLPLLSI......EELNAVVSCWQEQLTE.......LKE.............
GALT_STACT/19-233YYTETEYGDLEITIN-------LSKPE..............KDAKEIAKA...REAK.........Q.............
GALT_LACPL/16-224FPAKTPFGDLEITIN-------LSKPE..............KDPKAIAAA...RNQP.........Q.............
A8WVF3_CAEBR/2-179FKQQEVRGVCRVICY-------HPDSQKTLAQMSL......EEIRTVINLWHQQYVE.......LCP.............
A2AMS2_MOUSE/3-177FRAEAARGVCKVMCF-------HPWSDVTLPLMSV......PEIRAVIDAWASVTEE.......LGA.............
GAL7_NEUCR/2-217LQAQPATGRCYVLTF-------SAKHDTTLADMSA......TEIVPVIETWTRIYASHLSASHPLRDAAARSLSEIP...
A7TJY6_VANPO/4-190FKVQSVKGNCFVICF-------SPKHNLTIPQMKV......DELVGVVNAWQSLYNT.......LDQER...........
A6RBX1_AJECN/45-253LQAEPVTGRCYVLTF-------SASHNRTLADLSP......AEIKPIIDAWTDLYISHLSPTSLLAATASLMPISP....
GAL7_KLULA/1-189FKLKGVKGNCYVICF-------SPKHNLSFPQMAQ......SEIMNVVKTWTNLFQT.......LEKEA...........
Q5KY03_GEOKA/19-233WKVSTIYGELDITIN-------LAKPE..............KDPKEIAKL...KEMP.........S.............
Q03PB0_LACBA/18-226FPAKTPAGELEITIN-------LSKPE..............KDPKAIAAA...LTQK.........K.............
A2QCH5_ASPNC/2-209LKAEPVTGKCYVLTF-------SAAHNLTLADLSP......AEIVPVIDAWTEIYTAHLSPKSPLAAVAPATTLPP....
A6WF46_KINRD/10-216WPTRPAAGRCEVVCF-------SSDTRGSFGTLDP......RRARTVLEAWIDRTET.......LNA.............
Q2J7D6_FRASC/3-201LRSEPARGTCRVVCF-------GPRHDRGLVDMTP......AEVRAVVDTWAAQEEE.......LSR.............
A3QFA6_SHELP/9-182FRFETVEGESRVLCF-------SPDHSLTLAQLDP......EAMQAVIAAWQSQSEL.......LGK.............
GALT_BACHD/21-236WFSETPYGQLEITIN-------LSKPE..............KDPKAIAQA...KHLQ.........A.............
Q5WD06_BACSK/20-235WLAPTPYGDLEITIN-------LSKPE..............KDPVAIAAA...KKVA.........P.............
A0QYK5_MYCS2/3-199FLSAPGHGRCEVICF-------SSDHTGAFSQLPL......PHARLVVSAWRHRTAD.......LLS.............
GALT_LACSS/20-231YDVPTKYGDLEITIN-------LSKPE..............KDPKQIALA...KTMK.........Q.............
Q896X9_CLOTE/19-233WKHDTDYGDMEITIN-------LSKPE..............KDSKDIAKA...KNVP.........Q.............
GALT_DROME/1-175FQIAPARGNCRVMCF-------HPKSNLTLPTMSA......AEIVVVIDEWISQFNE.......LSA.............
GAL7_SCHPO/4-195FKTEGVKGKCFVICF-------CPNHNLTLPLMSA......EAICNVVETWKHLYVT.......LKKES...........
B8I4V5_CLOCE/19-234WTSDSKYGQLEITIN-------LTKPE..............KDPKTIAME...RMQP.........K.............
A3LR66_PICST/19-206LKTQGVKGKCFVICF-------SPNHSLTLPVMSI......PEITNVVEAWTSLYNS.......LQREA...........
Q7N8Y8_PHOLL/4-178FKAQGVRGLSRVICF-------SPDHSKTLPELPV......KHIRQLIDTWNEHIEI.......LGK.............
Q73SK2_MYCPA/2-203FVSAPAHGRCEVVCF-------SADHTGSFAGLPP......AHARLVVQAWRHRTAE.......LMD.............
A8FIP9_BACP2/20-233WFTPTDDGVLEITIN-------LSKPE..............KDPKAIAQA...KKLS.........Q.............
Q3IH81_PSEHT/3-176FKMATEQGESRVICF-------SPDHSKTLPQLSI......SAITDIVKTWQSQCLE.......LGE.............
A0M3B7_GRAFK/1-176LKAESEKGICKVVCF-------SPDHSLTLPLMEV......EDITRVVKMWKKEYKE.......LGA.............
A5FKW9_FLAJ1/2-179FKAEPEQGISRVVCF-------SPRHDLTLPEMEV......SDIENIVKTWQKEYAE.......LGS.............
Q4PDD8_USTMA/31-214LQSQPARGRCYVICF-------NPQHNLTLAQLSTPPFSPDQHIVPIIRSWQKIYKQ.......IPA.............
Q15Y61_PSEA6/2-176FTVEAARGTSRVICF-------SPAHNKSLPELPL......PALEKVVQTWRDQVAE.......LSK.............
Q6C0K3_YARLI/1-190LRKEDVFGYCQVICF-------SPKHNVTLATMTV......EQIEKVIETWQKMYTE........AQ.............
Q6BVI6_DEBHA/3-194FKTQGVKGKCFVICF-------SPNHNLTLPLMSV......EDITSVIQSWRSLYKD.......LQKEA...........
Q2GAY3_NOVAD/2-175FRVAEARGTARVICY-------SPDHSKTMPDMDV......AAIRSLVNCWAQESET.......LGA.............
GALT_CLOAB/17-229WKTPTEYGDLDITIN-------LSKPE..............KDPRDIAKA...KLSK.........S.............
GALT_ENTFA/20-232FPMDSPYGKLEITIN-------LSKPE..............KDARKILAE...KKMS.........Q.............
Q30V51_DESAG/2-182FAARPETGICRVVCY-------SPRHDLTMARMQP......AQAEAVITAWQQEYAA.......LCS.............
A9KN46_CLOPH/31-257WITKTEYGDLDITIN-------LSKPE..............KDPKAIAAL...LHVA.........N.............
GALT_LACS1/18-228FPVETSYGQLEITIN-------LSKPE..............KDPKQIALA...KKMK.........A.............
A0KQH7_AERHH/2-174LKLEAARGTSRVICF-------SPDHGKTLPELPL......PAIEQVITTWMEQVAE.......LSA.............
A4VT89_STRSY/18-226YPVSTEYGDLEITIN-------LSKPE..............KDPKSIAAA...TKAE.........A.............
A5VME1_LACRD/16-220FDKPTKYGNLEITIN-------LSKPE..............KDPKAIAAA...AHDT.........A.............
E7KK61_YEASL/5-192LKVQSVRGNCFVICF-------SPNHNLTIPQMKQ......SDLVHIVNSWQALTDD.......LSREA...........
G0RTP4_HYPJQ/7-208LRAQGVKGVCYVLTF-------SPKHNVTLADMSA......KDILPTINHWTRLYAN......HL.SPSNPLSAVAAQLQ
Q04GZ3_OENOB/18-225FPVKSDYGDLEITIN-------LSKPE..............KDPKAIAAA...AKQK........NR.............
Q5KLY2_CRYNJ/11-195FASEPIRGRCKVICF-------HPKHDLTIARMNV......DDVVRVIGEWKNVYVEEG...RMLQE.............
GALT_STRT2/18-226YKAPTKYGDLEITIN-------LSKPE..............KDPKAIAAA...KNAV.........A.............
Q5NEY1_FRATT/11-180FQLSGATGIAKVICF-------SAKHNLTMASMQQ......KDIVKVVDLWASEVTE.......LSK.............
Q7MBX0_VIBVY/28-200FQLHSAKGESRVICF-------SPDHSRTLPELAQ......EEIEQVITTWMTQTEE.......LGQ.............
GALT2_STRR6/16-224YRVPSDYGELEITIN-------LSKPE..............KDPKEIAVA...KLVQ.........A.............
GALT1_STRR6/18-225FRASTKYGELEITIN-------LSKPE..............KDPKTIAAE...KLVK.........A.............
GALT_CLOPE/21-230FKAPSKYGTMDITIN-------LSKPE..............KDPKEIALA...RNSV.........K.............
GALT_LACLA/19-228FSHLTKYGKLEITIN-------LSKPE..............KDPKAIAAA...KLVK.........A.............
U5L509_9BACI/19-230YKIATDYGELDITIN-------LSKPE..............KDPQQIARE...REMK.......VVS.............

PF16268

F5XH95_MICPN/8-422LSGDPQLYQHAVLDL-------AVKEHLVVAA---------NDHAIALAGVGHRYPSLEVYSTSLHQLPWEQSVAERASM
C3PH27_CORA7/1-419LRAHPNMYNDWAVGY-------AAKRNLVIAE---------NDYAVLFAGFGHRYPTLEIFSKSPRCEPWDQNPDEVRGM
B1VH78_CORU7/18-447VRNNPNMYNEWAVDY-------AARHNLVFAE---------NEHAIAFAGFGHRWPTLEVFSKSATTEPWLMTPEERAGV
Q8NNU9_CORGL/1-424LRGNPNMYNELAVDY-------AGYHNLIIAE---------NDHAVAFAGFGHRYPTIEIYSKSAIPEPWLQSDEEIQAM
W5WQ34_9CORY/18-447VRSNPNMYNEWAVDY-------ASRHNLVFAE---------NDHAVAFAGFGHRWPTLEVFSKSATTEPWLMSAEERDGV
W5Y1J6_9CORY/15-448LRSNPNMYNEWAVDY-------AATQNLIIAE---------NDHAVMFAGFGHRYPTLEIFSTSSTAEPWKQTPEEVRGM
G0HAG7_CORVD/18-449VRSNPNMYNEWAVDY-------AGHHNLIFAE---------NDHAIAFAGFGHRGPTLEVFSKSATTEPWLMKDEERDAV
U3GXR8_9CORY/26-464LRHNPNMYNEWAVDY-------AGYHNLVIAE---------NDHAVCFAGFGHRYPTLEIFSKSACGFPWEQSDEERDAM
Q6NGG7_CORDI/11-432LRNYPNMYNEWAVDY-------AGQRNLIIAE---------NDHAVCFAGFGHRYPTLEVFSRSATPEPWLQTNEEIKAM
S5SVS2_9CORY/15-437LRRNPNMYNEWAVDY-------AGYHNLTIAE---------NDHAVMVAGVGHRFPTLEIYSKSPTPEPWLQTQEEIRAM
B3QVF6_CHLT3/10-436VRDNPNIFNEYGPNF-------AIHHNLVFAE---------NNYAIAYAAIGHRYPTIAIYSKSNHPRPQEHSDEEIRGV
Q6A5P1_PROAC/10-435AVLDPGIFNRWGPDF-------AVEHGLVLAC---------NDGAVMTVGFGHRYPSVEVWSTSRVDQPWRVDDEGIDAV
Q8FP08_COREF/15-438LRHNPNMYNEWGVDY-------AGYHNLIIAE---------NDHAVAFAGFGHRYPTLEIYSRSPVSEPWLQSGEEVRAM
F8E0G1_CORRG/18-447VRSNPNMYNEWAVDY-------AARHNLIIAE---------NEHAIAFAGFGHRWPTLEVFSKSGTTEPWLMSDAERDAV
C5CBF5_MICLC/33-463LREDPQVFNHAALDV-------AVAHDLVIAA---------NEHAVMFAGFGHRYPTVEVYSTSPVGQPWRQSAAELRAL
I6XY80_PROPF/27-452LRQDPNLFNEVGPNY-------AGYHNLIVAE---------NDHAVAFAGFGHRYPTLEIYSCSEFSDPWEQTAEEVRGM
R5PXK8_9PROT/14-442ARENPNIYNDFAVNY-------AGYQNLIFAE---------NDYAVAFADFGHRYPTLSIYSKAEKNQPWNQTPEQIRGM
D7BLX6_ARCHD/14-437VRQNPNLYNEAAVDY-------AGYHNLVLAE---------NRHAVAIAGFGHRYPTLEVWSKSPVCQPWEHSDDERRGM
D9QB86_CORP2/15-442LRQNPNMYNEWAVDF-------AAMHNLVIAE---------NDHAICFAGFGHRFPTLEVFSKSAVSEPWLQSSEEIRDM
X5DSS5_9CORY/40-471VRANPNMYNQWAVDY-------AGHHNLIVAE---------NDHAIAFAGFGHRWPTLEVFSRSGTTEPWLISDDERDAM
M1P829_9CORY/11-432LRRNPNLYNEWAVDY-------AGYRNLIIAE---------NDHAICFAGFGHRFPTLEVYSKSRQPHPWLQSEEEVRGM
D7GCR7_PROFC/13-438LRSNPNIYNDLLLGT-------AVQHNLVIAE---------NDSAIVFAGFGHRYPTLEIYSKSATCEPWNQSDKELDDM
D7WEZ1_9CORY/10-431LRQNPNIYNEWGINY-------ASYHNLIIAE---------NDHAVMTAGIGHRYPTMNIYSKSATPEPWLQTADEVRGM
C8XCI8_NAKMY/35-455ARANPNVYNEFAVDY-------AAQHNLTVTE---------NDHAVAFAGFGHRYPTLEIFSRSERPQPWLHSTTELRGM
C4LIB0_CORK4/15-440LRSNPNMYNEWAVDY-------AGYHNLVIAE---------NTHAIAFAGFGHRYPTIEIYSRSATCEPWKLSEEEMRDM
K7RWS7_PROA4/29-464VAADPAMFNQWGPDF-------AIDHNLVLAA---------NDHAVAFVGFGHRYPTVEVWSTSARDQPWKMTTEEVDAV
D6ZJH6_MOBCV/17-441VAADPAIYRRI.LHY-------VTHRQMMILG---------NDYAVGFADFGHRYQTIAVWPLGPALLPWEYTREQVDGI

PF11969

Q5TVU2_ANOGA/17-126FNFGYHLKP..HMKR-------LHLHVISKD-------------------------------------------------
A5DAJ7_PICGU/3-137IRAGVHAAP..SLAN-------FHIHVISQD-------------------------------------------------
A5DAR3_PICGU/136-257LRIFIHYQP..SYYH-------FHIHVVNIT-------------------------------------------------
Q293N2_DROPS/5-112FKVGFHAEP..SLER-------VHLHVISQD-------------------------------------------------
Q293N2_DROPS/220-329FRIGFKADP..FWDR-------LNMHVISDD-------------------------------------------------
Q297L1_DROPS/153-272LRMYFHYQP..SFYH-------LHVHINPIR-------------------------------------------------
Q29LN6_DROPS/45-159AIIGFHIPPFISVKH-------LHLHGIYPP-------------------------------------------------
HINT3_RAT/40-155VRMGFHVPPFCSVSH-------LHLHVIAPA-------------------------------------------------
A0EGQ1_PARTE/118-231VKVFVHYLP..SFYH-------FHVHFTHSS-------------------------------------------------
A1CEC1_ASPCL/149-272LKLYVHYQP..TYYH-------FHIHVVNVM-------------------------------------------------
A3DF72_CLOTH/3-110TNCGVAAGQ..TVFH-------LHYHLLG..-------------------------------------------------
A3LWH2_PICST/136-257LRIFIHYQP..SYYH-------FHLHIVNVK-------------------------------------------------
A4S248_OSTLU/99-229MRVFVHYPP..QFYH-------FHVHYQALS-------------------------------------------------
APTX_DROME/4-113FNVGFHAEP..SMQR-------LHLHVISKD-------------------------------------------------
APTX_DROME/229-339FLIGFKVNT..FWNR-------LNLHVISND-------------------------------------------------
A4XKP5_CALS8/3-110VNCGEDGGQ..TVNH-------LHFHLLG..-------------------------------------------------
A5D7U9_BOVIN/174-293LRVYLHYLP..SYYH-------LHVHFTALG-------------------------------------------------
A5E770_LODEL/177-298LRIFVHYQP..SYYH-------FHIHVVTVK-------------------------------------------------
A5GQU3_SYNR3/125-230INTGAEAGQ..TVFH-------LHVHVIG..-------------------------------------------------
A5I635_CLOBH/3-110SNCGESAGQ..TVFH-------IHFHLIA..-------------------------------------------------
A6QUC5_AJECN/141-262LKLYLHYQP..TYYH-------LHIHVVNIM-------------------------------------------------
A6VZM3_MARMS/2-109MNCNEMGGQ..TVYH-------IHMHVLG..-------------------------------------------------
A7HMY4_FERNB/3-108QNNGKDAGQ..EVHH-------IHFHIIG..-------------------------------------------------
A7S614_NEMVE/151-270LRIYVHYQP..SYYH-------FHVHFTHLK-------------------------------------------------
A7SFV5_NEMVE/10-122TVIGFHWPPFNSIQH-------LHLHVISDA-------------------------------------------------
A7TKH2_VANPO/142-261LRIFIHYQP..SYYH-------FHIHIVNIK-------------------------------------------------
A7TQ97_VANPO/171-297LRIFVHYQP..SYYY-------FHIHIVNIK-------------------------------------------------
YHIT_CHLTR/2-108VNNGLEGGQ..SVFH-------LHIHLLG..-------------------------------------------------
APTX_CHICK/142-252FRLGYHAIP..SMSQ-------LHLHVISQD-------------------------------------------------
APTX_DANRE/150-260FRLGYHAIP..SMSH-------VHLHVISQD-------------------------------------------------
APTX_XENTR/173-283FQLGYHAIP..SMSH-------VHLHVISQD-------------------------------------------------
APTX_CIOIN/206-317FRFGYHAVA..SMSQ-------MHMHVISQD-------------------------------------------------
Q0U2I6_PHANO/148-269LKLYVHYQP..TYYH-------FHIHIVHVA-------------------------------------------------
Q15X15_PSEA6/3-110MNCNEYGGQ..TVYH-------IHLHVLA..-------------------------------------------------
Q16F07_AEDAE/8-123FAMGFHMRP..SMHR-------LHLHVISKD-------------------------------------------------
Q16XY1_AEDAE/224-343LRVYLHYQP..SFYH-------LHVHFTYLK-------------------------------------------------
Q16YN6_AEDAE/11-125VLFGFHVPPFTTVKH-------LHMHGMGPV-------------------------------------------------
Q18227_CAEEL/10-129LRIGFHLPPLLSVHH-------LHMHIIYPI-------------------------------------------------
Q1CY35_MYXXD/3-112MNTHAHAGQ..TVFH-------IHLHLLA..-------------------------------------------------
Q1QZ40_CHRSD/2-109MNCNDHGGQ..SVYH-------IHMHLMG..-------------------------------------------------
HINT3_XENTR/18-132IRLGFHYPPFCSISH-------LHLHVLAPA-------------------------------------------------
Q2H2H7_CHAGB/31-147FMTGFHTIP..SLFP-------LHCHVQDWS-------------------------------------------------
Q2H304_CHAGB/151-275LKLYVHYQP..TYYH-------LHIHIVHVA-------------------------------------------------
HINT3_BOVIN/47-162TRMGFHVSPFCSIAH-------LHLHVLAPA-------------------------------------------------
Q3IJU5_PSEHT/4-111MNCNEHGGQ..TVYH-------IHLHMLA..-------------------------------------------------
Q4PA08_USTMA/46-158RRFGFHIPPIRSVDH-------LHLHCLELP-------------------------------------------------
Q54DF5_DICDI/36-141IVLGFHSPPFYSVKH-------LHLHLLVPP-------------------------------------------------
Y2839_DICDI/224-348FKLGFHAIP..SMKR-------LHLHIISND-------------------------------------------------
Q59S51_CANAL/134-254LRVFLHYQP..SYYH-------FHLHIVNVQ-------------------------------------------------
Q5TUI6_ANOGA/154-273LRIYLHYQP..TFYH-------LHMHFTYLR-------------------------------------------------
A8XGQ1_CAEBR/148-267IKCYFHYQP..SFYH-------LHVHFINLK-------------------------------------------------
Q6BZT0_YARLI/136-263LRVFVHYQP..SYYH-------LHVHVVHIN-------------------------------------------------
Q6C515_YARLI/4-127IQSGIHSVP..SMNH-------VHVHVMTTD-------------------------------------------------
Q6C6M8_YARLI/30-153PVLYVPYPP..GKYH-------FHFLIREKS-------------------------------------------------
Q6CJA1_KLULA/160-286LRLFIHYQP..SYYH-------FHIHIVNVR-------------------------------------------------
Q6FLB9_CANGA/198-323LRIFVHYHP..SFYH-------FHVHIVNVK-------------------------------------------------
Q6FWT2_CANGA/170-296LRVFIHYQP..SYYH-------FHIHIVNIK-------------------------------------------------
Q6IIA4_DROME/5-118ALFGFHLPPFITVKH-------LHMHAISPR-------------------------------------------------
Q74ZD1_ASHGO/153-277LRLYVHYQP..SYYH-------FHIHIVNVR-------------------------------------------------
Q7PHF8_ANOGA/7-116FDFGYHMKP..SMRR-------LHLHVISKD-------------------------------------------------
Q7QJM2_ANOGA/10-124ASFGFHIPPFTSVKH-------LHMHAIAPV-------------------------------------------------
Q83DE2_COXBU/3-109MNCNRNGGQ..AVFH-------IHLHLLG..-------------------------------------------------
Q84VV6_ARATH/7-121HRFGFHQPPFNSVDH-------LHLHCFALP-------------------------------------------------
Q8GYJ9_ARATH/75-183INNGVEACQ..SVYH-------LHLHVLG..-------------------------------------------------
Q8SUA2_ENCCU/116-232VFMFFHYRP..TYFR-------LHLHVMNIK-------------------------------------------------
Q97JJ3_CLOAB/3-110SNCGEAAGQ..TVHH-------VHFHLLG..-------------------------------------------------
BH140_ARATH/717-833FRLGYHSVP..SMRQ-------LHLHVISQD-------------------------------------------------
DCPS_SCHPO/141-261LKMFVHYLP..SYYH-------LHVHILHVD-------------------------------------------------
E7KRX8_YEASL/160-281LRILVHYQP..SYYH-------FHIHIVNIK-------------------------------------------------
E7KUH0_YEASL/160-281LRVFIHYQP..SYYH-------FHVHIVNIR-------------------------------------------------
F1R776_DANRE/159-276LRVYFHYQP..SYYH-------LHVHFTAVE-------------------------------------------------
F7CC42_XENTR/161-276LRIYLHYQP..SYYH-------LHVHFTVLG-------------------------------------------------
H3C365_TETNG/54-161NRMGFHLPPFTSVPH-------LHLHVLCPA-------------------------------------------------
H3CJX6_TETNG/127-244LRVYLHYQP..SYYH-------LHVHFTMLG-------------------------------------------------
H3DP42_TETNG/31-141ARFGFHWPPFCSVTH-------LHLHVLAPA-------------------------------------------------
Q0JBF2_ORYSJ/25-136QRFGFHQPPFNSVDH-------LHLHCLALP-------------------------------------------------
Q5K774_CRYNJ/143-255LRLFVHYHP..TYYH-------FHVHIVHIR-------------------------------------------------
Q9VQ59_DROME/32-141AIVGFHLPPFISVRH-------LHLHGIFPP-------------------------------------------------

PF01230

HINT1_RAT/24-121VNEGADGGQ--SVYH-------IHLHVLGGR-------------------------------------------------
HNT2_YEAST/12-107IQDGPEAGQ--SVPH-------LHTHIIPRY-------------------------------------------------
FHIT_HUMAN/11-105MQDGPEAGQ--TVKH-------VHVHVLPRK-------------------------------------------------
APH1_SCHPO/12-106IQDGVDAGQ--TVPH-------VHVHIIPRK-------------------------------------------------
APTX_YEAST/15-139VQVGIHSVP--SMAN-------LHIHVISKD-------------------------------------------------
Q9I500_PSEAE/74-166KMNVANLGN--VVSQ-------LHMHVIVRR-------------------------------------------------
Q98BM9_RHILO/14-106KINTGALGN--IVRQ-------LHIHIVARS-------------------------------------------------
Y866_METJA/9-105NNNGRVAGQ--EVNH-------VHFHIIPRY-------------------------------------------------
YHIT_MYCPN/19-116VNEGAKAGQ--EVFH-------YHMHVVPKY-------------------------------------------------
APTX_SCHPO/44-156IKVGFHAGP--SMNN-------LHLHIMTLD-------------------------------------------------
YHIT_HELPY/9-104TNVGKNAGQ--EVMH-------LHFHILSGD-------------------------------------------------
HNT1_YEAST/32-125QNNGKIAHQ--EVDH-------VHFHLIPKR-------------------------------------------------
Q9A2A9_CAUCR/9-106KLNIGALGN--VTAQ-------LHVHVVGRR-------------------------------------------------
YHIT_SYNY3/12-109INNGAEVGQ--TVFH-------LHLHILGGR-------------------------------------------------
Y1390_SYNE7/12-109INTGPAGGQ--TVYH-------LHIHLLGGR-------------------------------------------------
YHI1_MYCLE/10-102I.....AGF--EVPH-------LHIHVFPTH-------------------------------------------------
Y961_HAEIN/12-110VNCNKHGGQ--EVFH-------LHMHLVGGE-------------------------------------------------
Q9JYE4_NEIMB/10-102KINLASLGN--VVPH-------LHWHIIARF-------------------------------------------------
Q9KQC5_VIBCH/14-106KLNLGALGN--MVPQ-------LHIHHIARF-------------------------------------------------
ZB14_MAIZE/24-123INDGPSGCQ--SVYH-------IHVHLLGGR-------------------------------------------------
HINT_CAEEL/28-125VNNGKDGAQ--SVFH-------LHLHVLGGR-------------------------------------------------
G8AG53_AZOBR/16-114SNCGEDANQ--EVPH-------LHIHVFAGR-------------------------------------------------
K7XM15_MYCHR/14-110INNEPDAEQ--SIFH-------THVHIIPYY-------------------------------------------------
YHI2_MYCTU/11-106INDGRAAFQ--TVFH-------VHLHVLPPR-------------------------------------------------
Q32EW3_SHIDS/12-109MNTNRHGGQ--EVYH-------IHMHLLGGR-------------------------------------------------

PF04677

C3H64_ARATH/370-491FELV...SK--RVSH-------ANLQVVPVP-------------------------------------------------
C19L1_CAEEL/309-429FER....NF--RTQH-------LQVQMVMID-------------------------------------------------
C19L2_CAEEL/226-350FEMSRHV.D--SNPH-------VFIECVPVE-------------------------------------------------
C19L2_DROME/460-584YEIANKL.H--RRPH-------LSVHCIPIP-------------------------------------------------
CWF19_SCHPO/399-523YENAP.SPQ--RYMH-------TAIECIPVS-------------------------------------------------
DRN1_YEAST/256-389FEIQ...SE--RSIH-------FHKQVIPVP-------------------------------------------------
MU161_SCHPO/334-470YEIS...RA--NGVH-------LHWQMIPIP-------------------------------------------------
Q93ZX4_ARATH/458-582LETVIGLSQ--QRRH-------CLIECIPIP-------------------------------------------------

PF02611

CDH_HELPY/24-243LTINSSKGRSQNHFH-------IHISCISLEARKQ------LDNNLKKINSRWSPLPGGLNG..HKYLARRVTESELVQ.
G9AY12_PANAN/24-250MAINSAWGRSQNQLH-------IHLTCLREDVYRQ------LMAERPYIQDAWHPLPDKLLT..HTYYARRVLQPTAMG.
Q8P9Z9_XANCP/30-250LALNSPYGRSQEQLH-------IHIDCLRPDVYAA------LQREHAQIGPQWRALAEPLLG..HVYLARTLPGDTLN..
E8V0N7_TERSS/35-269VAINSVSGRSQDQLH-------LHVDCMQPAVKSA------LQQVAPQIGTAWQTLPVRLRG..DEYRAMWLPGADLDT.
A8GL49_SERP5/45-264LAINSAYGRTQNQLH-------IHISCLLPAVKTQ------LAQYAADYSERWEPLPGGLLG..HDYLVRRVTPEELHK.
E0SJ94_DICD3/33-253LAINSLYGRTQGQLH-------IHISCLKPEVYQT------LRARNANIGYDWVSLGQPLLG..HDYLAIKLNGSDLTR.
CDH_YERPE/33-252LAINSQYGRTQDQLH-------IHISCLKPQVKTA------LAAHSADFQQQWQPLPGGLLG..HDYWVRRITATELQQ.
B8IMH8_METNO/37-256LAVNSIGGRSQDQLH-------IHLDCVQPSVQAA------LQHYASTIGSTWAAMPIALQG..SRFFALRVGADQMRD.
W0LHA3_SERFO/26-254MAINSAYGRSQNQLH-------IHLTCLREDVYRQ------LQAERPYIQDKWLPLPDKLLR..HTYYARRVVQPAAMG.
B1M455_METRJ/29-249LAVNSARGRSQDQLH-------IHLDCLKPSVLKA------VRAHGRQVRHTWSRFPVPLAG..DRYYALRVPEAEAAQ.
Q1LBK3_RALME/33-250LAINARAARSQDQLH-------IHLDCISESARDF------L..ASGAFDRQWRSL..TFRG..KPVRVRLIPSDDPVLA
Q6MQF2_BDEBA/30-256LAINSQFGRSQNQLH-------IHVSCVKPLVQQH------LQEQSAKLKNGWSLLPQPLLG..HKYYARKVSEKELEK.
G8MBN7_9BURK/67-288LAINSASGRTQNQFH-------IHIDCLAHDVAQT------LRELGPTIGTDWAPLPVRLRG..HVYSAMRIDDADLTH.
A6TFQ8_KLEP7/24-243LAINSRSGRTQNHFH-------IHISCLRPDVRAQ------LDKDAAAISSRWLPLPGGLQG..HEYLARRVTEAELAQ.
H2INV4_RAHAC/31-250LAINSQYGRSQNQLH-------IHISCLLPQVKTT------LSKDGGQMGYNWQELPDKLLG..HTYLARKVTQAELNE.
B0U7T2_METS4/29-248LAVNSTSGRSQDQLH-------IHVDCLKPSIQVA------LQRYAQGIRRAWTRLPMIVQG..SPLYAMRVEAPDVQI.
B2VF57_ERWT9/34-251LAVNSRWGRTQNQLH-------IHISCLRPDIRQR------LDALSSTLDTTWQT..HRLGE..HDYQLRVVTRDEFKR.
B9JRW8_AGRVS/27-242LAVNAQNARSQNQLH-------IHIDCLSPDAHAL------LTKMANDIGTDWAPLPGTVAG..HHFIAMKVEGDTLAG.
D8IW24_HERSS/34-253VEVNSAAGRSQLHLH-------LHIDCMRRDVAAS------LAAHRDDPLQQWRPW..HFEG..HRYWVMRLPAEALAQ.
C5BB31_EDWI9/31-247LTINSRAGRTQDQLH-------IHLSCTRQAVVSQ------LWKIYPTLGTQWQAVSNGING..HPYWARRLSNETLAR.
A9HJU4_GLUDA/35-256LAINSQYGRSQNQLH-------IHIDCLAPNIRVA------LHWARPQIGHGWTRL..VLND..HTYRATRIDGNSLDG.
B2JLJ5_BURP8/29-246LEINSAYRRSQQQLH-------IHMDCMHDSVIKD------LARFATVEPGQWHWT..TLDG..NRYRVMRVLSLTGAD.
B1LSY8_METRJ/26-246LEVNSVGGRSQDQLH-------IHLDCMRRSVVAA------LKAHGDAVGESWAPFPVPLEE..VSYVAMRVPADAMAA.
L0IYV5_MYCSM/29-248LAINSAVARSQNQLH-------IHIDCVRADIRET------VNRRIADVGPDWAPFPEPLRG..HPYQAMAVEGDTFDV.
B8IPC5_METNO/27-247LAVNSKGGRSQDQLH-------IHLDCVDPSVRAT------LDARSGLIGSKWTRLPFGLEG..DHYYALRVGAMNARD.
B2FII5_STRMK/27-247LALNSPHGRSQHQLH-------IHVDCLRADVLQA------LDTHAAALGSRWAPLPVLLRG..HQYQARLLAGAELT..
CDH_CROS8/31-250LTINSRMGRSQNHFH-------IHISCLRPDVRAQ------LDAAMNAIGSRWQPFPGSLRG..HDYLARRVSGEELSR.
B8EQB5_METSB/40-259MAINGAGARSQDQLH-------IHVDCVRSDVRDE------LRKRAPEIGSDWADF..RMFG..QNYRARRMKGEEPQ..
B2HIW3_MYCMM/43-260LTINAKNARSQDQLH-------IHISCSSPATLAT------LKEVNAADYVRWKQLPVDLGG..HSYHVLAVNTDTLKS.
W0HRX4_9ENTR/35-254LAINSAYGRTQNQLH-------IHISCLRPDIRER------LDNDAASISTDWQPLAQPVLG..HEYLAKRISAAGLAA.
E6WAG7_PANSA/33-250LAINSQYGRTQNQLH-------IHISCLRPDVRQR------LDLLAPQLNEQWQS..ETLQN..HRYQIRTLTTAQLAQ.
B1M8V7_METRJ/69-294LAVNARLRRSQGQLH-------IHIDCVRLDVRDA------LRRLAPTIGDRWAPLPEPLVG..RPFRAMRVLGDDLDA.
D8MKK8_ERWBE/33-250LSINSERGRTQNQLH-------IHISCLRPDIRQQ------LDSLSPKLTSLWQS..EQLAG..HTYQVRAVTRDEIKK.
G2I2H3_GLUMN/36-254LAINSAYGRTQNQLH-------IHVDCIRPDVKVA------LHWARPQLGTKWVAL..SLNG..HGYRARLLP..VLSG.
Q6D6W9_PECAS/32-251LAINSRYGRTQNQLH-------IHIACLRPEIYQT------LNQQFPTLSGDWKALPVKING..HIYLAKTLTANELTQ.
D2UA62_XANAP/30-247IVVNAQTAHLQNQLE-------LHIACLRADIRQR------LASVGAHWNPRWSGY..WLQG..HHYYLRTLSEEELIQ.
CDH_MYCLE/38-255LAINPKNARTQDQLH-------IHISCVSPTTAEI------LKQVNWAEYVGWKPLPVTLQD..HTYQALAVNRSTFES.
Q13LU5_BURXL/41-259LEINSQYRRSQNQLH-------IHIDCMRGDISEA------LAQHAKDTPGKWRWD..TLDG..KRYRIMRVTALTQTD.
Q7NQ26_CHRVO/27-251LAINSEYGRSQNQLH-------IHISCTDPTVRQQ------VDDLADGLKRRWRQLPVELKG..HAYWARRVDADQNGDP
K7SS21_GLUOY/32-232LAINSRDGRTQDQLH-------IHIDCLTPYVRAE------IDKYM..IGEAWTPV..SLYG..HPYRARLVQTLD....
R9VP92_9ENTR/32-251LTINSRSGRTQNHFH-------IHISCLRPDVRTQ------LNDNAARISSQWLAFPGGLLG..HQYLARRVTEAELVQ.
Q0JZ98_CUPNH/25-246LAINSRASRSQDQLH-------IHLDCISSAARAV------VNGAAGPIGTGWTTL..RLED..KPVRAIFVPASAPVLA
H8L0L3_FRAAD/32-259LVINSAYGRSQNQLH-------IHADCMQPWLVRR------LADPALSRGEDWQSIDLPLDGAIRHFQLRWLPGEQLS..
CDH_ECOLI/31-250LAINSRTGRTQNHFH-------IHISCIRPDVRKQ------LDNNLANISSRWLPLPGGLRG..HEYLARRVTESELVQ.
Q5FPM0_GLUOX/32-232MAINSRPGRTQDQLH-------IHLDCLTAYARAE------LDKNM..ITETWSLV..SLYG..HPYRARIVPSLD....
W0PFV2_9BURK/44-257LTVNSKSGRSQNHLH-------IHISCVRPALRDR------LLGMHAQFDSRWRAVPGGING..HAYQVRTLSLNELEQ.
I2BEE8_SHIBC/29-247LAINSPSGRSQNQLH-------IHISCLRKDVRQQ------LDHWAADAGSRWSR.AGNLAG..HPYLARKVSRETLVE.
CDH_MYCTU/41-258LTINPKNARTQDQLH-------IHISCSSPTTSAA------LRNVDTSEYVGWKQLPIDLGG..RRFQGLAVDTKAFES.
U3U143_9ENTR/33-250LAINAQYGRTQNQLH-------IHISCLRPDVRQQ------LDTLAPKLNAQWQT..ATLLR..HRWLIHTLITAELAQ.
D5CGT2_ENTCC/45-264LTINSPTGRTQNHFH-------IHISCLRPDVREK------LNAAQGQISTQWLPLPGGLEG..HEYLARRVTENELVQ.

PF02744

GAL7_CRYNJ/204-373YSMGLHQSPLPPTDPT.SNSAQVHFHFYPPLLRSA------TVRKFMV.GFELLGEAQRDIVPEQAAVRLR........-
GAL7_HAEIN/183-348YSMGFHAAPFNGEDN...EHWQLHAHFYPPLLRSA------TVRKFMV.GYEMLGENQRDLTAEQAAERLR........-
GALT_STRMU/231-435YPDGV.................YHPHIDVQHIKKE------NIGLIEVMGLAILPPRLKKELAEVEKYVLNQ.......-
GALT_BACSU/240-451HPLGI.................FHPHQEVHHIKKE------NIGLIEVMGLAILPGRLQEEMKETAAALCSADPKTALE-
GAL7_YEAST/198-366YSMGIHQAPLNATGDELSNSW.FHMHFYPPLLRSA------TVRKFLV.GFELLGEPQRDLTSEQAAEKLR........-
GAL7_KLULA/195-363YSMGLHQASLNATEGELKAAW.FHMHFYPPLLRSA------TVRKFLV.GFELLGQPQRDLTAEQAADRLK........-
GAL7_ECOLI/182-347YSMGWHGAPFNGEEN...QHWQLHAHFYPPLLRSA------TVRKFMV.GYEMLAETQRDLTAEQAAERLR........-
GALT_HUMAN/202-370YSMGWHGAPTGSEAGANWNHWQLHAHYYPPLLRSA------TVRKFMV.GYEMLAQAQRDLTPEQAAERLR........-

PF16285

D5DD06_BACMD/8-254-------------YLQTAAHYLLNHFHRSCTSYNLFFYNLKNGKIAAKIIPRFATSPLYVGYGIPQVSNKLEHIANQVQE
C0ZAZ1_BREBN/8-252-------------YLQILAHWILTHVNPRHQSYNFFFYHWG.EKLIAKVVPRFVTSPLYVGYSIPQVANNLEDMVAQLQR
B2TPI8_CLOBB/11-256-------------GIRKTVYYILNNYFAKCDSFNLFFYHWN.NKIICKITPRFVTSPLLLGYSLKQVSNSLEEIAGNLKE
C9LU44_SELS3/8-252-------------DIQIAVDYLMHHFNKRCNSYNIFFYQER.GVLRAKIMPRFATSPLFIGYNIRFRPSNLEDLRNNVRK
D9SRU9_CLOC7/9-253-------------NIQKIVHYILNNFYVKCDSFNLFFYDWK.GKLICKAVPRFVTSPLFIGFSIGQVSNNQDKIVEHVKQ
Q81VH8_BACAN/8-251-------------YIQQTVRYILTDFHKGCSSYNLFFYHVS.GKIICKVVPRFVVSPLYVGYKIPQVSTKLEDVKIQLAE
U5LFA6_9BACI/8-252-------------YIQAAVRYILHSFPFKCSSYNLFFYKLG.EDIYAKIVPRFVTTPIYIGYSIPQVPNNLEWMKEDIRA

PF01087

GAL7_CRYNJ/15-198...........ESSDGCVQIFENRGAMMGCSAPHP.............................HGQVWTTSFVP-----
Q7QA38_ANOGA/1-174.............RYQWVQIFENKGATMGCSNPHP.............................HCQIWACSFLP-----
A5DRG5_PICGU/6-197........VEGKAPYKYLQIFENKGFAMGCSNPHP.............................HGQAWCLDVIP-----
Q9CM11_PASMU/4-178.............KYQWVQIFENKGAAMGCSNPHP.............................HGQIWANSFLP-----
Q2H1V5_CHAGB/2-211.ANPDGEVDPPQNQLRYMQIFENKGAAMGCSNPHP.............................HCQIWTTSTLP-----
A4AQM0_MARSH/1-176...........NESINHVQIFENKGDVMGCSNPHP.............................HGQIWAQRNVP-----
Q65CW7_BACLD/17-231...........RSYPMCLLCKENEGYAGRIG..YPARANHRIIKVPLAGENWYFQYSPYAYYNEHSILFSEQHRP-----
A9WJH8_CHLAA/4-191...........IDWVQSVLIFENRGAMMGASNPHP.............................HGQIWANEQLP-----
A7MIY8_CROS8/2-176.............TYPWVQVFENKGAAMGCSNPHP.............................HGQIWANSFLP-----
Q03XA5_LEUMM/18-235...........SQYPVSQLAKENEGYWGRLD..YAARTNHRVIPITLGHEKWYFQYSPYAYFNEHAIVLSENLRP-----
A3N102_ACTP2/3-177.............RYQWVQIFENKGSMMGCSNPHP.............................HGQIWASNFLP-----
GALT_STRMU/16-225...........SNYPKCQLCMENEGYQGRIN..YPARANHRIIRMNLGDEKWGFQYSPYAYFNEHCIFLNTEHVP-----
A5DWA9_LODEL/21-211........KAKGLPYKYLQIFENKGFAMGCSNPHP.............................HGQAWCLDIVP-----
Q6D2C5_PECAS/1-175.............RYPWVQVFENKGTMMGCSNPHP.............................HGQVWANDFLP-----
Q1IQZ6_KORVE/1-177...........KSWINYVQIFENRGEMMGASNPHP.............................HGQIWANSSVP-----
Q6LQE3_PHOPR/15-189.............DYVWVQAFENKGSAMGCSQPHP.............................HGQIWANSFLP-----
A8LEI8_FRASN/19-211.............VWRWVQIFENRGAAMGASSPHP.............................HGQVWASASLP-----
Q59VY3_CANAL/21-210........NQDIAPYKYLQIFENKGAAMGCSNPHP.............................HGQAWCLDVIP-----
A1L2D1_DANRE/7-181.............TYAWVQIFENKGAMMGCSNPHP.............................HCQVWASNFLP-----
A7F8S7_SCLS1/1-208..PSGHDVGAPNQQYKWMQIFENKGAAMGCSNPHP.............................HGQIWTTTGLP-----
Q3XZ93_ENTFC/18-230...........VDYPTCMLCMENEGYRGRLN..YPARTNHRIIRMNLDGESWGFQYSPYAYYNEHSIILSEQHRP-----
B1YII0_EXIS2/18-230...........STYPTCLLCVENVGYAGRSN..HPARANHRIVPLTLSGESWALQYSPYVYYNEHSIILSQEHRD-----
Q0RE52_FRAAA/14-191.............RWRWVQVFENRGTAMGASNPHP.............................HGQIWACDALP-----
Q21LR9_SACD2/5-180.............SCSWVQIFENKGAAMGCSNPHP.............................HGQIWATDQIP-----
GALT_STACT/19-233...........SSYPANALCMENEGFVGSVT..QAARRNHRIVRLNLNHQPWGFQFSPYAYFPEHSIVLSEAHEP-----
GALT_LACPL/16-224...........DGYPLCQLCMQNEGYLGRLG..YPARSNHRIIRLTLGGNTWGFQYSPYAYFNEHSIFLDQEHRP-----
A8WVF3_CAEBR/2-179.............KYDWVQIFENRGAVVGCSNMHP.............................HGQLWASNYLP-----
A2AMS2_MOUSE/3-177.............QYPWVQIFENKGAMMGCSNPHP.............................HCQVWASSFLP-----
GAL7_NEUCR/2-217PNPDGEVEPAKKQQLRYMQIFENKGAAMGCSNPHP.............................HCQIWTTSTLP-----
A7TJY6_VANPO/4-190.........KEGNPYKFLQIFENKGTAMGCSNLHP.............................HGQAWCLDVVP-----
A6RBX1_AJECN/45-253.GSPISQISLPKHQLRYMQIFENKGSAMGCSNPHP.............................HGQVWALSCLP-----
GAL7_KLULA/1-189........LEENKPYKYLQIFENKGTAMGCSNLHP.............................HGQAWCLDSIP-----
Q5KY03_GEOKA/19-233...........SSYPKCVLCKENEGYEGTWR..HPARSNHRVIPITLLDEQWYFQYSPYVYYNEHCIVFHAEHVP-----
Q03PB0_LACBA/18-226...........TSYPLDQLCMTNEGYLGRLG..YPARSNHRIVRMMLGGETWGFQYSPYAYFSEHAIFLSQIHRP-----
A2QCH5_ASPNC/2-209.NSPTASLTKPKEQYRYMQIFENKGAAMGCSNPHP.............................HGQVWTTSSLP-----
A6WF46_KINRD/10-216...........TDGVEQVFVFENRGEEIGVTLPHP.............................HGQIYGYPFLT-----
Q2J7D6_FRASC/3-201.............TWRWVQVFENRGTAMGASNPHP.............................HGQIWACDALP-----
A3QFA6_SHELP/9-182.............KYLWVQVFENKGAAMGCSNPHP.............................HGQIWAHNHLP-----
GALT_BACHD/21-236...........SSYPKCLLCKENVGYRGRVN..HPARQNLRVIPVELNQEQWYMQFSPYVYYNEHAIVFSGEHVP-----
Q5WD06_BACSK/20-235...........SDYPKGLLAKENVGFAGRAT..HPARQNLRLIPVTLGNEQWYMQFSPYVYYEEHAIVLFEKQRP-----
A0QYK5_MYCS2/3-199...........RNGIEQVFCFENRGEAIGVTLNHP.............................HGQIYGYPYLT-----
GALT_LACSS/20-231...........TGYPKCQLCLENEGYAGRLD..FPARRNHRIVRFDLEQQTWGFQYSPYAYFNEHSIFLDGKHEP-----
Q896X9_CLOTE/19-233...........ISYPKCPLCLENVGYKGRLD..HPARQNHRVIPVELEEEKWYLQYSPYVYYKEHSILFYEKHVP-----
GALT_DROME/1-175.............KYAWVQIFENKGAAMGCSNPHP.............................HCQIWSCSFLP-----
GAL7_SCHPO/4-195........LEGPIRYKYLQIFENKGSAMGCSNPHP.............................HGQAWCLDVIP-----
B8I4V5_CLOCE/19-234...........SNYPECMLCIDNIGYAGRIN..FPPRQTHRLMPVTLCGEQWYLQYSPYVYYNEHCIVLSEKHVP-----
A3LR66_PICST/19-206........LSGNAPYKYLQIFENKGFAMGCSNPHP.............................HGQAWCLDVVP-----
Q7N8Y8_PHOLL/4-178.............EYLWVQVFENKGEAMGCSQPHP.............................HGQIWANSFLP-----
Q73SK2_MYCPA/2-203...........TPGIEQVFCFENRGEEIGVTLTHP.............................HGQIYGYPYLT-----
A8FIP9_BACP2/20-233...........KQYPLCLLCKENVGFEGRVN..HPARQNHRIIPVSLSGESWFLQFSPYVYYNEHCIVFKGKHEP-----
Q3IH81_PSEHT/3-176.............KYNWVQVFENKGAMMGCSNPHP.............................HGQIWSQQQLP-----
A0M3B7_GRAFK/1-176...........VENINYVQIFENKGAIMGCSNPHP.............................HGQIWSQSSVP-----
A5FKW9_FLAJ1/2-179...........IKYINHVQIFENKGSVMGCSNPHP.............................HGQIWAQSSLP-----
Q4PDD8_USTMA/31-214..........ENPFVKYIQIFENKGSAMGCSNPHP.............................HGQVWSLDYIP-----
Q15Y61_PSEA6/2-176.............DYTWVQVFENKGAAMGCSNPHP.............................HGQVWANDFIP-----
Q6C0K3_YARLI/1-190...........SRGIKYSLIFENKGATMGCSNPHA.............................HGQVWNTSIVP-----
Q6BVI6_DEBHA/3-194........QDGPVKYKYLQIFENRGFAMGCSNPHP.............................HGQAWCLDTIP-----
Q2GAY3_NOVAD/2-175.............HFANVQIFENKGAMMGCSSPHP.............................HGQIWASDFIP-----
GALT_CLOAB/17-229...........TSYPKCLLCKENEGFYGNIN..HPARQTLRIIPLELNKSKWFLQYSPYTYYNEHCIILNNEHIP-----
GALT_ENTFA/20-232...........KKYPACMLCMENEGYYGRVN..YPARTNHRIIRLNLEDEAWGFQYSPYAYYNEHAIFLDQQHRE-----
Q30V51_DESAG/2-182...........RQDIGYVQIFENRGAMMGCSNPHP.............................HGQIWASSSVP-----
A9KN46_CLOPH/31-257...........TEYPACQLCKENEGYAGRVN..HPARNTLRTIPITIQEDPWFLQYSPYVYYNEHCIVFRGEHSP-----
GALT_LACS1/18-228...........SGYPLCQLCMENEGYQGRIN..YPARANHRIIRFDLDDKQWGFQYSPYAYFNEHCIFLDTIHEP-----
A0KQH7_AERHH/2-174.............QWEWVQVFENKGAVMGCSNPHP.............................HGQLWGSDFLP-----
A4VT89_STRSY/18-226...........SNYPKCLLCMENEGYQGRIN..HPARANHRIIRLELGQEKWGFQYSPYAYYNEHAIFLNQEHVP-----
A5VME1_LACRD/16-220...........KKYPQCALCMENEGYRGRLGQAARSNHRIIRITVGGQ..QWGFQYSPYAYFHEHCIFLDSKHEP-----
E7KK61_YEASL/5-192........RENHKPFKYVQIFENKGTAMGCSNLHP.............................HGQAWCLESIP-----
G0RTP4_HYPJQ/7-208LPISKEEAPVPKDNYRYMQIFENKGAAMGCSNPHP.............................HCQAWTTSTMP-----
Q04GZ3_OENOB/18-225...........SSYPLDQLCLENEGYLGRLD..YPARSNHRIIRLTLGGETWGFQYSPYAYFQEHSIFLSKIHRP-----
Q5KLY2_CRYNJ/11-195...........SSGQGYVQIFENRGAMMGASAPHP.............................HGQVWSLSYVP-----
GALT_STRT2/18-226...........SDYPKCQLCMENEGYLGRIN..HPARSNHRVVRFQMEDKEWGFQYSPYAYFNEHSIFFYGKHEP-----
Q5NEY1_FRATT/11-180.............KYQWVQVFENKGSIMGCSNSHP.............................HGQIWACDFLP-----
Q7MBX0_VIBVY/28-200.............RYPWVQVFENKGESMGCSQPHP.............................HGQIWANSFIP-----
GALT2_STRR6/16-224...........SNYPQCQLCLENEGYHGRVN..HPARSNHRIIRFEMVGQEWGFQYSPYAYFNEHCIFLDGQHRP-----
GALT1_STRR6/18-225...........TNYPKCLLCMENEGYQGRIN..YPARSNHRIIRLKLGDEVWGFQYSPYLYFNEHAIFLNSQHVP-----
GALT_CLOPE/21-230...........SNYPKCLLCIENEGYEGTVT..HPDRANHRMIRLDLNDRTWMLQYSPYLYYNEHCIILSEDHVP-----
GALT_LACLA/19-228...........SSYPACQLCLENEGFYGIGN..KPARSNHRIIQVSINGEDWGFQYSPYAYFNEHSILLNAKHQP-----
U5L509_9BACI/19-230...........SNYPKCLLCAENEGYAGRPG..HPARSNHRIIDLELSDEPWFLQYSPYVYYNEHCIVLCGEHR.-----

PF16268

F5XH95_MICPN/8-422ADLLHALHAATGPAVPTNEEWHYRPPGLDRPMPWRIVLKWRISVPAGFEGGTKIYVNTIDPWTLRDRMLAALHTLRRDRL
C3PH27_CORA7/1-419SDLIHAAHAAVGPDVACNEEWHHRPPSVDLPQPWRVMIKLRVSTLAGFEGGTKVYINTIDPWGLRDRVVDAMFRLRERGE
B1VH78_CORU7/18-447ADLVHACHIASGPSIPCNEEWLHRPMDVDVPMPWRIVIKWRVSTLAGFEGGTKIYINTITPQELCELVLHRLEAAQAAGR
Q8NNU9_CORGL/1-424SNLIHACHAATGADVPCNEEWVHKPIDVDMPMPWHVMIKWRVSTLAGFEGGTKVYLNTLSPHKVRDRVVKEMYRLRDEEL
W5WQ34_9CORY/18-447ADLVHACHVAAGPHVSCNEEWLHRPLDVDIPMPWRIVIKWRVSTVAGFEGGTKIYINTISPADLKDRVLSALEEAREDGR
W5Y1J6_9CORY/15-448SDMVHAAHAATGPDVPCNEEWHHKPADLDMPMPWRIMLKWRVSNLAGFEGGTKIYLNTLSPWNIRDRIVSTMYALRDEGR
G0HAG7_CORVD/18-449SDLVHACHVAAGTETPSNEEWLHRPLDVDVPMPWRIVIKWRTSTLAGFEGGTKIFINTISPKALKKQVLAALLTAREEGR
U3GXR8_9CORY/26-464ADLIHACHAAAGPDIPCNEEWHHTPIDLDITMPWRVMIKWRVSTLAGFEGGTKIYLNTLSPQGLRDRMVSAMYELRDQGH
Q6NGG7_CORDI/11-432SDLIHACHAAAGPHVPCNEEWHHKPIDLDIAMPWRVMIKWRVSTLAGFEGSTKVYLNTLSPWDVRDRVVPRLYELRDSGA
S5SVS2_9CORY/15-437SDMVHAAHAAAGADVPCNEEWHHKPIDLDMPMPWRINIKWRVSTLAGFEGGTKIYVNTLSPTDIRDRVVPQLYALRDARR
B3QVF6_CHLT3/10-436SDLVHACHVGMGNQISCNEEWNYTPIDSVYNMPWRILIKWRINIPAGFEGNTGIYINPISPHQLRDKMVPRLYEMRAQGL
Q6A5P1_PROAC/10-435SDLLHAAHVAVSDDVPANEEWHYRPMGTGVPVPWRIILKLRTSTLAGFEGGTKIYVNTISPTTLAAMLLPKLFEARAAGR
Q8FP08_COREF/15-438SDLIHACHAATGPDVPCNEEWHHKPVDVDMPMPWRVTIKWRVSTLAGFEGGTKIYLNTLSPQNVRDRVVRELYRLRDEGW
F8E0G1_CORRG/18-447SDLVHACHVAAGPHIACNEEWLHRPLDVDVPMPWRIVIKWRVSTMAGFEGGTKIYINTITPGQLKDRVLTALQKAQDEGR
C5CBF5_MICLC/33-463SDLLHAAHAATGPDVPSNEEWHTRPPGVASPMPWRVMLKWRVSTLAGFEGATKINVNTLSPWDVRDRVLARLRELRAAGA
I6XY80_PROPF/27-452SDLIHAMHAATGVDVACNEEWHYRPIDVALPMPWRVMLKWRVSTLAGFEGATKIYLNTISPVMLRDRVVEKLLALREAGR
R5PXK8_9PROT/14-442SDIVHACHASMGSEIPCNEEWYYRPPAVDIPSPWHILIKWRISNPAGFEAVTKIFINTIDPWQLRDRIVQNLFALRNEGK
D7BLX6_ARCHD/14-437SDLIHAMHAATGADVPTNEEWHCKPIDADVSMPWKVLIKWRVSTLAGFEGGTKIYVNTIDPWALRDRVVPRLLELRAEGA
D9QB86_CORP2/15-442SDLVHACHAGAGPQVPCNEEWHHKPVDVDIPMPWRIMIKWRVSTLAGFEGGTKIYLNTLSPWDVRDRIVHELYSLRDQGR
X5DSS5_9CORY/40-471ADLVHACHVAAGPHMPSNEEWLHRPLDVDVPMPWRIMIKWRDSTMAGFEGGTKIFINTLSPAGLKAKVLARLEDARDRGR
M1P829_9CORY/11-432SDLLHACHAAAGADVPCNEEWLHKPIDLDLPMPWRVRIKWRVSTLAGFEGGTKIYVNTLSPYNIRDRVVSAMYGLRDGGR
D7GCR7_PROFC/13-438SALVHACHAATGMDVPSNEEWHHRAPDMDVPMPWRINLKWRVSTLAGFEGGTKIYLNTIDPWHLRDRVVPRLHALRRQGR
D7WEZ1_9CORY/10-431SDLIHAAHAATGPEVPSNEEWHHKPIDLDMPMPWHINLKWRVSTLAGFEGGTKVYVNTLSPYDIRDRMVSNLYRLREEGR
C8XCI8_NAKMY/35-455SDLIHALHAASGPGVPCNEEWHHKPPDGDVPMPWRVLIKWRLSTIAGFEGGTKIYLNTIDPQTLRDIVTADLLRLREQGA
C4LIB0_CORK4/15-440SDLIHACHAATGSDVPCNEEWHHKPIDLDIPMPWRVMIKWRASNLAGFEGSTKVYLNTISPENIRQRMSKRLSQLREEGR
K7RWS7_PROA4/29-464SDLLHAMHLAVGADVPSNEEWHYRPVGVEMPMPWRILLKLRVSTLAGFEGSTKVYVNTISPASLAARLLPRLLDARKAGK
D6ZJH6_MOBCV/17-441SDVLHALHCAVGPAVPTNEEWYHRPVDLDVPLRFRILLKQRTSTLAGFEGSTRIYLNSVDPWTLGDEMVTLLEKKREQGL

PF11969

Q5TVU2_ANOGA/17-126-------------------------------------------------------------FDSPCL---KRRHH-----
A5DAJ7_PICGU/3-137-------------------------------------------------------------FESPCL---KHKKH-----
A5DAR3_PICGU/136-257-------------------------------------------------------------HPGLGE---GTNVG-----
Q293N2_DROPS/5-112-------------------------------------------------------------FVSPCL---KRKKH-----
Q293N2_DROPS/220-329-------------------------------------------------------------FYSLSM---KRIKH-----
Q297L1_DROPS/153-272-------------------------------------------------------------NDAPGI---W..CE-----
Q29LN6_DROPS/45-159-------------------------------------------------------------SEMSI.---WNRIN-----
HINT3_RAT/40-155-------------------------------------------------------------KEFGF.---LSRVV-----
A0EGQ1_PARTE/118-231-------------------------------------------------------------QMG...---..QAF-----
A1CEC1_ASPCL/149-272-------------------------------------------------------------LEA.GA---TQATG-----
A3DF72_CLOTH/3-110-------------------------------------------------------------......---GVDMG-----
A3LWH2_PICST/136-257-------------------------------------------------------------HPGLGD---GIAVG-----
A4S248_OSTLU/99-229-------------------------------------------------------------AKEQGC---A..CE-----
APTX_DROME/4-113-------------------------------------------------------------FVSTSL---KTKKH-----
APTX_DROME/229-339-------------------------------------------------------------FYSMAM---KRISH-----
A4XKP5_CALS8/3-110-------------------------------------------------------------......---GRKFS-----
A5D7U9_BOVIN/174-293-------------------------------------------------------------FEAPGA---G..VE-----
A5E770_LODEL/177-298-------------------------------------------------------------HPGLGD---GANIG-----
A5GQU3_SYNR3/125-230-------------------------------------------------------------......---GRPLA-----
A5I635_CLOBH/3-110-------------------------------------------------------------......---GRNLQ-----
A6QUC5_AJECN/141-262-------------------------------------------------------------LEG.GT---TQSTG-----
A6VZM3_MARMS/2-109-------------------------------------------------------------......---GRAMT-----
A7HMY4_FERNB/3-108-------------------------------------------------------------......---GRKLG-----
A7S614_NEMVE/151-270-------------------------------------------------------------FDAPGS---G..SG-----
A7SFV5_NEMVE/10-122-------------------------------------------------------------SQMRF.---ASRHI-----
A7TKH2_VANPO/142-261-------------------------------------------------------------HLGLGN---GIVAG-----
A7TQ97_VANPO/171-297-------------------------------------------------------------HAGLED---NMAAG-----
YHIT_CHLTR/2-108-------------------------------------------------------------......---GGLLG-----
APTX_CHICK/142-252-------------------------------------------------------------FDSPAL---KTKKH-----
APTX_DANRE/150-260-------------------------------------------------------------FDSPCL---KNKKH-----
APTX_XENTR/173-283-------------------------------------------------------------FDSPCL---KNKKH-----
APTX_CIOIN/206-317-------------------------------------------------------------FQSSSF---KTKKH-----
Q0U2I6_PHANO/148-269-------------------------------------------------------------LEA.GN---TQATG-----
Q15X15_PSEA6/3-110-------------------------------------------------------------......---GKPLG-----
Q16F07_AEDAE/8-123-------------------------------------------------------------FVSARL---KTVKH-----
Q16XY1_AEDAE/224-343-------------------------------------------------------------HDPPGI---H..CE-----
Q16YN6_AEDAE/11-125-------------------------------------------------------------GSMGF.---ISRMI-----
Q18227_CAEEL/10-129-------------------------------------------------------------SDMGLI---SRKLT-----
Q1CY35_MYXXD/3-112-------------------------------------------------------------......---GRPLG-----
Q1QZ40_CHRSD/2-109-------------------------------------------------------------......---GRRFT-----
HINT3_XENTR/18-132-------------------------------------------------------------SQLGF.---LSRMI-----
Q2H2H7_CHAGB/31-147-------------------------------------------------------------LSTDKM---FNARH-----
Q2H304_CHAGB/151-275-------------------------------------------------------------LEA.GA---TQATG-----
HINT3_BOVIN/47-162-------------------------------------------------------------DQLSF.---MSRLV-----
Q3IJU5_PSEHT/4-111-------------------------------------------------------------......---GKEMG-----
Q4PA08_USTMA/46-158-------------------------------------------------------------FKSQW.---KAIKY-----
Q54DF5_DICDI/36-141-------------------------------------------------------------FTPKF.---.KKHS-----
Y2839_DICDI/224-348-------------------------------------------------------------YNTKYL---KNNKH-----
Q59S51_CANAL/134-254-------------------------------------------------------------HPGLGD---GIAIG-----
Q5TUI6_ANOGA/154-273-------------------------------------------------------------YDPPGA---G..CE-----
A8XGQ1_CAEBR/148-267-------------------------------------------------------------YDAPAS---T..TM-----
Q6BZT0_YARLI/136-263-------------------------------------------------------------NEGLGS---SQLVG-----
Q6C515_YARLI/4-127-------------------------------------------------------------LSSPRL---KNRTH-----
Q6C6M8_YARLI/30-153-------------------------------------------------------------SPILQE---ELRSG-----
Q6CJA1_KLULA/160-286-------------------------------------------------------------HSGLGD---GIAVG-----
Q6FLB9_CANGA/198-323-------------------------------------------------------------HPGIGE---EMGQG-----
Q6FWT2_CANGA/170-296-------------------------------------------------------------HPGLGN---GISTG-----
Q6IIA4_DROME/5-118-------------------------------------------------------------TQMTF.---LSKMI-----
Q74ZD1_ASHGO/153-277-------------------------------------------------------------HPGVGA---D..AG-----
Q7PHF8_ANOGA/7-116-------------------------------------------------------------YYSPCL---SHRYH-----
Q7QJM2_ANOGA/10-124-------------------------------------------------------------SKMGF.---ISRMI-----
Q83DE2_COXBU/3-109-------------------------------------------------------------......---GRQMH-----
Q84VV6_ARATH/7-121-------------------------------------------------------------YVPRWK---AIKYK-----
Q8GYJ9_ARATH/75-183-------------------------------------------------------------......---GRQMK-----
Q8SUA2_ENCCU/116-232-------------------------------------------------------------MAHEG.---NVSCT-----
Q97JJ3_CLOAB/3-110-------------------------------------------------------------......---KKKFT-----
BH140_ARATH/717-833-------------------------------------------------------------FNSDSL---KNKKH-----
DCPS_SCHPO/141-261-------------------------------------------------------------HET.GD---GSAVG-----
E7KRX8_YEASL/160-281-------------------------------------------------------------HPGLGN---.....-----
E7KUH0_YEASL/160-281-------------------------------------------------------------HPGVGE---.....-----
F1R776_DANRE/159-276-------------------------------------------------------------YNVPGC---G....-----
F7CC42_XENTR/161-276-------------------------------------------------------------HDAPG.---.....-----
H3C365_TETNG/54-161-------------------------------------------------------------SKMN..---.....-----
H3CJX6_TETNG/127-244-------------------------------------------------------------YEAPGC---G....-----
H3DP42_TETNG/31-141-------------------------------------------------------------SQMGFM---S....-----
Q0JBF2_ORYSJ/25-136-------------------------------------------------------------FTPSWR---.....-----
Q5K774_CRYNJ/143-255-------------------------------------------------------------HDNL..---.....-----
Q9VQ59_DROME/32-141-------------------------------------------------------------ADMSF.---.....-----

PF01230

HINT1_RAT/24-121-------------------------------------------------------------QM-----------------
HNT2_YEAST/12-107-------------------------------------------------------------KI-----------------
FHIT_HUMAN/11-105-------------------------------------------------------------AG-----------------
APH1_SCHPO/12-106-------------------------------------------------------------KA-----------------
APTX_YEAST/15-139-------------------------------------------------------------FH-----------------
Q9I500_PSEAE/74-166-------------------------------------------------------------RG-----------------
Q98BM9_RHILO/14-106-------------------------------------------------------------EG-----------------
Y866_METJA/9-105-------------------------------------------------------------EG-----------------
YHIT_MYCPN/19-116-------------------------------------------------------------ET-----------------
APTX_SCHPO/44-156-------------------------------------------------------------HV-----------------
YHIT_HELPY/9-104-------------------------------------------------------------KH-----------------
HNT1_YEAST/32-125-------------------------------------------------------------DE-----------------
Q9A2A9_CAUCR/9-106-------------------------------------------------------------GD-----------------
YHIT_SYNY3/12-109-------------------------------------------------------------PF-----------------
Y1390_SYNE7/12-109-------------------------------------------------------------SL-----------------
YHI1_MYCLE/10-102-------------------------------------------------------------SL-----------------
Y961_HAEIN/12-110-------------------------------------------------------------PL-----------------
Q9JYE4_NEIMB/10-102-------------------------------------------------------------EN-----------------
Q9KQC5_VIBCH/14-106-------------------------------------------------------------TH-----------------
ZB14_MAIZE/24-123-------------------------------------------------------------QM-----------------
HINT_CAEEL/28-125-------------------------------------------------------------QL-----------------
G8AG53_AZOBR/16-114-------------------------------------------------------------R.-----------------
K7XM15_MYCHR/14-110-------------------------------------------------------------K.-----------------
YHI2_MYCTU/11-106-------------------------------------------------------------N.-----------------
Q32EW3_SHIDS/12-109-------------------------------------------------------------P.-----------------

PF04677

C3H64_ARATH/370-491-------------------------------------------------------------SSRARL..LPNIFS-----
C19L1_CAEEL/309-429-------------------------------------------------------------KSSSKA..LKSSFT-----
C19L2_CAEEL/226-350-------------------------------------------------------------QEIGDM..ASIYFK-----
C19L2_DROME/460-584-------------------------------------------------------------ASQGEM..APFYFK-----
CWF19_SCHPO/399-523-------------------------------------------------------------KRILSL..APAYFR-----
DRN1_YEAST/256-389-------------------------------------------------------------KYLVLKFCSALDRQ-----
MU161_SCHPO/334-470-------------------------------------------------------------KISSHR..IESVFL-----
Q93ZX4_ARATH/458-582-------------------------------------------------------------QEIAKE..GPLYFK-----

PF02611

CDH_HELPY/24-243.KSPFVMLNKEVP.NAYKRMGDYGLAV..VQQSDNS..FVLLATQFNPLTL......NR..ASAEEIQDHECAIL-----
G9AY12_PANAN/24-250.IYPIASVAHYFR.LTPPMLAEYGVALVPTTFS.GEKGFILLATRRGWDKG......NR..ASVESLLDKRCDIL-----
Q8P9Z9_XANCP/30-250.EDPIRLLASAIP..ADASLRDYSLVVAGAQLDEGQPGFVLLATRQDAATG......NR..ASGEELQDHACGLV-----
E8V0N7_TERSS/35-269.RNPFRLLADSLS.DPAREMGNHTLVLVGAERL.GKDGFILLDGKAPALATAISSWLRLGYGAGGKLQDHQCRVA-----
A8GL49_SERP5/45-264.QGAFRLLADEVA.RSKGRMGSFGLAM..TALPGGD..FLLLATERSLLPF......TL..ASSEEIQDHDCRVL-----
E0SJ94_DICD3/33-253.TDPFKLLNQYVQ.TREDRMENYGLAL..TANTQGE..LILLAVRRDFIGL.....FNR..GSAEEILDVNCALA-----
CDH_YERPE/33-252.PGPFHLLADEMP.GAKEQMGRYGLAI..TALPSGD..FLLLANKASLITQ......DR..ASAEELQDHTCQVL-----
B8IMH8_METNO/37-256.LNPFAALGH.LP.GRRTELRDTSLAMISVSGESGTRDFVLLAYRDPE.............AHAEKLLDHACTA.-----
W0LHA3_SERFO/26-254.IYPIKSVADYFQ.LSPQQLAEYGVALVPTLFS.GQKGFILLTTKRGWDSG......NR..ASVESLLDKECAIL-----
B1M455_METRJ/29-249.FNPFAALHT.LP.GARPDLHRTSFAALATPPGDPEPGYILLAYRAPS.............ASAEDVMDHSCAVA-----
Q1LBK3_RALME/33-250.VDPFDVVREDL..GADGKIADRGVFLGYVRPLQGQAGFVVVDEPVDKAGG......AN..GHASDFLDRGCKLG-----
Q6MQF2_BDEBA/30-256.GNAFQMLADGVP.GAKDHSGEFGLGLVAVKDKKKGHSLILLTSRFERGTN......NY..GSVEEIQDHSCPQ.-----
G8MBN7_9BURK/67-288.TDPFKLLAPYAA.SRGQTMGEQTLLLAGATRGDGAPVFILLNDHVQPG........NW..ASSEELQDHTCSLA-----
A6TFQ8_KLEP7/24-243.RSPFLMLAEEVP.EARQHMGRFALAM..AQQSDGS..LVLLATERNLLTL......NR..ASAEEIQDHRCAIL-----
H2INV4_RAHAC/31-250.KGAFRLLAEGVP.DAQKKMGHFGMAM..VSLPGGD..FLLLASERDLLKL......NN..ASTEEIQDHKCAVL-----
B0U7T2_METS4/29-248.FNPFAELTK.LP.GSSGSLSDVTFAAVSATNGV.RGDLYLLAYRQKY.............SAAEKVLDHSCSLT-----
B2VF57_ERWT9/34-251.TSPFIRLAHELP.GARDHMGHYGLAV..AALGDGK..RVLMVVKRNVLLL......NL..ASAEELQDHSCALL-----
B9JRW8_AGRVS/27-242.YNPFLALAKTLK.DPSTEMASHNLVVVGASFASG.PGFIILSDIAPAATI......GF..SGGEDVQDHSCQI.-----
D8IW24_HERSS/34-253.HDPFKLAAARSA.YAAANMASQSLLLTGARFADGGSGFFLVNMPVNFDLQ......EQ..GSAEVLMDHDCR..-----
C5BB31_EDWI9/31-247.ESPFILLSRLN..GAHDDMAAYGLAL..LPAPDGQ..LILLATRRALWRG......SL..ASIEEIQDHRCP..-----
A9HJU4_GLUDA/35-256.AYPFRRLAASLA.DPAREMGEHTLVVVGTVWPGGRPGFILLDDMVKPLSG......DR..AEGEELQDHACRIG-----
B2JLJ5_BURP8/29-246..DPFRIVARDR..QGSDAMAQQTILVTGAGPTD.KDGWLVVNSGPELDDG......S...GSAEPLLDHACEIG-----
B1LSY8_METRJ/26-246.FNPFAALAR.VP.GWQGRLHDASFAAVEADPGDPRGGMILLAYREPE.............ASAEYLMDHSCRMA-----
L0IYV5_MYCSM/29-248.TNPVQLLA.....KRADDMGLETLVVIGAYLPDGRPGFVLLASRADPAAG......NP..GAGEELQDHT....-----
B8IPC5_METNO/27-247.FNPFAALAH.LP.ATRGGLSATSLAVVATSPNDPHPGFYILAYQAPR.............AHAEALLDHQCEIA-----
B2FII5_STRMK/27-247.ANPLNLLAYDL..AGVDDVGQWSLVVAGRDAVQGGPGFILLATRVDAGTG......NE..ASAEELQDHACSVL-----
CDH_CROS8/31-250.RSPFMMLAEEVP.QAREHMGRYSLAL..APLKDGA..FVLLATQRQLLQF......NL..AHSEELQDHDCALL-----
B8EQB5_METSB/40-259.PDPFRLLAED...PRSLPLRDNSLAVIGASFADGAPGFIAIAQQAPGGA...........THLEDLQDHFCKVA-----
B2HIW3_MYCMM/43-260.KNLFRDIHDKVA.ADGKKMENASVALANVAPDR....FLLLVVEGTDEDP..........VAAETLQDHDCSVA-----
W0HRX4_9ENTR/35-254.QSPFLLLAREVP.EASEEMGEFGMAL..TPLPDGS..LVLLASQRSLLHR......NT..GSIEEIQDHSCVIL-----
E6WAG7_PANSA/33-250.QSVFIRLATEVP.DARSEMGKYGMAL..AALPDGR..LALMAIERNWARL......NS..GSAEELQDHRCQIL-----
B1M8V7_METRJ/69-294.ADPFDLLARDG..DARAAMGEHSLAVVGAEFPGGKPGFVLLDGLVTSRFG......RA..ANGEILQDHTCGLT-----
D8MKK8_ERWBE/33-250.MSPFLRLAREIP.GAREEMYKYGIAV..AALPDGR..RVMMVIKRNLLLM......NR..GSAEELQDHSCSIL-----
G2I2H3_GLUMN/36-254.ARPFQLLATDMA.DPASEMGQHTLVIAGMAQADGRPGFVLLDDRIDLQHG......DH..ASGEELQDHTCQIQ-----
Q6D6W9_PECAS/32-251.SDPFKTLDRYAQ.QRNESIGKYGLAM..VSMPAGE..KVLLASSLDVFNM......SL..GSVEEIQDFSCALA-----
D2UA62_XANAP/30-247.RSPFIRLAEELP.ENPVKLERYGLAL..SRLQDGR..FVLLALPRTLLGR......GATLGATRELQDDTCT..-----
CDH_MYCLE/38-255.KSLFRDIQTKVT.ADGNTMDHASVAVANIAPDQ....FLLLVAEGTEDQA..........IAAEELQDHNCSIA-----
Q13LU5_BURXL/41-259..NPFRIVAQDN..QGEGTMATQTILVTGAGPSAEQDGWLVVNSGIDVDNG......S...GSAEGLLDHACRVA-----
Q7NQ26_CHRVO/27-251LDDPFRLLANELP.GARAEMGRYGMAMLPARFADGEG.FVLLATRSDLLEI......NR..GSAEELQDHDCRIL-----
K7SS21_GLUOY/32-232.PSPFRLIGD.......TEMADHTIVVTPGHHGG....FVILDDVAHAL........DR..ASGEEVQDHKCKID-----
R9VP92_9ENTR/32-251.RSPFLMLAEEVP.EAKAHMGRFALAL..AQQADGS..FVLLATERNLLAL......NR..ASAEEIQDHQCDIL-----
Q0JZ98_CUPNH/25-246.VDPFQLVRDGTKGGAAAAPPDRGIFVTYVRERQGGAGFVVIDQPVDSAAG......SN..GHASDFLDRRCRLA-----
H8L0L3_FRAAD/32-259.VNPFRLLAEHL..SAGDDMASHSLVLIGGYDPRHRPGFFLLSGHHDAATG......DS..ANADRLQDLACHIV-----
CDH_ECOLI/31-250.RSPFMMLAEEVP.EAREHMGRYGLAM..VRQSDNS..FVLLATQRNLLTL......NR..ASAEEIQDHQCEIL-----
Q5FPM0_GLUOX/32-232.PSPFRVIAA.......DDMSIHTLVITPAKHGG....FILLDDMAHVF........DH..GSGEELQDHECHLD-----
W0PFV2_9BURK/44-257.RGPIALTITSLP.QARQDMANVSLALYPLSEQQ....FLLFADHRYGA............SAEGDFQDHRCP..-----
I2BEE8_SHIBC/29-247.DGPFILLANEIP.GARQNMGAWSLAL..ASLGDNS..FVLLATERDYLTL......NF..ASAEELQDHDCGIL-----
CDH_MYCTU/41-258.RNLFRDIYLKVT.ADGKKMENASIAVANVAQDQ....FLLLLAEGTEDQP..........VAAETLQDHDCSIT-----
U3U143_9ENTR/33-250.QSVFIRLAEEVP.HARGEMGKYGLAL..AQLPDGR..LALLALERNWLKL......NR..GSAEELQDHQCRLL-----
D5CGT2_ENTCC/45-264.RSPFMMLAEELP.EARDHMGRFALAM..AQQSDGS..FVLLATERNLLML......NR..ASAEELQDHQCDIL-----

PF02744

GAL7_CRYNJ/204-373-------------------------------------------------------------.ESLP...HKRATL-----
GAL7_HAEIN/183-348-------------------------------------------------------------..ALS.EVHYKERT-----
GALT_STRMU/231-435-------------------------------------------------------------YNEMA.DYHKDWAD-----
GALT_BACSU/240-451-------------------------------------------------------------QNPLT.AKHSEWAL-----
GAL7_YEAST/198-366-------------------------------------------------------------..NLDGQIHYLQRL-----
GAL7_KLULA/195-363-------------------------------------------------------------..ALSGEVHYLAKL-----
GAL7_ECOLI/182-347-------------------------------------------------------------..AVS.DIHFRESG-----
GALT_HUMAN/202-370-------------------------------------------------------------..ALP.EVHYHLGQ-----

PF16285

D5DD06_BACMD/8-254LYF-----------------
C0ZAZ1_BREBN/8-252RYF-----------------
B2TPI8_CLOBB/11-256LYF-----------------
C9LU44_SELS3/8-252IYF-----------------
D9SRU9_CLOC7/9-253LYF-----------------
Q81VH8_BACAN/8-251.YF-----------------
U5LFA6_9BACI/8-252KYF-----------------

PF01087

GAL7_CRYNJ/15-198--------------------
Q7QA38_ANOGA/1-174--------------------
A5DRG5_PICGU/6-197--------------------
Q9CM11_PASMU/4-178--------------------
Q2H1V5_CHAGB/2-211--------------------
A4AQM0_MARSH/1-176--------------------
Q65CW7_BACLD/17-231--------------------
A9WJH8_CHLAA/4-191--------------------
A7MIY8_CROS8/2-176--------------------
Q03XA5_LEUMM/18-235--------------------
A3N102_ACTP2/3-177--------------------
GALT_STRMU/16-225--------------------
A5DWA9_LODEL/21-211--------------------
Q6D2C5_PECAS/1-175--------------------
Q1IQZ6_KORVE/1-177--------------------
Q6LQE3_PHOPR/15-189--------------------
A8LEI8_FRASN/19-211--------------------
Q59VY3_CANAL/21-210--------------------
A1L2D1_DANRE/7-181--------------------
A7F8S7_SCLS1/1-208--------------------
Q3XZ93_ENTFC/18-230--------------------
B1YII0_EXIS2/18-230--------------------
Q0RE52_FRAAA/14-191--------------------
Q21LR9_SACD2/5-180--------------------
GALT_STACT/19-233--------------------
GALT_LACPL/16-224--------------------
A8WVF3_CAEBR/2-179--------------------
A2AMS2_MOUSE/3-177--------------------
GAL7_NEUCR/2-217--------------------
A7TJY6_VANPO/4-190--------------------
A6RBX1_AJECN/45-253--------------------
GAL7_KLULA/1-189--------------------
Q5KY03_GEOKA/19-233--------------------
Q03PB0_LACBA/18-226--------------------
A2QCH5_ASPNC/2-209--------------------
A6WF46_KINRD/10-216--------------------
Q2J7D6_FRASC/3-201--------------------
A3QFA6_SHELP/9-182--------------------
GALT_BACHD/21-236--------------------
Q5WD06_BACSK/20-235--------------------
A0QYK5_MYCS2/3-199--------------------
GALT_LACSS/20-231--------------------
Q896X9_CLOTE/19-233--------------------
GALT_DROME/1-175--------------------
GAL7_SCHPO/4-195--------------------
B8I4V5_CLOCE/19-234--------------------
A3LR66_PICST/19-206--------------------
Q7N8Y8_PHOLL/4-178--------------------
Q73SK2_MYCPA/2-203--------------------
A8FIP9_BACP2/20-233--------------------
Q3IH81_PSEHT/3-176--------------------
A0M3B7_GRAFK/1-176--------------------
A5FKW9_FLAJ1/2-179--------------------
Q4PDD8_USTMA/31-214--------------------
Q15Y61_PSEA6/2-176--------------------
Q6C0K3_YARLI/1-190--------------------
Q6BVI6_DEBHA/3-194--------------------
Q2GAY3_NOVAD/2-175--------------------
GALT_CLOAB/17-229--------------------
GALT_ENTFA/20-232--------------------
Q30V51_DESAG/2-182--------------------
A9KN46_CLOPH/31-257--------------------
GALT_LACS1/18-228--------------------
A0KQH7_AERHH/2-174--------------------
A4VT89_STRSY/18-226--------------------
A5VME1_LACRD/16-220--------------------
E7KK61_YEASL/5-192--------------------
G0RTP4_HYPJQ/7-208--------------------
Q04GZ3_OENOB/18-225--------------------
Q5KLY2_CRYNJ/11-195--------------------
GALT_STRT2/18-226--------------------
Q5NEY1_FRATT/11-180--------------------
Q7MBX0_VIBVY/28-200--------------------
GALT2_STRR6/16-224--------------------
GALT1_STRR6/18-225--------------------
GALT_CLOPE/21-230--------------------
GALT_LACLA/19-228--------------------
U5L509_9BACI/19-230--------------------

PF16268

F5XH95_MICPN/8-422IAP.LRIGDEVL........
C3PH27_CORA7/1-419IASGIAIATECELKRNSLRY
B1VH78_CORU7/18-447LAPGIKLGEDIEHAPNKLKY
Q8NNU9_CORGL/1-424IASDLRIAMECSVERNSLKY
W5WQ34_9CORY/18-447LAPGIRLGDECAHTPNMLKY
W5Y1J6_9CORY/15-448VSPDLRIATECKVKRNSLRY
G0HAG7_CORVD/18-449LAPDLRLGNECVFQRSTLKY
U3GXR8_9CORY/26-464IARNIRIATECLLPRNSLRY
Q6NGG7_CORDI/11-432IDGSIRIATECSVRRNSLLY
S5SVS2_9CORY/15-437IDEGIRIAMECATGRNMLRY
B3QVF6_CHLT3/10-436IAFGVSIAEECPCKFNCLTY
Q6A5P1_PROAC/10-435IAA.MNLGDECEIPRGVL..
Q8FP08_COREF/15-438IDEEMRIATECSVQRNSLRY
F8E0G1_CORRG/18-447LAPGISLGEECTMRPNSLKY
C5CBF5_MICLC/33-463LADGVRIGADARARPGALRY
I6XY80_PROPF/27-452LAPEIRIATETRCRPNPLRY
R5PXK8_9PROT/14-442IAKGIKIAAECDCTPNCLLY
D7BLX6_ARCHD/14-437IAHNISIASECSNEPNSLKY
D9QB86_CORP2/15-442ISPNIRIATECAVQRNSLKY
X5DSS5_9CORY/40-471LAPGIRLGDEVDFHRNSLRY
M1P829_9CORY/11-432IARGIRISTECPAERNCLKY
D7GCR7_PROFC/13-438LADNILLDIECPAQYNSLMY
D7WEZ1_9CORY/10-431LADRLRIATECSPVRNALRY
C8XCI8_NAKMY/35-455IADTLRIGPECARVPNSLRY
C4LIB0_CORK4/15-440LADSVRIAGELTYRRNSLKY
K7RWS7_PROA4/29-464LAE.MRIGAECDLPRGVL..
D6ZJH6_MOBCV/17-441IAPSLRLGNEYRLPKDSL..

PF11969

Q5TVU2_ANOGA/17-126--------------------
A5DAJ7_PICGU/3-137--------------------
A5DAR3_PICGU/136-257--------------------
Q293N2_DROPS/5-112--------------------
Q293N2_DROPS/220-329--------------------
Q297L1_DROPS/153-272--------------------
Q29LN6_DROPS/45-159--------------------
HINT3_RAT/40-155--------------------
A0EGQ1_PARTE/118-231--------------------
A1CEC1_ASPCL/149-272--------------------
A3DF72_CLOTH/3-110--------------------
A3LWH2_PICST/136-257--------------------
A4S248_OSTLU/99-229--------------------
APTX_DROME/4-113--------------------
APTX_DROME/229-339--------------------
A4XKP5_CALS8/3-110--------------------
A5D7U9_BOVIN/174-293--------------------
A5E770_LODEL/177-298--------------------
A5GQU3_SYNR3/125-230--------------------
A5I635_CLOBH/3-110--------------------
A6QUC5_AJECN/141-262--------------------
A6VZM3_MARMS/2-109--------------------
A7HMY4_FERNB/3-108--------------------
A7S614_NEMVE/151-270--------------------
A7SFV5_NEMVE/10-122--------------------
A7TKH2_VANPO/142-261--------------------
A7TQ97_VANPO/171-297--------------------
YHIT_CHLTR/2-108--------------------
APTX_CHICK/142-252--------------------
APTX_DANRE/150-260--------------------
APTX_XENTR/173-283--------------------
APTX_CIOIN/206-317--------------------
Q0U2I6_PHANO/148-269--------------------
Q15X15_PSEA6/3-110--------------------
Q16F07_AEDAE/8-123--------------------
Q16XY1_AEDAE/224-343--------------------
Q16YN6_AEDAE/11-125--------------------
Q18227_CAEEL/10-129--------------------
Q1CY35_MYXXD/3-112--------------------
Q1QZ40_CHRSD/2-109--------------------
HINT3_XENTR/18-132--------------------
Q2H2H7_CHAGB/31-147--------------------
Q2H304_CHAGB/151-275--------------------
HINT3_BOVIN/47-162--------------------
Q3IJU5_PSEHT/4-111--------------------
Q4PA08_USTMA/46-158--------------------
Q54DF5_DICDI/36-141--------------------
Y2839_DICDI/224-348--------------------
Q59S51_CANAL/134-254--------------------
Q5TUI6_ANOGA/154-273--------------------
A8XGQ1_CAEBR/148-267--------------------
Q6BZT0_YARLI/136-263--------------------
Q6C515_YARLI/4-127--------------------
Q6C6M8_YARLI/30-153--------------------
Q6CJA1_KLULA/160-286--------------------
Q6FLB9_CANGA/198-323--------------------
Q6FWT2_CANGA/170-296--------------------
Q6IIA4_DROME/5-118--------------------
Q74ZD1_ASHGO/153-277--------------------
Q7PHF8_ANOGA/7-116--------------------
Q7QJM2_ANOGA/10-124--------------------
Q83DE2_COXBU/3-109--------------------
Q84VV6_ARATH/7-121--------------------
Q8GYJ9_ARATH/75-183--------------------
Q8SUA2_ENCCU/116-232--------------------
Q97JJ3_CLOAB/3-110--------------------
BH140_ARATH/717-833--------------------
DCPS_SCHPO/141-261--------------------
E7KRX8_YEASL/160-281--------------------
E7KUH0_YEASL/160-281--------------------
F1R776_DANRE/159-276--------------------
F7CC42_XENTR/161-276--------------------
H3C365_TETNG/54-161--------------------
H3CJX6_TETNG/127-244--------------------
H3DP42_TETNG/31-141--------------------
Q0JBF2_ORYSJ/25-136--------------------
Q5K774_CRYNJ/143-255--------------------
Q9VQ59_DROME/32-141--------------------

PF01230

HINT1_RAT/24-121--------------------
HNT2_YEAST/12-107--------------------
FHIT_HUMAN/11-105--------------------
APH1_SCHPO/12-106--------------------
APTX_YEAST/15-139--------------------
Q9I500_PSEAE/74-166--------------------
Q98BM9_RHILO/14-106--------------------
Y866_METJA/9-105--------------------
YHIT_MYCPN/19-116--------------------
APTX_SCHPO/44-156--------------------
YHIT_HELPY/9-104--------------------
HNT1_YEAST/32-125--------------------
Q9A2A9_CAUCR/9-106--------------------
YHIT_SYNY3/12-109--------------------
Y1390_SYNE7/12-109--------------------
YHI1_MYCLE/10-102--------------------
Y961_HAEIN/12-110--------------------
Q9JYE4_NEIMB/10-102--------------------
Q9KQC5_VIBCH/14-106--------------------
ZB14_MAIZE/24-123--------------------
HINT_CAEEL/28-125--------------------
G8AG53_AZOBR/16-114--------------------
K7XM15_MYCHR/14-110--------------------
YHI2_MYCTU/11-106--------------------
Q32EW3_SHIDS/12-109--------------------

PF04677

C3H64_ARATH/370-491--------------------
C19L1_CAEEL/309-429--------------------
C19L2_CAEEL/226-350--------------------
C19L2_DROME/460-584--------------------
CWF19_SCHPO/399-523--------------------
DRN1_YEAST/256-389--------------------
MU161_SCHPO/334-470--------------------
Q93ZX4_ARATH/458-582--------------------

PF02611

CDH_HELPY/24-243--------------------
G9AY12_PANAN/24-250--------------------
Q8P9Z9_XANCP/30-250--------------------
E8V0N7_TERSS/35-269--------------------
A8GL49_SERP5/45-264--------------------
E0SJ94_DICD3/33-253--------------------
CDH_YERPE/33-252--------------------
B8IMH8_METNO/37-256--------------------
W0LHA3_SERFO/26-254--------------------
B1M455_METRJ/29-249--------------------
Q1LBK3_RALME/33-250--------------------
Q6MQF2_BDEBA/30-256--------------------
G8MBN7_9BURK/67-288--------------------
A6TFQ8_KLEP7/24-243--------------------
H2INV4_RAHAC/31-250--------------------
B0U7T2_METS4/29-248--------------------
B2VF57_ERWT9/34-251--------------------
B9JRW8_AGRVS/27-242--------------------
D8IW24_HERSS/34-253--------------------
C5BB31_EDWI9/31-247--------------------
A9HJU4_GLUDA/35-256--------------------
B2JLJ5_BURP8/29-246--------------------
B1LSY8_METRJ/26-246--------------------
L0IYV5_MYCSM/29-248--------------------
B8IPC5_METNO/27-247--------------------
B2FII5_STRMK/27-247--------------------
CDH_CROS8/31-250--------------------
B8EQB5_METSB/40-259--------------------
B2HIW3_MYCMM/43-260--------------------
W0HRX4_9ENTR/35-254--------------------
E6WAG7_PANSA/33-250--------------------
B1M8V7_METRJ/69-294--------------------
D8MKK8_ERWBE/33-250--------------------
G2I2H3_GLUMN/36-254--------------------
Q6D6W9_PECAS/32-251--------------------
D2UA62_XANAP/30-247--------------------
CDH_MYCLE/38-255--------------------
Q13LU5_BURXL/41-259--------------------
Q7NQ26_CHRVO/27-251--------------------
K7SS21_GLUOY/32-232--------------------
R9VP92_9ENTR/32-251--------------------
Q0JZ98_CUPNH/25-246--------------------
H8L0L3_FRAAD/32-259--------------------
CDH_ECOLI/31-250--------------------
Q5FPM0_GLUOX/32-232--------------------
W0PFV2_9BURK/44-257--------------------
I2BEE8_SHIBC/29-247--------------------
CDH_MYCTU/41-258--------------------
U3U143_9ENTR/33-250--------------------
D5CGT2_ENTCC/45-264--------------------

PF02744

GAL7_CRYNJ/204-373--------------------
GAL7_HAEIN/183-348--------------------
GALT_STRMU/231-435--------------------
GALT_BACSU/240-451--------------------
GAL7_YEAST/198-366--------------------
GAL7_KLULA/195-363--------------------
GAL7_ECOLI/182-347--------------------
GALT_HUMAN/202-370--------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window