Sequence alignment for CL0266

PF14470

A1KX55_9CAUD/97-188LK..DNENIMY-VT...SG..-----------------------------------------------------------
B1BWF3_CLOPF/113-210LL..PNEEVKM-AF...IG..-----------------------------------------------------------
B6QZJ6_9RHOB/59-150LM..DGEQVLA-FT...SG..-----------------------------------------------------------
D0G8V7_CLOBO/33-124LR..EDEEIKY-MT...SG..-----------------------------------------------------------
Q73PJ3_TREDE/33-124MK..DSEHILY-LT...SG..-----------------------------------------------------------
Q8XP28_CLOPE/122-213LS..IDEHIKA-MT...SG..-----------------------------------------------------------
D4GR98_HALVD/78-183LN..ENEQPHY-YF...AN..-----------------------------------------------------------
D4GR98_HALVD/240-354LD..PDERVHY-LT...RG..-----------------------------------------------------------
C7N8P3_LEPBD/33-124IT..DNEVVTY-AT...SG..-----------------------------------------------------------
Q1CPJ8_STRPF/52-143LS..DDEIIQY-AT...SG..-----------------------------------------------------------
B4TIA1_SALHS/41-132LN..SGEQPLA-IA...SG..-----------------------------------------------------------
E6L634_9PROT/33-123LW..EDEIIKK-LE...EG..-----------------------------------------------------------
A7GAX1_CLOBL/113-210LM..GDEKVYM-TF...IG..-----------------------------------------------------------
Q9B015_9CAUD/43-134MR..ENEIISF-AT...SG..-----------------------------------------------------------
C9MW71_9FUSO/32-123IG..DDEIITY-AT...SG..-----------------------------------------------------------
D0ABI1_ENTFC/115-211LN..SDEYVIF-CF...VG..-----------------------------------------------------------
C2EMA4_9LACO/66-157MQ..DGEKIEY-AT...VG..-----------------------------------------------------------
C2NBD8_BACCE/105-201LM..NGEKIHM-TY...IG..-----------------------------------------------------------
A0RJ01_BACAH/12-110LT..NDETILF-YT...AC..-----------------------------------------------------------
D1Y7N3_9BACT/74-169LD..EGEVIEF-LT...SG..-----------------------------------------------------------
B0A9U9_9FIRM/35-125LG..DSEELLD-LT...PG..-----------------------------------------------------------
C2NVG4_BACCE/15-112LH..KEEKILS-TL...KC..-----------------------------------------------------------
C5QQG0_STAEP/16-114LN..ESEELQY-VI...EG..-----------------------------------------------------------
C9S1F4_GEOSY/15-114LE..PGEQVVA-SV...LG..-----------------------------------------------------------
D9STE0_CLOC7/154-250LN..PDEEVLL-CF...CG..-----------------------------------------------------------
D4YUJ5_9LACO/65-159MQEHDDEKIVY-AA...IG..-----------------------------------------------------------
C2WDE4_BACCE/12-110LY..EDENIVS-YM...KC..-----------------------------------------------------------
F0BTF6_9XANT/28-122LT..RDEQVEY-IAVQKKM..-----------------------------------------------------------
C2RX88_BACCE/12-111VS..SDEKVLD-VL...QG..-----------------------------------------------------------
F0PPB5_BACT0/12-116LN..SEENILS-TL...YC..-----------------------------------------------------------
A0M4L3_GRAFK/28-124LT..REEKIEY-IA...VQKK-----------------------------------------------------------
C2PSH1_BACCE/35-136LH..HEENILS-TL...RC..-----------------------------------------------------------
E4SKV3_LACAR/66-157LS..DHEKIEY-AA...LG..-----------------------------------------------------------
C2X664_BACCE/12-105VD..DDEKILA-FV...VG..-----------------------------------------------------------
Q4L537_STAHJ/16-114LH..DNETIIY-AI...FG..-----------------------------------------------------------
B1RCX7_CLOPF/12-109LD..YDERPLC-YL...KC..-----------------------------------------------------------
D5BGD3_ZUNPS/37-134LT..RNENVEY-VA...VQKK-----------------------------------------------------------
C3I3B9_BACTU/68-162LL..PEETICY-SF...AQ..-----------------------------------------------------------
A2BKM8_HYPBU/14-108LE..PDEAIIK-AV...KQ..-----------------------------------------------------------
B3Z200_BACCE/12-116LQ..SNEEVIS-TL...YC..-----------------------------------------------------------
Q5JHI4_PYRKO/17-110LE..PDERVLF-AI...KK..-----------------------------------------------------------
Y689_ARCFU/15-109LY..PGEDVLY-SVK.KKL..-----------------------------------------------------------
F0NRS4_LACHH/66-157VK..DEEIIQY-AA...IG..-----------------------------------------------------------
E5WCD5_9BACI/12-111LY..EGETIIE-CL...SC..-----------------------------------------------------------
A3J3Z6_9FLAO/29-125LM..SNEEVGY-IA...VQ..-----------------------------------------------------------
Q6HPH0_BACHK/12-105LE..NDENIVA-FV...IG..-----------------------------------------------------------
A3V5V9_9RHOB/43-146LQ..KDEVVFA-LV...SG..-----------------------------------------------------------
C6XZU2_PEDHD/28-124LT..SNEELIY-MA...VQKK-----------------------------------------------------------
D7VUF4_9FLAO/27-123LT..SQEFVEY-IA...VQKK-----------------------------------------------------------
C2Z256_BACCE/12-105VE..DDEQILA-FV...IG..-----------------------------------------------------------
A0RV76_CENSY/18-109LR..DGEEILL-TV...TQ..-----------------------------------------------------------
A9VQB7_BACWK/12-105VE..DDEKILA-FV...VG..-----------------------------------------------------------
A5FK72_FLAJ1/29-125LM..KGEEVGY-IA...VQ..-----------------------------------------------------------
C2FZ39_9SPHI/27-123LT..AGEQIDY-IA...LQ..-----------------------------------------------------------
F0LI97_THEBM/14-108LY..PDEDVLY-AI...KK..-----------------------------------------------------------
A6DLU2_9BACT/54-148LE..KDERIKY-FY..SDG..-----------------------------------------------------------
D4RW70_9FIRM/218-308LF..DNEAYEF-VF...GG..-----------------------------------------------------------
B0ABX6_9FIRM/8-108LK..EDENILA-SL...KC..-----------------------------------------------------------
YOKE_BACSU/50-157VG..KKEKILH-MT...SA..-----------------------------------------------------------
A3ICZ3_9BACI/33-123VD..EEEIVEG-VA...IL..-----------------------------------------------------------
D3D498_9ACTO/29-119LW..AGELVTD-MA...RG..-----------------------------------------------------------
B9E7P9_MACCJ/52-151IK..NKELIYF-AS...YS..-----------------------------------------------------------
F0KC11_CLOAE/16-129LK..KSDSVLY-YC...YG..-----------------------------------------------------------
A7GMF6_BACCN/23-116LE..CGEKILA-YT...NG..-----------------------------------------------------------
B9DJ09_STACT/11-105LF..PTEQIES-SV...LG..-----------------------------------------------------------
Q63DC4_BACCZ/62-170LQ..EGEKIEC-EI...LV..-----------------------------------------------------------
E8SGW4_STAPH/11-105LF..PTEHIET-SV...LG..-----------------------------------------------------------
C2VL18_BACCE/51-157MK..AKENIHY-FE...VA..-----------------------------------------------------------

PF08000

Q1YDV8_MOBAS/1-123MGLISGLMGLS-SDA..DA-------------------------------------------------------------
Q4JTR2_CORJK/12-120I..........-.....EE-------------------------------------------------------------
A3CQI4_STRSV/1-125MGLFGGLLGNA-SQK..DI-------------------------------------------------------------
Q832M1_ENTFA/1-125MGLFDGLLGNA-TQN..NN-------------------------------------------------------------
YOZO_BACSU/1-113MGIFSV.....-.....SR-------------------------------------------------------------
Q813J1_BACCR/1-124MGLFSGILGNA-SNT..SS-------------------------------------------------------------
Q1ZV35_PHOAS/1-124MGLFNALLGNA-GEM..SI-------------------------------------------------------------
A0Y4W4_9GAMM/1-124MGLLSGLMGNA-SEV..DD-------------------------------------------------------------
A9AYV8_HERA2/1-124MGLFDGLMGNA-SEV..DP-------------------------------------------------------------
Q5N1D6_SYNP6/1-122MQEFKSAIGLA-P....VD-------------------------------------------------------------
YJQA_BACSU/1-125MGFIDGLLGNA-STL..ST-------------------------------------------------------------
A4VWQ3_STRSY/14-138MGLFSGLLGNA-SQM..DN-------------------------------------------------------------
A3XIK4_LEEBM/1-125MSIIDRILGNA-SEM..SL-------------------------------------------------------------
Q65II6_BACLD/1-113MGVFSA.....-.....SK-------------------------------------------------------------
Q2B2E1_9BACI/6-134ASDVLGISDIG-SVI..SP-------------------------------------------------------------
A0YP44_LYNSP/1-126MGLIGGLLGNA-SELKADG-------------------------------------------------------------
A1APA7_PELPD/1-124MGLFTGTTKAG-GSA..EI-------------------------------------------------------------
A4CBQ0_9GAMM/1-124MGLLSGLMGNA-SEV..DG-------------------------------------------------------------
A3J144_9FLAO/1-125MGLFSALLGNA-GAV..NQ-------------------------------------------------------------
Q1GUI3_SPHAL/1-119MGLFS.....A-GDL..DV-------------------------------------------------------------
YVBH_BACSU/6-134AADALGLSDIG-KII..EP-------------------------------------------------------------
B0UJV9_METS4/1-124MGLLDGLLGHG-SDA..AP-------------------------------------------------------------
Q5M368_STRT2/1-125MGIFSGLLGNA-SKK..DN-------------------------------------------------------------
A2U3F1_9FLAO/1-125MGLFNKILGNA-SEV..SS-------------------------------------------------------------
Q2LS73_SYNAS/2-125EGLIGGQMGLL-SMQE.LV-------------------------------------------------------------
A1S3D0_SHEAM/1-124MGFLDALMGNA-SEV..DL-------------------------------------------------------------
A4QHX3_CORGB/1-122MSNEVGAITSW-TFV..QE-------------------------------------------------------------
A5UL39_METS3/1-109MAFLDKVIGHG-DVS..EE-------------------------------------------------------------
Q3K1T3_STRA1/1-125MGIFSGLMGNA-SQM..DT-------------------------------------------------------------
A0LZE1_GRAFK/1-125MSILSSLLGNA-GAI..EK-------------------------------------------------------------
A6CNL3_9BACI/6-134ASDALGLSDIG-KII..KR-------------------------------------------------------------
A7GD79_CLOBL/1-124MGLFNGLMGNA-SEV..NI-------------------------------------------------------------
Q6ANG9_DESPS/2-124IDFDKSELFKL-KPI..DN-------------------------------------------------------------
Q8ELK9_OCEIH/1-124MGLFDGIMGNA-SEV..DN-------------------------------------------------------------
A8FE59_BACP2/1-112MGIFS......-.....VS-------------------------------------------------------------
A1VMG6_POLNA/1-124MGLLDGMMGNA-SKI..DA-------------------------------------------------------------
Q5Z2E2_NOCFA/1-124MGLIDGLMGNA-GRV..DP-------------------------------------------------------------
B8FYR8_DESHD/1-124MGIFSGMMGNA-SEI..DT-------------------------------------------------------------
Q11IY3_MESSB/1-124MGILNGLLGHG-SEV..DA-------------------------------------------------------------
Q1VFT1_VIBAL/2-124IDFDNSSVFKL-KPI..DV-------------------------------------------------------------
A8H0K5_SHEPA/1-124MGLLDSLMGNA-SEV..NL-------------------------------------------------------------
B8E5Z2_SHEB2/1-124MGLLDGLLGNA-SEV..DL-------------------------------------------------------------
C3E964_BACTU/6-134AADVLGLSDVG-SVI..TP-------------------------------------------------------------
A5GZ01_9CAUD/2-124IDFNNASFIKL-KPT..ND-------------------------------------------------------------
A0JTP3_ARTS2/1-111M..........-.FV..TE-------------------------------------------------------------
Q9F325_STRCO/1-120MALF....GNA-HSI..DP-------------------------------------------------------------
Q15NS1_PSEA6/1-123MGLLDAIMGNA-SEI..DV-------------------------------------------------------------
A6N235_9CAUD/15-120I..........-.......-------------------------------------------------------------
A3I5Y5_9BACI/1-124MGLFDGLIGNA-SEV..NF-------------------------------------------------------------
C5B2T2_METEA/1-124MGLLDGLLGHG-SDL..SA-------------------------------------------------------------
B1YH35_EXIS2/1-122MSNPLSQL.AW-TFV..SE-------------------------------------------------------------
Q723Y5_LISMF/1-127M..LDKLLGKA-AVV....-------------------------------------------------------------
Q1VZB8_9FLAO/1-125MGLFSSLLGNA-GAV..DK-------------------------------------------------------------
B1YJX4_EXIS2/6-134AADLTGFSDIG-QVI..HP-------------------------------------------------------------
A6DLR5_9BACT/1-133MGFFQGLFGNY-SEV..SL-------------------------------------------------------------

PF03703

Q1HA10_9ZZZZ/54-129--------------------------------------------------------------------------------
A5N1P5_CLOK5/62-141--------------------------------------------------------------------------------
C4XRD2_DESMR/88-163--------------------------------------------------------------------------------
Q9JPA9_RUBGE/102-193--------------------------------------------------------------------------------
A2BXQ3_PROM5/40-114--------------------------------------------------------------------------------
Q2N679_ERYLH/79-158--------------------------------------------------------------------------------
Q05WK2_9SYNE/41-115--------------------------------------------------------------------------------
O26822_METTH/90-166--------------------------------------------------------------------------------
A7B794_RUMGN/68-144--------------------------------------------------------------------------------
A5N1P4_CLOK5/81-157--------------------------------------------------------------------------------
A3Z634_9SYNE/41-115--------------------------------------------------------------------------------
B5INT9_9CHRO/45-119--------------------------------------------------------------------------------
Q6HMA1_BACHK/59-139--------------------------------------------------------------------------------
Q8YRN0_NOSS1/39-113--------------------------------------------------------------------------------
A8LQ34_DINSH/96-187--------------------------------------------------------------------------------
A5BQ81_VITVI/109-183--------------------------------------------------------------------------------
C5C9H6_MICLC/78-153--------------------------------------------------------------------------------
Q8CJW8_STRCO/479-556--------------------------------------------------------------------------------
Q8S7W8_ORYSJ/97-171--------------------------------------------------------------------------------
Q92DD3_LISIN/73-149--------------------------------------------------------------------------------
YDBT_BACSU/406-486--------------------------------------------------------------------------------
A0JUF8_ARTS2/86-161--------------------------------------------------------------------------------
Q0S416_RHOSR/85-163--------------------------------------------------------------------------------
A0YYM4_LYNSP/32-106--------------------------------------------------------------------------------
Q5KZA4_GEOKA/394-472--------------------------------------------------------------------------------
Q7TWU1_MYCBO/82-157--------------------------------------------------------------------------------
A4X9A7_SALTO/98-177--------------------------------------------------------------------------------
A1S9Q9_SHEAM/70-149--------------------------------------------------------------------------------
Q721T2_LISMF/403-484--------------------------------------------------------------------------------
Q5V3H6_HALMA/457-539--------------------------------------------------------------------------------
Q83YH0_RUBGE/102-193--------------------------------------------------------------------------------
Q132N9_RHOPS/92-183--------------------------------------------------------------------------------
B6SR38_MAIZE/97-171--------------------------------------------------------------------------------
A2C406_PROM1/41-115--------------------------------------------------------------------------------
Q2B513_9BACI/394-474--------------------------------------------------------------------------------
A6CG36_9PLAN/173-250--------------------------------------------------------------------------------
A4X9A6_SALTO/93-171--------------------------------------------------------------------------------
B4WGH0_9SYNE/39-113--------------------------------------------------------------------------------
Q0RP62_FRAAA/86-163--------------------------------------------------------------------------------
Q63ES8_BACCZ/238-321--------------------------------------------------------------------------------
A0JR89_ARTS2/421-499--------------------------------------------------------------------------------
B4W1I4_9CYAN/22-96--------------------------------------------------------------------------------
A0QQT0_MYCS2/68-149--------------------------------------------------------------------------------
A4CRN2_SYNPV/41-115--------------------------------------------------------------------------------
B8LD31_THAPS/35-108--------------------------------------------------------------------------------
A0M124_GRAFK/406-482--------------------------------------------------------------------------------
A3PE34_PROM0/40-114--------------------------------------------------------------------------------
B7KVD9_METC4/78-172--------------------------------------------------------------------------------
Q6NJ02_CORDI/358-436--------------------------------------------------------------------------------
YPU5_RHOCA/95-187--------------------------------------------------------------------------------
A4ACP9_9GAMM/95-186--------------------------------------------------------------------------------
Q03UQ0_LEUMM/60-139--------------------------------------------------------------------------------
A4INK5_GEOTN/61-142--------------------------------------------------------------------------------
A8I741_CHLRE/23-98--------------------------------------------------------------------------------
Q52V71_9ACTO/422-499--------------------------------------------------------------------------------
Q1VZX2_9FLAO/423-499--------------------------------------------------------------------------------
Q1PL87_PROMR/40-114--------------------------------------------------------------------------------
Q0A9I7_ALHEH/434-510--------------------------------------------------------------------------------
Q0TSV7_CLOP1/311-394--------------------------------------------------------------------------------
A7GLR9_BACCN/66-145--------------------------------------------------------------------------------
A2XD07_ORYSI/97-171--------------------------------------------------------------------------------
A4C2S8_9FLAO/260-345--------------------------------------------------------------------------------
Q5HEC8_STAAC/67-143--------------------------------------------------------------------------------
A0ZDC0_NODSP/39-113--------------------------------------------------------------------------------
B4FUN4_MAIZE/96-170--------------------------------------------------------------------------------
Q0DUR5_ORYSJ/97-171--------------------------------------------------------------------------------
Q2S4T2_SALRD/280-363--------------------------------------------------------------------------------
Q07RX8_RHOP5/92-183--------------------------------------------------------------------------------
Q1VZX2_9FLAO/274-357--------------------------------------------------------------------------------
B2J0Q4_NOSP7/39-113--------------------------------------------------------------------------------
Q49Z28_STAS1/72-148--------------------------------------------------------------------------------
Q1AYV8_RUBXD/67-148--------------------------------------------------------------------------------
Q949S6_ARATH/104-178--------------------------------------------------------------------------------
Q10VQ2_TRIEI/39-113--------------------------------------------------------------------------------
Q03T95_LACBA/71-147--------------------------------------------------------------------------------
Q3AV40_SYNS9/40-114--------------------------------------------------------------------------------
A5USV1_ROSS1/73-149--------------------------------------------------------------------------------
Q0TQ92_CLOP1/75-151--------------------------------------------------------------------------------
A7B9U4_9ACTO/406-484--------------------------------------------------------------------------------
A4ILF0_GEOTN/382-461--------------------------------------------------------------------------------
Q0A9I7_ALHEH/77-156--------------------------------------------------------------------------------
A1WXI2_HALHL/93-184--------------------------------------------------------------------------------
B7G849_PHATC/47-120--------------------------------------------------------------------------------
Q0TSV7_CLOP1/77-157--------------------------------------------------------------------------------
A7B793_RUMGN/74-155--------------------------------------------------------------------------------
B7KHE2_CYAP7/39-113--------------------------------------------------------------------------------
A5UZJ9_ROSS1/78-155--------------------------------------------------------------------------------
A6U3F8_STAA2/74-150--------------------------------------------------------------------------------
A6DYF7_9RHOB/94-185--------------------------------------------------------------------------------
A7A966_BIFAD/22-101--------------------------------------------------------------------------------
Q3IJZ4_PSEHT/76-156--------------------------------------------------------------------------------
Q73CA2_BACC1/388-464--------------------------------------------------------------------------------
Q9M9S8_ARATH/339-413--------------------------------------------------------------------------------
A1SMF8_NOCSJ/73-149--------------------------------------------------------------------------------
Q7U523_SYNPX/40-114--------------------------------------------------------------------------------
Q16DS6_ROSDO/94-185--------------------------------------------------------------------------------
A4X385_SALTO/78-154--------------------------------------------------------------------------------
A7B9U4_9ACTO/86-165--------------------------------------------------------------------------------
B6B3P5_9RHOB/94-185--------------------------------------------------------------------------------
A7GLR9_BACCN/269-351--------------------------------------------------------------------------------
A4AI68_9ACTN/73-148--------------------------------------------------------------------------------
A3Z0J2_9SYNE/41-115--------------------------------------------------------------------------------
Q3AM30_SYNSC/40-114--------------------------------------------------------------------------------
Q7VB01_PROMA/40-114--------------------------------------------------------------------------------
A3J6N0_9FLAO/71-152--------------------------------------------------------------------------------
Q6A731_PROAC/79-153--------------------------------------------------------------------------------
Q8GPI5_STAAU/65-145--------------------------------------------------------------------------------
Q4C5Y4_CROWT/39-113--------------------------------------------------------------------------------
A0NKK3_OENOE/413-495--------------------------------------------------------------------------------
A2C7A2_PROM3/40-114--------------------------------------------------------------------------------
A6FPZ3_9RHOB/96-187--------------------------------------------------------------------------------
A6G2U2_9DELT/86-163--------------------------------------------------------------------------------
Q05YV4_9SYNE/40-114--------------------------------------------------------------------------------
Q3IQW3_NATPD/58-137--------------------------------------------------------------------------------
A7VBS0_9CLOT/23-100--------------------------------------------------------------------------------
Q2JF56_FRASC/78-154--------------------------------------------------------------------------------
Q52V71_9ACTO/80-161--------------------------------------------------------------------------------
F2G2I3_ALTMD/454-530--------------------------------------------------------------------------------
A0Y0J5_9GAMM/280-360--------------------------------------------------------------------------------
A8YDE5_MICAE/39-113--------------------------------------------------------------------------------
Q7V0R9_PROMP/40-114--------------------------------------------------------------------------------
Q2NEQ5_METST/106-182--------------------------------------------------------------------------------
B1YH17_EXIS2/61-141--------------------------------------------------------------------------------
Q5QU90_IDILO/71-150--------------------------------------------------------------------------------
Q03UP9_LEUMM/73-149--------------------------------------------------------------------------------
Q086M2_SHEFN/453-529--------------------------------------------------------------------------------
Q92DD2_LISIN/68-148--------------------------------------------------------------------------------
A0NKK3_OENOE/79-160--------------------------------------------------------------------------------
Q8XM54_CLOPE/456-535--------------------------------------------------------------------------------
Q0W0T7_UNCMA/387-467--------------------------------------------------------------------------------
Q3JEQ1_NITOC/43-119--------------------------------------------------------------------------------
Q2JNH7_SYNJB/39-113--------------------------------------------------------------------------------
Q21G74_SACD2/81-160--------------------------------------------------------------------------------
Q2Z019_9CHLR/216-306--------------------------------------------------------------------------------
Q8XK94_CLOPE/57-138--------------------------------------------------------------------------------
Q8L2A0_PROVU/52-129--------------------------------------------------------------------------------
D1N2C5_9BACT/85-162--------------------------------------------------------------------------------
C1N978_MICPC/163-238--------------------------------------------------------------------------------
Q4UQ21_XANC8/70-149--------------------------------------------------------------------------------
Q9KC53_BACHD/397-477--------------------------------------------------------------------------------
A0M123_GRAFK/89-168--------------------------------------------------------------------------------
Q5NX64_AROAE/73-152--------------------------------------------------------------------------------
Q8ELM2_OCEIH/63-143--------------------------------------------------------------------------------
Q6NJ02_CORDI/83-162--------------------------------------------------------------------------------
D0CLT0_9SYNE/40-114--------------------------------------------------------------------------------
D7E125_NOSA0/39-113--------------------------------------------------------------------------------
A9NAV6_COXBR/84-159--------------------------------------------------------------------------------
B7K5U4_CYAP8/39-113--------------------------------------------------------------------------------
Q0S417_RHOSR/271-354--------------------------------------------------------------------------------
Q7UGR8_RHOBA/447-530--------------------------------------------------------------------------------
A8H7X9_SHEPA/99-178--------------------------------------------------------------------------------
Q8ELM2_OCEIH/411-490--------------------------------------------------------------------------------
Q1LGU6_RALME/27-104--------------------------------------------------------------------------------
A0PYF4_CLONN/263-346--------------------------------------------------------------------------------
A9DA93_9RHIZ/98-189--------------------------------------------------------------------------------
Q26E06_FLABB/272-354--------------------------------------------------------------------------------
A3IZS9_9CHRO/39-113--------------------------------------------------------------------------------
Q8DL95_THEEB/154-228--------------------------------------------------------------------------------
B5W8W6_SPIMA/39-113--------------------------------------------------------------------------------
Q0BW05_GRABC/100-175--------------------------------------------------------------------------------
Q0I8C4_SYNS3/41-115--------------------------------------------------------------------------------
Q7UG90_RHOBA/131-208--------------------------------------------------------------------------------
A1ZJ65_9BACT/38-113--------------------------------------------------------------------------------
Q46JN3_PROMT/41-115--------------------------------------------------------------------------------
A4C2S8_9FLAO/74-153--------------------------------------------------------------------------------
P74154_SYNY3/39-113--------------------------------------------------------------------------------
A3VXW4_9RHOB/94-185--------------------------------------------------------------------------------
A4VC01_BACUN/66-143--------------------------------------------------------------------------------
Q219Q4_RHOPB/92-183--------------------------------------------------------------------------------
D3LLG2_MICLU/78-153--------------------------------------------------------------------------------
A0Y0J7_9GAMM/81-160--------------------------------------------------------------------------------
A5ZQI3_9FIRM/16-93--------------------------------------------------------------------------------
C1E7H3_MICSR/155-230--------------------------------------------------------------------------------
A9BBJ1_PROM4/40-114--------------------------------------------------------------------------------
Q5MG95_IPOBA/97-168--------------------------------------------------------------------------------
Q5WBQ3_BACSK/413-492--------------------------------------------------------------------------------
A5CP90_CLAM3/129-207--------------------------------------------------------------------------------
E0U6K0_CYAP2/39-113--------------------------------------------------------------------------------
A8LDS5_FRASN/354-432--------------------------------------------------------------------------------
Q319V0_PROM9/40-114--------------------------------------------------------------------------------
A7BCE4_9ACTO/77-152--------------------------------------------------------------------------------
A5GN11_SYNPW/41-115--------------------------------------------------------------------------------
B4U7M5_HYDS0/110-189--------------------------------------------------------------------------------
B0JN61_MICAN/39-113--------------------------------------------------------------------------------
Q3BNL4_XANC5/409-490--------------------------------------------------------------------------------
Q21G75_SACD2/67-146--------------------------------------------------------------------------------
A3WHT6_9SPHN/102-193--------------------------------------------------------------------------------
A3ZL30_9PLAN/70-147--------------------------------------------------------------------------------
B4SKG8_STRM5/92-171--------------------------------------------------------------------------------
A6L372_BACV8/68-142--------------------------------------------------------------------------------
B1X5C5_PAUCH/39-113--------------------------------------------------------------------------------
Q3M7J5_ANAVT/39-113--------------------------------------------------------------------------------
Q7V611_PROMM/40-114--------------------------------------------------------------------------------
A3J6N0_9FLAO/260-345--------------------------------------------------------------------------------
B0CDM0_ACAM1/39-113--------------------------------------------------------------------------------
Q18HZ1_HALWD/71-148--------------------------------------------------------------------------------
B9HVA0_POPTR/105-179--------------------------------------------------------------------------------
A5IAX6_LEGPC/63-138--------------------------------------------------------------------------------
Q18K27_HALWD/63-142--------------------------------------------------------------------------------
A8G5Y3_PROM2/40-114--------------------------------------------------------------------------------
Q9KC53_BACHD/249-335--------------------------------------------------------------------------------
Q2JXB7_SYNJA/39-113--------------------------------------------------------------------------------
B1WWJ1_CYAA5/39-113--------------------------------------------------------------------------------
Q58PP7_9PROT/102-193--------------------------------------------------------------------------------
B8HR49_CYAP4/39-113--------------------------------------------------------------------------------
Q2S103_SALRD/46-123--------------------------------------------------------------------------------
B9P2Z9_PROMR/37-111--------------------------------------------------------------------------------
Q31MS3_SYNE7/39-113--------------------------------------------------------------------------------
A3CWW6_METMJ/72-152--------------------------------------------------------------------------------
B1XJD3_SYNP2/39-113--------------------------------------------------------------------------------
A5N1P5_CLOK5/245-328--------------------------------------------------------------------------------
Q5N604_SYNP6/39-113--------------------------------------------------------------------------------
C7QSQ1_CYAP0/39-113--------------------------------------------------------------------------------
B1YH17_EXIS2/235-317--------------------------------------------------------------------------------
A8DJC1_9BACT/77-153--------------------------------------------------------------------------------
A3TM09_9MICO/97-176--------------------------------------------------------------------------------
B9S293_RICCO/108-182--------------------------------------------------------------------------------
A0PYF4_CLONN/58-140--------------------------------------------------------------------------------
Q2BC10_9BACI/64-144--------------------------------------------------------------------------------

PF08512

E3JV35_PUCGT/378-471--------------------------------------------------------------------------------
SPT16_CRYNJ/823-913--------------------------------------------------------------------------------
MU183_SCHPO/224-312--------------------------------------------------------------------------------
A0D1L5_PARTE/272-363--------------------------------------------------------------------------------
A0DSI1_PARTE/255-346--------------------------------------------------------------------------------
A2DGX1_TRIVA/315-409--------------------------------------------------------------------------------
RT106_ASPNC/254-348--------------------------------------------------------------------------------
A3LUL0_PICST/372-466--------------------------------------------------------------------------------
A3LUQ9_PICST/282-380--------------------------------------------------------------------------------
RT106_MAGO7/271-365--------------------------------------------------------------------------------
A4RSB9_OSTLU/241-330--------------------------------------------------------------------------------
A5DBS4_PICGU/383-476--------------------------------------------------------------------------------
RT106_PICGU/253-354--------------------------------------------------------------------------------
RT106_LODEL/273-372--------------------------------------------------------------------------------
A5K9I5_PLAVS/838-928--------------------------------------------------------------------------------
A6QQT5_BOVIN/338-428--------------------------------------------------------------------------------
A7AMU7_BABBO/345-437--------------------------------------------------------------------------------
A7ATG3_BABBO/682-772--------------------------------------------------------------------------------
A7EF87_SCLS1/222-319--------------------------------------------------------------------------------
A7EHR1_SCLS1/823-913--------------------------------------------------------------------------------
A7EPG7_SCLS1/122-216--------------------------------------------------------------------------------
A7SAG6_NEMVE/329-422--------------------------------------------------------------------------------
A7SV15_NEMVE/817-907--------------------------------------------------------------------------------
A8B8A9_GIAIC/457-556--------------------------------------------------------------------------------
A8JHE3_CHLRE/834-924--------------------------------------------------------------------------------
A8NIX9_COPC7/281-392--------------------------------------------------------------------------------
A8NQK0_COPC7/350-445--------------------------------------------------------------------------------
A8PHT4_BRUMA/819-909--------------------------------------------------------------------------------
A8Q169_MALGO/420-513--------------------------------------------------------------------------------
A9TYN6_PHYPA/829-919--------------------------------------------------------------------------------
A9UWZ2_MONBE/130-221--------------------------------------------------------------------------------
B0D3X0_LACBS/691-781--------------------------------------------------------------------------------
B0EBA0_ENTDS/238-331--------------------------------------------------------------------------------
B0WV30_CULQU/164-253--------------------------------------------------------------------------------
B2AEJ4_PODAN/271-367--------------------------------------------------------------------------------
B2WB70_PYRTR/816-906--------------------------------------------------------------------------------
B3LP50_YEAS1/219-308--------------------------------------------------------------------------------
B3RJ01_TRIAD/796-886--------------------------------------------------------------------------------
B3S4B9_TRIAD/339-431--------------------------------------------------------------------------------
B4MYD4_DROWI/338-428--------------------------------------------------------------------------------
B5DPP2_DROPS/812-902--------------------------------------------------------------------------------
B6K3E4_SCHJY/354-447--------------------------------------------------------------------------------
B6Q860_PENMQ/277-371--------------------------------------------------------------------------------
B6SH59_MAIZE/359-454--------------------------------------------------------------------------------
B7FSR1_PHATC/830-920--------------------------------------------------------------------------------
B7Q220_IXOSC/338-428--------------------------------------------------------------------------------
B8C388_THAPS/329-429--------------------------------------------------------------------------------
B8N5D9_ASPFN/836-926--------------------------------------------------------------------------------
B9FEF3_ORYSJ/819-909--------------------------------------------------------------------------------
B9PYN6_TOXGO/951-1041--------------------------------------------------------------------------------
C0SF36_PARBP/419-513--------------------------------------------------------------------------------
C1EF78_MICSR/357-451--------------------------------------------------------------------------------
C1EGI9_MICSR/255-341--------------------------------------------------------------------------------
C1MGW4_MICPC/827-917--------------------------------------------------------------------------------
C1N716_MICPC/352-450--------------------------------------------------------------------------------
C3YLD4_BRAFL/809-899--------------------------------------------------------------------------------
C3Z3Y2_BRAFL/337-427--------------------------------------------------------------------------------
C4JJX0_UNCRE/248-343--------------------------------------------------------------------------------
C4M3K5_ENTHI/527-619--------------------------------------------------------------------------------
C4R4T9_PICPG/190-282--------------------------------------------------------------------------------
C4V834_NOSCE/640-728--------------------------------------------------------------------------------
C4VA45_NOSCE/300-390--------------------------------------------------------------------------------
C4XW15_CLAL4/363-457--------------------------------------------------------------------------------
C4XWH5_CLAL4/282-381--------------------------------------------------------------------------------
C4YJJ1_CANAW/361-455--------------------------------------------------------------------------------
C5DD23_LACTC/203-292--------------------------------------------------------------------------------
C5DLM5_LACTC/832-922--------------------------------------------------------------------------------
C5KH74_PERM5/339-433--------------------------------------------------------------------------------
C5M9F0_CANTT/250-349--------------------------------------------------------------------------------
C5MDR0_CANTT/801-891--------------------------------------------------------------------------------
C7GW05_YEAS2/381-475--------------------------------------------------------------------------------
C7Z9V4_NECH7/370-464--------------------------------------------------------------------------------
C9SCC5_VERA1/256-347--------------------------------------------------------------------------------
D0NNZ6_PHYIT/339-439--------------------------------------------------------------------------------
D2HYC0_AILME/786-876--------------------------------------------------------------------------------
D2VV01_NAEGR/360-450--------------------------------------------------------------------------------
D3AWW1_POLPA/841-931--------------------------------------------------------------------------------
D3AXH6_POLPA/368-466--------------------------------------------------------------------------------
D4D4T0_TRIVH/279-374--------------------------------------------------------------------------------
D5G7P9_TUBMM/814-904--------------------------------------------------------------------------------
D5G911_TUBMM/234-326--------------------------------------------------------------------------------
D5GN86_TUBMM/370-466--------------------------------------------------------------------------------
D7FLF8_ECTSI/341-441--------------------------------------------------------------------------------
D7FPY1_ECTSI/806-907--------------------------------------------------------------------------------
D8LUR8_BLAHO/80-165--------------------------------------------------------------------------------
D8LVG5_BLAHO/621-711--------------------------------------------------------------------------------
D8PY95_SCHCM/356-448--------------------------------------------------------------------------------
D8SZS6_SELML/346-442--------------------------------------------------------------------------------
D8TSG5_VOLCA/120-188--------------------------------------------------------------------------------
D8U9V6_VOLCA/356-451--------------------------------------------------------------------------------
E0VDU0_PEDHC/338-428--------------------------------------------------------------------------------
E2LU78_MONPE/65-164--------------------------------------------------------------------------------
E3K8A4_PUCGT/841-931--------------------------------------------------------------------------------
E3LF48_CAERE/802-892--------------------------------------------------------------------------------
E3N6Q4_CAERE/338-430--------------------------------------------------------------------------------
E3QQA8_COLGM/254-348--------------------------------------------------------------------------------
E4WR67_OIKDI/341-431--------------------------------------------------------------------------------
E4YKA6_OIKDI/21-111--------------------------------------------------------------------------------
E4ZT07_LEPMJ/588-682--------------------------------------------------------------------------------
E5A724_LEPMJ/8-89--------------------------------------------------------------------------------
E5RZ09_TRISP/385-475--------------------------------------------------------------------------------
E6REF3_CRYGW/369-463--------------------------------------------------------------------------------
E6ZPS6_SPORE/385-478--------------------------------------------------------------------------------
E7LIV2_TRYCR/395-493--------------------------------------------------------------------------------
E7R3F7_PICAD/361-455--------------------------------------------------------------------------------
E7R8M3_PICAD/192-282--------------------------------------------------------------------------------
E9AM77_LEIMU/797-887--------------------------------------------------------------------------------
E9AYL3_LEIMU/445-531--------------------------------------------------------------------------------
E9CGL5_CAPO3/770-860--------------------------------------------------------------------------------
E9CHA3_CAPO3/447-533--------------------------------------------------------------------------------
E9DTZ0_METAQ/822-912--------------------------------------------------------------------------------
E9DVQ4_METAQ/243-337--------------------------------------------------------------------------------
F0VGH1_NEOCL/360-452--------------------------------------------------------------------------------
F0WM38_9STRA/1874-1964--------------------------------------------------------------------------------
F0X7S7_GROCL/267-361--------------------------------------------------------------------------------
F0YFE5_AURAN/364-464--------------------------------------------------------------------------------
F0YK20_AURAN/255-345--------------------------------------------------------------------------------
F1KVT9_ASCSU/180-270--------------------------------------------------------------------------------
F1L0N9_ASCSU/243-330--------------------------------------------------------------------------------
F2QNN8_PICP7/393-484--------------------------------------------------------------------------------
F2T7L6_AJEDA/274-369--------------------------------------------------------------------------------
F2U7M9_SALS5/352-446--------------------------------------------------------------------------------
F2UEG8_SALS5/776-866--------------------------------------------------------------------------------
SSP1B_CAEEL/338-430--------------------------------------------------------------------------------
SPT16_SCHPO/813-903--------------------------------------------------------------------------------
POB3_SCHPO/353-446--------------------------------------------------------------------------------
Q00W77_OSTTA/322-416--------------------------------------------------------------------------------
SSRP1_ARATH/348-441--------------------------------------------------------------------------------
Q0INI2_ORYSJ/396-486--------------------------------------------------------------------------------
Q23D83_TETTS/261-352--------------------------------------------------------------------------------
RT106_CHAGB/265-365--------------------------------------------------------------------------------
Q2HGG4_CHAGB/821-911--------------------------------------------------------------------------------
Q388G3_TRYB2/376-473--------------------------------------------------------------------------------
Q4CP43_TRYCC/660-750--------------------------------------------------------------------------------
Q4E2D9_TRYCC/326-410--------------------------------------------------------------------------------
SSRP1_CIOIN/341-432--------------------------------------------------------------------------------
Q4N2N7_THEPA/648-738--------------------------------------------------------------------------------
SPT16_USTMA/817-907--------------------------------------------------------------------------------
Q4Q5R4_LEIMA/337-430--------------------------------------------------------------------------------
Q4UAH0_THEAN/359-451--------------------------------------------------------------------------------
SPT16_DICDI/824-914--------------------------------------------------------------------------------
RT106_CANAL/244-343--------------------------------------------------------------------------------
Q5CIB9_CRYHO/343-434--------------------------------------------------------------------------------
Q5CYL0_CRYPI/886-979--------------------------------------------------------------------------------
RT106_DEBHA/279-380--------------------------------------------------------------------------------
POB3_YARLI/385-478--------------------------------------------------------------------------------
SPT16_YARLI/812-902--------------------------------------------------------------------------------
RT106_YARLI/218-309--------------------------------------------------------------------------------
RT106_KLULA/205-294--------------------------------------------------------------------------------
RT106_CANGA/204-297--------------------------------------------------------------------------------
SPT16_CANGA/830-920--------------------------------------------------------------------------------
Q6RCP5_TETTH/797-887--------------------------------------------------------------------------------
RT106_ASHGO/199-288--------------------------------------------------------------------------------
RT106_NEUCR/266-364--------------------------------------------------------------------------------
Q8IL56_PLAF7/350-442--------------------------------------------------------------------------------
Q8SRJ1_ENCCU/303-393--------------------------------------------------------------------------------

PF07289

Q295Y8_DROPS/17-373LLWEDKDVKFD.TPHLHTRLR..TGEKVLDYIYHIEDSKGNPGDTGRLMVTNLRVIWHSLVHKKYNLSIGFARFGNTNTR
Q6PSU7_CHLRE/13-352LCWQDREIRFD.CNANDINLR..QGEELITLMDSVEDTKGNNGDLGELRVSNLRLCWVNKKNRRTNICIGHNCITTVNVR
BBS5_DANRE/7-341ALWEDRDVRFD.ITAQQMKTR..PGEALIDCLDSIEDTKGNNGDRGRLLVTNLRIIWHSLALPRVNLSVGYNCIINITTR
Q4QGM5_LEIMA/24-429TFWQDREIHFD.AATPVLKLR.ENTEHVYATFDNVEDTKGNNGCPGTLLVTNLRLIWRCKQRPNVNLSIGYYCVHKLTVQ
Q4V3K1_DROME/1-343M...DAVFKFDPLSAGGTAIF..IAAIISIFILGVGIKKG....IGVFAETLISLKWPIL.......SIGYARIGNTNTR
Q3SCX0_PARTE/4-324EFLYDRCIHFD.IAAAKLNMQ..KGEKTLFLWKDVEDIKGNPDQLGSLVISNTRILWWSERNNSVNLSIGLGTIFHIEQK
Q231T4_TETTS/4-299EYFYDREIKFD.LQTKKLSPC..SGEFEMSSQNYIEDFKGNADCDGVLVLTNLRLIWYQNDDKRINLSIEWRTDEYI...
Q21626_CAEEL/8-358DIWQDREIRFD.VDHKLLRLI..NGEIQVAKIEHVEDTKGNNGDRGTMRVTNLRLIWHAASMPRINITIGWNAITGVQSK
Q86PG0_TRYCR/17-372TFWFDREFRYN.LPDEGLVVQTARGEVLLSKLSPVEDTKGNNGEEGVLYVTNLRCIWQSKVNPHKNLSVGYYGIQGIEVR
A2FLN7_TRIVA/10-343HLTTDQVVRLF.QDQSKLKAI..PGESNVAVLSRVEDMKAHPGQFGQGHVTNIRFIWYIQNTPTINASIGYNTIVSYKIS
P91582_CIOIN/3-345VLWEDRDVRFD.LSLQQMNMR..PGEFVIQTFNSVEDTKGNNGDNGKLLVTNLRVMWHSHTLPRVNLSIGFGCIHNITTR
Q17LJ5_AEDAE/5-340PVWEDREIKFD.ITNICKTIR..SGEQPLEILDSIEDTKGNLGDRGRLLVTNLRIIWYSVTSNRFSLSIGFSCVLTMNTK
Q4GYG4_TRYB2/17-368TLLLDRTIRFD.TSLSELQEQTSRGERILMRLSPVEDTKGNSGKEGVLYVTNLRFMWHSSHRVRNNLSVGYYGVYNMSVQ

PF03531

SSRP1_XENLA/74-285YDGFRETEYDKL--------------------------------------------------------------------
SSRP1_ARATH/74-295FVGFRDQDVPSL--------------------------------------------------------------------
POB3_SCHPO/73-300LDGFSQEDLDDL--------------------------------------------------------------------
SSP1A_ORYSJ/74-294FIGFREQDVSSL--------------------------------------------------------------------
SSRP1_DROME/74-285FTGFRDSEHEKL--------------------------------------------------------------------
SSP1B_CAEEL/73-286FGGFLDDDLQKI--------------------------------------------------------------------

PF00638

RANG_HUMAN/37-161--------------------------------------------------------------------------------
RBP2_HUMAN/2321-2442--------------------------------------------------------------------------------
YRB2_YEAST/204-327--------------------------------------------------------------------------------
NUP2_YEAST/598-718--------------------------------------------------------------------------------
RBP2_HUMAN/2024-2145--------------------------------------------------------------------------------
YRB1_YEAST/75-197--------------------------------------------------------------------------------
RBP2_HUMAN/2922-3043--------------------------------------------------------------------------------
RBP2_HUMAN/1183-1304--------------------------------------------------------------------------------

PF00568

LAS17_YEAST/13-124--------------------------------------------------------------------------------
Q9VAT0_DROME/31-140--------------------------------------------------------------------------------
O96607_DROME/1-107--------------------------------------------------------------------------------
WASL_RAT/28-135--------------------------------------------------------------------------------
VASP_HUMAN/1-110--------------------------------------------------------------------------------
HOME3_RAT/3-110--------------------------------------------------------------------------------
ENAH_MOUSE/1-108--------------------------------------------------------------------------------
WASP_HUMAN/36-145--------------------------------------------------------------------------------

PF06058

DCP1B_HUMAN/9-131--------------------------------------------------------------------------------
Q03633_PLAFA/135-262--------------------------------------------------------------------------------
DCP1A_MOUSE/24-146--------------------------------------------------------------------------------
Q90WT0_DANRE/4-126--------------------------------------------------------------------------------
DCP1_ARATH/12-134--------------------------------------------------------------------------------
Q9W1H5_DROME/2-124--------------------------------------------------------------------------------
Q9N363_CAEEL/5-130--------------------------------------------------------------------------------
Q8SU45_ENCCU/2-123--------------------------------------------------------------------------------
DCP1_SCHPO/4-125--------------------------------------------------------------------------------

PF15410

E5RJ29_HUMAN/721-832--------------------------------------------------------------------------------
B3P8M6_DROER/1074-1185--------------------------------------------------------------------------------
A8PYL1_BRUMA/388-498--------------------------------------------------------------------------------
H2SLA8_TAKRU/516-627--------------------------------------------------------------------------------
B7QFP5_IXOSC/177-288--------------------------------------------------------------------------------
I1BQ29_RHIO9/379-506--------------------------------------------------------------------------------
E3WPL5_ANODA/343-456--------------------------------------------------------------------------------
D4YWC5_CAEEL/387-497--------------------------------------------------------------------------------
E3JSD7_PUCGT/1317-1461--------------------------------------------------------------------------------
F1KU63_ASCSU/420-530--------------------------------------------------------------------------------
YDYB_SCHPO/679-804--------------------------------------------------------------------------------
F6X1S7_XENTR/10-124--------------------------------------------------------------------------------
E9H3M8_DAPPU/491-615--------------------------------------------------------------------------------
G4VKT4_SCHMA/511-627--------------------------------------------------------------------------------
E5SKG2_TRISP/325-435--------------------------------------------------------------------------------
I1CBT7_RHIO9/688-826--------------------------------------------------------------------------------

PF00169

PSD1_HUMAN/757-869--------------------------------------------------------------------------------
O00886_DICDI/1008-1093--------------------------------------------------------------------------------
UNC89_CAEEL/349-451--------------------------------------------------------------------------------
O02134_CAEEL/257-375--------------------------------------------------------------------------------
O08724_RAT/33-133--------------------------------------------------------------------------------
YB35_SCHPO/255-349--------------------------------------------------------------------------------
O23559_ARATH/656-764--------------------------------------------------------------------------------
TRIO_HUMAN/1480-1591--------------------------------------------------------------------------------
TRIO_HUMAN/2158-2271--------------------------------------------------------------------------------
PLEK_HUMAN/5-101--------------------------------------------------------------------------------
PLEK_HUMAN/245-347--------------------------------------------------------------------------------
MCF2_HUMAN/705-809--------------------------------------------------------------------------------
OSBP1_RABIT/91-183--------------------------------------------------------------------------------
PLCG1_HUMAN/33-142--------------------------------------------------------------------------------
DYN1_RAT/520-625--------------------------------------------------------------------------------
UN104_CAEEL/1461-1558--------------------------------------------------------------------------------
TEC_MOUSE/5-111--------------------------------------------------------------------------------
ARBK1_HUMAN/559-652--------------------------------------------------------------------------------
SOS_DROME/481-588--------------------------------------------------------------------------------
RGRF1_RAT/23-129--------------------------------------------------------------------------------
RGRF1_RAT/457-582--------------------------------------------------------------------------------
GPRK1_DROME/558-657--------------------------------------------------------------------------------
BEM3_YEAST/635-741--------------------------------------------------------------------------------
KIF1A_MOUSE/1581-1678--------------------------------------------------------------------------------
PAC1_CAEEL/612-726--------------------------------------------------------------------------------
MIG10_CAEEL/457-566--------------------------------------------------------------------------------
GRP1_CAEEL/262-380--------------------------------------------------------------------------------
YOTB_CAEEL/36-131--------------------------------------------------------------------------------
CRAC_DICDI/23-122--------------------------------------------------------------------------------
OPY1_YEAST/216-318--------------------------------------------------------------------------------
SIP3_YEAST/310-423--------------------------------------------------------------------------------
YHT1_YEAST/194-304--------------------------------------------------------------------------------
YSP1_YEAST/309-421--------------------------------------------------------------------------------
BEM2_YEAST/1832-1948--------------------------------------------------------------------------------
BOI2_YEAST/769-887--------------------------------------------------------------------------------
SLM1_YEAST/469-581--------------------------------------------------------------------------------
RHG25_HUMAN/47-151--------------------------------------------------------------------------------
TG325_CAEEL/387-505--------------------------------------------------------------------------------
BUD4_YEAST/1303-1413--------------------------------------------------------------------------------
ASK10_YEAST/482-720--------------------------------------------------------------------------------
CTRO_MOUSE/1470-1589--------------------------------------------------------------------------------
BMX_HUMAN/5-111--------------------------------------------------------------------------------
BUD4_CANAL/1577-1685--------------------------------------------------------------------------------
CA120_YEAST/76-204--------------------------------------------------------------------------------
VAV_RAT/403-504--------------------------------------------------------------------------------
KRAC_DICDI/6-99--------------------------------------------------------------------------------
RGRF2_MOUSE/23-133--------------------------------------------------------------------------------
MYO10_BOVIN/1207-1304--------------------------------------------------------------------------------
SIF1_DROME/849-955--------------------------------------------------------------------------------
SIF1_DROME/1672-1793--------------------------------------------------------------------------------
P91678_DROME/205-307--------------------------------------------------------------------------------
MPRIP_MOUSE/387-482--------------------------------------------------------------------------------
FGD1_HUMAN/591-689--------------------------------------------------------------------------------
FGD1_HUMAN/822-921--------------------------------------------------------------------------------
APSA_EMENI/1394-1504--------------------------------------------------------------------------------
NUM1_YEAST/2574-2683--------------------------------------------------------------------------------
SPTCB_DROME/2148-2259--------------------------------------------------------------------------------
SPTB2_HUMAN/2198-2307--------------------------------------------------------------------------------
SOS2_MOUSE/443-545--------------------------------------------------------------------------------
GRB7_MOUSE/229-341--------------------------------------------------------------------------------
NRKB_TRYBB/332-429--------------------------------------------------------------------------------
ITK_MOUSE/5-117--------------------------------------------------------------------------------
BTK_HUMAN/4-133--------------------------------------------------------------------------------
SKG3_YEAST/91-221--------------------------------------------------------------------------------
ATG26_YEAST/239-336--------------------------------------------------------------------------------
TUS1_YEAST/716-877--------------------------------------------------------------------------------
3BP2_MOUSE/27-130--------------------------------------------------------------------------------
YP091_YEAST/114-266--------------------------------------------------------------------------------
ANI2_CAEEL/893-1005--------------------------------------------------------------------------------
SHK2_SCHPO/24-125--------------------------------------------------------------------------------
RGA2_SCHPO/720-836--------------------------------------------------------------------------------
CNT6_SCHPO/527-632--------------------------------------------------------------------------------
YDG1_SCHPO/549-677--------------------------------------------------------------------------------
OSH2_YEAST/290-386--------------------------------------------------------------------------------
SKM1_YEAST/4-118--------------------------------------------------------------------------------
ARHG5_HUMAN/1391-1502--------------------------------------------------------------------------------
AKP13_HUMAN/2232-2333--------------------------------------------------------------------------------
ABR_HUMAN/302-459--------------------------------------------------------------------------------
GRB10_HUMAN/291-399--------------------------------------------------------------------------------
PLD1_HUMAN/220-328--------------------------------------------------------------------------------
ROCK1_HUMAN/1119-1212--------------------------------------------------------------------------------
GAB1_HUMAN/6-116--------------------------------------------------------------------------------
SNTB1_HUMAN/323-433--------------------------------------------------------------------------------
ARHG7_HUMAN/480-578--------------------------------------------------------------------------------
ACAP1_HUMAN/266-360--------------------------------------------------------------------------------
ARHG6_HUMAN/450-548--------------------------------------------------------------------------------
KPCD1_HUMAN/423-541--------------------------------------------------------------------------------
CYH1_HUMAN/261-377--------------------------------------------------------------------------------
Q17777_CAEEL/241-343--------------------------------------------------------------------------------
AKT1_CAEEL/16-118--------------------------------------------------------------------------------
Q18284_CAEEL/578-673--------------------------------------------------------------------------------
Q18420_CAEEL/249-346--------------------------------------------------------------------------------
UN112_CAEEL/406-507--------------------------------------------------------------------------------
Q20151_CAEEL/20-135--------------------------------------------------------------------------------
Q21025_CAEEL/833-940--------------------------------------------------------------------------------
GAP1_CAEEL/412-507--------------------------------------------------------------------------------
Q23419_CAEEL/18-114--------------------------------------------------------------------------------
Q23980_DROME/1145-1252--------------------------------------------------------------------------------
Q24284_DROME/15-132--------------------------------------------------------------------------------
IRS1_CHLAE/13-115--------------------------------------------------------------------------------
SNTA1_RABIT/294-401--------------------------------------------------------------------------------
Q29517_RABIT/10-119--------------------------------------------------------------------------------
VAV_CAEEL/471-598--------------------------------------------------------------------------------
SECG_DICDI/785-895--------------------------------------------------------------------------------
RDCII_DICDI/354-461--------------------------------------------------------------------------------
RGPS1_HUMAN/432-543--------------------------------------------------------------------------------
ARHGG_HUMAN/502-620--------------------------------------------------------------------------------
RHG26_CHICK/266-369--------------------------------------------------------------------------------
TIAM1_MOUSE/434-547--------------------------------------------------------------------------------
TIAM1_MOUSE/1261-1395--------------------------------------------------------------------------------
AKT2_MOUSE/6-108--------------------------------------------------------------------------------
ARHG2_MOUSE/474-572--------------------------------------------------------------------------------
VAV2_MOUSE/401-502--------------------------------------------------------------------------------
PLCL1_RAT/115-224--------------------------------------------------------------------------------
PLCD4_RAT/17-124--------------------------------------------------------------------------------
SH2B1_RAT/247-376--------------------------------------------------------------------------------
PHLB1_RAT/722-824--------------------------------------------------------------------------------
Q63629_RAT/255-358--------------------------------------------------------------------------------
RASA2_RAT/604-704--------------------------------------------------------------------------------
DGKH_MESAU/60-152--------------------------------------------------------------------------------
ARHG8_HUMAN/387-501--------------------------------------------------------------------------------
CAPS1_MOUSE/520-622--------------------------------------------------------------------------------
AKT1_DROME/107-211--------------------------------------------------------------------------------
AFAP1_CHICK/154-249--------------------------------------------------------------------------------
AFAP1_CHICK/348-441--------------------------------------------------------------------------------
Q91492_TORCA/276-383--------------------------------------------------------------------------------
MUG79_SCHPO/1044-1158--------------------------------------------------------------------------------
Q93569_CAEEL/7-101--------------------------------------------------------------------------------
SNT1_CAEEL/228-340--------------------------------------------------------------------------------
FERM2_HUMAN/381-476--------------------------------------------------------------------------------
DOK1_HUMAN/4-119--------------------------------------------------------------------------------
ANLN_DROME/1107-1230--------------------------------------------------------------------------------
DOS_DROME/4-113--------------------------------------------------------------------------------

PF15413

A0CUJ8_PARTE/105-200--------------------------------------------------------------------------------
A7SI59_NEMVE/523-628--------------------------------------------------------------------------------
C4Y4Q1_CLAL4/136-269--------------------------------------------------------------------------------
C6HG43_AJECH/87-193--------------------------------------------------------------------------------
D7KQC6_ARALL/95-227--------------------------------------------------------------------------------
E5T4G3_TRISP/39-138--------------------------------------------------------------------------------
E9C7L7_CAPO3/130-226--------------------------------------------------------------------------------

PF15409

B6JVE7_SCHJY/144-232--------------------------------------------------------------------------------
C5K2A6_AJEDS/215-303--------------------------------------------------------------------------------
E3RG70_PYRTT/221-309--------------------------------------------------------------------------------
H1VVI1_COLHI/216-304--------------------------------------------------------------------------------
C8VHJ7_EMENI/110-198--------------------------------------------------------------------------------
Q6C4Y2_YARLI/155-243--------------------------------------------------------------------------------
G3B6N0_CANTC/156-243--------------------------------------------------------------------------------
A3LTM2_PICST/192-279--------------------------------------------------------------------------------
G8YKE6_PICSO/214-301--------------------------------------------------------------------------------
H8X718_9ASCO/198-285--------------------------------------------------------------------------------
F2UGB6_SALS5/1490-1577--------------------------------------------------------------------------------

PF15406

B6K769_SCHJY/110-235--------------------------------------------------------------------------------
G2X9M4_VERDV/99-204--------------------------------------------------------------------------------
E3Q3I3_COLGM/92-197--------------------------------------------------------------------------------
G4MXJ0_MAGO7/107-216--------------------------------------------------------------------------------
G2PZQ3_THIHA/101-208--------------------------------------------------------------------------------
A6STK7_BOTFB/10-118--------------------------------------------------------------------------------
G4UAB8_NEUT9/95-202--------------------------------------------------------------------------------
B2A9W4_PODAN/92-199--------------------------------------------------------------------------------
F9G078_FUSOF/114-219--------------------------------------------------------------------------------
H0EZ07_GLAL7/83-191--------------------------------------------------------------------------------
G0SHV9_CHATD/90-197--------------------------------------------------------------------------------
F0XAK4_GROCL/91-200--------------------------------------------------------------------------------
H6BUU9_EXODN/90-198--------------------------------------------------------------------------------

PF15408

B6JZV3_SCHJY/839-941--------------------------------------------------------------------------------
MID1_SCHPO/805-907--------------------------------------------------------------------------------

PF15411

SCD1_SCHPO/427-542--------------------------------------------------------------------------------
B6JVU8_SCHJY/389-504--------------------------------------------------------------------------------
E6ZVA8_SPORE/481-616--------------------------------------------------------------------------------
D5GGD7_TUBMM/420-541--------------------------------------------------------------------------------
G1XAU9_ARTOA/438-556--------------------------------------------------------------------------------
I1S1B1_GIBZE/431-552--------------------------------------------------------------------------------
G7E2X4_MIXOS/391-510--------------------------------------------------------------------------------
B6QQH4_PENMQ/385-509--------------------------------------------------------------------------------
G0T0J6_RHOG2/494-613--------------------------------------------------------------------------------
D1MYR8_9HYPO/434-550--------------------------------------------------------------------------------
F7VM13_SORMK/436-557--------------------------------------------------------------------------------
E9CVX1_COCPS/381-505--------------------------------------------------------------------------------
E3QQB9_COLGM/431-552--------------------------------------------------------------------------------
Q2GPG0_CHAGB/418-539--------------------------------------------------------------------------------
F0X7S3_GROCL/410-531--------------------------------------------------------------------------------
G4NAK1_MAGO7/442-563--------------------------------------------------------------------------------
F2PSL1_TRIEC/255-378--------------------------------------------------------------------------------
G3JRH1_CORMM/592-713--------------------------------------------------------------------------------
F9X6S4_MYCGM/383-505--------------------------------------------------------------------------------
B2VWD7_PYRTR/471-593--------------------------------------------------------------------------------
I1C104_RHIO9/375-487--------------------------------------------------------------------------------
Q6CBW7_YARLI/467-578--------------------------------------------------------------------------------
H6BPC6_EXODN/386-507--------------------------------------------------------------------------------
I1BLT9_RHIO9/200-314--------------------------------------------------------------------------------
Q5KFX7_CRYNJ/908-1028--------------------------------------------------------------------------------
Q4P6E0_USTMA/491-614--------------------------------------------------------------------------------
F4PBV1_BATDJ/346-455--------------------------------------------------------------------------------
I1C1Q1_RHIO9/363-476--------------------------------------------------------------------------------
D8Q1A2_SCHCM/269-391--------------------------------------------------------------------------------
A5DJC8_PICGU/472-589--------------------------------------------------------------------------------
A8N8V8_COPC7/386-508--------------------------------------------------------------------------------
F4RFQ9_MELLP/828-937--------------------------------------------------------------------------------
G3J9K1_CORMM/454-571--------------------------------------------------------------------------------
G9NM35_HYPAI/326-439--------------------------------------------------------------------------------
G1X4D9_ARTOA/384-499--------------------------------------------------------------------------------
F9X5J1_MYCGM/455-563--------------------------------------------------------------------------------
Q7PLZ7_ANOGA/417-526--------------------------------------------------------------------------------
C4JQ35_UNCRE/310-422--------------------------------------------------------------------------------
C5P3B7_COCP7/314-426--------------------------------------------------------------------------------

PF14593

Q7PUX5_ANOGA/445-547--------------------------------------------------------------------------------
D6WGV3_TRICA/369-471--------------------------------------------------------------------------------
E2A088_CAMFO/460-562--------------------------------------------------------------------------------
Q76BX2_ASTPE/464-566--------------------------------------------------------------------------------
PDPK1_MOUSE/449-551--------------------------------------------------------------------------------
A8XME2_CAEBR/317-419--------------------------------------------------------------------------------
F0ZQF1_DICPU/137-240--------------------------------------------------------------------------------
Q172S2_AEDAE/402-506--------------------------------------------------------------------------------
A8PPP4_BRUMA/323-425--------------------------------------------------------------------------------
E3MA10_CAERE/460-562--------------------------------------------------------------------------------
A8X5P7_CAEBR/474-576--------------------------------------------------------------------------------
D2VK59_NAEGR/353-456--------------------------------------------------------------------------------
B5DR97_DROPS/703-805--------------------------------------------------------------------------------
F0W8Q4_9STRA/392-494--------------------------------------------------------------------------------
D8QMJ5_SELML/388-489--------------------------------------------------------------------------------
C1KFX1_9CNID/346-448--------------------------------------------------------------------------------
E9CBD6_CAPO3/483-586--------------------------------------------------------------------------------
C4QMA7_SCHMA/364-466--------------------------------------------------------------------------------
F0ZSM2_DICPU/404-506--------------------------------------------------------------------------------
E3WL97_ANODA/469-571--------------------------------------------------------------------------------
B0X1B0_CULQU/404-508--------------------------------------------------------------------------------
E5SYD2_TRISP/403-505--------------------------------------------------------------------------------
Q9XF68_ORYSA/242-348--------------------------------------------------------------------------------
E4XZ21_OIKDI/382-502--------------------------------------------------------------------------------
A2DAR5_TRIVA/371-472--------------------------------------------------------------------------------
F0ZMQ8_DICPU/111-220--------------------------------------------------------------------------------
Q9BMX6_APLCA/717-819--------------------------------------------------------------------------------
D3BJW1_POLPA/401-501--------------------------------------------------------------------------------
E9H687_DAPPU/410-512--------------------------------------------------------------------------------
D8M3A3_BLAHO/75-180--------------------------------------------------------------------------------
F2U695_SALS5/410-513--------------------------------------------------------------------------------

PF12814

A4HEV0_LEIBR/313-423--------------------------------------------------------------------------------
A6RUJ3_BOTFB/967-1099--------------------------------------------------------------------------------
A8NC45_COPC7/1477-1596--------------------------------------------------------------------------------
A8Q694_MALGO/495-613--------------------------------------------------------------------------------
B2VUN2_PYRTR/943-1083--------------------------------------------------------------------------------
B6JVF8_SCHJY/810-930--------------------------------------------------------------------------------
B8M115_TALSN/905-1052--------------------------------------------------------------------------------
C0SAF8_PARBP/1004-1151--------------------------------------------------------------------------------
C1H210_PARBA/1232-1352--------------------------------------------------------------------------------
C5DMW2_LACTC/3405-3524--------------------------------------------------------------------------------
C5DY62_ZYGRC/2362-2478--------------------------------------------------------------------------------
C5FCE3_ARTOC/935-1060--------------------------------------------------------------------------------
C5FWA2_ARTOC/1261-1380--------------------------------------------------------------------------------
C5MCT5_CANTT/3605-3725--------------------------------------------------------------------------------
Q0TVR4_PHANO/1388-1507--------------------------------------------------------------------------------
Q23GA5_TETTS/12-127--------------------------------------------------------------------------------
Q2TZB5_ASPOR/919-1066--------------------------------------------------------------------------------
Q4P966_USTMA/1901-2021--------------------------------------------------------------------------------
Q4Q999_LEIMA/446-556--------------------------------------------------------------------------------
Q4YWB8_PLABA/90-206--------------------------------------------------------------------------------
Q5KMI7_CRYNJ/1724-1843--------------------------------------------------------------------------------
Q5MG88_TOXGO/125-237--------------------------------------------------------------------------------
Q6CF84_YARLI/3022-3141--------------------------------------------------------------------------------
Q6FVK1_CANGA/1920-2038--------------------------------------------------------------------------------
Q9C2A3_NEUCS/971-1096--------------------------------------------------------------------------------
MCP5_SCHPO/840-959--------------------------------------------------------------------------------

PF15405

A7TQH3_VANPO/867-996--------------------------------------------------------------------------------
A8QCG1_MALGO/650-787--------------------------------------------------------------------------------
B0Y407_ASPFC/727-851--------------------------------------------------------------------------------
B2ATW7_PODAN/781-899--------------------------------------------------------------------------------
B6HR54_PENCW/741-867--------------------------------------------------------------------------------
B6K4Z0_SCHJY/799-929--------------------------------------------------------------------------------
B6K7Q5_SCHJY/658-790--------------------------------------------------------------------------------
C5DFA7_LACTC/775-905--------------------------------------------------------------------------------
D5G4S8_TUBMM/733-864--------------------------------------------------------------------------------
D6RNQ8_COPC7/510-650--------------------------------------------------------------------------------
E3KTU1_PUCGT/826-974--------------------------------------------------------------------------------
E4ZWW2_LEPMJ/934-1064--------------------------------------------------------------------------------
E6RBG3_CRYGW/694-836--------------------------------------------------------------------------------
E7R275_PICAD/758-897--------------------------------------------------------------------------------
F0XUN9_GROCL/777-902--------------------------------------------------------------------------------
F2QX04_PICP7/790-895--------------------------------------------------------------------------------
F2Z621_KLULA/763-894--------------------------------------------------------------------------------
F4PBC1_BATDJ/457-572--------------------------------------------------------------------------------
F4RK51_MELLP/486-612--------------------------------------------------------------------------------
F8P447_SERL9/728-864--------------------------------------------------------------------------------
F9X7Y7_MYCGM/750-877--------------------------------------------------------------------------------
G0V5Q3_NAUCC/849-979--------------------------------------------------------------------------------
G1XBW2_ARTOA/827-954--------------------------------------------------------------------------------
G2WW94_VERDV/764-891--------------------------------------------------------------------------------
G2YJS9_BOTF4/50-174--------------------------------------------------------------------------------
G4NKJ4_MAGO7/790-913--------------------------------------------------------------------------------
G7DY91_MIXOS/924-1056--------------------------------------------------------------------------------
G8BPI3_TETPH/796-928--------------------------------------------------------------------------------
G8ZUV3_TORDC/841-971--------------------------------------------------------------------------------
G9N7F4_HYPVG/769-895--------------------------------------------------------------------------------
H0GGJ3_9SACH/518-648--------------------------------------------------------------------------------
H1UV38_COLHI/767-893--------------------------------------------------------------------------------
I1BJ67_RHIO9/768-907--------------------------------------------------------------------------------
I1BQA0_RHIO9/235-373--------------------------------------------------------------------------------
I1C1X6_RHIO9/740-879--------------------------------------------------------------------------------
I1CB67_RHIO9/496-608--------------------------------------------------------------------------------
Q4P7K1_USTMA/348-484--------------------------------------------------------------------------------
Q6CDY6_YARLI/831-954--------------------------------------------------------------------------------
Q752J0_ASHGO/816-948--------------------------------------------------------------------------------
Q7SHY5_NEUCR/784-908--------------------------------------------------------------------------------
RGF2_SCHPO/670-802--------------------------------------------------------------------------------
RGF1_SCHPO/844-972--------------------------------------------------------------------------------

PF08458

Q7XC71_ORYSJ/259-367--------------------------------------------------------------------------------
Q8VY20_ARATH/362-472--------------------------------------------------------------------------------
Q8W4K5_ARATH/378-487--------------------------------------------------------------------------------
Q8S7E8_ORYSJ/138-241--------------------------------------------------------------------------------
O23578_ARATH/260-368--------------------------------------------------------------------------------
Q8S7Q8_ORYSJ/273-375--------------------------------------------------------------------------------
Q9LKC2_ARATH/340-450--------------------------------------------------------------------------------
Q9FGL4_ARATH/282-390--------------------------------------------------------------------------------
Q949B7_ORYSA/260-379--------------------------------------------------------------------------------

PF15404

A6ZY67_YEAS7/1032-1228--------------------------------------------------------------------------------
C5DN47_LACTC/1032-1239--------------------------------------------------------------------------------
G0WGW0_NAUDC/1002-1189--------------------------------------------------------------------------------
G0V9Z1_NAUCC/1010-1197--------------------------------------------------------------------------------
C5DSP7_ZYGRC/1057-1243--------------------------------------------------------------------------------
G8JS70_ERECY/1003-1198--------------------------------------------------------------------------------
G8ZX42_TORDC/989-1169--------------------------------------------------------------------------------
Q74ZU3_ASHGO/998-1187--------------------------------------------------------------------------------
H6CBI5_EXODN/881-1078--------------------------------------------------------------------------------
E5A6C0_LEPMJ/941-1113--------------------------------------------------------------------------------
F9XLM8_MYCGM/682-862--------------------------------------------------------------------------------
F2T6E6_AJEDA/871-1037--------------------------------------------------------------------------------
E7RAB4_PICAD/902-1094--------------------------------------------------------------------------------
A3GEX7_PICST/684-865--------------------------------------------------------------------------------
H2AR29_KAZAF/997-1185--------------------------------------------------------------------------------
D5G6N9_TUBMM/935-1096--------------------------------------------------------------------------------
C0SDS0_PARBP/901-1069--------------------------------------------------------------------------------
A1CLB3_ASPCL/876-1043--------------------------------------------------------------------------------
C5PF94_COCP7/925-1091--------------------------------------------------------------------------------
Q6CKB3_KLULA/919-1083--------------------------------------------------------------------------------
G3AEW4_SPAPN/678-854--------------------------------------------------------------------------------
G1XK76_ARTOA/820-982--------------------------------------------------------------------------------
B6H2T1_PENCW/909-1076--------------------------------------------------------------------------------
A7TM50_VANPO/1058-1235--------------------------------------------------------------------------------
A5DM32_PICGU/798-966--------------------------------------------------------------------------------
E6ZQ69_SPORE/1863-2064--------------------------------------------------------------------------------
G8BMZ3_TETPH/890-1075--------------------------------------------------------------------------------
G4TI65_PIRID/968-1141--------------------------------------------------------------------------------
E6R4C5_CRYGW/559-712--------------------------------------------------------------------------------
A8NQT9_COPC7/886-1037--------------------------------------------------------------------------------
B0CVV2_LACBS/512-664--------------------------------------------------------------------------------
F4REX6_MELLP/921-1086--------------------------------------------------------------------------------

PF00640

APBA3_RAT/216-354--------------------------------------------------------------------------------
APBB2_HUMAN/590-712--------------------------------------------------------------------------------
APBB2_HUMAN/419-555--------------------------------------------------------------------------------
SHC1_HUMAN/162-318--------------------------------------------------------------------------------
SHC2_HUMAN/153-308--------------------------------------------------------------------------------
ANS1A_HUMAN/942-1068--------------------------------------------------------------------------------
APBA1_HUMAN/461-618--------------------------------------------------------------------------------
JIP1_RAT/564-698--------------------------------------------------------------------------------
APBB1_RAT/544-665--------------------------------------------------------------------------------
JIP2_HUMAN/683-814--------------------------------------------------------------------------------
Q24080_DROME/34-184--------------------------------------------------------------------------------
DAB1_MOUSE/42-168--------------------------------------------------------------------------------
LIN10_CAEEL/607-762--------------------------------------------------------------------------------
APBB3_RAT/289-415--------------------------------------------------------------------------------
NUMB_DROME/83-205--------------------------------------------------------------------------------
CAPON_RAT/32-170--------------------------------------------------------------------------------
APBB3_RAT/117-255--------------------------------------------------------------------------------
APBA3_HUMAN/221-359--------------------------------------------------------------------------------
APBA2_MOUSE/373-531--------------------------------------------------------------------------------
CED6_CAEEL/61-194--------------------------------------------------------------------------------
SHC3_HUMAN/155-311--------------------------------------------------------------------------------
DAB2_MOUSE/50-176--------------------------------------------------------------------------------
NUMB_MOUSE/39-172--------------------------------------------------------------------------------
APBB1_RAT/371-510--------------------------------------------------------------------------------
DAB_DROME/51-175--------------------------------------------------------------------------------

PF08416

EPS8_MOUSE/64-194--------------------------------------------------------------------------------
ES8L1_HUMAN/35-165--------------------------------------------------------------------------------
TENS3_HUMAN/1310-1444--------------------------------------------------------------------------------
Q5XH20_XENLA/51-177--------------------------------------------------------------------------------
Q7ZUV6_DANRE/51-181--------------------------------------------------------------------------------
A7E2A6_HUMAN/1275-1408--------------------------------------------------------------------------------
Q4RXQ8_TETNG/64-188--------------------------------------------------------------------------------
Q9VHC3_DROME/580-716--------------------------------------------------------------------------------
Q6NU33_XENLA/61-191--------------------------------------------------------------------------------
Q6PJM3_HUMAN/301-437--------------------------------------------------------------------------------
P92160_CAEEL/272-416--------------------------------------------------------------------------------
Q3T129_BOVIN/28-149--------------------------------------------------------------------------------
Q3T0F6_BOVIN/51-181--------------------------------------------------------------------------------
Q7T3A3_DANRE/50-171--------------------------------------------------------------------------------

PF14719

F1SFG1_PIG/69-256--------------------------------------------------------------------------------
C3ZEC0_BRAFL/18-200--------------------------------------------------------------------------------
A2AM80_MOUSE/71-265--------------------------------------------------------------------------------
Q20652_CAEEL/34-211--------------------------------------------------------------------------------
F1L1C4_ASCSU/64-246--------------------------------------------------------------------------------
B4LZF0_DROVI/288-472--------------------------------------------------------------------------------
E1FRI2_LOALO/49-231--------------------------------------------------------------------------------
E5SI18_TRISP/18-200--------------------------------------------------------------------------------
E9GIB1_DAPPU/14-199--------------------------------------------------------------------------------
E0VC17_PEDHC/15-198--------------------------------------------------------------------------------

PF10480

ITBP1_HUMAN/1-200--------------------------------------------------------------------------------
Q5RG21_DANRE/1-198--------------------------------------------------------------------------------

PF09380

Q7QB86_ANOGA/230-322--------------------------------------------------------------------------------
FARP2_MOUSE/238-328--------------------------------------------------------------------------------
FRPD2_HUMAN/557-646--------------------------------------------------------------------------------
E41L5_MOUSE/239-331--------------------------------------------------------------------------------
O17905_CAEEL/223-313--------------------------------------------------------------------------------
FRM4A_HUMAN/225-326--------------------------------------------------------------------------------
PTN3_HUMAN/226-316--------------------------------------------------------------------------------
Q29ET4_DROPS/237-305--------------------------------------------------------------------------------
A4QNY2_DANRE/770-859--------------------------------------------------------------------------------
Q5SZU5_HUMAN/141-234--------------------------------------------------------------------------------
Q4SR04_TETNG/263-364--------------------------------------------------------------------------------
MERH_DROME/220-309--------------------------------------------------------------------------------
A2ASR3_MOUSE/132-220--------------------------------------------------------------------------------
Q4T916_TETNG/118-207--------------------------------------------------------------------------------
Q16F39_AEDAE/217-307--------------------------------------------------------------------------------
Q9VKY7_DROME/209-301--------------------------------------------------------------------------------
Q17GE0_AEDAE/263-353--------------------------------------------------------------------------------
A2AUK8_MOUSE/292-382--------------------------------------------------------------------------------
Q4S8Q6_TETNG/206-302--------------------------------------------------------------------------------
A7SRN5_NEMVE/219-309--------------------------------------------------------------------------------
Q8I093_CAEEL/223-359--------------------------------------------------------------------------------
Q7PMF4_ANOGA/228-311--------------------------------------------------------------------------------
Q8K2R0_MOUSE/21-111--------------------------------------------------------------------------------
Q2M1E6_DROME/268-358--------------------------------------------------------------------------------
Q8JG61_DANRE/197-287--------------------------------------------------------------------------------
Q1MTL1_DANRE/226-316--------------------------------------------------------------------------------
Q4S0A7_TETNG/201-298--------------------------------------------------------------------------------
Q6GPK7_XENLA/226-316--------------------------------------------------------------------------------
Q9NDP4_CIOIN/233-326--------------------------------------------------------------------------------
Q5DAD7_SCHJA/210-299--------------------------------------------------------------------------------
Q4SDP7_TETNG/210-299--------------------------------------------------------------------------------
A7RWH0_NEMVE/210-299--------------------------------------------------------------------------------
Q4RQ84_TETNG/174-267--------------------------------------------------------------------------------
Q94815_TAESA/212-301--------------------------------------------------------------------------------
Q7PRJ8_ANOGA/219-309--------------------------------------------------------------------------------
A8X9K5_CAEBR/230-319--------------------------------------------------------------------------------
Q28006_BOVIN/787-876--------------------------------------------------------------------------------
Q4RI64_TETNG/212-305--------------------------------------------------------------------------------
Q05CU6_HUMAN/210-299--------------------------------------------------------------------------------
Q3UH12_MOUSE/129-218--------------------------------------------------------------------------------
A7SJJ3_NEMVE/179-269--------------------------------------------------------------------------------
A7T1E3_NEMVE/204-296--------------------------------------------------------------------------------
PTP1_CAEEL/230-319--------------------------------------------------------------------------------
A7SBA4_NEMVE/205-308--------------------------------------------------------------------------------
Q5LK46_CAEEL/220-307--------------------------------------------------------------------------------
Q4RMH6_TETNG/655-741--------------------------------------------------------------------------------
Q4REG2_TETNG/277-370--------------------------------------------------------------------------------
PTN4_MOUSE/226-316--------------------------------------------------------------------------------
A7S031_NEMVE/180-270--------------------------------------------------------------------------------
Q4RRW4_TETNG/220-358--------------------------------------------------------------------------------
Q4SAZ3_TETNG/102-217--------------------------------------------------------------------------------
Q16TI3_AEDAE/200-283--------------------------------------------------------------------------------
Q4RI64_TETNG/1158-1250--------------------------------------------------------------------------------
Q16YM3_AEDAE/262-348--------------------------------------------------------------------------------
FRMD3_HUMAN/229-316--------------------------------------------------------------------------------
A4F2N5_9ASCI/216-329--------------------------------------------------------------------------------
A7RUW8_NEMVE/238-328--------------------------------------------------------------------------------
Q9U566_DROSL/232-320--------------------------------------------------------------------------------
FRMD7_HUMAN/196-286--------------------------------------------------------------------------------
MERL_HUMAN/226-315--------------------------------------------------------------------------------
A8Y3W1_CAEBR/270-367--------------------------------------------------------------------------------
Q6NXW5_MOUSE/226-312--------------------------------------------------------------------------------

PF10756

Q1BAS0_MYCSS/59-130--------------------------------------------------------------------------------
A1UE92_MYCSK/59-130--------------------------------------------------------------------------------
A3PXP6_MYCSJ/59-130--------------------------------------------------------------------------------
A1T6Y6_MYCVP/40-111--------------------------------------------------------------------------------
A4TE10_MYCGI/115-186--------------------------------------------------------------------------------
A0QUX5_MYCS2/56-127--------------------------------------------------------------------------------
A1KMZ9_MYCBP/39-110--------------------------------------------------------------------------------
CFP6_MYCBO/39-110--------------------------------------------------------------------------------
A2VLX4_MYCTU/25-96--------------------------------------------------------------------------------
A5WRQ7_MYCTF/52-123--------------------------------------------------------------------------------
A5U716_MYCTA/39-110--------------------------------------------------------------------------------
CFP6_MYCTU/39-110--------------------------------------------------------------------------------
A4KKR2_MYCTU/52-123--------------------------------------------------------------------------------
A0QJC8_MYCA1/42-113--------------------------------------------------------------------------------
A0PPX9_MYCUA/46-117--------------------------------------------------------------------------------
Q0S2H6_RHOSR/133-204--------------------------------------------------------------------------------
A4FMQ8_SACEN/47-118--------------------------------------------------------------------------------
Q5YRV9_NOCFA/80-151--------------------------------------------------------------------------------
A8M5F2_SALAI/52-123--------------------------------------------------------------------------------
A4X496_SALTO/52-123--------------------------------------------------------------------------------
Q8NQZ8_CORGL/37-108--------------------------------------------------------------------------------
Q6M5S3_CORGL/51-122--------------------------------------------------------------------------------
A4QDN0_CORGB/60-131--------------------------------------------------------------------------------
Q8FPX5_COREF/69-140--------------------------------------------------------------------------------
Q6NHN5_CORDI/53-124--------------------------------------------------------------------------------
Q4JUN4_CORJK/53-125--------------------------------------------------------------------------------
Q2IEC1_ANADE/109-180--------------------------------------------------------------------------------
A0QWV2_MYCS2/76-146--------------------------------------------------------------------------------
A5U2B9_MYCTA/72-142--------------------------------------------------------------------------------
Y1452_MYCBO/72-142--------------------------------------------------------------------------------
A1KIK6_MYCBP/72-142--------------------------------------------------------------------------------
A4KGX3_MYCTU/72-142--------------------------------------------------------------------------------
Y1417_MYCTU/72-142--------------------------------------------------------------------------------
A5WMA0_MYCTF/72-142--------------------------------------------------------------------------------
Q741E9_MYCPA/73-143--------------------------------------------------------------------------------
A0QI07_MYCA1/73-143--------------------------------------------------------------------------------
A0PPL8_MYCUA/74-144--------------------------------------------------------------------------------
Q9CCP2_MYCLE/74-144--------------------------------------------------------------------------------
A4TC11_MYCGI/69-139--------------------------------------------------------------------------------
A1T8K3_MYCVP/70-140--------------------------------------------------------------------------------
A1UFM9_MYCSK/68-138--------------------------------------------------------------------------------
Q1B9D4_MYCSS/68-138--------------------------------------------------------------------------------
A3PZ90_MYCSJ/68-138--------------------------------------------------------------------------------
Q0S0K0_RHOSR/72-142--------------------------------------------------------------------------------
Q5YTP5_NOCFA/86-156--------------------------------------------------------------------------------
A4FBK6_SACEN/71-141--------------------------------------------------------------------------------
A4QEG7_CORGB/114-184--------------------------------------------------------------------------------
Q8NQ54_CORGL/114-184--------------------------------------------------------------------------------
Q8FT59_COREF/117-187--------------------------------------------------------------------------------
Q6NH30_CORDI/107-177--------------------------------------------------------------------------------
O24754_CORAM/105-175--------------------------------------------------------------------------------
Q4JVI7_CORJK/71-141--------------------------------------------------------------------------------
A4X643_SALTO/103-173--------------------------------------------------------------------------------
A8LY42_SALAI/72-142--------------------------------------------------------------------------------
Q47QZ7_THEFY/72-143--------------------------------------------------------------------------------
Q827L6_STRAW/68-139--------------------------------------------------------------------------------
A3KKZ4_STRAM/69-140--------------------------------------------------------------------------------
Q9RKZ5_STRCO/70-141--------------------------------------------------------------------------------
A1SJH2_NOCSJ/82-152--------------------------------------------------------------------------------
A3TLM6_9MICO/70-140--------------------------------------------------------------------------------
A6WC99_KINRD/77-147--------------------------------------------------------------------------------
A3PSE7_MYCSJ/58-136--------------------------------------------------------------------------------
A1U8T0_MYCSK/58-136--------------------------------------------------------------------------------
Q1BG51_MYCSS/58-136--------------------------------------------------------------------------------
A0PKC3_MYCUA/58-136--------------------------------------------------------------------------------
A5TY78_MYCTA/58-136--------------------------------------------------------------------------------
A5WI64_MYCTF/58-136--------------------------------------------------------------------------------
Y010_MYCTU/58-136--------------------------------------------------------------------------------
A2VMV2_MYCTU/58-136--------------------------------------------------------------------------------
A4KN42_MYCTU/37-115--------------------------------------------------------------------------------
Q9CDE8_MYCLE/58-136--------------------------------------------------------------------------------
Q744S0_MYCPA/58-136--------------------------------------------------------------------------------
A0Q8S7_MYCA1/10-88--------------------------------------------------------------------------------
A1T119_MYCVP/58-136--------------------------------------------------------------------------------
A4T4V1_MYCGI/58-136--------------------------------------------------------------------------------
Q5Z3S4_NOCFA/64-148--------------------------------------------------------------------------------
Q0SAE3_RHOSR/62-146--------------------------------------------------------------------------------
A4F5R5_SACEN/60-137--------------------------------------------------------------------------------
A8LWD3_SALAI/68-146--------------------------------------------------------------------------------
A4XDA1_SALTO/68-146--------------------------------------------------------------------------------
A8LCF4_FRASN/69-148--------------------------------------------------------------------------------
Q0RB02_FRAAA/82-161--------------------------------------------------------------------------------
Q7VS84_BORPE/85-153--------------------------------------------------------------------------------
Q7W1V7_BORPA/85-153--------------------------------------------------------------------------------
Q7WQT3_BORBR/85-153--------------------------------------------------------------------------------
Q9X8Z2_STRCO/64-149--------------------------------------------------------------------------------
Q93NX3_9ACTO/64-147--------------------------------------------------------------------------------
Q8TW66_METKA/65-149--------------------------------------------------------------------------------
A3ZYD7_9PLAN/70-141--------------------------------------------------------------------------------
Q6ADX4_LEIXX/63-147--------------------------------------------------------------------------------
A4ALH2_9ACTN/59-141--------------------------------------------------------------------------------
A5CT27_CLAM3/59-141--------------------------------------------------------------------------------
A0JYT3_ARTS2/61-144--------------------------------------------------------------------------------
Q47LS7_THEFY/56-142--------------------------------------------------------------------------------
Q82I13_STRAW/80-156--------------------------------------------------------------------------------

PF11605

VPS36_DROME/2-94--------------------------------------------------------------------------------
Q4QDE7_LEIMA/5-95--------------------------------------------------------------------------------
Q5TPR5_ANOGA/2-94--------------------------------------------------------------------------------
Q5AHK1_CANAL/13-100--------------------------------------------------------------------------------
Q19519_CAEEL/2-89--------------------------------------------------------------------------------
Q6CAN8_YARLI/6-95--------------------------------------------------------------------------------
A5DUJ7_LODEL/11-99--------------------------------------------------------------------------------
Q6CWP4_KLULA/12-100--------------------------------------------------------------------------------
Q5AXE3_EMENI/547-615--------------------------------------------------------------------------------
A3LUC0_PICST/11-98--------------------------------------------------------------------------------
A5DGQ5_PICGU/60-147--------------------------------------------------------------------------------
Q4PA51_USTMA/9-97--------------------------------------------------------------------------------
Q6BSQ4_DEBHA/12-99--------------------------------------------------------------------------------
A7A1T8_YEAS7/8-96--------------------------------------------------------------------------------
VPS36_DICDI/8-94--------------------------------------------------------------------------------
Q6FPE3_CANGA/8-96--------------------------------------------------------------------------------
VPS36_SCHPO/6-94--------------------------------------------------------------------------------
VPS36_ARATH/18-111--------------------------------------------------------------------------------
Q757C1_ASHGO/15-103--------------------------------------------------------------------------------
A7TGC6_VANPO/8-96--------------------------------------------------------------------------------
Q4DRE4_TRYCC/5-94--------------------------------------------------------------------------------
A4HA31_LEIBR/5-95--------------------------------------------------------------------------------

PF02893

MTMR2_MOUSE/71-139--------------------------------------------------------------------------------
TBCD8_MOUSE/285-353--------------------------------------------------------------------------------
UGT52_DICDI/881-948--------------------------------------------------------------------------------
FAN_HUMAN/176-247--------------------------------------------------------------------------------
GRAM4_HUMAN/445-523--------------------------------------------------------------------------------
GRM1B_HUMAN/96-163--------------------------------------------------------------------------------
B9A6K8_HUMAN/288-356--------------------------------------------------------------------------------
MTMR5_HUMAN/882-968--------------------------------------------------------------------------------
B9A6K8_HUMAN/142-209--------------------------------------------------------------------------------
Q9VP46_DROME/136-203--------------------------------------------------------------------------------
Q9VP46_DROME/282-350--------------------------------------------------------------------------------
GYP2_SCHPO/20-85--------------------------------------------------------------------------------
Q9TXP3_CAEEL/783-872--------------------------------------------------------------------------------
YL072_YEAST/164-231--------------------------------------------------------------------------------
GYP2_YEAST/29-116--------------------------------------------------------------------------------
YFE2_YEAST/198-265--------------------------------------------------------------------------------
ATG26_YEAST/570-636--------------------------------------------------------------------------------
MTM1_HUMAN/29-97--------------------------------------------------------------------------------
ATG26_PICPG/586-652--------------------------------------------------------------------------------
YGZ7_SCHPO/197-264--------------------------------------------------------------------------------
Q18966_CAEEL/9-83--------------------------------------------------------------------------------
Q9VGH9_DROME/922-1002--------------------------------------------------------------------------------
YHO0_YEAST/548-617--------------------------------------------------------------------------------
YSP2_YEAST/647-716--------------------------------------------------------------------------------
GEML1_ARATH/138-215--------------------------------------------------------------------------------
WBP2_MOUSE/1-84--------------------------------------------------------------------------------
ATG26_CANAL/816-880--------------------------------------------------------------------------------
Q9ZTW0_HORVU/229-307--------------------------------------------------------------------------------
Q9VMI9_DROME/40-113--------------------------------------------------------------------------------
Q9VU19_DROME/11-82--------------------------------------------------------------------------------
C2GR1_ARATH/688-754--------------------------------------------------------------------------------
MTMR1_HUMAN/104-161--------------------------------------------------------------------------------
Q18075_CAEEL/23-84--------------------------------------------------------------------------------

PF14844

LVSD_DICDI/2064-2162--------------------------------------------------------------------------------
Q0KHV9_DROME/2916-3020--------------------------------------------------------------------------------
C1E8K2_MICSR/38-147--------------------------------------------------------------------------------
F1QJA6_DANRE/2074-2178--------------------------------------------------------------------------------
A9SKJ8_PHYPA/1974-2088--------------------------------------------------------------------------------
E7EZD1_DANRE/2173-2277--------------------------------------------------------------------------------
LYST_MOUSE/3000-3102--------------------------------------------------------------------------------
E2RM94_CANFA/597-690--------------------------------------------------------------------------------
A5B5Q4_VITVI/1437-1541--------------------------------------------------------------------------------
B4HU25_DROSE/77-170--------------------------------------------------------------------------------
Q4RI15_TETNG/1957-2053--------------------------------------------------------------------------------
D0NB84_PHYIT/1693-1817--------------------------------------------------------------------------------
B8AGC7_ORYSI/1908-2017--------------------------------------------------------------------------------
D3B4G5_POLPA/1060-1165--------------------------------------------------------------------------------
E9BTN9_LEIDB/3473-3580--------------------------------------------------------------------------------
A9V098_MONBE/74-174--------------------------------------------------------------------------------
LVSC_DICDI/1705-1818--------------------------------------------------------------------------------
E9CEC6_CAPO3/3668-3773--------------------------------------------------------------------------------
D3BQI1_POLPA/231-322--------------------------------------------------------------------------------
F0ZLG9_DICPU/1569-1668--------------------------------------------------------------------------------
D8S3X7_SELML/1882-1980--------------------------------------------------------------------------------
Q5TUA8_ANOGA/79-172--------------------------------------------------------------------------------
Q01AN8_OSTTA/2194-2290--------------------------------------------------------------------------------
C3YYV6_BRAFL/1806-1900--------------------------------------------------------------------------------
E9CED0_CAPO3/1920-2025--------------------------------------------------------------------------------
LVSF_DICDI/293-384--------------------------------------------------------------------------------
C3Y0L9_BRAFL/2973-3076--------------------------------------------------------------------------------
D7LRV7_ARALL/2028-2133--------------------------------------------------------------------------------
D8M509_BLAHO/332-453--------------------------------------------------------------------------------
D2UYK5_NAEGR/2485-2591--------------------------------------------------------------------------------
E4X0F7_OIKDI/1583-1687--------------------------------------------------------------------------------
F0ZTM1_DICPU/1937-2035--------------------------------------------------------------------------------
E9GKY9_DAPPU/2065-2169--------------------------------------------------------------------------------
E9C1E6_CAPO3/193-284--------------------------------------------------------------------------------
A9V898_MONBE/2770-2881--------------------------------------------------------------------------------
F2UGS7_SALS5/2284-2404--------------------------------------------------------------------------------
A2DFN3_TRIVA/1803-1904--------------------------------------------------------------------------------
B3RRZ7_TRIAD/111-205--------------------------------------------------------------------------------
E1FZ76_LOALO/328-427--------------------------------------------------------------------------------
B3RWH0_TRIAD/273-377--------------------------------------------------------------------------------
D3BT75_POLPA/2598-2696--------------------------------------------------------------------------------
F1KPT4_ASCSU/1732-1836--------------------------------------------------------------------------------
F0WHU1_9STRA/1484-1601--------------------------------------------------------------------------------
F1KPL1_ASCSU/2436-2535--------------------------------------------------------------------------------
NBEA_CAEEL/1694-1798--------------------------------------------------------------------------------
A7SQQ4_NEMVE/217-312--------------------------------------------------------------------------------
Q22HC6_TETTS/2401-2508--------------------------------------------------------------------------------

PF03517

ICLN_ARATH/49-167--------------------------------------------------------------------------------
B9Q2B0_TOXGO/47-162--------------------------------------------------------------------------------
A1DEP8_NEOFI/99-240--------------------------------------------------------------------------------
A1ZAW5_DROME/33-179--------------------------------------------------------------------------------
A2QMX0_ASPNC/82-226--------------------------------------------------------------------------------
LOT5_PICST/75-215--------------------------------------------------------------------------------
A4S3U5_OSTLU/82-224--------------------------------------------------------------------------------
A5CAA6_VITVI/49-167--------------------------------------------------------------------------------
LOT5_PICGU/78-210--------------------------------------------------------------------------------
LOT5_LODEL/63-191--------------------------------------------------------------------------------
A6QTC2_AJECN/141-306--------------------------------------------------------------------------------
A6RQ79_BOTFB/74-191--------------------------------------------------------------------------------
LOT5_YEAS7/82-244--------------------------------------------------------------------------------
A7RR20_NEMVE/33-147--------------------------------------------------------------------------------
LOT5_VANPO/82-248--------------------------------------------------------------------------------
A8NTF5_COPC7/63-194--------------------------------------------------------------------------------
A8Y0J2_CAEBR/34-180--------------------------------------------------------------------------------
A9NQA9_PICSI/43-164--------------------------------------------------------------------------------
A9S1N0_PHYPA/47-165--------------------------------------------------------------------------------
A9ULH1_XENTR/33-162--------------------------------------------------------------------------------
A9VD70_MONBE/35-180--------------------------------------------------------------------------------
B0DAB3_LACBS/60-176--------------------------------------------------------------------------------
B0FLX5_FUSOX/110-226--------------------------------------------------------------------------------
B0WD72_CULQU/34-182--------------------------------------------------------------------------------
B2B612_PODAN/138-262--------------------------------------------------------------------------------
B2WLS9_PYRTR/75-197--------------------------------------------------------------------------------
B3MIF9_DROAN/33-169--------------------------------------------------------------------------------
B3S5M1_TRIAD/33-150--------------------------------------------------------------------------------
B4FU22_MAIZE/47-164--------------------------------------------------------------------------------
B4J796_DROGR/33-197--------------------------------------------------------------------------------
B4MIS2_DROWI/33-184--------------------------------------------------------------------------------
B5X8R1_SALSA/33-161--------------------------------------------------------------------------------
B5X9U7_SALSA/56-181--------------------------------------------------------------------------------
B6HHS4_PENCW/87-223--------------------------------------------------------------------------------
B6K3T8_SCHJY/53-175--------------------------------------------------------------------------------
B6QED0_PENMQ/87-259--------------------------------------------------------------------------------
B7FMN0_MEDTR/42-162--------------------------------------------------------------------------------
B7P9B2_IXOSC/33-159--------------------------------------------------------------------------------
B8AK26_ORYSI/47-166--------------------------------------------------------------------------------
B8BFW3_ORYSI/47-166--------------------------------------------------------------------------------
B8BUW5_THAPS/168-320--------------------------------------------------------------------------------
B8NUB0_ASPFN/89-218--------------------------------------------------------------------------------
B8NZE3_POSPM/63-180--------------------------------------------------------------------------------
B9I4K9_POPTR/49-167--------------------------------------------------------------------------------
B9R9P4_RICCO/49-168--------------------------------------------------------------------------------
B9W785_CANDC/63-184--------------------------------------------------------------------------------
C0S818_PARBP/100-260--------------------------------------------------------------------------------
C1BLM5_OSMMO/33-163--------------------------------------------------------------------------------
C1BT70_9MAXI/33-168--------------------------------------------------------------------------------
C1EAA0_MICSR/47-200--------------------------------------------------------------------------------
C4JLR6_UNCRE/89-230--------------------------------------------------------------------------------
C4R4H9_PICPG/69-202--------------------------------------------------------------------------------
C4WYC8_ACYPI/33-183--------------------------------------------------------------------------------
C4XYE0_CLAL4/70-200--------------------------------------------------------------------------------
C5DFH3_LACTC/77-239--------------------------------------------------------------------------------
C5DS18_ZYGRC/74-243--------------------------------------------------------------------------------
C5FIH0_ARTOC/100-255--------------------------------------------------------------------------------
C5JF20_AJEDS/150-324--------------------------------------------------------------------------------
C5M0L7_PERM5/411-532--------------------------------------------------------------------------------
C5ME47_CANTT/63-184--------------------------------------------------------------------------------
C5P4Z2_COCP7/90-232--------------------------------------------------------------------------------
C5WQX7_SORBI/47-165--------------------------------------------------------------------------------
C7YUN3_NECH7/83-199--------------------------------------------------------------------------------
C8V9L5_EMENI/93-223--------------------------------------------------------------------------------
C9SS04_VERA1/113-222--------------------------------------------------------------------------------
D0MW27_PHYIT/62-159--------------------------------------------------------------------------------
D2H3S9_AILME/35-156--------------------------------------------------------------------------------
D2U835_9ROSI/49-168--------------------------------------------------------------------------------
D2VE54_NAEGR/89-219--------------------------------------------------------------------------------
D3AWK5_POLPA/41-182--------------------------------------------------------------------------------
D3TMJ1_GLOMM/33-174--------------------------------------------------------------------------------
D4DKR6_TRIVH/99-216--------------------------------------------------------------------------------
D5GPC9_TUBMM/75-207--------------------------------------------------------------------------------
D6WHX2_TRICA/33-160--------------------------------------------------------------------------------
D7G4C9_ECTSI/52-165--------------------------------------------------------------------------------
D8Q594_SCHCM/62-183--------------------------------------------------------------------------------
D8R326_SELML/48-170--------------------------------------------------------------------------------
D8TWT3_VOLCA/56-171--------------------------------------------------------------------------------
E0VCN6_PEDHC/33-152--------------------------------------------------------------------------------
E1GH06_LOALO/36-197--------------------------------------------------------------------------------
E1ZS71_CHLVA/50-172--------------------------------------------------------------------------------
E2AYH0_CAMFO/33-160--------------------------------------------------------------------------------
E3MRC6_CAERE/33-179--------------------------------------------------------------------------------
E3QTP6_COLGM/107-222--------------------------------------------------------------------------------
E3TFM3_ICTPU/33-149--------------------------------------------------------------------------------
E4X6Q6_OIKDI/31-151--------------------------------------------------------------------------------
E5AE79_LEPMJ/75-200--------------------------------------------------------------------------------
E5SJS0_TRISP/31-178--------------------------------------------------------------------------------
E6R1Y0_CRYGW/62-207--------------------------------------------------------------------------------
E6ZKI1_SPORE/90-225--------------------------------------------------------------------------------
E9CD59_CAPO3/34-165--------------------------------------------------------------------------------
E9E872_METAQ/84-201--------------------------------------------------------------------------------
E9H646_DAPPU/33-155--------------------------------------------------------------------------------
F0WL16_9STRA/59-162--------------------------------------------------------------------------------
F0XG98_GROCL/95-242--------------------------------------------------------------------------------
F0ZDK9_DICPU/33-167--------------------------------------------------------------------------------
F1L444_ASCSU/85-210--------------------------------------------------------------------------------
F1QDS7_DANRE/33-166--------------------------------------------------------------------------------
F2DSJ7_HORVD/47-166--------------------------------------------------------------------------------
F2UJQ4_SALS5/35-160--------------------------------------------------------------------------------
LOT5_DEBHA/75-213--------------------------------------------------------------------------------
YIU1_SCHPO/53-192--------------------------------------------------------------------------------
Q00ZV5_OSTTA/292-403--------------------------------------------------------------------------------
Q0CIH1_ASPTN/83-217--------------------------------------------------------------------------------
Q0UAR5_PHANO/75-198--------------------------------------------------------------------------------
Q2TU72_FASHE/33-209--------------------------------------------------------------------------------
Q4PHI8_USTMA/90-237--------------------------------------------------------------------------------
Q4UE37_THEAN/53-155--------------------------------------------------------------------------------
Q54Q91_DICDI/34-173--------------------------------------------------------------------------------
Q5TW40_ANOGA/34-170--------------------------------------------------------------------------------
Q6C5D1_YARLI/86-206--------------------------------------------------------------------------------
LOT5_KLULA/83-248--------------------------------------------------------------------------------
Q6FWF9_CANGA/65-256--------------------------------------------------------------------------------
LOT5_ASHGO/69-217--------------------------------------------------------------------------------
Q7RFA5_PLAYO/43-232--------------------------------------------------------------------------------

PF10882

E8ZQG4_CLOB0/63-164--------------------------------------------------------------------------------
D2RH36_ARCPA/66-169--------------------------------------------------------------------------------
Q892T1_CLOTE/66-167--------------------------------------------------------------------------------
B1BIL0_CLOPF/63-164--------------------------------------------------------------------------------
B9LAJ8_CHLSY/77-176--------------------------------------------------------------------------------
A5N6R3_CLOK5/63-164--------------------------------------------------------------------------------
A9B463_HERA2/77-175--------------------------------------------------------------------------------
C9PZP2_9BACT/69-168--------------------------------------------------------------------------------
D9SW68_CLOC7/63-164--------------------------------------------------------------------------------
D8GPI2_CLOLD/64-165--------------------------------------------------------------------------------
D7JGR0_9BACT/59-159--------------------------------------------------------------------------------
Q67L16_SYMTH/48-147--------------------------------------------------------------------------------
D5XC81_THEPJ/68-168--------------------------------------------------------------------------------
C5CH43_KOSOT/70-173--------------------------------------------------------------------------------
A5ZGT7_9BACE/66-165--------------------------------------------------------------------------------
C5VRR7_CLOBO/63-164--------------------------------------------------------------------------------
C6PTX6_9CLOT/63-164--------------------------------------------------------------------------------
D7JGQ9_9BACT/71-172--------------------------------------------------------------------------------
B8G387_CHLAD/77-176--------------------------------------------------------------------------------
F2KQG8_ARCVS/58-157--------------------------------------------------------------------------------
B1I1Z1_DESAP/63-162--------------------------------------------------------------------------------
F0KD96_CLOAE/63-164--------------------------------------------------------------------------------
A3HRM5_9BACT/66-167--------------------------------------------------------------------------------
B1BDC7_CLOBO/63-164--------------------------------------------------------------------------------
E8N364_ANATU/72-171--------------------------------------------------------------------------------
A2BJK7_HYPBU/63-163--------------------------------------------------------------------------------
E1II11_9CHLR/77-175--------------------------------------------------------------------------------

PF06713

YYAB_BACSU/60-136--------------------------------------------------------------------------------
A7GTV4_BACCN/61-123--------------------------------------------------------------------------------
A6T2Q0_JANMA/61-134--------------------------------------------------------------------------------
Q5WGJ5_BACSK/65-143--------------------------------------------------------------------------------
Q5WLL6_BACSK/65-138--------------------------------------------------------------------------------
Q6HLV3_BACHK/52-125--------------------------------------------------------------------------------
Q5WBM1_BACSK/61-138--------------------------------------------------------------------------------
Q8A2X0_BACTN/53-129--------------------------------------------------------------------------------
Q9K9B1_BACHD/42-116--------------------------------------------------------------------------------
Q650Q2_BACFR/53-129--------------------------------------------------------------------------------
A6KZD8_BACV8/54-130--------------------------------------------------------------------------------
A5WI48_PSYWF/64-136--------------------------------------------------------------------------------
Q8ELH5_OCEIH/56-129--------------------------------------------------------------------------------
A4BZG7_9FLAO/58-133--------------------------------------------------------------------------------
Q9KEX6_BACHD/65-138--------------------------------------------------------------------------------
Q67SW8_SYMTH/62-135--------------------------------------------------------------------------------
Q633A6_BACCZ/61-123--------------------------------------------------------------------------------
A7UYW5_BACUN/53-129--------------------------------------------------------------------------------
Q813R4_BACCR/53-128--------------------------------------------------------------------------------
Q5WM07_BACSK/64-139--------------------------------------------------------------------------------
Q8ETD0_OCEIH/64-141--------------------------------------------------------------------------------
A9VJV3_BACWK/52-125--------------------------------------------------------------------------------
Q2BCY1_9BACI/62-139--------------------------------------------------------------------------------
A7AH02_9PORP/54-129--------------------------------------------------------------------------------
A4ASP1_MARSH/60-135--------------------------------------------------------------------------------
A7LYH2_BACOV/53-129--------------------------------------------------------------------------------
A6KZD7_BACV8/56-123--------------------------------------------------------------------------------
A4CQ29_ROBBH/54-128--------------------------------------------------------------------------------
Q4V1T4_BACCZ/53-127--------------------------------------------------------------------------------
A6EQ87_9BACT/59-133--------------------------------------------------------------------------------
A4ANC2_MARSH/53-127--------------------------------------------------------------------------------
A3J6N6_9FLAO/59-136--------------------------------------------------------------------------------
A7GNM9_BACCN/53-127--------------------------------------------------------------------------------
Q64WH9_BACFR/55-123--------------------------------------------------------------------------------
Q5WDR5_BACSK/61-138--------------------------------------------------------------------------------
Q8EQJ6_OCEIH/52-125--------------------------------------------------------------------------------
A6CHZ7_9BACI/57-130--------------------------------------------------------------------------------
Q99IS9_9BACT/61-134--------------------------------------------------------------------------------
A6TN63_ALKMQ/64-137--------------------------------------------------------------------------------
A5ZET0_9BACE/53-129--------------------------------------------------------------------------------
A6LGE4_PARD8/53-128--------------------------------------------------------------------------------
Q7USX7_RHOBA/65-137--------------------------------------------------------------------------------
Q81GH2_BACCR/2-75--------------------------------------------------------------------------------
A6CKW3_9BACI/69-152--------------------------------------------------------------------------------
Q8CV26_OCEIH/61-135--------------------------------------------------------------------------------
A3XNY3_LEEBM/58-133--------------------------------------------------------------------------------

PF14470

A1KX55_9CAUD/97-188------------------------------------------------------------------------.LY.N...
B1BWF3_CLOPF/113-210------------------------------------------------------------------------.LH.NYIS
B6QZJ6_9RHOB/59-150------------------------------------------------------------------------.LM.D...
D0G8V7_CLOBO/33-124------------------------------------------------------------------------.FL.D...
Q73PJ3_TREDE/33-124------------------------------------------------------------------------.LM.D...
Q8XP28_CLOPE/122-213------------------------------------------------------------------------.LT.D...
D4GR98_HALVD/78-183------------------------------------------------------------------------.NS.KGQI
D4GR98_HALVD/240-354------------------------------------------------------------------------.QT.VDVE
C7N8P3_LEPBD/33-124------------------------------------------------------------------------.YY.E...
Q1CPJ8_STRPF/52-143------------------------------------------------------------------------.FV.N...
B4TIA1_SALHS/41-132------------------------------------------------------------------------.MM.D...
E6L634_9PROT/33-123------------------------------------------------------------------------.MY.K...
A7GAX1_CLOBL/113-210------------------------------------------------------------------------.MH.KSVY
Q9B015_9CAUD/43-134------------------------------------------------------------------------.FV.D...
C9MW71_9FUSO/32-123------------------------------------------------------------------------.VY.E...
D0ABI1_ENTFC/115-211------------------------------------------------------------------------.LH.NYIS
C2EMA4_9LACO/66-157------------------------------------------------------------------------.IN.E...
C2NBD8_BACCE/105-201------------------------------------------------------------------------.MH.DYQS
A0RJ01_BACAH/12-110------------------------------------------------------------------------.SL.EIFI
D1Y7N3_9BACT/74-169------------------------------------------------------------------------.Y..DG..
B0A9U9_9FIRM/35-125------------------------------------------------------------------------.AI.G...
C2NVG4_BACCE/15-112------------------------------------------------------------------------.SL.TGYM
C5QQG0_STAEP/16-114------------------------------------------------------------------------.IY.ETHT
C9S1F4_GEOSY/15-114------------------------------------------------------------------------.AY.ETKI
D9STE0_CLOC7/154-250------------------------------------------------------------------------.LN.NFVS
D4YUJ5_9LACO/65-159------------------------------------------------------------------------.INVK...
C2WDE4_BACCE/12-110------------------------------------------------------------------------.SL.ETFL
F0BTF6_9XANT/28-122------------------------------------------------------------------------.VM.N...
C2RX88_BACCE/12-111------------------------------------------------------------------------.SL.DVFE
F0PPB5_BACT0/12-116------------------------------------------------------------------------.VI.NFG.
A0M4L3_GRAFK/28-124------------------------------------------------------------------------PAV.N...
C2PSH1_BACCE/35-136------------------------------------------------------------------------.SL.TGYI
E4SKV3_LACAR/66-157------------------------------------------------------------------------.IT.D...
C2X664_BACCE/12-105------------------------------------------------------------------------.IF.EKDN
Q4L537_STAHJ/16-114------------------------------------------------------------------------.AY.KTKS
B1RCX7_CLOPF/12-109------------------------------------------------------------------------.SL.LTFV
D5BGD3_ZUNPS/37-134------------------------------------------------------------------------PAV.N...
C3I3B9_BACTU/68-162------------------------------------------------------------------------PRYQN...
A2BKM8_HYPBU/14-108------------------------------------------------------------------------.QR.IA..
B3Z200_BACCE/12-116------------------------------------------------------------------------.AI.NLG.
Q5JHI4_PYRKO/17-110------------------------------------------------------------------------.KI.S...
Y689_ARCFU/15-109------------------------------------------------------------------------.YT.E...
F0NRS4_LACHH/66-157------------------------------------------------------------------------.IN.E...
E5WCD5_9BACI/12-111------------------------------------------------------------------------.SL.VAHF
A3J3Z6_9FLAO/29-125------------------------------------------------------------------------.K..KPA.
Q6HPH0_BACHK/12-105------------------------------------------------------------------------.IF.EKDN
A3V5V9_9RHOB/43-146------------------------------------------------------------------------.VM.SQSV
C6XZU2_PEDHD/28-124------------------------------------------------------------------------PAV.N...
D7VUF4_9FLAO/27-123------------------------------------------------------------------------PVI.N...
C2Z256_BACCE/12-105------------------------------------------------------------------------.IF.EKDD
A0RV76_CENSY/18-109------------------------------------------------------------------------.SK.A...
A9VQB7_BACWK/12-105------------------------------------------------------------------------.IF.EKDD
A5FK72_FLAJ1/29-125------------------------------------------------------------------------.K..KPA.
C2FZ39_9SPHI/27-123------------------------------------------------------------------------.K..KPA.
F0LI97_THEBM/14-108------------------------------------------------------------------------.KF.SL..
A6DLU2_9BACT/54-148------------------------------------------------------------------------.LI.N...
D4RW70_9FIRM/218-308------------------------------------------------------------------------.VL.NLD.
B0ABX6_9FIRM/8-108------------------------------------------------------------------------.NL.KSFI
YOKE_BACSU/50-157------------------------------------------------------------------------.DP.K...
A3ICZ3_9BACI/33-123------------------------------------------------------------------------.VR.GI..
D3D498_9ACTO/29-119------------------------------------------------------------------------.SR.G...
B9E7P9_MACCJ/52-151------------------------------------------------------------------------.QI.N...
F0KC11_CLOAE/16-129------------------------------------------------------------------------.II.NAKI
A7GMF6_BACCN/23-116------------------------------------------------------------------------.LY.EIDT
B9DJ09_STACT/11-105------------------------------------------------------------------------.KM.AYPM
Q63DC4_BACCZ/62-170------------------------------------------------------------------------.E..EGSL
E8SGW4_STAPH/11-105------------------------------------------------------------------------.IM.PYQM
C2VL18_BACCE/51-157------------------------------------------------------------------------.DP.K...

PF08000

Q1YDV8_MOBAS/1-123-------------------------------------------------------------------------TA-IEAD
Q4JTR2_CORJK/12-120-------------------------------------------------------------------------VP-IPED
A3CQI4_STRSV/1-125-------------------------------------------------------------------------EK-TERQ
Q832M1_ENTFA/1-125-------------------------------------------------------------------------ET-AEKE
YOZO_BACSU/1-113-------------------------------------------------------------------------ST-DAKK
Q813J1_BACCR/1-124-------------------------------------------------------------------------ES-VERD
Q1ZV35_PHOAS/1-124-------------------------------------------------------------------------AD-ATEE
A0Y4W4_9GAMM/1-124-------------------------------------------------------------------------SD-LEKV
A9AYV8_HERA2/1-124-------------------------------------------------------------------------QA-AQRD
Q5N1D6_SYNP6/1-122-------------------------------------------------------------------------PQ-SCSV
YJQA_BACSU/1-125-------------------------------------------------------------------------AA-VQEE
A4VWQ3_STRSY/14-138-------------------------------------------------------------------------DK-IEQE
A3XIK4_LEEBM/1-125-------------------------------------------------------------------------ED-LTKK
Q65II6_BACLD/1-113-------------------------------------------------------------------------TA-DGKK
Q2B2E1_9BACI/6-134-------------------------------------------------------------------------AD-YDKV
A0YP44_LYNSP/1-126-------------------------------------------------------------------------AK-LDKL
A1APA7_PELPD/1-124-------------------------------------------------------------------------KK-YNTE
A4CBQ0_9GAMM/1-124-------------------------------------------------------------------------NT-LDQL
A3J144_9FLAO/1-125-------------------------------------------------------------------------ET-LVKD
Q1GUI3_SPHAL/1-119-------------------------------------------------------------------------SR-AQAE
YVBH_BACSU/6-134-------------------------------------------------------------------------QD-YDKT
B0UJV9_METS4/1-124-------------------------------------------------------------------------AD-VARE
Q5M368_STRT2/1-125-------------------------------------------------------------------------DK-VERQ
A2U3F1_9FLAO/1-125-------------------------------------------------------------------------EK-LTEK
Q2LS73_SYNAS/2-125-------------------------------------------------------------------------DN-IRKE
A1S3D0_SHEAM/1-124-------------------------------------------------------------------------GK-LAAE
A4QHX3_CORGB/1-122-------------------------------------------------------------------------VP-IPND
A5UL39_METS3/1-109-------------------------------------------------------------------------MD-KDY.
Q3K1T3_STRA1/1-125-------------------------------------------------------------------------DK-VENQ
A0LZE1_GRAFK/1-125-------------------------------------------------------------------------DK-LQEK
A6CNL3_9BACI/6-134-------------------------------------------------------------------------ED-FDKT
A7GD79_CLOBL/1-124-------------------------------------------------------------------------ME-VEKE
Q6ANG9_DESPS/2-124-------------------------------------------------------------------------SK-ALEA
Q8ELK9_OCEIH/1-124-------------------------------------------------------------------------GK-IEEE
A8FE59_BACP2/1-112-------------------------------------------------------------------------KQ-NDKK
A1VMG6_POLNA/1-124-------------------------------------------------------------------------GK-IQQE
Q5Z2E2_NOCFA/1-124-------------------------------------------------------------------------AQ-AQQE
B8FYR8_DESHD/1-124-------------------------------------------------------------------------KE-IESE
Q11IY3_MESSB/1-124-------------------------------------------------------------------------SK-LAQR
Q1VFT1_VIBAL/2-124-------------------------------------------------------------------------SN-ARED
A8H0K5_SHEPA/1-124-------------------------------------------------------------------------DE-LTQE
B8E5Z2_SHEB2/1-124-------------------------------------------------------------------------QE-LAEE
C3E964_BACTU/6-134-------------------------------------------------------------------------KD-YDKV
A5GZ01_9CAUD/2-124-------------------------------------------------------------------------DA-FVNN
A0JTP3_ARTS2/1-111-------------------------------------------------------------------------CP-IPND
Q9F325_STRCO/1-120-------------------------------------------------------------------------AQ-AQQE
Q15NS1_PSEA6/1-123-------------------------------------------------------------------------SD-VSEE
A6N235_9CAUD/15-120-------------------------------------------------------------------------.A-IPPD
A3I5Y5_9BACI/1-124-------------------------------------------------------------------------EK-LQEE
C5B2T2_METEA/1-124-------------------------------------------------------------------------DE-VDRQ
B1YH35_EXIS2/1-122-------------------------------------------------------------------------CD-IPQD
Q723Y5_LISMF/1-127-------------------------------------------------------------------------TE-SSYG
Q1VZB8_9FLAO/1-125-------------------------------------------------------------------------EQ-LAKE
B1YJX4_EXIS2/6-134-------------------------------------------------------------------------DD-FDKA
A6DLR5_9BACT/1-133-------------------------------------------------------------------------EE-LQKK

PF03703

Q1HA10_9ZZZZ/54-129--------------------------------------------------------------------------------
A5N1P5_CLOK5/62-141--------------------------------------------------------------------------------
C4XRD2_DESMR/88-163--------------------------------------------------------------------------------
Q9JPA9_RUBGE/102-193--------------------------------------------------------------------------------
A2BXQ3_PROM5/40-114--------------------------------------------------------------------------------
Q2N679_ERYLH/79-158--------------------------------------------------------------------------------
Q05WK2_9SYNE/41-115--------------------------------------------------------------------------------
O26822_METTH/90-166--------------------------------------------------------------------------------
A7B794_RUMGN/68-144--------------------------------------------------------------------------------
A5N1P4_CLOK5/81-157--------------------------------------------------------------------------------
A3Z634_9SYNE/41-115--------------------------------------------------------------------------------
B5INT9_9CHRO/45-119--------------------------------------------------------------------------------
Q6HMA1_BACHK/59-139--------------------------------------------------------------------------------
Q8YRN0_NOSS1/39-113--------------------------------------------------------------------------------
A8LQ34_DINSH/96-187--------------------------------------------------------------------------------
A5BQ81_VITVI/109-183--------------------------------------------------------------------------------
C5C9H6_MICLC/78-153--------------------------------------------------------------------------------
Q8CJW8_STRCO/479-556--------------------------------------------------------------------------------
Q8S7W8_ORYSJ/97-171--------------------------------------------------------------------------------
Q92DD3_LISIN/73-149--------------------------------------------------------------------------------
YDBT_BACSU/406-486--------------------------------------------------------------------------------
A0JUF8_ARTS2/86-161--------------------------------------------------------------------------------
Q0S416_RHOSR/85-163--------------------------------------------------------------------------------
A0YYM4_LYNSP/32-106--------------------------------------------------------------------------------
Q5KZA4_GEOKA/394-472--------------------------------------------------------------------------------
Q7TWU1_MYCBO/82-157--------------------------------------------------------------------------------
A4X9A7_SALTO/98-177--------------------------------------------------------------------------------
A1S9Q9_SHEAM/70-149--------------------------------------------------------------------------------
Q721T2_LISMF/403-484--------------------------------------------------------------------------------
Q5V3H6_HALMA/457-539--------------------------------------------------------------------------------
Q83YH0_RUBGE/102-193--------------------------------------------------------------------------------
Q132N9_RHOPS/92-183--------------------------------------------------------------------------------
B6SR38_MAIZE/97-171--------------------------------------------------------------------------------
A2C406_PROM1/41-115--------------------------------------------------------------------------------
Q2B513_9BACI/394-474--------------------------------------------------------------------------------
A6CG36_9PLAN/173-250--------------------------------------------------------------------------------
A4X9A6_SALTO/93-171--------------------------------------------------------------------------------
B4WGH0_9SYNE/39-113--------------------------------------------------------------------------------
Q0RP62_FRAAA/86-163--------------------------------------------------------------------------------
Q63ES8_BACCZ/238-321--------------------------------------------------------------------------------
A0JR89_ARTS2/421-499--------------------------------------------------------------------------------
B4W1I4_9CYAN/22-96--------------------------------------------------------------------------------
A0QQT0_MYCS2/68-149--------------------------------------------------------------------------------
A4CRN2_SYNPV/41-115--------------------------------------------------------------------------------
B8LD31_THAPS/35-108--------------------------------------------------------------------------------
A0M124_GRAFK/406-482--------------------------------------------------------------------------------
A3PE34_PROM0/40-114--------------------------------------------------------------------------------
B7KVD9_METC4/78-172--------------------------------------------------------------------------------
Q6NJ02_CORDI/358-436--------------------------------------------------------------------------------
YPU5_RHOCA/95-187--------------------------------------------------------------------------------
A4ACP9_9GAMM/95-186--------------------------------------------------------------------------------
Q03UQ0_LEUMM/60-139--------------------------------------------------------------------------------
A4INK5_GEOTN/61-142--------------------------------------------------------------------------------
A8I741_CHLRE/23-98--------------------------------------------------------------------------------
Q52V71_9ACTO/422-499--------------------------------------------------------------------------------
Q1VZX2_9FLAO/423-499--------------------------------------------------------------------------------
Q1PL87_PROMR/40-114--------------------------------------------------------------------------------
Q0A9I7_ALHEH/434-510--------------------------------------------------------------------------------
Q0TSV7_CLOP1/311-394--------------------------------------------------------------------------------
A7GLR9_BACCN/66-145--------------------------------------------------------------------------------
A2XD07_ORYSI/97-171--------------------------------------------------------------------------------
A4C2S8_9FLAO/260-345--------------------------------------------------------------------------------
Q5HEC8_STAAC/67-143--------------------------------------------------------------------------------
A0ZDC0_NODSP/39-113--------------------------------------------------------------------------------
B4FUN4_MAIZE/96-170--------------------------------------------------------------------------------
Q0DUR5_ORYSJ/97-171--------------------------------------------------------------------------------
Q2S4T2_SALRD/280-363--------------------------------------------------------------------------------
Q07RX8_RHOP5/92-183--------------------------------------------------------------------------------
Q1VZX2_9FLAO/274-357--------------------------------------------------------------------------------
B2J0Q4_NOSP7/39-113--------------------------------------------------------------------------------
Q49Z28_STAS1/72-148--------------------------------------------------------------------------------
Q1AYV8_RUBXD/67-148--------------------------------------------------------------------------------
Q949S6_ARATH/104-178--------------------------------------------------------------------------------
Q10VQ2_TRIEI/39-113--------------------------------------------------------------------------------
Q03T95_LACBA/71-147--------------------------------------------------------------------------------
Q3AV40_SYNS9/40-114--------------------------------------------------------------------------------
A5USV1_ROSS1/73-149--------------------------------------------------------------------------------
Q0TQ92_CLOP1/75-151--------------------------------------------------------------------------------
A7B9U4_9ACTO/406-484--------------------------------------------------------------------------------
A4ILF0_GEOTN/382-461--------------------------------------------------------------------------------
Q0A9I7_ALHEH/77-156--------------------------------------------------------------------------------
A1WXI2_HALHL/93-184--------------------------------------------------------------------------------
B7G849_PHATC/47-120--------------------------------------------------------------------------------
Q0TSV7_CLOP1/77-157--------------------------------------------------------------------------------
A7B793_RUMGN/74-155--------------------------------------------------------------------------------
B7KHE2_CYAP7/39-113--------------------------------------------------------------------------------
A5UZJ9_ROSS1/78-155--------------------------------------------------------------------------------
A6U3F8_STAA2/74-150--------------------------------------------------------------------------------
A6DYF7_9RHOB/94-185--------------------------------------------------------------------------------
A7A966_BIFAD/22-101--------------------------------------------------------------------------------
Q3IJZ4_PSEHT/76-156--------------------------------------------------------------------------------
Q73CA2_BACC1/388-464--------------------------------------------------------------------------------
Q9M9S8_ARATH/339-413--------------------------------------------------------------------------------
A1SMF8_NOCSJ/73-149--------------------------------------------------------------------------------
Q7U523_SYNPX/40-114--------------------------------------------------------------------------------
Q16DS6_ROSDO/94-185--------------------------------------------------------------------------------
A4X385_SALTO/78-154--------------------------------------------------------------------------------
A7B9U4_9ACTO/86-165--------------------------------------------------------------------------------
B6B3P5_9RHOB/94-185--------------------------------------------------------------------------------
A7GLR9_BACCN/269-351--------------------------------------------------------------------------------
A4AI68_9ACTN/73-148--------------------------------------------------------------------------------
A3Z0J2_9SYNE/41-115--------------------------------------------------------------------------------
Q3AM30_SYNSC/40-114--------------------------------------------------------------------------------
Q7VB01_PROMA/40-114--------------------------------------------------------------------------------
A3J6N0_9FLAO/71-152--------------------------------------------------------------------------------
Q6A731_PROAC/79-153--------------------------------------------------------------------------------
Q8GPI5_STAAU/65-145--------------------------------------------------------------------------------
Q4C5Y4_CROWT/39-113--------------------------------------------------------------------------------
A0NKK3_OENOE/413-495--------------------------------------------------------------------------------
A2C7A2_PROM3/40-114--------------------------------------------------------------------------------
A6FPZ3_9RHOB/96-187--------------------------------------------------------------------------------
A6G2U2_9DELT/86-163--------------------------------------------------------------------------------
Q05YV4_9SYNE/40-114--------------------------------------------------------------------------------
Q3IQW3_NATPD/58-137--------------------------------------------------------------------------------
A7VBS0_9CLOT/23-100--------------------------------------------------------------------------------
Q2JF56_FRASC/78-154--------------------------------------------------------------------------------
Q52V71_9ACTO/80-161--------------------------------------------------------------------------------
F2G2I3_ALTMD/454-530--------------------------------------------------------------------------------
A0Y0J5_9GAMM/280-360--------------------------------------------------------------------------------
A8YDE5_MICAE/39-113--------------------------------------------------------------------------------
Q7V0R9_PROMP/40-114--------------------------------------------------------------------------------
Q2NEQ5_METST/106-182--------------------------------------------------------------------------------
B1YH17_EXIS2/61-141--------------------------------------------------------------------------------
Q5QU90_IDILO/71-150--------------------------------------------------------------------------------
Q03UP9_LEUMM/73-149--------------------------------------------------------------------------------
Q086M2_SHEFN/453-529--------------------------------------------------------------------------------
Q92DD2_LISIN/68-148--------------------------------------------------------------------------------
A0NKK3_OENOE/79-160--------------------------------------------------------------------------------
Q8XM54_CLOPE/456-535--------------------------------------------------------------------------------
Q0W0T7_UNCMA/387-467--------------------------------------------------------------------------------
Q3JEQ1_NITOC/43-119--------------------------------------------------------------------------------
Q2JNH7_SYNJB/39-113--------------------------------------------------------------------------------
Q21G74_SACD2/81-160--------------------------------------------------------------------------------
Q2Z019_9CHLR/216-306--------------------------------------------------------------------------------
Q8XK94_CLOPE/57-138--------------------------------------------------------------------------------
Q8L2A0_PROVU/52-129--------------------------------------------------------------------------------
D1N2C5_9BACT/85-162--------------------------------------------------------------------------------
C1N978_MICPC/163-238--------------------------------------------------------------------------------
Q4UQ21_XANC8/70-149--------------------------------------------------------------------------------
Q9KC53_BACHD/397-477--------------------------------------------------------------------------------
A0M123_GRAFK/89-168--------------------------------------------------------------------------------
Q5NX64_AROAE/73-152--------------------------------------------------------------------------------
Q8ELM2_OCEIH/63-143--------------------------------------------------------------------------------
Q6NJ02_CORDI/83-162--------------------------------------------------------------------------------
D0CLT0_9SYNE/40-114--------------------------------------------------------------------------------
D7E125_NOSA0/39-113--------------------------------------------------------------------------------
A9NAV6_COXBR/84-159--------------------------------------------------------------------------------
B7K5U4_CYAP8/39-113--------------------------------------------------------------------------------
Q0S417_RHOSR/271-354--------------------------------------------------------------------------------
Q7UGR8_RHOBA/447-530--------------------------------------------------------------------------------
A8H7X9_SHEPA/99-178--------------------------------------------------------------------------------
Q8ELM2_OCEIH/411-490--------------------------------------------------------------------------------
Q1LGU6_RALME/27-104--------------------------------------------------------------------------------
A0PYF4_CLONN/263-346--------------------------------------------------------------------------------
A9DA93_9RHIZ/98-189--------------------------------------------------------------------------------
Q26E06_FLABB/272-354--------------------------------------------------------------------------------
A3IZS9_9CHRO/39-113--------------------------------------------------------------------------------
Q8DL95_THEEB/154-228--------------------------------------------------------------------------------
B5W8W6_SPIMA/39-113--------------------------------------------------------------------------------
Q0BW05_GRABC/100-175--------------------------------------------------------------------------------
Q0I8C4_SYNS3/41-115--------------------------------------------------------------------------------
Q7UG90_RHOBA/131-208--------------------------------------------------------------------------------
A1ZJ65_9BACT/38-113--------------------------------------------------------------------------------
Q46JN3_PROMT/41-115--------------------------------------------------------------------------------
A4C2S8_9FLAO/74-153--------------------------------------------------------------------------------
P74154_SYNY3/39-113--------------------------------------------------------------------------------
A3VXW4_9RHOB/94-185--------------------------------------------------------------------------------
A4VC01_BACUN/66-143--------------------------------------------------------------------------------
Q219Q4_RHOPB/92-183--------------------------------------------------------------------------------
D3LLG2_MICLU/78-153--------------------------------------------------------------------------------
A0Y0J7_9GAMM/81-160--------------------------------------------------------------------------------
A5ZQI3_9FIRM/16-93--------------------------------------------------------------------------------
C1E7H3_MICSR/155-230--------------------------------------------------------------------------------
A9BBJ1_PROM4/40-114--------------------------------------------------------------------------------
Q5MG95_IPOBA/97-168--------------------------------------------------------------------------------
Q5WBQ3_BACSK/413-492--------------------------------------------------------------------------------
A5CP90_CLAM3/129-207--------------------------------------------------------------------------------
E0U6K0_CYAP2/39-113--------------------------------------------------------------------------------
A8LDS5_FRASN/354-432--------------------------------------------------------------------------------
Q319V0_PROM9/40-114--------------------------------------------------------------------------------
A7BCE4_9ACTO/77-152--------------------------------------------------------------------------------
A5GN11_SYNPW/41-115--------------------------------------------------------------------------------
B4U7M5_HYDS0/110-189--------------------------------------------------------------------------------
B0JN61_MICAN/39-113--------------------------------------------------------------------------------
Q3BNL4_XANC5/409-490--------------------------------------------------------------------------------
Q21G75_SACD2/67-146--------------------------------------------------------------------------------
A3WHT6_9SPHN/102-193--------------------------------------------------------------------------------
A3ZL30_9PLAN/70-147--------------------------------------------------------------------------------
B4SKG8_STRM5/92-171--------------------------------------------------------------------------------
A6L372_BACV8/68-142--------------------------------------------------------------------------------
B1X5C5_PAUCH/39-113--------------------------------------------------------------------------------
Q3M7J5_ANAVT/39-113--------------------------------------------------------------------------------
Q7V611_PROMM/40-114--------------------------------------------------------------------------------
A3J6N0_9FLAO/260-345--------------------------------------------------------------------------------
B0CDM0_ACAM1/39-113--------------------------------------------------------------------------------
Q18HZ1_HALWD/71-148--------------------------------------------------------------------------------
B9HVA0_POPTR/105-179--------------------------------------------------------------------------------
A5IAX6_LEGPC/63-138--------------------------------------------------------------------------------
Q18K27_HALWD/63-142--------------------------------------------------------------------------------
A8G5Y3_PROM2/40-114--------------------------------------------------------------------------------
Q9KC53_BACHD/249-335--------------------------------------------------------------------------------
Q2JXB7_SYNJA/39-113--------------------------------------------------------------------------------
B1WWJ1_CYAA5/39-113--------------------------------------------------------------------------------
Q58PP7_9PROT/102-193--------------------------------------------------------------------------------
B8HR49_CYAP4/39-113--------------------------------------------------------------------------------
Q2S103_SALRD/46-123--------------------------------------------------------------------------------
B9P2Z9_PROMR/37-111--------------------------------------------------------------------------------
Q31MS3_SYNE7/39-113--------------------------------------------------------------------------------
A3CWW6_METMJ/72-152--------------------------------------------------------------------------------
B1XJD3_SYNP2/39-113--------------------------------------------------------------------------------
A5N1P5_CLOK5/245-328--------------------------------------------------------------------------------
Q5N604_SYNP6/39-113--------------------------------------------------------------------------------
C7QSQ1_CYAP0/39-113--------------------------------------------------------------------------------
B1YH17_EXIS2/235-317--------------------------------------------------------------------------------
A8DJC1_9BACT/77-153--------------------------------------------------------------------------------
A3TM09_9MICO/97-176--------------------------------------------------------------------------------
B9S293_RICCO/108-182--------------------------------------------------------------------------------
A0PYF4_CLONN/58-140--------------------------------------------------------------------------------
Q2BC10_9BACI/64-144--------------------------------------------------------------------------------

PF08512

E3JV35_PUCGT/378-471--------------------------------------------------------------------------------
SPT16_CRYNJ/823-913--------------------------------------------------------------------------------
MU183_SCHPO/224-312--------------------------------------------------------------------------------
A0D1L5_PARTE/272-363--------------------------------------------------------------------------------
A0DSI1_PARTE/255-346--------------------------------------------------------------------------------
A2DGX1_TRIVA/315-409--------------------------------------------------------------------------------
RT106_ASPNC/254-348--------------------------------------------------------------------------------
A3LUL0_PICST/372-466--------------------------------------------------------------------------------
A3LUQ9_PICST/282-380--------------------------------------------------------------------------------
RT106_MAGO7/271-365--------------------------------------------------------------------------------
A4RSB9_OSTLU/241-330--------------------------------------------------------------------------------
A5DBS4_PICGU/383-476--------------------------------------------------------------------------------
RT106_PICGU/253-354--------------------------------------------------------------------------------
RT106_LODEL/273-372--------------------------------------------------------------------------------
A5K9I5_PLAVS/838-928--------------------------------------------------------------------------------
A6QQT5_BOVIN/338-428--------------------------------------------------------------------------------
A7AMU7_BABBO/345-437--------------------------------------------------------------------------------
A7ATG3_BABBO/682-772--------------------------------------------------------------------------------
A7EF87_SCLS1/222-319--------------------------------------------------------------------------------
A7EHR1_SCLS1/823-913--------------------------------------------------------------------------------
A7EPG7_SCLS1/122-216--------------------------------------------------------------------------------
A7SAG6_NEMVE/329-422--------------------------------------------------------------------------------
A7SV15_NEMVE/817-907--------------------------------------------------------------------------------
A8B8A9_GIAIC/457-556--------------------------------------------------------------------------------
A8JHE3_CHLRE/834-924--------------------------------------------------------------------------------
A8NIX9_COPC7/281-392--------------------------------------------------------------------------------
A8NQK0_COPC7/350-445--------------------------------------------------------------------------------
A8PHT4_BRUMA/819-909--------------------------------------------------------------------------------
A8Q169_MALGO/420-513--------------------------------------------------------------------------------
A9TYN6_PHYPA/829-919--------------------------------------------------------------------------------
A9UWZ2_MONBE/130-221--------------------------------------------------------------------------------
B0D3X0_LACBS/691-781--------------------------------------------------------------------------------
B0EBA0_ENTDS/238-331--------------------------------------------------------------------------------
B0WV30_CULQU/164-253--------------------------------------------------------------------------------
B2AEJ4_PODAN/271-367--------------------------------------------------------------------------------
B2WB70_PYRTR/816-906--------------------------------------------------------------------------------
B3LP50_YEAS1/219-308--------------------------------------------------------------------------------
B3RJ01_TRIAD/796-886--------------------------------------------------------------------------------
B3S4B9_TRIAD/339-431--------------------------------------------------------------------------------
B4MYD4_DROWI/338-428--------------------------------------------------------------------------------
B5DPP2_DROPS/812-902--------------------------------------------------------------------------------
B6K3E4_SCHJY/354-447--------------------------------------------------------------------------------
B6Q860_PENMQ/277-371--------------------------------------------------------------------------------
B6SH59_MAIZE/359-454--------------------------------------------------------------------------------
B7FSR1_PHATC/830-920--------------------------------------------------------------------------------
B7Q220_IXOSC/338-428--------------------------------------------------------------------------------
B8C388_THAPS/329-429--------------------------------------------------------------------------------
B8N5D9_ASPFN/836-926--------------------------------------------------------------------------------
B9FEF3_ORYSJ/819-909--------------------------------------------------------------------------------
B9PYN6_TOXGO/951-1041--------------------------------------------------------------------------------
C0SF36_PARBP/419-513--------------------------------------------------------------------------------
C1EF78_MICSR/357-451--------------------------------------------------------------------------------
C1EGI9_MICSR/255-341--------------------------------------------------------------------------------
C1MGW4_MICPC/827-917--------------------------------------------------------------------------------
C1N716_MICPC/352-450--------------------------------------------------------------------------------
C3YLD4_BRAFL/809-899--------------------------------------------------------------------------------
C3Z3Y2_BRAFL/337-427--------------------------------------------------------------------------------
C4JJX0_UNCRE/248-343--------------------------------------------------------------------------------
C4M3K5_ENTHI/527-619--------------------------------------------------------------------------------
C4R4T9_PICPG/190-282--------------------------------------------------------------------------------
C4V834_NOSCE/640-728--------------------------------------------------------------------------------
C4VA45_NOSCE/300-390--------------------------------------------------------------------------------
C4XW15_CLAL4/363-457--------------------------------------------------------------------------------
C4XWH5_CLAL4/282-381--------------------------------------------------------------------------------
C4YJJ1_CANAW/361-455--------------------------------------------------------------------------------
C5DD23_LACTC/203-292--------------------------------------------------------------------------------
C5DLM5_LACTC/832-922--------------------------------------------------------------------------------
C5KH74_PERM5/339-433--------------------------------------------------------------------------------
C5M9F0_CANTT/250-349--------------------------------------------------------------------------------
C5MDR0_CANTT/801-891--------------------------------------------------------------------------------
C7GW05_YEAS2/381-475--------------------------------------------------------------------------------
C7Z9V4_NECH7/370-464--------------------------------------------------------------------------------
C9SCC5_VERA1/256-347--------------------------------------------------------------------------------
D0NNZ6_PHYIT/339-439--------------------------------------------------------------------------------
D2HYC0_AILME/786-876--------------------------------------------------------------------------------
D2VV01_NAEGR/360-450--------------------------------------------------------------------------------
D3AWW1_POLPA/841-931--------------------------------------------------------------------------------
D3AXH6_POLPA/368-466--------------------------------------------------------------------------------
D4D4T0_TRIVH/279-374--------------------------------------------------------------------------------
D5G7P9_TUBMM/814-904--------------------------------------------------------------------------------
D5G911_TUBMM/234-326--------------------------------------------------------------------------------
D5GN86_TUBMM/370-466--------------------------------------------------------------------------------
D7FLF8_ECTSI/341-441--------------------------------------------------------------------------------
D7FPY1_ECTSI/806-907--------------------------------------------------------------------------------
D8LUR8_BLAHO/80-165--------------------------------------------------------------------------------
D8LVG5_BLAHO/621-711--------------------------------------------------------------------------------
D8PY95_SCHCM/356-448--------------------------------------------------------------------------------
D8SZS6_SELML/346-442--------------------------------------------------------------------------------
D8TSG5_VOLCA/120-188--------------------------------------------------------------------------------
D8U9V6_VOLCA/356-451--------------------------------------------------------------------------------
E0VDU0_PEDHC/338-428--------------------------------------------------------------------------------
E2LU78_MONPE/65-164--------------------------------------------------------------------------------
E3K8A4_PUCGT/841-931--------------------------------------------------------------------------------
E3LF48_CAERE/802-892--------------------------------------------------------------------------------
E3N6Q4_CAERE/338-430--------------------------------------------------------------------------------
E3QQA8_COLGM/254-348--------------------------------------------------------------------------------
E4WR67_OIKDI/341-431--------------------------------------------------------------------------------
E4YKA6_OIKDI/21-111--------------------------------------------------------------------------------
E4ZT07_LEPMJ/588-682--------------------------------------------------------------------------------
E5A724_LEPMJ/8-89--------------------------------------------------------------------------------
E5RZ09_TRISP/385-475--------------------------------------------------------------------------------
E6REF3_CRYGW/369-463--------------------------------------------------------------------------------
E6ZPS6_SPORE/385-478--------------------------------------------------------------------------------
E7LIV2_TRYCR/395-493--------------------------------------------------------------------------------
E7R3F7_PICAD/361-455--------------------------------------------------------------------------------
E7R8M3_PICAD/192-282--------------------------------------------------------------------------------
E9AM77_LEIMU/797-887--------------------------------------------------------------------------------
E9AYL3_LEIMU/445-531--------------------------------------------------------------------------------
E9CGL5_CAPO3/770-860--------------------------------------------------------------------------------
E9CHA3_CAPO3/447-533--------------------------------------------------------------------------------
E9DTZ0_METAQ/822-912--------------------------------------------------------------------------------
E9DVQ4_METAQ/243-337--------------------------------------------------------------------------------
F0VGH1_NEOCL/360-452--------------------------------------------------------------------------------
F0WM38_9STRA/1874-1964--------------------------------------------------------------------------------
F0X7S7_GROCL/267-361--------------------------------------------------------------------------------
F0YFE5_AURAN/364-464--------------------------------------------------------------------------------
F0YK20_AURAN/255-345--------------------------------------------------------------------------------
F1KVT9_ASCSU/180-270--------------------------------------------------------------------------------
F1L0N9_ASCSU/243-330--------------------------------------------------------------------------------
F2QNN8_PICP7/393-484--------------------------------------------------------------------------------
F2T7L6_AJEDA/274-369--------------------------------------------------------------------------------
F2U7M9_SALS5/352-446--------------------------------------------------------------------------------
F2UEG8_SALS5/776-866--------------------------------------------------------------------------------
SSP1B_CAEEL/338-430--------------------------------------------------------------------------------
SPT16_SCHPO/813-903--------------------------------------------------------------------------------
POB3_SCHPO/353-446--------------------------------------------------------------------------------
Q00W77_OSTTA/322-416--------------------------------------------------------------------------------
SSRP1_ARATH/348-441--------------------------------------------------------------------------------
Q0INI2_ORYSJ/396-486--------------------------------------------------------------------------------
Q23D83_TETTS/261-352--------------------------------------------------------------------------------
RT106_CHAGB/265-365--------------------------------------------------------------------------------
Q2HGG4_CHAGB/821-911--------------------------------------------------------------------------------
Q388G3_TRYB2/376-473--------------------------------------------------------------------------------
Q4CP43_TRYCC/660-750--------------------------------------------------------------------------------
Q4E2D9_TRYCC/326-410--------------------------------------------------------------------------------
SSRP1_CIOIN/341-432--------------------------------------------------------------------------------
Q4N2N7_THEPA/648-738--------------------------------------------------------------------------------
SPT16_USTMA/817-907--------------------------------------------------------------------------------
Q4Q5R4_LEIMA/337-430--------------------------------------------------------------------------------
Q4UAH0_THEAN/359-451--------------------------------------------------------------------------------
SPT16_DICDI/824-914--------------------------------------------------------------------------------
RT106_CANAL/244-343--------------------------------------------------------------------------------
Q5CIB9_CRYHO/343-434--------------------------------------------------------------------------------
Q5CYL0_CRYPI/886-979--------------------------------------------------------------------------------
RT106_DEBHA/279-380--------------------------------------------------------------------------------
POB3_YARLI/385-478--------------------------------------------------------------------------------
SPT16_YARLI/812-902--------------------------------------------------------------------------------
RT106_YARLI/218-309--------------------------------------------------------------------------------
RT106_KLULA/205-294--------------------------------------------------------------------------------
RT106_CANGA/204-297--------------------------------------------------------------------------------
SPT16_CANGA/830-920--------------------------------------------------------------------------------
Q6RCP5_TETTH/797-887--------------------------------------------------------------------------------
RT106_ASHGO/199-288--------------------------------------------------------------------------------
RT106_NEUCR/266-364--------------------------------------------------------------------------------
Q8IL56_PLAF7/350-442--------------------------------------------------------------------------------
Q8SRJ1_ENCCU/303-393--------------------------------------------------------------------------------

PF07289

Q295Y8_DROPS/17-373.IVHMHSKGRM.PSQALYILAI..SNETRFEFLFT.............................DVSGETARR....EQP
Q6PSU7_CHLRE/13-352.AA..TSRIKG.STQSLYVLTK..YHNQRFEFIFT.............................ATASESAT......DS
BBS5_DANRE/7-341.TA..NSKLRG.QTEALYILTK..SNNTRFEFIFT.............................NVVPGSP........R
Q4QGM5_LEIMA/24-429.EA..ESKLAGRMTECITLGSK..CGASRFQFIFSVAHDVGDIGSGSAASTSTSGGAAAQRDCENRSRRRPSKGTGGHQR
Q4V3K1_DROME/1-343.VVHMHSKARI.ASQALYILAV..SNETRFEFLFT.............................DVSGETSRR....DQP
Q3SCX0_PARTE/4-324VTN..NNRTFG....TLFRTKL..ATGQKYEFHFS.....................................SQ...DKK
Q231T4_TETTS/4-299.....QSILAG.....................................................................
Q21626_CAEEL/8-358QTTSLVTRNRGISNEAIYVLAKVSATTTKFEFIFT.............................TTNPASHS.......K
Q86PG0_TRYCR/17-372.EA..NLRLRG.TTEVLYITSR..FGSSRYEFVFT.............................QLMRKNCQ........
A2FLN7_TRIVA/10-343NTF...NQSNG.NTENLFIRAK..EGTKTYEFIFS..............................VSRISS........S
P91582_CIOIN/3-345.RT..NSKLRG.PTESLCISTK..CNSNKFEFIFT.............................NDVSEQG........G
Q17LJ5_AEDAE/5-340.TV..VSKVRG.TTQALHILSV..GNNSRFEFIFT.............................NLTVNNTK......H.
Q4GYG4_TRYB2/17-368.MV..ETRLRG.HAEALRITAR..YGSNRFEFFFT.............................HPSEDRRS......R.

PF03531

SSRP1_XENLA/74-285--------------------------------------------------------------------------------
SSRP1_ARATH/74-295--------------------------------------------------------------------------------
POB3_SCHPO/73-300--------------------------------------------------------------------------------
SSP1A_ORYSJ/74-294--------------------------------------------------------------------------------
SSRP1_DROME/74-285--------------------------------------------------------------------------------
SSP1B_CAEEL/73-286--------------------------------------------------------------------------------

PF00638

RANG_HUMAN/37-161----------------------------------------------------------------------EIKTLEED--
RBP2_HUMAN/2321-2442----------------------------------------------------------------------EVSSGEEN--
YRB2_YEAST/204-327----------------------------------------------------------------------EVKSGEES--
NUP2_YEAST/598-718----------------------------------------------------------------------NLQNGEED--
RBP2_HUMAN/2024-2145----------------------------------------------------------------------ELVTGEED--
YRB1_YEAST/75-197----------------------------------------------------------------------DVKTMEED--
RBP2_HUMAN/2922-3043----------------------------------------------------------------------EVKSGEED--
RBP2_HUMAN/1183-1304----------------------------------------------------------------------EVKTGEED--

PF00568

LAS17_YEAST/13-124----------------------------------------------------------------------KRALPKAS--
Q9VAT0_DROME/31-140----------------------------------------------------------------------FKLLGKKC--
O96607_DROME/1-107----------------------------------------------------------------------MG.E....--
WASL_RAT/28-135----------------------------------------------------------------------FSFLGKKC--
VASP_HUMAN/1-110----------------------------------------------------------------------MS.E....--
HOME3_RAT/3-110----------------------------------------------------------------------TARE....--
ENAH_MOUSE/1-108----------------------------------------------------------------------MS.E....--
WASP_HUMAN/36-145----------------------------------------------------------------------FEMLGRKC--

PF06058

DCP1B_HUMAN/9-131----------------------------------------------------------------------LVGKGRDI..
Q03633_PLAFA/135-262----------------------------------------------------------------------MKLLREKI..
DCP1A_MOUSE/24-146----------------------------------------------------------------------LSRAEQEM..
Q90WT0_DANRE/4-126----------------------------------------------------------------------VNKAGQLM..
DCP1_ARATH/12-134----------------------------------------------------------------------DQNSTRLL..
Q9W1H5_DROME/2-124----------------------------------------------------------------------ADESITRM..
Q9N363_CAEEL/5-130----------------------------------------------------------------------KKKAAAELAA
Q8SU45_ENCCU/2-123----------------------------------------------------------------------VGKRDGQI..
DCP1_SCHPO/4-125----------------------------------------------------------------------ENILRNAV..

PF15410

E5RJ29_HUMAN/721-832--------------------------------------------------------------------------------
B3P8M6_DROER/1074-1185--------------------------------------------------------------------------------
A8PYL1_BRUMA/388-498--------------------------------------------------------------------------------
H2SLA8_TAKRU/516-627--------------------------------------------------------------------------------
B7QFP5_IXOSC/177-288--------------------------------------------------------------------------------
I1BQ29_RHIO9/379-506--------------------------------------------------------------------------------
E3WPL5_ANODA/343-456--------------------------------------------------------------------------------
D4YWC5_CAEEL/387-497--------------------------------------------------------------------------------
E3JSD7_PUCGT/1317-1461--------------------------------------------------------------------------------
F1KU63_ASCSU/420-530--------------------------------------------------------------------------------
YDYB_SCHPO/679-804--------------------------------------------------------------------------------
F6X1S7_XENTR/10-124--------------------------------------------------------------------------------
E9H3M8_DAPPU/491-615--------------------------------------------------------------------------------
G4VKT4_SCHMA/511-627--------------------------------------------------------------------------------
E5SKG2_TRISP/325-435--------------------------------------------------------------------------------
I1CBT7_RHIO9/688-826--------------------------------------------------------------------------------

PF00169

PSD1_HUMAN/757-869--------------------------------------------------------------------------------
O00886_DICDI/1008-1093--------------------------------------------------------------------------------
UNC89_CAEEL/349-451--------------------------------------------------------------------------------
O02134_CAEEL/257-375--------------------------------------------------------------------------------
O08724_RAT/33-133--------------------------------------------------------------------------------
YB35_SCHPO/255-349--------------------------------------------------------------------------------
O23559_ARATH/656-764--------------------------------------------------------------------------------
TRIO_HUMAN/1480-1591--------------------------------------------------------------------------------
TRIO_HUMAN/2158-2271--------------------------------------------------------------------------------
PLEK_HUMAN/5-101--------------------------------------------------------------------------------
PLEK_HUMAN/245-347--------------------------------------------------------------------------------
MCF2_HUMAN/705-809--------------------------------------------------------------------------------
OSBP1_RABIT/91-183--------------------------------------------------------------------------------
PLCG1_HUMAN/33-142--------------------------------------------------------------------------------
DYN1_RAT/520-625--------------------------------------------------------------------------------
UN104_CAEEL/1461-1558--------------------------------------------------------------------------------
TEC_MOUSE/5-111--------------------------------------------------------------------------------
ARBK1_HUMAN/559-652--------------------------------------------------------------------------------
SOS_DROME/481-588--------------------------------------------------------------------------------
RGRF1_RAT/23-129--------------------------------------------------------------------------------
RGRF1_RAT/457-582--------------------------------------------------------------------------------
GPRK1_DROME/558-657--------------------------------------------------------------------------------
BEM3_YEAST/635-741--------------------------------------------------------------------------------
KIF1A_MOUSE/1581-1678--------------------------------------------------------------------------------
PAC1_CAEEL/612-726--------------------------------------------------------------------------------
MIG10_CAEEL/457-566--------------------------------------------------------------------------------
GRP1_CAEEL/262-380--------------------------------------------------------------------------------
YOTB_CAEEL/36-131--------------------------------------------------------------------------------
CRAC_DICDI/23-122--------------------------------------------------------------------------------
OPY1_YEAST/216-318--------------------------------------------------------------------------------
SIP3_YEAST/310-423--------------------------------------------------------------------------------
YHT1_YEAST/194-304--------------------------------------------------------------------------------
YSP1_YEAST/309-421--------------------------------------------------------------------------------
BEM2_YEAST/1832-1948--------------------------------------------------------------------------------
BOI2_YEAST/769-887--------------------------------------------------------------------------------
SLM1_YEAST/469-581--------------------------------------------------------------------------------
RHG25_HUMAN/47-151--------------------------------------------------------------------------------
TG325_CAEEL/387-505--------------------------------------------------------------------------------
BUD4_YEAST/1303-1413--------------------------------------------------------------------------------
ASK10_YEAST/482-720--------------------------------------------------------------------------------
CTRO_MOUSE/1470-1589--------------------------------------------------------------------------------
BMX_HUMAN/5-111--------------------------------------------------------------------------------
BUD4_CANAL/1577-1685--------------------------------------------------------------------------------
CA120_YEAST/76-204--------------------------------------------------------------------------------
VAV_RAT/403-504--------------------------------------------------------------------------------
KRAC_DICDI/6-99--------------------------------------------------------------------------------
RGRF2_MOUSE/23-133--------------------------------------------------------------------------------
MYO10_BOVIN/1207-1304--------------------------------------------------------------------------------
SIF1_DROME/849-955--------------------------------------------------------------------------------
SIF1_DROME/1672-1793--------------------------------------------------------------------------------
P91678_DROME/205-307--------------------------------------------------------------------------------
MPRIP_MOUSE/387-482--------------------------------------------------------------------------------
FGD1_HUMAN/591-689--------------------------------------------------------------------------------
FGD1_HUMAN/822-921--------------------------------------------------------------------------------
APSA_EMENI/1394-1504--------------------------------------------------------------------------------
NUM1_YEAST/2574-2683--------------------------------------------------------------------------------
SPTCB_DROME/2148-2259--------------------------------------------------------------------------------
SPTB2_HUMAN/2198-2307--------------------------------------------------------------------------------
SOS2_MOUSE/443-545--------------------------------------------------------------------------------
GRB7_MOUSE/229-341--------------------------------------------------------------------------------
NRKB_TRYBB/332-429--------------------------------------------------------------------------------
ITK_MOUSE/5-117--------------------------------------------------------------------------------
BTK_HUMAN/4-133--------------------------------------------------------------------------------
SKG3_YEAST/91-221--------------------------------------------------------------------------------
ATG26_YEAST/239-336--------------------------------------------------------------------------------
TUS1_YEAST/716-877--------------------------------------------------------------------------------
3BP2_MOUSE/27-130--------------------------------------------------------------------------------
YP091_YEAST/114-266--------------------------------------------------------------------------------
ANI2_CAEEL/893-1005--------------------------------------------------------------------------------
SHK2_SCHPO/24-125--------------------------------------------------------------------------------
RGA2_SCHPO/720-836--------------------------------------------------------------------------------
CNT6_SCHPO/527-632--------------------------------------------------------------------------------
YDG1_SCHPO/549-677--------------------------------------------------------------------------------
OSH2_YEAST/290-386--------------------------------------------------------------------------------
SKM1_YEAST/4-118--------------------------------------------------------------------------------
ARHG5_HUMAN/1391-1502--------------------------------------------------------------------------------
AKP13_HUMAN/2232-2333--------------------------------------------------------------------------------
ABR_HUMAN/302-459--------------------------------------------------------------------------------
GRB10_HUMAN/291-399--------------------------------------------------------------------------------
PLD1_HUMAN/220-328--------------------------------------------------------------------------------
ROCK1_HUMAN/1119-1212--------------------------------------------------------------------------------
GAB1_HUMAN/6-116--------------------------------------------------------------------------------
SNTB1_HUMAN/323-433--------------------------------------------------------------------------------
ARHG7_HUMAN/480-578--------------------------------------------------------------------------------
ACAP1_HUMAN/266-360--------------------------------------------------------------------------------
ARHG6_HUMAN/450-548--------------------------------------------------------------------------------
KPCD1_HUMAN/423-541--------------------------------------------------------------------------------
CYH1_HUMAN/261-377--------------------------------------------------------------------------------
Q17777_CAEEL/241-343--------------------------------------------------------------------------------
AKT1_CAEEL/16-118--------------------------------------------------------------------------------
Q18284_CAEEL/578-673--------------------------------------------------------------------------------
Q18420_CAEEL/249-346--------------------------------------------------------------------------------
UN112_CAEEL/406-507--------------------------------------------------------------------------------
Q20151_CAEEL/20-135--------------------------------------------------------------------------------
Q21025_CAEEL/833-940--------------------------------------------------------------------------------
GAP1_CAEEL/412-507--------------------------------------------------------------------------------
Q23419_CAEEL/18-114--------------------------------------------------------------------------------
Q23980_DROME/1145-1252--------------------------------------------------------------------------------
Q24284_DROME/15-132--------------------------------------------------------------------------------
IRS1_CHLAE/13-115--------------------------------------------------------------------------------
SNTA1_RABIT/294-401--------------------------------------------------------------------------------
Q29517_RABIT/10-119--------------------------------------------------------------------------------
VAV_CAEEL/471-598--------------------------------------------------------------------------------
SECG_DICDI/785-895--------------------------------------------------------------------------------
RDCII_DICDI/354-461--------------------------------------------------------------------------------
RGPS1_HUMAN/432-543--------------------------------------------------------------------------------
ARHGG_HUMAN/502-620--------------------------------------------------------------------------------
RHG26_CHICK/266-369--------------------------------------------------------------------------------
TIAM1_MOUSE/434-547--------------------------------------------------------------------------------
TIAM1_MOUSE/1261-1395--------------------------------------------------------------------------------
AKT2_MOUSE/6-108--------------------------------------------------------------------------------
ARHG2_MOUSE/474-572--------------------------------------------------------------------------------
VAV2_MOUSE/401-502--------------------------------------------------------------------------------
PLCL1_RAT/115-224--------------------------------------------------------------------------------
PLCD4_RAT/17-124--------------------------------------------------------------------------------
SH2B1_RAT/247-376--------------------------------------------------------------------------------
PHLB1_RAT/722-824--------------------------------------------------------------------------------
Q63629_RAT/255-358--------------------------------------------------------------------------------
RASA2_RAT/604-704--------------------------------------------------------------------------------
DGKH_MESAU/60-152--------------------------------------------------------------------------------
ARHG8_HUMAN/387-501--------------------------------------------------------------------------------
CAPS1_MOUSE/520-622--------------------------------------------------------------------------------
AKT1_DROME/107-211--------------------------------------------------------------------------------
AFAP1_CHICK/154-249--------------------------------------------------------------------------------
AFAP1_CHICK/348-441--------------------------------------------------------------------------------
Q91492_TORCA/276-383--------------------------------------------------------------------------------
MUG79_SCHPO/1044-1158--------------------------------------------------------------------------------
Q93569_CAEEL/7-101--------------------------------------------------------------------------------
SNT1_CAEEL/228-340--------------------------------------------------------------------------------
FERM2_HUMAN/381-476--------------------------------------------------------------------------------
DOK1_HUMAN/4-119--------------------------------------------------------------------------------
ANLN_DROME/1107-1230--------------------------------------------------------------------------------
DOS_DROME/4-113--------------------------------------------------------------------------------

PF15413

A0CUJ8_PARTE/105-200--------------------------------------------------------------------------------
A7SI59_NEMVE/523-628--------------------------------------------------------------------------------
C4Y4Q1_CLAL4/136-269--------------------------------------------------------------------------------
C6HG43_AJECH/87-193--------------------------------------------------------------------------------
D7KQC6_ARALL/95-227--------------------------------------------------------------------------------
E5T4G3_TRISP/39-138--------------------------------------------------------------------------------
E9C7L7_CAPO3/130-226--------------------------------------------------------------------------------

PF15409

B6JVE7_SCHJY/144-232--------------------------------------------------------------------------------
C5K2A6_AJEDS/215-303--------------------------------------------------------------------------------
E3RG70_PYRTT/221-309--------------------------------------------------------------------------------
H1VVI1_COLHI/216-304--------------------------------------------------------------------------------
C8VHJ7_EMENI/110-198--------------------------------------------------------------------------------
Q6C4Y2_YARLI/155-243--------------------------------------------------------------------------------
G3B6N0_CANTC/156-243--------------------------------------------------------------------------------
A3LTM2_PICST/192-279--------------------------------------------------------------------------------
G8YKE6_PICSO/214-301--------------------------------------------------------------------------------
H8X718_9ASCO/198-285--------------------------------------------------------------------------------
F2UGB6_SALS5/1490-1577--------------------------------------------------------------------------------

PF15406

B6K769_SCHJY/110-235--------------------------------------------------------------------------------
G2X9M4_VERDV/99-204--------------------------------------------------------------------------------
E3Q3I3_COLGM/92-197--------------------------------------------------------------------------------
G4MXJ0_MAGO7/107-216--------------------------------------------------------------------------------
G2PZQ3_THIHA/101-208--------------------------------------------------------------------------------
A6STK7_BOTFB/10-118--------------------------------------------------------------------------------
G4UAB8_NEUT9/95-202--------------------------------------------------------------------------------
B2A9W4_PODAN/92-199--------------------------------------------------------------------------------
F9G078_FUSOF/114-219--------------------------------------------------------------------------------
H0EZ07_GLAL7/83-191--------------------------------------------------------------------------------
G0SHV9_CHATD/90-197--------------------------------------------------------------------------------
F0XAK4_GROCL/91-200--------------------------------------------------------------------------------
H6BUU9_EXODN/90-198--------------------------------------------------------------------------------

PF15408

B6JZV3_SCHJY/839-941--------------------------------------------------------------------------------
MID1_SCHPO/805-907--------------------------------------------------------------------------------

PF15411

SCD1_SCHPO/427-542--------------------------------------------------------------------------------
B6JVU8_SCHJY/389-504--------------------------------------------------------------------------------
E6ZVA8_SPORE/481-616--------------------------------------------------------------------------------
D5GGD7_TUBMM/420-541--------------------------------------------------------------------------------
G1XAU9_ARTOA/438-556--------------------------------------------------------------------------------
I1S1B1_GIBZE/431-552--------------------------------------------------------------------------------
G7E2X4_MIXOS/391-510--------------------------------------------------------------------------------
B6QQH4_PENMQ/385-509--------------------------------------------------------------------------------
G0T0J6_RHOG2/494-613--------------------------------------------------------------------------------
D1MYR8_9HYPO/434-550--------------------------------------------------------------------------------
F7VM13_SORMK/436-557--------------------------------------------------------------------------------
E9CVX1_COCPS/381-505--------------------------------------------------------------------------------
E3QQB9_COLGM/431-552--------------------------------------------------------------------------------
Q2GPG0_CHAGB/418-539--------------------------------------------------------------------------------
F0X7S3_GROCL/410-531--------------------------------------------------------------------------------
G4NAK1_MAGO7/442-563--------------------------------------------------------------------------------
F2PSL1_TRIEC/255-378--------------------------------------------------------------------------------
G3JRH1_CORMM/592-713--------------------------------------------------------------------------------
F9X6S4_MYCGM/383-505--------------------------------------------------------------------------------
B2VWD7_PYRTR/471-593--------------------------------------------------------------------------------
I1C104_RHIO9/375-487--------------------------------------------------------------------------------
Q6CBW7_YARLI/467-578--------------------------------------------------------------------------------
H6BPC6_EXODN/386-507--------------------------------------------------------------------------------
I1BLT9_RHIO9/200-314--------------------------------------------------------------------------------
Q5KFX7_CRYNJ/908-1028--------------------------------------------------------------------------------
Q4P6E0_USTMA/491-614--------------------------------------------------------------------------------
F4PBV1_BATDJ/346-455--------------------------------------------------------------------------------
I1C1Q1_RHIO9/363-476--------------------------------------------------------------------------------
D8Q1A2_SCHCM/269-391--------------------------------------------------------------------------------
A5DJC8_PICGU/472-589--------------------------------------------------------------------------------
A8N8V8_COPC7/386-508--------------------------------------------------------------------------------
F4RFQ9_MELLP/828-937--------------------------------------------------------------------------------
G3J9K1_CORMM/454-571--------------------------------------------------------------------------------
G9NM35_HYPAI/326-439--------------------------------------------------------------------------------
G1X4D9_ARTOA/384-499--------------------------------------------------------------------------------
F9X5J1_MYCGM/455-563--------------------------------------------------------------------------------
Q7PLZ7_ANOGA/417-526--------------------------------------------------------------------------------
C4JQ35_UNCRE/310-422--------------------------------------------------------------------------------
C5P3B7_COCP7/314-426--------------------------------------------------------------------------------

PF14593

Q7PUX5_ANOGA/445-547--------------------------------------------------------------------------------
D6WGV3_TRICA/369-471--------------------------------------------------------------------------------
E2A088_CAMFO/460-562--------------------------------------------------------------------------------
Q76BX2_ASTPE/464-566--------------------------------------------------------------------------------
PDPK1_MOUSE/449-551--------------------------------------------------------------------------------
A8XME2_CAEBR/317-419--------------------------------------------------------------------------------
F0ZQF1_DICPU/137-240--------------------------------------------------------------------------------
Q172S2_AEDAE/402-506--------------------------------------------------------------------------------
A8PPP4_BRUMA/323-425--------------------------------------------------------------------------------
E3MA10_CAERE/460-562--------------------------------------------------------------------------------
A8X5P7_CAEBR/474-576--------------------------------------------------------------------------------
D2VK59_NAEGR/353-456--------------------------------------------------------------------------------
B5DR97_DROPS/703-805--------------------------------------------------------------------------------
F0W8Q4_9STRA/392-494--------------------------------------------------------------------------------
D8QMJ5_SELML/388-489--------------------------------------------------------------------------------
C1KFX1_9CNID/346-448--------------------------------------------------------------------------------
E9CBD6_CAPO3/483-586--------------------------------------------------------------------------------
C4QMA7_SCHMA/364-466--------------------------------------------------------------------------------
F0ZSM2_DICPU/404-506--------------------------------------------------------------------------------
E3WL97_ANODA/469-571--------------------------------------------------------------------------------
B0X1B0_CULQU/404-508--------------------------------------------------------------------------------
E5SYD2_TRISP/403-505--------------------------------------------------------------------------------
Q9XF68_ORYSA/242-348--------------------------------------------------------------------------------
E4XZ21_OIKDI/382-502--------------------------------------------------------------------------------
A2DAR5_TRIVA/371-472--------------------------------------------------------------------------------
F0ZMQ8_DICPU/111-220--------------------------------------------------------------------------------
Q9BMX6_APLCA/717-819--------------------------------------------------------------------------------
D3BJW1_POLPA/401-501--------------------------------------------------------------------------------
E9H687_DAPPU/410-512--------------------------------------------------------------------------------
D8M3A3_BLAHO/75-180--------------------------------------------------------------------------------
F2U695_SALS5/410-513--------------------------------------------------------------------------------

PF12814

A4HEV0_LEIBR/313-423--------------------------------------------------------------------------------
A6RUJ3_BOTFB/967-1099--------------------------------------------------------------------------------
A8NC45_COPC7/1477-1596--------------------------------------------------------------------------------
A8Q694_MALGO/495-613--------------------------------------------------------------------------------
B2VUN2_PYRTR/943-1083--------------------------------------------------------------------------------
B6JVF8_SCHJY/810-930--------------------------------------------------------------------------------
B8M115_TALSN/905-1052--------------------------------------------------------------------------------
C0SAF8_PARBP/1004-1151--------------------------------------------------------------------------------
C1H210_PARBA/1232-1352--------------------------------------------------------------------------------
C5DMW2_LACTC/3405-3524--------------------------------------------------------------------------------
C5DY62_ZYGRC/2362-2478--------------------------------------------------------------------------------
C5FCE3_ARTOC/935-1060--------------------------------------------------------------------------------
C5FWA2_ARTOC/1261-1380--------------------------------------------------------------------------------
C5MCT5_CANTT/3605-3725--------------------------------------------------------------------------------
Q0TVR4_PHANO/1388-1507--------------------------------------------------------------------------------
Q23GA5_TETTS/12-127--------------------------------------------------------------------------------
Q2TZB5_ASPOR/919-1066--------------------------------------------------------------------------------
Q4P966_USTMA/1901-2021--------------------------------------------------------------------------------
Q4Q999_LEIMA/446-556--------------------------------------------------------------------------------
Q4YWB8_PLABA/90-206--------------------------------------------------------------------------------
Q5KMI7_CRYNJ/1724-1843--------------------------------------------------------------------------------
Q5MG88_TOXGO/125-237--------------------------------------------------------------------------------
Q6CF84_YARLI/3022-3141--------------------------------------------------------------------------------
Q6FVK1_CANGA/1920-2038--------------------------------------------------------------------------------
Q9C2A3_NEUCS/971-1096--------------------------------------------------------------------------------
MCP5_SCHPO/840-959--------------------------------------------------------------------------------

PF15405

A7TQH3_VANPO/867-996--------------------------------------------------------------------------------
A8QCG1_MALGO/650-787--------------------------------------------------------------------------------
B0Y407_ASPFC/727-851--------------------------------------------------------------------------------
B2ATW7_PODAN/781-899--------------------------------------------------------------------------------
B6HR54_PENCW/741-867--------------------------------------------------------------------------------
B6K4Z0_SCHJY/799-929--------------------------------------------------------------------------------
B6K7Q5_SCHJY/658-790--------------------------------------------------------------------------------
C5DFA7_LACTC/775-905--------------------------------------------------------------------------------
D5G4S8_TUBMM/733-864--------------------------------------------------------------------------------
D6RNQ8_COPC7/510-650--------------------------------------------------------------------------------
E3KTU1_PUCGT/826-974--------------------------------------------------------------------------------
E4ZWW2_LEPMJ/934-1064--------------------------------------------------------------------------------
E6RBG3_CRYGW/694-836--------------------------------------------------------------------------------
E7R275_PICAD/758-897--------------------------------------------------------------------------------
F0XUN9_GROCL/777-902--------------------------------------------------------------------------------
F2QX04_PICP7/790-895--------------------------------------------------------------------------------
F2Z621_KLULA/763-894--------------------------------------------------------------------------------
F4PBC1_BATDJ/457-572--------------------------------------------------------------------------------
F4RK51_MELLP/486-612--------------------------------------------------------------------------------
F8P447_SERL9/728-864--------------------------------------------------------------------------------
F9X7Y7_MYCGM/750-877--------------------------------------------------------------------------------
G0V5Q3_NAUCC/849-979--------------------------------------------------------------------------------
G1XBW2_ARTOA/827-954--------------------------------------------------------------------------------
G2WW94_VERDV/764-891--------------------------------------------------------------------------------
G2YJS9_BOTF4/50-174--------------------------------------------------------------------------------
G4NKJ4_MAGO7/790-913--------------------------------------------------------------------------------
G7DY91_MIXOS/924-1056--------------------------------------------------------------------------------
G8BPI3_TETPH/796-928--------------------------------------------------------------------------------
G8ZUV3_TORDC/841-971--------------------------------------------------------------------------------
G9N7F4_HYPVG/769-895--------------------------------------------------------------------------------
H0GGJ3_9SACH/518-648--------------------------------------------------------------------------------
H1UV38_COLHI/767-893--------------------------------------------------------------------------------
I1BJ67_RHIO9/768-907--------------------------------------------------------------------------------
I1BQA0_RHIO9/235-373--------------------------------------------------------------------------------
I1C1X6_RHIO9/740-879--------------------------------------------------------------------------------
I1CB67_RHIO9/496-608--------------------------------------------------------------------------------
Q4P7K1_USTMA/348-484--------------------------------------------------------------------------------
Q6CDY6_YARLI/831-954--------------------------------------------------------------------------------
Q752J0_ASHGO/816-948--------------------------------------------------------------------------------
Q7SHY5_NEUCR/784-908--------------------------------------------------------------------------------
RGF2_SCHPO/670-802--------------------------------------------------------------------------------
RGF1_SCHPO/844-972--------------------------------------------------------------------------------

PF08458

Q7XC71_ORYSJ/259-367--------------------------------------------------------------------------------
Q8VY20_ARATH/362-472--------------------------------------------------------------------------------
Q8W4K5_ARATH/378-487--------------------------------------------------------------------------------
Q8S7E8_ORYSJ/138-241--------------------------------------------------------------------------------
O23578_ARATH/260-368--------------------------------------------------------------------------------
Q8S7Q8_ORYSJ/273-375--------------------------------------------------------------------------------
Q9LKC2_ARATH/340-450--------------------------------------------------------------------------------
Q9FGL4_ARATH/282-390--------------------------------------------------------------------------------
Q949B7_ORYSA/260-379--------------------------------------------------------------------------------

PF15404

A6ZY67_YEAS7/1032-1228--------------------------------------------------------------------------------
C5DN47_LACTC/1032-1239--------------------------------------------------------------------------------
G0WGW0_NAUDC/1002-1189--------------------------------------------------------------------------------
G0V9Z1_NAUCC/1010-1197--------------------------------------------------------------------------------
C5DSP7_ZYGRC/1057-1243--------------------------------------------------------------------------------
G8JS70_ERECY/1003-1198--------------------------------------------------------------------------------
G8ZX42_TORDC/989-1169--------------------------------------------------------------------------------
Q74ZU3_ASHGO/998-1187--------------------------------------------------------------------------------
H6CBI5_EXODN/881-1078--------------------------------------------------------------------------------
E5A6C0_LEPMJ/941-1113--------------------------------------------------------------------------------
F9XLM8_MYCGM/682-862--------------------------------------------------------------------------------
F2T6E6_AJEDA/871-1037--------------------------------------------------------------------------------
E7RAB4_PICAD/902-1094--------------------------------------------------------------------------------
A3GEX7_PICST/684-865--------------------------------------------------------------------------------
H2AR29_KAZAF/997-1185--------------------------------------------------------------------------------
D5G6N9_TUBMM/935-1096--------------------------------------------------------------------------------
C0SDS0_PARBP/901-1069--------------------------------------------------------------------------------
A1CLB3_ASPCL/876-1043--------------------------------------------------------------------------------
C5PF94_COCP7/925-1091--------------------------------------------------------------------------------
Q6CKB3_KLULA/919-1083--------------------------------------------------------------------------------
G3AEW4_SPAPN/678-854--------------------------------------------------------------------------------
G1XK76_ARTOA/820-982--------------------------------------------------------------------------------
B6H2T1_PENCW/909-1076--------------------------------------------------------------------------------
A7TM50_VANPO/1058-1235--------------------------------------------------------------------------------
A5DM32_PICGU/798-966--------------------------------------------------------------------------------
E6ZQ69_SPORE/1863-2064--------------------------------------------------------------------------------
G8BMZ3_TETPH/890-1075--------------------------------------------------------------------------------
G4TI65_PIRID/968-1141--------------------------------------------------------------------------------
E6R4C5_CRYGW/559-712--------------------------------------------------------------------------------
A8NQT9_COPC7/886-1037--------------------------------------------------------------------------------
B0CVV2_LACBS/512-664--------------------------------------------------------------------------------
F4REX6_MELLP/921-1086--------------------------------------------------------------------------------

PF00640

APBA3_RAT/216-354--------------------------------------------------------------------------------
APBB2_HUMAN/590-712--------------------------------------------------------------------------------
APBB2_HUMAN/419-555--------------------------------------------------------------------------------
SHC1_HUMAN/162-318--------------------------------------------------------------------------------
SHC2_HUMAN/153-308--------------------------------------------------------------------------------
ANS1A_HUMAN/942-1068--------------------------------------------------------------------------------
APBA1_HUMAN/461-618--------------------------------------------------------------------------------
JIP1_RAT/564-698--------------------------------------------------------------------------------
APBB1_RAT/544-665--------------------------------------------------------------------------------
JIP2_HUMAN/683-814--------------------------------------------------------------------------------
Q24080_DROME/34-184--------------------------------------------------------------------------------
DAB1_MOUSE/42-168--------------------------------------------------------------------------------
LIN10_CAEEL/607-762--------------------------------------------------------------------------------
APBB3_RAT/289-415--------------------------------------------------------------------------------
NUMB_DROME/83-205--------------------------------------------------------------------------------
CAPON_RAT/32-170--------------------------------------------------------------------------------
APBB3_RAT/117-255--------------------------------------------------------------------------------
APBA3_HUMAN/221-359--------------------------------------------------------------------------------
APBA2_MOUSE/373-531--------------------------------------------------------------------------------
CED6_CAEEL/61-194--------------------------------------------------------------------------------
SHC3_HUMAN/155-311--------------------------------------------------------------------------------
DAB2_MOUSE/50-176--------------------------------------------------------------------------------
NUMB_MOUSE/39-172--------------------------------------------------------------------------------
APBB1_RAT/371-510--------------------------------------------------------------------------------
DAB_DROME/51-175--------------------------------------------------------------------------------

PF08416

EPS8_MOUSE/64-194--------------------------------------------------------------------------------
ES8L1_HUMAN/35-165--------------------------------------------------------------------------------
TENS3_HUMAN/1310-1444--------------------------------------------------------------------------------
Q5XH20_XENLA/51-177--------------------------------------------------------------------------------
Q7ZUV6_DANRE/51-181--------------------------------------------------------------------------------
A7E2A6_HUMAN/1275-1408--------------------------------------------------------------------------------
Q4RXQ8_TETNG/64-188--------------------------------------------------------------------------------
Q9VHC3_DROME/580-716--------------------------------------------------------------------------------
Q6NU33_XENLA/61-191--------------------------------------------------------------------------------
Q6PJM3_HUMAN/301-437--------------------------------------------------------------------------------
P92160_CAEEL/272-416--------------------------------------------------------------------------------
Q3T129_BOVIN/28-149--------------------------------------------------------------------------------
Q3T0F6_BOVIN/51-181--------------------------------------------------------------------------------
Q7T3A3_DANRE/50-171--------------------------------------------------------------------------------

PF14719

F1SFG1_PIG/69-256--------------------------------------------------------------------------------
C3ZEC0_BRAFL/18-200--------------------------------------------------------------------------------
A2AM80_MOUSE/71-265--------------------------------------------------------------------------------
Q20652_CAEEL/34-211--------------------------------------------------------------------------------
F1L1C4_ASCSU/64-246--------------------------------------------------------------------------------
B4LZF0_DROVI/288-472--------------------------------------------------------------------------------
E1FRI2_LOALO/49-231--------------------------------------------------------------------------------
E5SI18_TRISP/18-200--------------------------------------------------------------------------------
E9GIB1_DAPPU/14-199--------------------------------------------------------------------------------
E0VC17_PEDHC/15-198--------------------------------------------------------------------------------

PF10480

ITBP1_HUMAN/1-200-------------------------------MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKS
Q5RG21_DANRE/1-198-------------------------------MFRKVKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKS

PF09380

Q7QB86_ANOGA/230-322--------------------------------------------------------------------------------
FARP2_MOUSE/238-328--------------------------------------------------------------------------------
FRPD2_HUMAN/557-646--------------------------------------------------------------------------------
E41L5_MOUSE/239-331--------------------------------------------------------------------------------
O17905_CAEEL/223-313--------------------------------------------------------------------------------
FRM4A_HUMAN/225-326--------------------------------------------------------------------------------
PTN3_HUMAN/226-316--------------------------------------------------------------------------------
Q29ET4_DROPS/237-305--------------------------------------------------------------------------------
A4QNY2_DANRE/770-859--------------------------------------------------------------------------------
Q5SZU5_HUMAN/141-234--------------------------------------------------------------------------------
Q4SR04_TETNG/263-364--------------------------------------------------------------------------------
MERH_DROME/220-309--------------------------------------------------------------------------------
A2ASR3_MOUSE/132-220--------------------------------------------------------------------------------
Q4T916_TETNG/118-207--------------------------------------------------------------------------------
Q16F39_AEDAE/217-307--------------------------------------------------------------------------------
Q9VKY7_DROME/209-301--------------------------------------------------------------------------------
Q17GE0_AEDAE/263-353--------------------------------------------------------------------------------
A2AUK8_MOUSE/292-382--------------------------------------------------------------------------------
Q4S8Q6_TETNG/206-302--------------------------------------------------------------------------------
A7SRN5_NEMVE/219-309--------------------------------------------------------------------------------
Q8I093_CAEEL/223-359--------------------------------------------------------------------------------
Q7PMF4_ANOGA/228-311--------------------------------------------------------------------------------
Q8K2R0_MOUSE/21-111--------------------------------------------------------------------------------
Q2M1E6_DROME/268-358--------------------------------------------------------------------------------
Q8JG61_DANRE/197-287--------------------------------------------------------------------------------
Q1MTL1_DANRE/226-316--------------------------------------------------------------------------------
Q4S0A7_TETNG/201-298--------------------------------------------------------------------------------
Q6GPK7_XENLA/226-316--------------------------------------------------------------------------------
Q9NDP4_CIOIN/233-326--------------------------------------------------------------------------------
Q5DAD7_SCHJA/210-299--------------------------------------------------------------------------------
Q4SDP7_TETNG/210-299--------------------------------------------------------------------------------
A7RWH0_NEMVE/210-299--------------------------------------------------------------------------------
Q4RQ84_TETNG/174-267--------------------------------------------------------------------------------
Q94815_TAESA/212-301--------------------------------------------------------------------------------
Q7PRJ8_ANOGA/219-309--------------------------------------------------------------------------------
A8X9K5_CAEBR/230-319--------------------------------------------------------------------------------
Q28006_BOVIN/787-876--------------------------------------------------------------------------------
Q4RI64_TETNG/212-305--------------------------------------------------------------------------------
Q05CU6_HUMAN/210-299--------------------------------------------------------------------------------
Q3UH12_MOUSE/129-218--------------------------------------------------------------------------------
A7SJJ3_NEMVE/179-269--------------------------------------------------------------------------------
A7T1E3_NEMVE/204-296--------------------------------------------------------------------------------
PTP1_CAEEL/230-319--------------------------------------------------------------------------------
A7SBA4_NEMVE/205-308--------------------------------------------------------------------------------
Q5LK46_CAEEL/220-307--------------------------------------------------------------------------------
Q4RMH6_TETNG/655-741--------------------------------------------------------------------------------
Q4REG2_TETNG/277-370--------------------------------------------------------------------------------
PTN4_MOUSE/226-316--------------------------------------------------------------------------------
A7S031_NEMVE/180-270--------------------------------------------------------------------------------
Q4RRW4_TETNG/220-358--------------------------------------------------------------------------------
Q4SAZ3_TETNG/102-217--------------------------------------------------------------------------------
Q16TI3_AEDAE/200-283--------------------------------------------------------------------------------
Q4RI64_TETNG/1158-1250--------------------------------------------------------------------------------
Q16YM3_AEDAE/262-348--------------------------------------------------------------------------------
FRMD3_HUMAN/229-316--------------------------------------------------------------------------------
A4F2N5_9ASCI/216-329--------------------------------------------------------------------------------
A7RUW8_NEMVE/238-328--------------------------------------------------------------------------------
Q9U566_DROSL/232-320--------------------------------------------------------------------------------
FRMD7_HUMAN/196-286--------------------------------------------------------------------------------
MERL_HUMAN/226-315--------------------------------------------------------------------------------
A8Y3W1_CAEBR/270-367--------------------------------------------------------------------------------
Q6NXW5_MOUSE/226-312--------------------------------------------------------------------------------

PF10756

Q1BAS0_MYCSS/59-130--------------------------------------------------------------------------------
A1UE92_MYCSK/59-130--------------------------------------------------------------------------------
A3PXP6_MYCSJ/59-130--------------------------------------------------------------------------------
A1T6Y6_MYCVP/40-111--------------------------------------------------------------------------------
A4TE10_MYCGI/115-186--------------------------------------------------------------------------------
A0QUX5_MYCS2/56-127--------------------------------------------------------------------------------
A1KMZ9_MYCBP/39-110--------------------------------------------------------------------------------
CFP6_MYCBO/39-110--------------------------------------------------------------------------------
A2VLX4_MYCTU/25-96--------------------------------------------------------------------------------
A5WRQ7_MYCTF/52-123--------------------------------------------------------------------------------
A5U716_MYCTA/39-110--------------------------------------------------------------------------------
CFP6_MYCTU/39-110--------------------------------------------------------------------------------
A4KKR2_MYCTU/52-123--------------------------------------------------------------------------------
A0QJC8_MYCA1/42-113--------------------------------------------------------------------------------
A0PPX9_MYCUA/46-117--------------------------------------------------------------------------------
Q0S2H6_RHOSR/133-204--------------------------------------------------------------------------------
A4FMQ8_SACEN/47-118--------------------------------------------------------------------------------
Q5YRV9_NOCFA/80-151--------------------------------------------------------------------------------
A8M5F2_SALAI/52-123--------------------------------------------------------------------------------
A4X496_SALTO/52-123--------------------------------------------------------------------------------
Q8NQZ8_CORGL/37-108--------------------------------------------------------------------------------
Q6M5S3_CORGL/51-122--------------------------------------------------------------------------------
A4QDN0_CORGB/60-131--------------------------------------------------------------------------------
Q8FPX5_COREF/69-140--------------------------------------------------------------------------------
Q6NHN5_CORDI/53-124--------------------------------------------------------------------------------
Q4JUN4_CORJK/53-125--------------------------------------------------------------------------------
Q2IEC1_ANADE/109-180--------------------------------------------------------------------------------
A0QWV2_MYCS2/76-146--------------------------------------------------------------------------------
A5U2B9_MYCTA/72-142--------------------------------------------------------------------------------
Y1452_MYCBO/72-142--------------------------------------------------------------------------------
A1KIK6_MYCBP/72-142--------------------------------------------------------------------------------
A4KGX3_MYCTU/72-142--------------------------------------------------------------------------------
Y1417_MYCTU/72-142--------------------------------------------------------------------------------
A5WMA0_MYCTF/72-142--------------------------------------------------------------------------------
Q741E9_MYCPA/73-143--------------------------------------------------------------------------------
A0QI07_MYCA1/73-143--------------------------------------------------------------------------------
A0PPL8_MYCUA/74-144--------------------------------------------------------------------------------
Q9CCP2_MYCLE/74-144--------------------------------------------------------------------------------
A4TC11_MYCGI/69-139--------------------------------------------------------------------------------
A1T8K3_MYCVP/70-140--------------------------------------------------------------------------------
A1UFM9_MYCSK/68-138--------------------------------------------------------------------------------
Q1B9D4_MYCSS/68-138--------------------------------------------------------------------------------
A3PZ90_MYCSJ/68-138--------------------------------------------------------------------------------
Q0S0K0_RHOSR/72-142--------------------------------------------------------------------------------
Q5YTP5_NOCFA/86-156--------------------------------------------------------------------------------
A4FBK6_SACEN/71-141--------------------------------------------------------------------------------
A4QEG7_CORGB/114-184--------------------------------------------------------------------------------
Q8NQ54_CORGL/114-184--------------------------------------------------------------------------------
Q8FT59_COREF/117-187--------------------------------------------------------------------------------
Q6NH30_CORDI/107-177--------------------------------------------------------------------------------
O24754_CORAM/105-175--------------------------------------------------------------------------------
Q4JVI7_CORJK/71-141--------------------------------------------------------------------------------
A4X643_SALTO/103-173--------------------------------------------------------------------------------
A8LY42_SALAI/72-142--------------------------------------------------------------------------------
Q47QZ7_THEFY/72-143--------------------------------------------------------------------------------
Q827L6_STRAW/68-139--------------------------------------------------------------------------------
A3KKZ4_STRAM/69-140--------------------------------------------------------------------------------
Q9RKZ5_STRCO/70-141--------------------------------------------------------------------------------
A1SJH2_NOCSJ/82-152--------------------------------------------------------------------------------
A3TLM6_9MICO/70-140--------------------------------------------------------------------------------
A6WC99_KINRD/77-147--------------------------------------------------------------------------------
A3PSE7_MYCSJ/58-136--------------------------------------------------------------------------------
A1U8T0_MYCSK/58-136--------------------------------------------------------------------------------
Q1BG51_MYCSS/58-136--------------------------------------------------------------------------------
A0PKC3_MYCUA/58-136--------------------------------------------------------------------------------
A5TY78_MYCTA/58-136--------------------------------------------------------------------------------
A5WI64_MYCTF/58-136--------------------------------------------------------------------------------
Y010_MYCTU/58-136--------------------------------------------------------------------------------
A2VMV2_MYCTU/58-136--------------------------------------------------------------------------------
A4KN42_MYCTU/37-115--------------------------------------------------------------------------------
Q9CDE8_MYCLE/58-136--------------------------------------------------------------------------------
Q744S0_MYCPA/58-136--------------------------------------------------------------------------------
A0Q8S7_MYCA1/10-88--------------------------------------------------------------------------------
A1T119_MYCVP/58-136--------------------------------------------------------------------------------
A4T4V1_MYCGI/58-136--------------------------------------------------------------------------------
Q5Z3S4_NOCFA/64-148--------------------------------------------------------------------------------
Q0SAE3_RHOSR/62-146--------------------------------------------------------------------------------
A4F5R5_SACEN/60-137--------------------------------------------------------------------------------
A8LWD3_SALAI/68-146--------------------------------------------------------------------------------
A4XDA1_SALTO/68-146--------------------------------------------------------------------------------
A8LCF4_FRASN/69-148--------------------------------------------------------------------------------
Q0RB02_FRAAA/82-161--------------------------------------------------------------------------------
Q7VS84_BORPE/85-153--------------------------------------------------------------------------------
Q7W1V7_BORPA/85-153--------------------------------------------------------------------------------
Q7WQT3_BORBR/85-153--------------------------------------------------------------------------------
Q9X8Z2_STRCO/64-149--------------------------------------------------------------------------------
Q93NX3_9ACTO/64-147--------------------------------------------------------------------------------
Q8TW66_METKA/65-149--------------------------------------------------------------------------------
A3ZYD7_9PLAN/70-141--------------------------------------------------------------------------------
Q6ADX4_LEIXX/63-147--------------------------------------------------------------------------------
A4ALH2_9ACTN/59-141--------------------------------------------------------------------------------
A5CT27_CLAM3/59-141--------------------------------------------------------------------------------
A0JYT3_ARTS2/61-144--------------------------------------------------------------------------------
Q47LS7_THEFY/56-142--------------------------------------------------------------------------------
Q82I13_STRAW/80-156--------------------------------------------------------------------------------

PF11605

VPS36_DROME/2-94--------------------------------------------------------------------------------
Q4QDE7_LEIMA/5-95--------------------------------------------------------------------------------
Q5TPR5_ANOGA/2-94--------------------------------------------------------------------------------
Q5AHK1_CANAL/13-100--------------------------------------------------------------------------------
Q19519_CAEEL/2-89--------------------------------------------------------------------------------
Q6CAN8_YARLI/6-95--------------------------------------------------------------------------------
A5DUJ7_LODEL/11-99--------------------------------------------------------------------------------
Q6CWP4_KLULA/12-100--------------------------------------------------------------------------------
Q5AXE3_EMENI/547-615--------------------------------------------------------------------------------
A3LUC0_PICST/11-98--------------------------------------------------------------------------------
A5DGQ5_PICGU/60-147--------------------------------------------------------------------------------
Q4PA51_USTMA/9-97--------------------------------------------------------------------------------
Q6BSQ4_DEBHA/12-99--------------------------------------------------------------------------------
A7A1T8_YEAS7/8-96--------------------------------------------------------------------------------
VPS36_DICDI/8-94--------------------------------------------------------------------------------
Q6FPE3_CANGA/8-96--------------------------------------------------------------------------------
VPS36_SCHPO/6-94--------------------------------------------------------------------------------
VPS36_ARATH/18-111--------------------------------------------------------------------------------
Q757C1_ASHGO/15-103--------------------------------------------------------------------------------
A7TGC6_VANPO/8-96--------------------------------------------------------------------------------
Q4DRE4_TRYCC/5-94--------------------------------------------------------------------------------
A4HA31_LEIBR/5-95--------------------------------------------------------------------------------

PF02893

MTMR2_MOUSE/71-139--------------------------------------------------------------------------------
TBCD8_MOUSE/285-353--------------------------------------------------------------------------------
UGT52_DICDI/881-948--------------------------------------------------------------------------------
FAN_HUMAN/176-247--------------------------------------------------------------------------------
GRAM4_HUMAN/445-523--------------------------------------------------------------------------------
GRM1B_HUMAN/96-163--------------------------------------------------------------------------------
B9A6K8_HUMAN/288-356--------------------------------------------------------------------------------
MTMR5_HUMAN/882-968--------------------------------------------------------------------------------
B9A6K8_HUMAN/142-209--------------------------------------------------------------------------------
Q9VP46_DROME/136-203--------------------------------------------------------------------------------
Q9VP46_DROME/282-350--------------------------------------------------------------------------------
GYP2_SCHPO/20-85--------------------------------------------------------------------------------
Q9TXP3_CAEEL/783-872--------------------------------------------------------------------------------
YL072_YEAST/164-231--------------------------------------------------------------------------------
GYP2_YEAST/29-116--------------------------------------------------------------------------------
YFE2_YEAST/198-265--------------------------------------------------------------------------------
ATG26_YEAST/570-636--------------------------------------------------------------------------------
MTM1_HUMAN/29-97--------------------------------------------------------------------------------
ATG26_PICPG/586-652--------------------------------------------------------------------------------
YGZ7_SCHPO/197-264--------------------------------------------------------------------------------
Q18966_CAEEL/9-83--------------------------------------------------------------------------------
Q9VGH9_DROME/922-1002--------------------------------------------------------------------------------
YHO0_YEAST/548-617--------------------------------------------------------------------------------
YSP2_YEAST/647-716--------------------------------------------------------------------------------
GEML1_ARATH/138-215--------------------------------------------------------------------------------
WBP2_MOUSE/1-84--------------------------------------------------------------------------------
ATG26_CANAL/816-880--------------------------------------------------------------------------------
Q9ZTW0_HORVU/229-307--------------------------------------------------------------------------------
Q9VMI9_DROME/40-113--------------------------------------------------------------------------------
Q9VU19_DROME/11-82--------------------------------------------------------------------------------
C2GR1_ARATH/688-754--------------------------------------------------------------------------------
MTMR1_HUMAN/104-161--------------------------------------------------------------------------------
Q18075_CAEEL/23-84--------------------------------------------------------------------------------

PF14844

LVSD_DICDI/2064-2162--------------------------------------------------------------------------------
Q0KHV9_DROME/2916-3020--------------------------------------------------------------------------------
C1E8K2_MICSR/38-147--------------------------------------------------------------------------------
F1QJA6_DANRE/2074-2178--------------------------------------------------------------------------------
A9SKJ8_PHYPA/1974-2088--------------------------------------------------------------------------------
E7EZD1_DANRE/2173-2277--------------------------------------------------------------------------------
LYST_MOUSE/3000-3102--------------------------------------------------------------------------------
E2RM94_CANFA/597-690--------------------------------------------------------------------------------
A5B5Q4_VITVI/1437-1541--------------------------------------------------------------------------------
B4HU25_DROSE/77-170--------------------------------------------------------------------------------
Q4RI15_TETNG/1957-2053--------------------------------------------------------------------------------
D0NB84_PHYIT/1693-1817--------------------------------------------------------------------------------
B8AGC7_ORYSI/1908-2017--------------------------------------------------------------------------------
D3B4G5_POLPA/1060-1165--------------------------------------------------------------------------------
E9BTN9_LEIDB/3473-3580--------------------------------------------------------------------------------
A9V098_MONBE/74-174--------------------------------------------------------------------------------
LVSC_DICDI/1705-1818--------------------------------------------------------------------------------
E9CEC6_CAPO3/3668-3773--------------------------------------------------------------------------------
D3BQI1_POLPA/231-322--------------------------------------------------------------------------------
F0ZLG9_DICPU/1569-1668--------------------------------------------------------------------------------
D8S3X7_SELML/1882-1980--------------------------------------------------------------------------------
Q5TUA8_ANOGA/79-172--------------------------------------------------------------------------------
Q01AN8_OSTTA/2194-2290--------------------------------------------------------------------------------
C3YYV6_BRAFL/1806-1900--------------------------------------------------------------------------------
E9CED0_CAPO3/1920-2025--------------------------------------------------------------------------------
LVSF_DICDI/293-384--------------------------------------------------------------------------------
C3Y0L9_BRAFL/2973-3076--------------------------------------------------------------------------------
D7LRV7_ARALL/2028-2133--------------------------------------------------------------------------------
D8M509_BLAHO/332-453--------------------------------------------------------------------------------
D2UYK5_NAEGR/2485-2591--------------------------------------------------------------------------------
E4X0F7_OIKDI/1583-1687--------------------------------------------------------------------------------
F0ZTM1_DICPU/1937-2035--------------------------------------------------------------------------------
E9GKY9_DAPPU/2065-2169--------------------------------------------------------------------------------
E9C1E6_CAPO3/193-284--------------------------------------------------------------------------------
A9V898_MONBE/2770-2881--------------------------------------------------------------------------------
F2UGS7_SALS5/2284-2404--------------------------------------------------------------------------------
A2DFN3_TRIVA/1803-1904--------------------------------------------------------------------------------
B3RRZ7_TRIAD/111-205--------------------------------------------------------------------------------
E1FZ76_LOALO/328-427--------------------------------------------------------------------------------
B3RWH0_TRIAD/273-377--------------------------------------------------------------------------------
D3BT75_POLPA/2598-2696--------------------------------------------------------------------------------
F1KPT4_ASCSU/1732-1836--------------------------------------------------------------------------------
F0WHU1_9STRA/1484-1601--------------------------------------------------------------------------------
F1KPL1_ASCSU/2436-2535--------------------------------------------------------------------------------
NBEA_CAEEL/1694-1798--------------------------------------------------------------------------------
A7SQQ4_NEMVE/217-312--------------------------------------------------------------------------------
Q22HC6_TETTS/2401-2508--------------------------------------------------------------------------------

PF03517

ICLN_ARATH/49-167--------------------------------------------------------------------------------
B9Q2B0_TOXGO/47-162--------------------------------------------------------------------------------
A1DEP8_NEOFI/99-240--------------------------------------------------------------------------------
A1ZAW5_DROME/33-179--------------------------------------------------------------------------------
A2QMX0_ASPNC/82-226--------------------------------------------------------------------------------
LOT5_PICST/75-215--------------------------------------------------------------------------------
A4S3U5_OSTLU/82-224--------------------------------------------------------------------------------
A5CAA6_VITVI/49-167--------------------------------------------------------------------------------
LOT5_PICGU/78-210--------------------------------------------------------------------------------
LOT5_LODEL/63-191--------------------------------------------------------------------------------
A6QTC2_AJECN/141-306--------------------------------------------------------------------------------
A6RQ79_BOTFB/74-191--------------------------------------------------------------------------------
LOT5_YEAS7/82-244--------------------------------------------------------------------------------
A7RR20_NEMVE/33-147--------------------------------------------------------------------------------
LOT5_VANPO/82-248--------------------------------------------------------------------------------
A8NTF5_COPC7/63-194--------------------------------------------------------------------------------
A8Y0J2_CAEBR/34-180--------------------------------------------------------------------------------
A9NQA9_PICSI/43-164--------------------------------------------------------------------------------
A9S1N0_PHYPA/47-165--------------------------------------------------------------------------------
A9ULH1_XENTR/33-162--------------------------------------------------------------------------------
A9VD70_MONBE/35-180--------------------------------------------------------------------------------
B0DAB3_LACBS/60-176--------------------------------------------------------------------------------
B0FLX5_FUSOX/110-226--------------------------------------------------------------------------------
B0WD72_CULQU/34-182--------------------------------------------------------------------------------
B2B612_PODAN/138-262--------------------------------------------------------------------------------
B2WLS9_PYRTR/75-197--------------------------------------------------------------------------------
B3MIF9_DROAN/33-169--------------------------------------------------------------------------------
B3S5M1_TRIAD/33-150--------------------------------------------------------------------------------
B4FU22_MAIZE/47-164--------------------------------------------------------------------------------
B4J796_DROGR/33-197--------------------------------------------------------------------------------
B4MIS2_DROWI/33-184--------------------------------------------------------------------------------
B5X8R1_SALSA/33-161--------------------------------------------------------------------------------
B5X9U7_SALSA/56-181--------------------------------------------------------------------------------
B6HHS4_PENCW/87-223--------------------------------------------------------------------------------
B6K3T8_SCHJY/53-175--------------------------------------------------------------------------------
B6QED0_PENMQ/87-259--------------------------------------------------------------------------------
B7FMN0_MEDTR/42-162--------------------------------------------------------------------------------
B7P9B2_IXOSC/33-159--------------------------------------------------------------------------------
B8AK26_ORYSI/47-166--------------------------------------------------------------------------------
B8BFW3_ORYSI/47-166--------------------------------------------------------------------------------
B8BUW5_THAPS/168-320--------------------------------------------------------------------------------
B8NUB0_ASPFN/89-218--------------------------------------------------------------------------------
B8NZE3_POSPM/63-180--------------------------------------------------------------------------------
B9I4K9_POPTR/49-167--------------------------------------------------------------------------------
B9R9P4_RICCO/49-168--------------------------------------------------------------------------------
B9W785_CANDC/63-184--------------------------------------------------------------------------------
C0S818_PARBP/100-260--------------------------------------------------------------------------------
C1BLM5_OSMMO/33-163--------------------------------------------------------------------------------
C1BT70_9MAXI/33-168--------------------------------------------------------------------------------
C1EAA0_MICSR/47-200--------------------------------------------------------------------------------
C4JLR6_UNCRE/89-230--------------------------------------------------------------------------------
C4R4H9_PICPG/69-202--------------------------------------------------------------------------------
C4WYC8_ACYPI/33-183--------------------------------------------------------------------------------
C4XYE0_CLAL4/70-200--------------------------------------------------------------------------------
C5DFH3_LACTC/77-239--------------------------------------------------------------------------------
C5DS18_ZYGRC/74-243--------------------------------------------------------------------------------
C5FIH0_ARTOC/100-255--------------------------------------------------------------------------------
C5JF20_AJEDS/150-324--------------------------------------------------------------------------------
C5M0L7_PERM5/411-532--------------------------------------------------------------------------------
C5ME47_CANTT/63-184--------------------------------------------------------------------------------
C5P4Z2_COCP7/90-232--------------------------------------------------------------------------------
C5WQX7_SORBI/47-165--------------------------------------------------------------------------------
C7YUN3_NECH7/83-199--------------------------------------------------------------------------------
C8V9L5_EMENI/93-223--------------------------------------------------------------------------------
C9SS04_VERA1/113-222--------------------------------------------------------------------------------
D0MW27_PHYIT/62-159--------------------------------------------------------------------------------
D2H3S9_AILME/35-156--------------------------------------------------------------------------------
D2U835_9ROSI/49-168--------------------------------------------------------------------------------
D2VE54_NAEGR/89-219--------------------------------------------------------------------------------
D3AWK5_POLPA/41-182--------------------------------------------------------------------------------
D3TMJ1_GLOMM/33-174--------------------------------------------------------------------------------
D4DKR6_TRIVH/99-216--------------------------------------------------------------------------------
D5GPC9_TUBMM/75-207--------------------------------------------------------------------------------
D6WHX2_TRICA/33-160--------------------------------------------------------------------------------
D7G4C9_ECTSI/52-165--------------------------------------------------------------------------------
D8Q594_SCHCM/62-183--------------------------------------------------------------------------------
D8R326_SELML/48-170--------------------------------------------------------------------------------
D8TWT3_VOLCA/56-171--------------------------------------------------------------------------------
E0VCN6_PEDHC/33-152--------------------------------------------------------------------------------
E1GH06_LOALO/36-197--------------------------------------------------------------------------------
E1ZS71_CHLVA/50-172--------------------------------------------------------------------------------
E2AYH0_CAMFO/33-160--------------------------------------------------------------------------------
E3MRC6_CAERE/33-179--------------------------------------------------------------------------------
E3QTP6_COLGM/107-222--------------------------------------------------------------------------------
E3TFM3_ICTPU/33-149--------------------------------------------------------------------------------
E4X6Q6_OIKDI/31-151--------------------------------------------------------------------------------
E5AE79_LEPMJ/75-200--------------------------------------------------------------------------------
E5SJS0_TRISP/31-178--------------------------------------------------------------------------------
E6R1Y0_CRYGW/62-207--------------------------------------------------------------------------------
E6ZKI1_SPORE/90-225--------------------------------------------------------------------------------
E9CD59_CAPO3/34-165--------------------------------------------------------------------------------
E9E872_METAQ/84-201--------------------------------------------------------------------------------
E9H646_DAPPU/33-155--------------------------------------------------------------------------------
F0WL16_9STRA/59-162--------------------------------------------------------------------------------
F0XG98_GROCL/95-242--------------------------------------------------------------------------------
F0ZDK9_DICPU/33-167--------------------------------------------------------------------------------
F1L444_ASCSU/85-210--------------------------------------------------------------------------------
F1QDS7_DANRE/33-166--------------------------------------------------------------------------------
F2DSJ7_HORVD/47-166--------------------------------------------------------------------------------
F2UJQ4_SALS5/35-160--------------------------------------------------------------------------------
LOT5_DEBHA/75-213--------------------------------------------------------------------------------
YIU1_SCHPO/53-192--------------------------------------------------------------------------------
Q00ZV5_OSTTA/292-403--------------------------------------------------------------------------------
Q0CIH1_ASPTN/83-217--------------------------------------------------------------------------------
Q0UAR5_PHANO/75-198--------------------------------------------------------------------------------
Q2TU72_FASHE/33-209--------------------------------------------------------------------------------
Q4PHI8_USTMA/90-237--------------------------------------------------------------------------------
Q4UE37_THEAN/53-155--------------------------------------------------------------------------------
Q54Q91_DICDI/34-173--------------------------------------------------------------------------------
Q5TW40_ANOGA/34-170--------------------------------------------------------------------------------
Q6C5D1_YARLI/86-206--------------------------------------------------------------------------------
LOT5_KLULA/83-248--------------------------------------------------------------------------------
Q6FWF9_CANGA/65-256--------------------------------------------------------------------------------
LOT5_ASHGO/69-217--------------------------------------------------------------------------------
Q7RFA5_PLAYO/43-232--------------------------------------------------------------------------------

PF10882

E8ZQG4_CLOB0/63-164--------------------------------------------------------------------------------
D2RH36_ARCPA/66-169--------------------------------------------------------------------------------
Q892T1_CLOTE/66-167--------------------------------------------------------------------------------
B1BIL0_CLOPF/63-164--------------------------------------------------------------------------------
B9LAJ8_CHLSY/77-176--------------------------------------------------------------------------------
A5N6R3_CLOK5/63-164--------------------------------------------------------------------------------
A9B463_HERA2/77-175--------------------------------------------------------------------------------
C9PZP2_9BACT/69-168--------------------------------------------------------------------------------
D9SW68_CLOC7/63-164--------------------------------------------------------------------------------
D8GPI2_CLOLD/64-165--------------------------------------------------------------------------------
D7JGR0_9BACT/59-159--------------------------------------------------------------------------------
Q67L16_SYMTH/48-147--------------------------------------------------------------------------------
D5XC81_THEPJ/68-168--------------------------------------------------------------------------------
C5CH43_KOSOT/70-173--------------------------------------------------------------------------------
A5ZGT7_9BACE/66-165--------------------------------------------------------------------------------
C5VRR7_CLOBO/63-164--------------------------------------------------------------------------------
C6PTX6_9CLOT/63-164--------------------------------------------------------------------------------
D7JGQ9_9BACT/71-172--------------------------------------------------------------------------------
B8G387_CHLAD/77-176--------------------------------------------------------------------------------
F2KQG8_ARCVS/58-157--------------------------------------------------------------------------------
B1I1Z1_DESAP/63-162--------------------------------------------------------------------------------
F0KD96_CLOAE/63-164--------------------------------------------------------------------------------
A3HRM5_9BACT/66-167--------------------------------------------------------------------------------
B1BDC7_CLOBO/63-164--------------------------------------------------------------------------------
E8N364_ANATU/72-171--------------------------------------------------------------------------------
A2BJK7_HYPBU/63-163--------------------------------------------------------------------------------
E1II11_9CHLR/77-175--------------------------------------------------------------------------------

PF06713

YYAB_BACSU/60-136--------------------------------------------------------------------------------
A7GTV4_BACCN/61-123--------------------------------------------------------------------------------
A6T2Q0_JANMA/61-134--------------------------------------------------------------------------------
Q5WGJ5_BACSK/65-143--------------------------------------------------------------------------------
Q5WLL6_BACSK/65-138--------------------------------------------------------------------------------
Q6HLV3_BACHK/52-125--------------------------------------------------------------------------------
Q5WBM1_BACSK/61-138--------------------------------------------------------------------------------
Q8A2X0_BACTN/53-129--------------------------------------------------------------------------------
Q9K9B1_BACHD/42-116--------------------------------------------------------------------------------
Q650Q2_BACFR/53-129--------------------------------------------------------------------------------
A6KZD8_BACV8/54-130--------------------------------------------------------------------------------
A5WI48_PSYWF/64-136--------------------------------------------------------------------------------
Q8ELH5_OCEIH/56-129--------------------------------------------------------------------------------
A4BZG7_9FLAO/58-133--------------------------------------------------------------------------------
Q9KEX6_BACHD/65-138--------------------------------------------------------------------------------
Q67SW8_SYMTH/62-135--------------------------------------------------------------------------------
Q633A6_BACCZ/61-123--------------------------------------------------------------------------------
A7UYW5_BACUN/53-129--------------------------------------------------------------------------------
Q813R4_BACCR/53-128--------------------------------------------------------------------------------
Q5WM07_BACSK/64-139--------------------------------------------------------------------------------
Q8ETD0_OCEIH/64-141--------------------------------------------------------------------------------
A9VJV3_BACWK/52-125--------------------------------------------------------------------------------
Q2BCY1_9BACI/62-139--------------------------------------------------------------------------------
A7AH02_9PORP/54-129--------------------------------------------------------------------------------
A4ASP1_MARSH/60-135--------------------------------------------------------------------------------
A7LYH2_BACOV/53-129--------------------------------------------------------------------------------
A6KZD7_BACV8/56-123--------------------------------------------------------------------------------
A4CQ29_ROBBH/54-128--------------------------------------------------------------------------------
Q4V1T4_BACCZ/53-127--------------------------------------------------------------------------------
A6EQ87_9BACT/59-133--------------------------------------------------------------------------------
A4ANC2_MARSH/53-127--------------------------------------------------------------------------------
A3J6N6_9FLAO/59-136--------------------------------------------------------------------------------
A7GNM9_BACCN/53-127--------------------------------------------------------------------------------
Q64WH9_BACFR/55-123--------------------------------------------------------------------------------
Q5WDR5_BACSK/61-138--------------------------------------------------------------------------------
Q8EQJ6_OCEIH/52-125--------------------------------------------------------------------------------
A6CHZ7_9BACI/57-130--------------------------------------------------------------------------------
Q99IS9_9BACT/61-134--------------------------------------------------------------------------------
A6TN63_ALKMQ/64-137--------------------------------------------------------------------------------
A5ZET0_9BACE/53-129--------------------------------------------------------------------------------
A6LGE4_PARD8/53-128--------------------------------------------------------------------------------
Q7USX7_RHOBA/65-137--------------------------------------------------------------------------------
Q81GH2_BACCR/2-75--------------------------------------------------------------------------------
A6CKW3_9BACI/69-152--------------------------------------------------------------------------------
Q8CV26_OCEIH/61-135--------------------------------------------------------------------------------
A3XNY3_LEEBM/58-133--------------------------------------------------------------------------------

PF14470

A1KX55_9CAUD/97-188...................NNTY--LIV----------------------------------------------------
B1BWF3_CLOPF/113-210...............STKHDGNF--AYA----------------------------------------------------
B6QZJ6_9RHOB/59-150...................GNTW--LIT----------------------------------------------------
D0G8V7_CLOBO/33-124...................GNTW--LVT----------------------------------------------------
Q73PJ3_TREDE/33-124...................GTTW--LIV----------------------------------------------------
Q8XP28_CLOPE/122-213...................GNTW--LIV----------------------------------------------------
D4GR98_HALVD/78-183RDGD.......AVGAGHQQDFMS--TFF----------------------------------------------------
D4GR98_HALVD/240-354GSGAGSSWWGNDRSRKQGTRGYV--RAA----------------------------------------------------
C7N8P3_LEPBD/33-124...................SHTW--LIV----------------------------------------------------
Q1CPJ8_STRPF/52-143...................GNTV--LVV----------------------------------------------------
B4TIA1_SALHS/41-132...................GNTW--LIT----------------------------------------------------
E6L634_9PROT/33-123...................NGIG--LLV----------------------------------------------------
A7GAX1_CLOBL/113-210...............SNEDGGYF--AYA----------------------------------------------------
Q9B015_9CAUD/43-134...................GDTV--LIV----------------------------------------------------
C9MW71_9FUSO/32-123...................GHTW--LIV----------------------------------------------------
D0ABI1_ENTFC/115-211...............STKHDNNY--AYA----------------------------------------------------
C2EMA4_9LACO/66-157..................KNATV--LLA----------------------------------------------------
C2NBD8_BACCE/105-201...............TTKHDGYY--AYA----------------------------------------------------
A0RJ01_BACAH/12-110...............YRSVARPG--LFI----------------------------------------------------
D1Y7N3_9BACT/74-169..................RKNTV--LVV----------------------------------------------------
B0A9U9_9FIRM/35-125...................NVMG--IIA----------------------------------------------------
C2NVG4_BACCE/15-112I..............THKVPYPG--MLL----------------------------------------------------
C5QQG0_STAEP/16-114I..............GVDVYRNG--ILA----------------------------------------------------
C9S1F4_GEOSY/15-114M..............GKDTVMNG--VFL----------------------------------------------------
D9STE0_CLOC7/154-250...............MTKHDGHF--AYV----------------------------------------------------
D4YUJ5_9LACO/65-159...................SKNV--MLV----------------------------------------------------
C2WDE4_BACCE/12-110...............YRSVMRPG--VLI----------------------------------------------------
F0BTF6_9XANT/28-122...................LSPD--AVV----------------------------------------------------
C2RX88_BACCE/12-111...............YRHPVRPG--VLV----------------------------------------------------
F0PPB5_BACT0/12-116.................YMSRSG--ILA----------------------------------------------------
A0M4L3_GRAFK/28-124...................LSPD--SIA----------------------------------------------------
C2PSH1_BACCE/35-136I..............THNVPRSG--VLL----------------------------------------------------
E4SKV3_LACAR/66-157..................RGEDV--MLT----------------------------------------------------
C2X664_BACCE/12-105...............FILSYQHG--VFV----------------------------------------------------
Q4L537_STAHJ/16-114L..............GKNTIRHG--VLA----------------------------------------------------
B1RCX7_CLOPF/12-109...............CRRGYRPG--ILI----------------------------------------------------
D5BGD3_ZUNPS/37-134...................FSPD--SVA----------------------------------------------------
C3I3B9_BACTU/68-162...................KDMN--VYV----------------------------------------------------
A2BKM8_HYPBU/14-108..................LEKPK--WLV----------------------------------------------------
B3Z200_BACCE/12-116.................YSSRSG--ILA----------------------------------------------------
Q5JHI4_PYRKO/17-110..................IEKPK--WLL----------------------------------------------------
Y689_ARCFU/15-109...................LKPK--YLI----------------------------------------------------
F0NRS4_LACHH/66-157..................HSENV--MLV----------------------------------------------------
E5WCD5_9BACI/12-111................CLAPHPG--FFA----------------------------------------------------
A3J3Z6_9FLAO/29-125.................VTIFPD--SIV----------------------------------------------------
Q6HPH0_BACHK/12-105...............FTLCYQHG--IFV----------------------------------------------------
A3V5V9_9RHOB/43-146TS...........NDFDFGANTW--IAA----------------------------------------------------
C6XZU2_PEDHD/28-124...................LLPD--CIA----------------------------------------------------
D7VUF4_9FLAO/27-123...................LSPD--CIA----------------------------------------------------
C2Z256_BACCE/12-105...............FTLSYRHG--IFV----------------------------------------------------
A0RV76_CENSY/18-109...................ILPA--TYF----------------------------------------------------
A9VQB7_BACWK/12-105...............FTLCYQHG--IFV----------------------------------------------------
A5FK72_FLAJ1/29-125.................ITVFPD--SIV----------------------------------------------------
C2FZ39_9SPHI/27-123.................VTILPD--SIA----------------------------------------------------
F0LI97_THEBM/14-108..................EAKPK--WLV----------------------------------------------------
A6DLU2_9BACT/54-148...................IDEG--MYF----------------------------------------------------
D4RW70_9FIRM/218-308................GDDDRVA--GCG----------------------------------------------------
B0ABX6_9FIRM/8-108D..............FTIVDENG--VLL----------------------------------------------------
YOKE_BACSU/50-157..................LTKFG--FMV----------------------------------------------------
A3ICZ3_9BACI/33-123.................GGLKQY--LGV----------------------------------------------------
D3D498_9ACTO/29-119...................RGGG--ILV----------------------------------------------------
B9E7P9_MACCJ/52-151..................LNQSG--LIL----------------------------------------------------
F0KC11_CLOAE/16-129GS............MITADDRNY--IIG----------------------------------------------------
A7GMF6_BACCN/23-116...............LGFPYKYG--FFI----------------------------------------------------
B9DJ09_STACT/11-105N..............GEIKIFEA--AYV----------------------------------------------------
Q63DC4_BACCZ/62-170VNSKV.....IPNIFTAGATFYY--YIV----------------------------------------------------
E8SGW4_STAPH/11-105K..............DMTKRFEA--AYV----------------------------------------------------
C2VL18_BACCE/51-157..................LTKTG--FIV----------------------------------------------------

PF08000

Q1YDV8_MOBAS/1-123LAPILL...PGEGVELAFQIVRD--LLV----------------------------------------------------
Q4JTR2_CORJK/12-120VMALLV...PGEQAVVAFKTFRD--SAI----------------------------------------------------
A3CQI4_STRSV/1-125LEDILT...TTENVELAFSLIRD--LIV----------------------------------------------------
Q832M1_ENTFA/1-125LRDVLI...PNEKVDMAFTLVRD--LIV----------------------------------------------------
YOZO_BACSU/1-113LEALLV...EGERIESIYKLRVD--QIC----------------------------------------------------
Q813J1_BACCR/1-124LEKIML...DDEKVEHAYKLIRD--LIV----------------------------------------------------
Q1ZV35_PHOAS/1-124LSTILG...PNENIELAYKLVRD--MII----------------------------------------------------
A0Y4W4_9GAMM/1-124LANTLI...EGEHVEKAYKVIRD--MFI----------------------------------------------------
A9AYV8_HERA2/1-124FAQLLA...WGEQVQRAYQLIRD--FFI----------------------------------------------------
Q5N1D6_SYNP6/1-122RAGVFV...KDEMIYCAYKGARD--LLF----------------------------------------------------
YJQA_BACSU/1-125LAHILL...EGEKVEAAFKLVRD--LIV----------------------------------------------------
A4VWQ3_STRSY/14-138LEHVLL...DNEQVEMAFSLVRD--LIV----------------------------------------------------
A3XIK4_LEEBM/1-125YDRLLT...EREHIEVGFQLLRD--VFI----------------------------------------------------
Q65II6_BACLD/1-113FEPLLI...EGEKIESVCRLRMD--QIC----------------------------------------------------
Q2B2E1_9BACI/6-134DADDYVMHEDNEKIYFLIKSKSD--EYC----------------------------------------------------
A0YP44_LYNSP/1-126FSEVLV...EGETIEKAYQLIRD--LFV----------------------------------------------------
A1APA7_PELPD/1-124YRQLLI...DGEIIEAGFAVNRD--TFL----------------------------------------------------
A4CBQ0_9GAMM/1-124IGDALI...DGESVQKAYKVIRD--MFV----------------------------------------------------
A3J144_9FLAO/1-125YGKLLI...TDEEIELGFKLIRD--TFI----------------------------------------------------
Q1GUI3_SPHAL/1-119FQPWLI...DGEQVLAAFRTIRD--TVL----------------------------------------------------
YVBH_BACSU/6-134DADDYVMHEDNEKIYFLIKTKAD--EYC----------------------------------------------------
B0UJV9_METS4/1-124LDGMLV...PGETVEVAFRVLRD--LIV----------------------------------------------------
Q5M368_STRT2/1-125LENILI...PGEQVDLAYVLVRD--LIV----------------------------------------------------
A2U3F1_9FLAO/1-125YGRLLV...QNESIELGFKLLRD--TFM----------------------------------------------------
Q2LS73_SYNAS/2-125YAPLLV...DGEDVTKVFRLHNE--MIV----------------------------------------------------
A1S3D0_SHEAM/1-124LSPILG...DNEELQLAYKMVRD--LFV----------------------------------------------------
A4QHX3_CORGB/1-122LETILI...PGERPITAYKTFRD--SAI----------------------------------------------------
A5UL39_METS3/1-109VSEFFF...DDEEVIQSYQFIRD--QII----------------------------------------------------
Q3K1T3_STRA1/1-125LSDILI...SDEQVDLAYTLIRD--LIV----------------------------------------------------
A0LZE1_GRAFK/1-125YGKLLI...PSEEIEAGFKIIRD--TFI----------------------------------------------------
A6CNL3_9BACI/6-134LSDDYVLHEDGEKIHFLIKSKTD--EYC----------------------------------------------------
A7GD79_CLOBL/1-124YSNVLA...ENERVEKAYKLIRD--MFI----------------------------------------------------
Q6ANG9_DESPS/2-124ISLFLI...DGEKIFATFKTIRD--QVV----------------------------------------------------
Q8ELK9_OCEIH/1-124FQQVLA...ESENIERTYKLIRD--LFI----------------------------------------------------
A8FE59_BACP2/1-112FESLLI...EGERIEAVYRLRHD--QIC----------------------------------------------------
A1VMG6_POLNA/1-124FEQILA...AGEQVEHAYQLIRD--YFV----------------------------------------------------
Q5Z2E2_NOCFA/1-124YAKLFG...NGEQVYAAYILVRD--AML----------------------------------------------------
B8FYR8_DESHD/1-124VGPLLY...DSEQITKAFKLIRD--LIV----------------------------------------------------
Q11IY3_MESSB/1-124LDGVLI...DGETVDLAFRVIRD--FFV----------------------------------------------------
Q1VFT1_VIBAL/2-124FLKFLI...DGETIFAVFKTVRD--QVV----------------------------------------------------
A8H0K5_SHEPA/1-124LSPIMA...DGEALTLAYKVIRD--MFV----------------------------------------------------
B8E5Z2_SHEB2/1-124LRPIMG...IQEELKLAYKVIRD--LFI----------------------------------------------------
C3E964_BACTU/6-134DADDYVMHEDGEKIYFLIKSKSD--EYC----------------------------------------------------
A5GZ01_9CAUD/2-124ISPIFV...KGESILGTYKGIRD--GVV----------------------------------------------------
A0JTP3_ARTS2/1-111VMELMV...PGEQPVAAYKTFRD--SAI----------------------------------------------------
Q9F325_STRCO/1-120YARLLG...QGEQVHAAYLLIRD--TIL----------------------------------------------------
Q15NS1_PSEA6/1-123LAPIIG...ATEEVQQVFKVVRD--MYV----------------------------------------------------
A6N235_9CAUD/15-120VAALLT...QGEQAVAAFQTFRD--SAI----------------------------------------------------
A3I5Y5_9BACI/1-124VNDLLI...PNETIKNAYKIIRD--IFI----------------------------------------------------
C5B2T2_METEA/1-124LAGVLA...PGESVRVAFKVIRD--LMI----------------------------------------------------
B1YH35_EXIS2/1-122VTGLLI...QGEDALSAYKTIRD--VAI----------------------------------------------------
Q723Y5_LISMF/1-127IERFLG...EDETIIQIFKFVRD--EVI----------------------------------------------------
Q1VZB8_9FLAO/1-125YEQLLT...EHENIEIGFKLVRD--TFI----------------------------------------------------
B1YJX4_EXIS2/6-134AADDYVLHEDGEKIYFLIKSKTD--EYC----------------------------------------------------
A6DLR5_9BACT/1-133HGAYLI...EGEEIQTGFKLVRD--TLI----------------------------------------------------

PF03703

Q1HA10_9ZZZZ/54-129-----------------YFTTE.--.LA----------------------------------------------------
A5N1P5_CLOK5/62-141-----------------WRKNF.--.FI----------------------------------------------------
C4XRD2_DESMR/88-163-----------------FSFFTL--RVG----------------------------------------------------
Q9JPA9_RUBGE/102-193-----------------TARGAV--.YT----------------------------------------------------
A2BXQ3_PROM5/40-114-----------------VRALWL--RYK----------------------------------------------------
Q2N679_ERYLH/79-158-----------------WSRFT.--.YR----------------------------------------------------
Q05WK2_9SYNE/41-115-----------------VRALWL--RFQ----------------------------------------------------
O26822_METTH/90-166-----------------WRNRR.--.YI----------------------------------------------------
A7B794_RUMGN/68-144-----------------YNRYR.--.YS----------------------------------------------------
A5N1P4_CLOK5/81-157-----------------YKQWK.--.YA----------------------------------------------------
A3Z634_9SYNE/41-115-----------------MRALWL--RFR----------------------------------------------------
B5INT9_9CHRO/45-119-----------------VRALWL--RFR----------------------------------------------------
Q6HMA1_BACHK/59-139-----------------WYFKV.--.YW----------------------------------------------------
Q8YRN0_NOSS1/39-113-----------------VRALWL--RYR----------------------------------------------------
A8LQ34_DINSH/96-187-----------------QAVTTI--.YT----------------------------------------------------
A5BQ81_VITVI/109-183-----------------SRAFFL--RYR----------------------------------------------------
C5C9H6_MICLC/78-153-----------------WRWVFR--RTV----------------------------------------------------
Q8CJW8_STRCO/479-556-----------------WRGHG.--.LA----------------------------------------------------
Q8S7W8_ORYSJ/97-171-----------------SRAFIL--RYR----------------------------------------------------
Q92DD3_LISIN/73-149-----------------FARWS.--.YQ----------------------------------------------------
YDBT_BACSU/406-486-----------------YKEAA.--.WT----------------------------------------------------
A0JUF8_ARTS2/86-161-----------------WHATQ.--.YV----------------------------------------------------
Q0S416_RHOSR/85-163-----------------YRVHR.--.WE----------------------------------------------------
A0YYM4_LYNSP/32-106-----------------VRALWL--RYR----------------------------------------------------
Q5KZA4_GEOKA/394-472-----------------FQIAG.--.WS----------------------------------------------------
Q7TWU1_MYCBO/82-157-----------------WLTTH.--.FV----------------------------------------------------
A4X9A7_SALTO/98-177-----------------WYNTG.--.YH----------------------------------------------------
A1S9Q9_SHEAM/70-149-----------------YATYR.--.FR----------------------------------------------------
Q721T2_LISMF/403-484-----------------YRATG.--..V----------------------------------------------------
Q5V3H6_HALMA/457-539-----------------WRHRG.--.FD----------------------------------------------------
Q83YH0_RUBGE/102-193-----------------TARGAV--.YT----------------------------------------------------
Q132N9_RHOPS/92-183-----------------FRRASC--.YT----------------------------------------------------
B6SR38_MAIZE/97-171-----------------SRAFIL--RYR----------------------------------------------------
A2C406_PROM1/41-115-----------------VRALWV--RYK----------------------------------------------------
Q2B513_9BACI/394-474-----------------FRAAG.--.WH----------------------------------------------------
A6CG36_9PLAN/173-250-----------------TRFRS.--.VT----------------------------------------------------
A4X9A6_SALTO/93-171-----------------VRAWG.--.YA----------------------------------------------------
B4WGH0_9SYNE/39-113-----------------VRALWL--RYR----------------------------------------------------
Q0RP62_FRAAA/86-163-----------------WQFDH.--.LM----------------------------------------------------
Q63ES8_BACCZ/238-321-----------------YANFK.--.IE----------------------------------------------------
A0JR89_ARTS2/421-499-----------------WRRNG.--.FT----------------------------------------------------
B4W1I4_9CYAN/22-96-----------------VRALWL--RYR----------------------------------------------------
A0QQT0_MYCS2/68-149-----------------WFTTT.--.YR----------------------------------------------------
A4CRN2_SYNPV/41-115-----------------VRALWL--RFN----------------------------------------------------
B8LD31_THAPS/35-108-----------------ARQAWV--RYK----------------------------------------------------
A0M124_GRAFK/406-482-----------------YRSLR.--.LS----------------------------------------------------
A3PE34_PROM0/40-114-----------------VRALWL--RYK----------------------------------------------------
B7KVD9_METC4/78-172-----------------YRTTR.--.YR----------------------------------------------------
Q6NJ02_CORDI/358-436-----------------VSSQV.--.VE----------------------------------------------------
YPU5_RHOCA/95-187-----------------QARAAI--.YT----------------------------------------------------
A4ACP9_9GAMM/95-186-----------------YARTTI--.YT----------------------------------------------------
Q03UQ0_LEUMM/60-139-----------------WFFFI.--.FE----------------------------------------------------
A4INK5_GEOTN/61-142-----------------WVRFT.--.YG----------------------------------------------------
A8I741_CHLRE/23-98-----------------GRRLWI--SFK----------------------------------------------------
Q52V71_9ACTO/422-499-----------------YRSLG.--.HG----------------------------------------------------
Q1VZX2_9FLAO/423-499-----------------VKKSS.--.IG----------------------------------------------------
Q1PL87_PROMR/40-114-----------------VRALWL--RYK----------------------------------------------------
Q0A9I7_ALHEH/434-510-----------------WRAVA.--.WR----------------------------------------------------
Q0TSV7_CLOP1/311-394-----------------YYNFT.--.LL----------------------------------------------------
A7GLR9_BACCN/66-145-----------------WKNNV.--.FI----------------------------------------------------
A2XD07_ORYSI/97-171-----------------SRAFIL--RYR----------------------------------------------------
A4C2S8_9FLAO/260-345-----------------HFNLR.--.VY----------------------------------------------------
Q5HEC8_STAAC/67-143-----------------IMNTR.--.YW----------------------------------------------------
A0ZDC0_NODSP/39-113-----------------VRALWL--RFR----------------------------------------------------
B4FUN4_MAIZE/96-170-----------------SRAFIL--RYR----------------------------------------------------
Q0DUR5_ORYSJ/97-171-----------------SRAFIL--RYR----------------------------------------------------
Q2S4T2_SALRD/280-363-----------------YYNFR.--.LW----------------------------------------------------
Q07RX8_RHOP5/92-183-----------------FRRATA--.YT----------------------------------------------------
Q1VZX2_9FLAO/274-357-----------------YYDLK.--.IT----------------------------------------------------
B2J0Q4_NOSP7/39-113-----------------VRALWL--RFR----------------------------------------------------
Q49Z28_STAS1/72-148-----------------YHYTY.--.YR----------------------------------------------------
Q1AYV8_RUBXD/67-148-----------------WRATV.--.YR----------------------------------------------------
Q949S6_ARATH/104-178-----------------SRAFNL--RYR----------------------------------------------------
Q10VQ2_TRIEI/39-113-----------------VRALWL--RYR----------------------------------------------------
Q03T95_LACBA/71-147-----------------YRFTR.--.YQ----------------------------------------------------
Q3AV40_SYNS9/40-114-----------------VRAVWL--RFR----------------------------------------------------
A5USV1_ROSS1/73-149-----------------WSNAH.--.YV----------------------------------------------------
Q0TQ92_CLOP1/75-151-----------------YFTWS.--.YF----------------------------------------------------
A7B9U4_9ACTO/406-484-----------------YKRRA.--.FG----------------------------------------------------
A4ILF0_GEOTN/382-461-----------------YRHTA.--.FR----------------------------------------------------
Q0A9I7_ALHEH/77-156-----------------YRRFR.--.FR----------------------------------------------------
A1WXI2_HALHL/93-184-----------------MATTTL--.YS----------------------------------------------------
B7G849_PHATC/47-120-----------------ARQAWV--RYK----------------------------------------------------
Q0TSV7_CLOP1/77-157-----------------WKKEY.--.ML----------------------------------------------------
A7B793_RUMGN/74-155-----------------WSKTY.--.IS----------------------------------------------------
B7KHE2_CYAP7/39-113-----------------VRAIWL--RYR----------------------------------------------------
A5UZJ9_ROSS1/78-155-----------------SITER.--.YV----------------------------------------------------
A6U3F8_STAA2/74-150-----------------YKHCR.--.YA----------------------------------------------------
A6DYF7_9RHOB/94-185-----------------QARATV--.YT----------------------------------------------------
A7A966_BIFAD/22-101-----------------FTFTV.--.YA----------------------------------------------------
Q3IJZ4_PSEHT/76-156-----------------YKSFR.--.FC----------------------------------------------------
Q73CA2_BACC1/388-464-----------------YTSSG.--.YM----------------------------------------------------
Q9M9S8_ARATH/339-413-----------------SRAFNL--RYR----------------------------------------------------
A1SMF8_NOCSJ/73-149-----------------WATAS.--.YT----------------------------------------------------
Q7U523_SYNPX/40-114-----------------VRAVWL--RFR----------------------------------------------------
Q16DS6_ROSDO/94-185-----------------QARATV--.YT----------------------------------------------------
A4X385_SALTO/78-154-----------------WQATH.--.YL----------------------------------------------------
A7B9U4_9ACTO/86-165-----------------WTKTR.--.YA----------------------------------------------------
B6B3P5_9RHOB/94-185-----------------QARSTV--.YT----------------------------------------------------
A7GLR9_BACCN/269-351-----------------YKNFK.--.VQ----------------------------------------------------
A4AI68_9ACTN/73-148-----------------WLAKN.--.YT----------------------------------------------------
A3Z0J2_9SYNE/41-115-----------------VRALWL--RFR----------------------------------------------------
Q3AM30_SYNSC/40-114-----------------VRALWL--RFR----------------------------------------------------
Q7VB01_PROMA/40-114-----------------VRALWL--RFK----------------------------------------------------
A3J6N0_9FLAO/71-152-----------------YWFFT.--.FH----------------------------------------------------
Q6A731_PROAC/79-153-----------------WFTTT.--.MT----------------------------------------------------
Q8GPI5_STAAU/65-145-----------------WVHFK.--.FK----------------------------------------------------
Q4C5Y4_CROWT/39-113-----------------VRAIWL--RYR----------------------------------------------------
A0NKK3_OENOE/413-495-----------------SRHMA.--.FV----------------------------------------------------
A2C7A2_PROM3/40-114-----------------IRALWL--RFR----------------------------------------------------
A6FPZ3_9RHOB/96-187-----------------QARATV--.YT----------------------------------------------------
A6G2U2_9DELT/86-163-----------------HVSTK.--.YK----------------------------------------------------
Q05YV4_9SYNE/40-114-----------------VRAVWL--RFR----------------------------------------------------
Q3IQW3_NATPD/58-137-----------------YQRFE.--.YE----------------------------------------------------
A7VBS0_9CLOT/23-100-----------------WTFTK.--.YR----------------------------------------------------
Q2JF56_FRASC/78-154-----------------RMTTH.--.YV----------------------------------------------------
Q52V71_9ACTO/80-161-----------------LLTTR.--.FR----------------------------------------------------
F2G2I3_ALTMD/454-530-----------------WWRWG.--.IS----------------------------------------------------
A0Y0J5_9GAMM/280-360-----------------YQRYG.--.YY----------------------------------------------------
A8YDE5_MICAE/39-113-----------------VRAIWL--RYK----------------------------------------------------
Q7V0R9_PROMP/40-114-----------------VRALWL--RYK----------------------------------------------------
Q2NEQ5_METST/106-182-----------------WNYTL.--.YT----------------------------------------------------
B1YH17_EXIS2/61-141-----------------WYFYT.--.FT----------------------------------------------------
Q5QU90_IDILO/71-150-----------------FYFYQ.--.YR----------------------------------------------------
Q03UP9_LEUMM/73-149-----------------YHFRR.--.YY----------------------------------------------------
Q086M2_SHEFN/453-529-----------------YKQWG.--.YV----------------------------------------------------
Q92DD2_LISIN/68-148-----------------YITYK.--.YT----------------------------------------------------
A0NKK3_OENOE/79-160-----------------YIFFA.--.YR----------------------------------------------------
Q8XM54_CLOPE/456-535-----------------GRNIN.--.LK----------------------------------------------------
Q0W0T7_UNCMA/387-467-----------------YLDAG.--.YR----------------------------------------------------
Q3JEQ1_NITOC/43-119-----------------TKMDK.--.LT----------------------------------------------------
Q2JNH7_SYNJB/39-113-----------------VRKLWV--HYR----------------------------------------------------
Q21G74_SACD2/81-160-----------------AKCKA.--.YA----------------------------------------------------
Q2Z019_9CHLR/216-306-----------------IDYAND--YYV----------------------------------------------------
Q8XK94_CLOPE/57-138-----------------WFNTS.--.IL----------------------------------------------------
Q8L2A0_PROVU/52-129-----------------IHSIR.--.YE----------------------------------------------------
D1N2C5_9BACT/85-162-----------------RKNQF.--.YT----------------------------------------------------
C1N978_MICPC/163-238-----------------GRGLWS--SYK----------------------------------------------------
Q4UQ21_XANC8/70-149-----------------YFTYR.--.YR----------------------------------------------------
Q9KC53_BACHD/397-477-----------------YKVAG.--.YF----------------------------------------------------
A0M123_GRAFK/89-168-----------------QKRNG.--.YA----------------------------------------------------
Q5NX64_AROAE/73-152-----------------YLKFSA--LYT----------------------------------------------------
Q8ELM2_OCEIH/63-143-----------------WFRTS.--.YE----------------------------------------------------
Q6NJ02_CORDI/83-162-----------------WRSIG.--.YS----------------------------------------------------
D0CLT0_9SYNE/40-114-----------------VRALWL--RFR----------------------------------------------------
D7E125_NOSA0/39-113-----------------VRALWL--RFR----------------------------------------------------
A9NAV6_COXBR/84-159-----------------YRTSE.--.YG----------------------------------------------------
B7K5U4_CYAP8/39-113-----------------VRAIWL--RYR----------------------------------------------------
Q0S417_RHOSR/271-354-----------------YGNMT.--.LT----------------------------------------------------
Q7UGR8_RHOBA/447-530-----------------HRHFG.--.FA----------------------------------------------------
A8H7X9_SHEPA/99-178-----------------AKSLA.--.YA----------------------------------------------------
Q8ELM2_OCEIH/411-490-----------------YRFAK.--.FT----------------------------------------------------
Q1LGU6_RALME/27-104-----------------IQTTR.--.IE----------------------------------------------------
A0PYF4_CLONN/263-346-----------------YYGFS.--.VY----------------------------------------------------
A9DA93_9RHIZ/98-189-----------------VQKTTM--.YT----------------------------------------------------
Q26E06_FLABB/272-354-----------------FYDFK.--.ME----------------------------------------------------
A3IZS9_9CHRO/39-113-----------------VRAIWL--RYR----------------------------------------------------
Q8DL95_THEEB/154-228-----------------VRALWL--RYR----------------------------------------------------
B5W8W6_SPIMA/39-113-----------------VRALWL--RYR----------------------------------------------------
Q0BW05_GRABC/100-175-----------------RFGTE.--.IV----------------------------------------------------
Q0I8C4_SYNS3/41-115-----------------VRAVWL--RFN----------------------------------------------------
Q7UG90_RHOBA/131-208-----------------RLGVQ.--.YE----------------------------------------------------
A1ZJ65_9BACT/38-113-----------------HHTSE.--.FV----------------------------------------------------
Q46JN3_PROMT/41-115-----------------VRALWV--RYK----------------------------------------------------
A4C2S8_9FLAO/74-153-----------------FKNFQ.--.FK----------------------------------------------------
P74154_SYNY3/39-113-----------------VRAIWL--RYK----------------------------------------------------
A3VXW4_9RHOB/94-185-----------------QARATV--.YT----------------------------------------------------
A4VC01_BACUN/66-143-----------------LRRIR.--.YR----------------------------------------------------
Q219Q4_RHOPB/92-183-----------------FRRATT--.YT----------------------------------------------------
D3LLG2_MICLU/78-153-----------------WRWVFR--RTV----------------------------------------------------
A0Y0J7_9GAMM/81-160-----------------IKLQG.--.VA----------------------------------------------------
A5ZQI3_9FIRM/16-93-----------------WTFTT.--.YT----------------------------------------------------
C1E7H3_MICSR/155-230-----------------GRGLWV--NYR----------------------------------------------------
A9BBJ1_PROM4/40-114-----------------VRALWL--RFK----------------------------------------------------
Q5MG95_IPOBA/97-168-----------------FRAFSL--RYR----------------------------------------------------
Q5WBQ3_BACSK/413-492-----------------FFHTR.--.YA----------------------------------------------------
A5CP90_CLAM3/129-207-----------------WRMHT.--.FR----------------------------------------------------
E0U6K0_CYAP2/39-113-----------------VRAIWL--RYR----------------------------------------------------
A8LDS5_FRASN/354-432-----------------WRRMR.--.CG----------------------------------------------------
Q319V0_PROM9/40-114-----------------VRALWL--RYK----------------------------------------------------
A7BCE4_9ACTO/77-152-----------------WSSTT.--.YT----------------------------------------------------
A5GN11_SYNPW/41-115-----------------VRALWL--RFN----------------------------------------------------
B4U7M5_HYDS0/110-189-----------------KKTTK.--.LF----------------------------------------------------
B0JN61_MICAN/39-113-----------------VRAIWL--RYK----------------------------------------------------
Q3BNL4_XANC5/409-490-----------------VQRMA.--.YA----------------------------------------------------
Q21G75_SACD2/67-146-----------------YLNFF.--.YI----------------------------------------------------
A3WHT6_9SPHN/102-193-----------------SRRTTL--.YI----------------------------------------------------
A3ZL30_9PLAN/70-147-----------------APGVGT--HYR----------------------------------------------------
B4SKG8_STRM5/92-171-----------------LTRTR.--.WR----------------------------------------------------
A6L372_BACV8/68-142-----------------KMGAE.--.YV----------------------------------------------------
B1X5C5_PAUCH/39-113-----------------VRALWL--RFE----------------------------------------------------
Q3M7J5_ANAVT/39-113-----------------VRALWL--RYR----------------------------------------------------
Q7V611_PROMM/40-114-----------------IRALWL--RFR----------------------------------------------------
A3J6N0_9FLAO/260-345-----------------YFDFT.--.IQ----------------------------------------------------
B0CDM0_ACAM1/39-113-----------------VRAIWL--RFR----------------------------------------------------
Q18HZ1_HALWD/71-148-----------------YTNTN.--.YV----------------------------------------------------
B9HVA0_POPTR/105-179-----------------SRAFYL--RYR----------------------------------------------------
A5IAX6_LEGPC/63-138-----------------YHFSS.--.IT----------------------------------------------------
Q18K27_HALWD/63-142-----------------YRIWR.--.YE----------------------------------------------------
A8G5Y3_PROM2/40-114-----------------VRALWL--RYK----------------------------------------------------
Q9KC53_BACHD/249-335-----------------YWNHQ.--.VQ----------------------------------------------------
Q2JXB7_SYNJA/39-113-----------------VRKLWV--HYR----------------------------------------------------
B1WWJ1_CYAA5/39-113-----------------VRAIWL--RYR----------------------------------------------------
Q58PP7_9PROT/102-193-----------------SASSTL--.YT----------------------------------------------------
B8HR49_CYAP4/39-113-----------------VRALWL--RYR----------------------------------------------------
Q2S103_SALRD/46-123-----------------ARSRE.--.LV----------------------------------------------------
B9P2Z9_PROMR/37-111-----------------VRALWL--RYK----------------------------------------------------
Q31MS3_SYNE7/39-113-----------------VRALWL--RFR----------------------------------------------------
A3CWW6_METMJ/72-152-----------------HESIV.--.YR----------------------------------------------------
B1XJD3_SYNP2/39-113-----------------VRALWL--RYR----------------------------------------------------
A5N1P5_CLOK5/245-328-----------------YYNFK.--.MW----------------------------------------------------
Q5N604_SYNP6/39-113-----------------VRALWL--RFR----------------------------------------------------
C7QSQ1_CYAP0/39-113-----------------VRAIWL--RYR----------------------------------------------------
B1YH17_EXIS2/235-317-----------------YGSFR.--.AT----------------------------------------------------
A8DJC1_9BACT/77-153-----------------QWTET.--.YI----------------------------------------------------
A3TM09_9MICO/97-176-----------------WRFAK.--.FR----------------------------------------------------
B9S293_RICCO/108-182-----------------SRAFFL--RYR----------------------------------------------------
A0PYF4_CLONN/58-140-----------------WRTTK.--.FT----------------------------------------------------
Q2BC10_9BACI/64-144-----------------WLTST.--.YK----------------------------------------------------

PF08512

E3JV35_PUCGT/378-471-----------------QSAIKC--NMK----------------------------------------------------
SPT16_CRYNJ/823-913-----------------FNGVPH--K..----------------------------------------------------
MU183_SCHPO/224-312-----------------TYGVEA--NYK----------------------------------------------------
A0D1L5_PARTE/272-363-----------------LFCLRC--SVG----------------------------------------------------
A0DSI1_PARTE/255-346-----------------LFCLRC--SVV----------------------------------------------------
A2DGX1_TRIVA/315-409-----------------TNAIFG--SWK----------------------------------------------------
RT106_ASPNC/254-348-----------------AFHVKA--FRG----------------------------------------------------
A3LUL0_PICST/372-466-----------------QPGISC--SLK----------------------------------------------------
A3LUQ9_PICST/282-380-----------------LIIVEC--HRG----------------------------------------------------
RT106_MAGO7/271-365-----------------AVHVKA--FRG----------------------------------------------------
A4RSB9_OSTLU/241-330-----------------FGHVQA--TKG----------------------------------------------------
A5DBS4_PICGU/383-476-----------------QPGVSC--SLK----------------------------------------------------
RT106_PICGU/253-354-----------------VVIVQA--YRG----------------------------------------------------
RT106_LODEL/273-372-----------------MVMVEC--HKG----------------------------------------------------
A5K9I5_PLAVS/838-928-----------------FSGVPN--K..----------------------------------------------------
A6QQT5_BOVIN/338-428-----------------AQCITC--SYK----------------------------------------------------
A7AMU7_BABBO/345-437-----------------EAGFSC--TYK----------------------------------------------------
A7ATG3_BABBO/682-772-----------------FSGVPS--K..----------------------------------------------------
A7EF87_SCLS1/222-319-----------------AVHVRA--FRG----------------------------------------------------
A7EHR1_SCLS1/823-913-----------------FNGVPF--R..----------------------------------------------------
A7EPG7_SCLS1/122-216-----------------QYGIKC--SIK----------------------------------------------------
A7SAG6_NEMVE/329-422-----------------VSCITC--SHR----------------------------------------------------
A7SV15_NEMVE/817-907-----------------FSGVPF--R..----------------------------------------------------
A8B8A9_GIAIC/457-556-----------------YPCVEC--KNR----------------------------------------------------
A8JHE3_CHLRE/834-924-----------------FSGVPH--R..----------------------------------------------------
A8NIX9_COPC7/281-392-----------------IPGVEA--YRA----------------------------------------------------
A8NQK0_COPC7/350-445-----------------HPGIKA--NLK----------------------------------------------------
A8PHT4_BRUMA/819-909-----------------FFGVPY--R..----------------------------------------------------
A8Q169_MALGO/420-513-----------------QESVRC--NVK----------------------------------------------------
A9TYN6_PHYPA/829-919-----------------FHGVPN--K..----------------------------------------------------
A9UWZ2_MONBE/130-221-----------------FYRTIE--EEL----------------------------------------------------
B0D3X0_LACBS/691-781-----------------FEGVPF--R..----------------------------------------------------
B0EBA0_ENTDS/238-331-----------------SHFLKC--NLS----------------------------------------------------
B0WV30_CULQU/164-253-----------------TPAVGC--SYK----------------------------------------------------
B2AEJ4_PODAN/271-367-----------------AVHVKA--FRG----------------------------------------------------
B2WB70_PYRTR/816-906-----------------FNGVPS--R..----------------------------------------------------
B3LP50_YEAS1/219-308-----------------SFHLQC--HRG----------------------------------------------------
B3RJ01_TRIAD/796-886-----------------FYGVPH--R..----------------------------------------------------
B3S4B9_TRIAD/339-431-----------------SSSVSC--SHK----------------------------------------------------
B4MYD4_DROWI/338-428-----------------TAAVGC--SFK----------------------------------------------------
B5DPP2_DROPS/812-902-----------------FPGAPF--R..----------------------------------------------------
B6K3E4_SCHJY/354-447-----------------HTAVKC--SYK----------------------------------------------------
B6Q860_PENMQ/277-371-----------------AYHVKA--HRG----------------------------------------------------
B6SH59_MAIZE/359-454-----------------GYAVKS--SLK----------------------------------------------------
B7FSR1_PHATC/830-920-----------------FTGNPH--K..----------------------------------------------------
B7Q220_IXOSC/338-428-----------------TNCITC--SYR----------------------------------------------------
B8C388_THAPS/329-429-----------------QACVKC--ALR----------------------------------------------------
B8N5D9_ASPFN/836-926-----------------FTGVPN--R..----------------------------------------------------
B9FEF3_ORYSJ/819-909-----------------FHGVPY--K..----------------------------------------------------
B9PYN6_TOXGO/951-1041-----------------FTGVPM--K..----------------------------------------------------
C0SF36_PARBP/419-513-----------------HSGVKC--SIK----------------------------------------------------
C1EF78_MICSR/357-451-----------------GHAVKA--SNK----------------------------------------------------
C1EGI9_MICSR/255-341-----------------RGCVKA--NHK----------------------------------------------------
C1MGW4_MICPC/827-917-----------------FDGVPF--K..----------------------------------------------------
C1N716_MICPC/352-450-----------------GSAVKA--SNK----------------------------------------------------
C3YLD4_BRAFL/809-899-----------------FFGVPN--R..----------------------------------------------------
C3Z3Y2_BRAFL/337-427-----------------TSAVSC--SHK----------------------------------------------------
C4JJX0_UNCRE/248-343-----------------AFHVKA--FRG----------------------------------------------------
C4M3K5_ENTHI/527-619-----------------FGGTIK--R..----------------------------------------------------
C4R4T9_PICPG/190-282-----------------DFYVVA--HKG----------------------------------------------------
C4V834_NOSCE/640-728-----------------FTGVPF--K..----------------------------------------------------
C4VA45_NOSCE/300-390-----------------RRGLKC--TYK----------------------------------------------------
C4XW15_CLAL4/363-457-----------------QAGVSC--SLK----------------------------------------------------
C4XWH5_CLAL4/282-381-----------------FLAVEA--YKG----------------------------------------------------
C4YJJ1_CANAW/361-455-----------------QAGVPC--SVK----------------------------------------------------
C5DD23_LACTC/203-292-----------------SFHVEA--HRG----------------------------------------------------
C5DLM5_LACTC/832-922-----------------FQGVPS--R..----------------------------------------------------
C5KH74_PERM5/339-433-----------------YNCVRC--SHK----------------------------------------------------
C5M9F0_CANTT/250-349-----------------LVMVDC--YKG----------------------------------------------------
C5MDR0_CANTT/801-891-----------------FQGVPF--R..----------------------------------------------------
C7GW05_YEAS2/381-475-----------------QCAVSC--SFK----------------------------------------------------
C7Z9V4_NECH7/370-464-----------------QYGIKC--SIK----------------------------------------------------
C9SCC5_VERA1/256-347-----------------AVHVKA--FRG----------------------------------------------------
D0NNZ6_PHYIT/339-439-----------------ERAVKC--AVK----------------------------------------------------
D2HYC0_AILME/786-876-----------------FNGAPY--R..----------------------------------------------------
D2VV01_NAEGR/360-450-----------------DKALKC--SLK----------------------------------------------------
D3AWW1_POLPA/841-931-----------------FYGVPN--V..----------------------------------------------------
D3AXH6_POLPA/368-466-----------------SNSIKC--SLK----------------------------------------------------
D4D4T0_TRIVH/279-374-----------------AYHVKA--FRG----------------------------------------------------
D5G7P9_TUBMM/814-904-----------------FNGVPF--R..----------------------------------------------------
D5G911_TUBMM/234-326-----------------AFHVKA--HVG----------------------------------------------------
D5GN86_TUBMM/370-466-----------------QSGVKC--SLK----------------------------------------------------
D7FLF8_ECTSI/341-441-----------------AKAVKC--ALG----------------------------------------------------
D7FPY1_ECTSI/806-907-----------------FGGKPF--KEA----------------------------------------------------
D8LUR8_BLAHO/80-165-----------------TSFVKC--YHG----------------------------------------------------
D8LVG5_BLAHO/621-711-----------------FMGRPF--K..----------------------------------------------------
D8PY95_SCHCM/356-448-----------------HPGIKA--NLK----------------------------------------------------
D8SZS6_SELML/346-442-----------------GYAVRA--ALK----------------------------------------------------
D8TSG5_VOLCA/120-188-----------------HVAVPA--VVK----------------------------------------------------
D8U9V6_VOLCA/356-451-----------------GFSVRC--SYK----------------------------------------------------
E0VDU0_PEDHC/338-428-----------------TPAIAC--SYK----------------------------------------------------
E2LU78_MONPE/65-164-----------------VPGVEA--YRG----------------------------------------------------
E3K8A4_PUCGT/841-931-----------------FQGVPF--R..----------------------------------------------------
E3LF48_CAERE/802-892-----------------FLGVPH--L..----------------------------------------------------
E3N6Q4_CAERE/338-430-----------------TPAIQC--THR----------------------------------------------------
E3QQA8_COLGM/254-348-----------------AVHVKA--FRG----------------------------------------------------
E4WR67_OIKDI/341-431-----------------LACMAC--SYK----------------------------------------------------
E4YKA6_OIKDI/21-111-----------------FSGVPH--R..----------------------------------------------------
E4ZT07_LEPMJ/588-682-----------------QSGVKC--SIK----------------------------------------------------
E5A724_LEPMJ/8-89-----------------LTKL..--...----------------------------------------------------
E5RZ09_TRISP/385-475-----------------TPAVGC--AYK----------------------------------------------------
E6REF3_CRYGW/369-463-----------------LNGIRA--NVK----------------------------------------------------
E6ZPS6_SPORE/385-478-----------------QTSIKC--NVK----------------------------------------------------
E7LIV2_TRYCR/395-493-----------------YSVLRC--LHQ----------------------------------------------------
E7R3F7_PICAD/361-455-----------------QVAISC--SLK----------------------------------------------------
E7R8M3_PICAD/192-282-----------------CFFVDA--YKG----------------------------------------------------
E9AM77_LEIMU/797-887-----------------FDGVHA--R..----------------------------------------------------
E9AYL3_LEIMU/445-531-----------------GALSLV--FIG----------------------------------------------------
E9CGL5_CAPO3/770-860-----------------FFGVAN--R..----------------------------------------------------
E9CHA3_CAPO3/447-533-----------------QHGYKA--SYR----------------------------------------------------
E9DTZ0_METAQ/822-912-----------------FNGVPY--R..----------------------------------------------------
E9DVQ4_METAQ/243-337-----------------AVHVSG--FRG----------------------------------------------------
F0VGH1_NEOCL/360-452-----------------QFGIAC--SYR----------------------------------------------------
F0WM38_9STRA/1874-1964-----------------FMGTPF--K..----------------------------------------------------
F0X7S7_GROCL/267-361-----------------AVHVRA--FRG----------------------------------------------------
F0YFE5_AURAN/364-464-----------------RHAVNC--SVK----------------------------------------------------
F0YK20_AURAN/255-345-----------------FHGVPN--R..----------------------------------------------------
F1KVT9_ASCSU/180-270-----------------TPAIMC--AHK----------------------------------------------------
F1L0N9_ASCSU/243-330-----------------LLSVVC--TYD----------------------------------------------------
F2QNN8_PICP7/393-484-----------------QPGVNC--SLK----------------------------------------------------
F2T7L6_AJEDA/274-369-----------------AYHVKA--FRG----------------------------------------------------
F2U7M9_SALS5/352-446-----------------FAAVNC--TYK----------------------------------------------------
F2UEG8_SALS5/776-866-----------------FPGVPF--K..----------------------------------------------------
SSP1B_CAEEL/338-430-----------------TPAIQC--THR----------------------------------------------------
SPT16_SCHPO/813-903-----------------FNGVPF--R..----------------------------------------------------
POB3_SCHPO/353-446-----------------HAAVKC--SYK----------------------------------------------------
Q00W77_OSTTA/322-416-----------------GHAIRV--SHK----------------------------------------------------
SSRP1_ARATH/348-441-----------------GFAVKS--SLK----------------------------------------------------
Q0INI2_ORYSJ/396-486-----------------FNGVHG--R..----------------------------------------------------
Q23D83_TETTS/261-352-----------------QNCLKC--TLK----------------------------------------------------
RT106_CHAGB/265-365-----------------AVHVKA--FRG----------------------------------------------------
Q2HGG4_CHAGB/821-911-----------------FHGVPN--R..----------------------------------------------------
Q388G3_TRYB2/376-473-----------------NSVLRC--LYQ----------------------------------------------------
Q4CP43_TRYCC/660-750-----------------FEGVHA--K..----------------------------------------------------
Q4E2D9_TRYCC/326-410-----------------NEASYC--HIG----------------------------------------------------
SSRP1_CIOIN/341-432-----------------VQSITC--TYK----------------------------------------------------
Q4N2N7_THEPA/648-738-----------------FTGVPL--K..----------------------------------------------------
SPT16_USTMA/817-907-----------------FNGVPF--R..----------------------------------------------------
Q4Q5R4_LEIMA/337-430-----------------QSSMRC--LFH----------------------------------------------------
Q4UAH0_THEAN/359-451-----------------DSAISC--TYK----------------------------------------------------
SPT16_DICDI/824-914-----------------FYGVPN--V..----------------------------------------------------
RT106_CANAL/244-343-----------------LVMVNC--HKG----------------------------------------------------
Q5CIB9_CRYHO/343-434-----------------YHCIRC--SYK----------------------------------------------------
Q5CYL0_CRYPI/886-979-----------------FYGVPG--RAG----------------------------------------------------
RT106_DEBHA/279-380-----------------LVMVEA--YKG----------------------------------------------------
POB3_YARLI/385-478-----------------HAGVSC--SLK----------------------------------------------------
SPT16_YARLI/812-902-----------------FHGVPF--R..----------------------------------------------------
RT106_YARLI/218-309-----------------KFHVLA--HKG----------------------------------------------------
RT106_KLULA/205-294-----------------SFFVDC--HRG----------------------------------------------------
RT106_CANGA/204-297-----------------SFHVEC--HRG----------------------------------------------------
SPT16_CANGA/830-920-----------------FQGVPN--R..----------------------------------------------------
Q6RCP5_TETTH/797-887-----------------FYGSPS--R..----------------------------------------------------
RT106_ASHGO/199-288-----------------AFHVEC--HRG----------------------------------------------------
RT106_NEUCR/266-364-----------------AVHVKA--FRG----------------------------------------------------
Q8IL56_PLAF7/350-442-----------------QHGITC--SYR----------------------------------------------------
Q8SRJ1_ENCCU/303-393-----------------MRCLRC--AMK----------------------------------------------------

PF07289

Q295Y8_DROPS/17-373IFASVFDVYQLYQRTYLYRDLKL--RGA----------------------------------------------------
Q6PSU7_CHLRE/13-352LFASMQGVFRAYDSSRLYRDLKL--RGA----------------------------------------------------
BBS5_DANRE/7-341LFTSVIAVHRAYETSKMYRDLKL--RGA----------------------------------------------------
Q4QGM5_LEIMA/24-429LYATIRAVWNAYESTRVYRELRV--RSA----------------------------------------------------
Q4V3K1_DROME/1-343IFASVFDVYHLYQRTYLYRDLKL--RGA----------------------------------------------------
Q3SCX0_PARTE/4-324LYESLINIQRLYTQTMLHREIKV--QFA----------------------------------------------------
Q231T4_TETTS/4-299................VQRDLK.--RGA----------------------------------------------------
Q21626_CAEEL/8-358LFNTISSISRAYETTKMYRELKM--RGV----------------------------------------------------
Q86PG0_TRYCR/17-372.LFIVPTVWRAYESSRAYRELRM--RSS----------------------------------------------------
A2FLN7_TRIVA/10-343VFKFFEKALKNYQTSTLYREQRL--RSA----------------------------------------------------
P91582_CIOIN/3-345LFVTVMSVSKAYDSTKLYRDLKL--RGS----------------------------------------------------
Q17LJ5_AEDAE/5-340.FSAIFDIYRLYQASFLYRELKL--RSA----------------------------------------------------
Q4GYG4_TRYB2/17-368.LSAVRLVWRAYDTTRIYREVRL--RSC----------------------------------------------------

PF03531

SSRP1_XENLA/74-285-----------------FDYFKS--HFS----------------------------------------------------
SSRP1_ARATH/74-295-----------------SSFFQS--SYG----------------------------------------------------
POB3_SCHPO/73-300-----------------INVIKQ--NFD----------------------------------------------------
SSP1A_ORYSJ/74-294-----------------TNFMQK--NMG----------------------------------------------------
SSRP1_DROME/74-285-----------------GKFIKA--AYS----------------------------------------------------
SSP1B_CAEEL/73-286-----------------QSFTSS--NWS----------------------------------------------------

PF00638

RANG_HUMAN/37-161--------------EEELFKMRA--KLF----RFA---------------------------------------------
RBP2_HUMAN/2321-2442--------------EQVVFSHRA--KLY----RYD---------------------------------------------
YRB2_YEAST/204-327--------------EECIYQVNA--KLY----QLS---------------------------------------------
NUP2_YEAST/598-718--------------EVALFSQKA--KLM----TFN---------------------------------------------
RBP2_HUMAN/2024-2145--------------EKVLYSQRV--KLF----RFD---------------------------------------------
YRB1_YEAST/75-197--------------EEVLYKVRA--KLF----RFD---------------------------------------------
RBP2_HUMAN/2922-3043--------------EEILFKERA--KLY----RWD---------------------------------------------
RBP2_HUMAN/1183-1304--------------EEEFFCNRA--KLF----RFD---------------------------------------------

PF00568

LAS17_YEAST/13-124--------------NKIIDVTVA--RLY----IAY---------------------------------------------
Q9VAT0_DROME/31-140--------------.QTLNTAVV--QIY----KTE---------------------------------------------
O96607_DROME/1-107--------------.QPIFTCQA--HVF----HID---------------------------------------------
WASL_RAT/28-135--------------.VTMSSAVV--QLY----AA.---------------------------------------------
VASP_HUMAN/1-110--------------.TVICSSRA--TVM----LYD---------------------------------------------
HOME3_RAT/3-110--------------.QPIFSTRA--HVF----QID---------------------------------------------
ENAH_MOUSE/1-108--------------.QSICQARA--AVM----VYD---------------------------------------------
WASP_HUMAN/36-145--------------.LTLATAVV--QLY----LAL---------------------------------------------

PF06058

DCP1B_HUMAN/9-131.SLAALQRHDPYINRIVDVASQV--ALY----TFG---------------------------------------------
Q03633_PLAFA/135-262.CFKMLKSIDIYITEIIMKSCFV--TVY----KMK---------------------------------------------
DCP1A_MOUSE/24-146.SLAALKQHDPYITSIADLTGQV--ALY----TFC---------------------------------------------
Q90WT0_DANRE/4-126.SLAALQQHDPYIVKLLDVTGQV--ALY----TFN---------------------------------------------
DCP1_ARATH/12-134.NLTVLQRIDPYIEEILITAAHV--TFY----EFN---------------------------------------------
Q9W1H5_DROME/2-124.NLAAIKKIDPYAKEIVDSSSHV--AFY----TFN---------------------------------------------
Q9N363_CAEEL/5-130KNLAQLQKIDIAASKILDKMPFA--AIY----HID---------------------------------------------
Q8SU45_ENCCU/2-123.LMREIGRADPLLKDLLYVSSFA--SVY----R..---------------------------------------------
DCP1_SCHPO/4-125.NLQVLKFHYPEIESIIDIASHV--AVY----QFD---------------------------------------------

PF15410

E5RJ29_HUMAN/721-832-------------------YKSG--FLA----RKI----------------------HADMDGKKTPRG-----------
B3P8M6_DROER/1074-1185-------------------YKKG--YVM----RKC----------------------CYDSSFKKTPFG-----------
A8PYL1_BRUMA/388-498-------------------YKAG--WVV----RKY----------------------LFDRDGKRTPFG-----------
H2SLA8_TAKRU/516-627-------------------YKSG--FLV----RKV----------------------HADPDGKRTPRG-----------
B7QFP5_IXOSC/177-288-------------------YKKG--YVM----RKC----------------------CLDPGGKRTPLG-----------
I1BQ29_RHIO9/379-506-------------------CKEG--VVT----RKH----------------------LLENASQKA..K-----------
E3WPL5_ANODA/343-456-------------------YKKG--YVY----RKW----------------------CFEDNRKKIPFG-----------
D4YWC5_CAEEL/387-497-------------------YYSG--FLM----RKY----------------------VRETDGGKTPFG-----------
E3JSD7_PUCGT/1317-1461-------------------AKEG--ILQ----RKQ----------------------YWESKGKRH..K-----------
F1KU63_ASCSU/420-530-------------------YKAG--WVM----RKC----------------------VYDRDGSRTPFG-----------
YDYB_SCHPO/679-804-------------------VHPY--IKQ----GIL----------------------KFQSKESHKFRK-----------
F6X1S7_XENTR/10-124-------------------IYSL--WCK----NHL----------------------LICIFILTAPWG-----------
E9H3M8_DAPPU/491-615-------------------FKKG--YIM----RKC----------------------CMEPNGKRTPLG-----------
G4VKT4_SCHMA/511-627-------------------AQSS--IVT----SIN----------------------STNTMTSSFSTS-----------
E5SKG2_TRISP/325-435-------------------YKKG--WVM----RKC----------------------VVDKGGKKVPFG-----------
I1CBT7_RHIO9/688-826-------------------YKEG--IVI----RKH----------------------LLENASQKA..K-----------

PF00169

PSD1_HUMAN/757-869------------------VYKHG--ALV----RKV------HA--DPD..............CRKTPRG-----------
O00886_DICDI/1008-1093------------------FVTEG--ALT----LKK------..--........................-----------
UNC89_CAEEL/349-451------------------IIRHD--AFQ----VWE------..--.......................G-----------
O02134_CAEEL/257-375------------------LKSLG--LLR----LQT------EC--DVFT............YNRKKKAK-----------
O08724_RAT/33-133------------------VRLCG--HLR----KQK------..--........................-----------
YB35_SCHPO/255-349------------------QHMSG--YLK----KWT------..--......................NY-----------
O23559_ARATH/656-764------------------ADFEG--WLS----ILS------W.--.....................KGR-----------
TRIO_HUMAN/1480-1591------------------IESQG--ELI----LQE------SF--QV................WDPKTL-----------
TRIO_HUMAN/2158-2271------------------IVAQG--KLL----LQD------TF--LV...............TDQDAGL-----------
PLEK_HUMAN/5-101------------------RIREG--YLV----KKG------..--......................SV-----------
PLEK_HUMAN/245-347------------------IIKQG--CLL----KQG------..--......................HR-----------
MCF2_HUMAN/705-809------------------GHKKG--ATK----MKD------..--......................LA-----------
OSBP1_RABIT/91-183------------------SAREG--WLF----KWT------..--......................NY-----------
PLCG1_HUMAN/33-142------------------TVMTL--FYS----KKS------..--.......................Q-----------
DYN1_RAT/520-625------------------VIRKG--WLT----INN------I.--.....................GIM-----------
UN104_CAEEL/1461-1558------------------VSKKG--YMN----FLE------..--......................EK-----------
TEC_MOUSE/5-111------------------TILEE--ILI----KRS------QQ--...................KKKTS-----------
ARBK1_HUMAN/559-652------------------CIMHG--YMS----KMG------..--.....................NPF-----------
SOS_DROME/481-588------------------FIRED--SLS----KLG------..--......................SG-----------
RGRF1_RAT/23-129------------------GTRKG--YLS----KRS------..--......................SD-----------
RGRF1_RAT/457-582------------------FVRQG--SLI----QVP------MS--EKGKI..........NKGRLGSLS-----------
GPRK1_DROME/558-657------------------CILHG--YIK----KLG------..--.....................GSF-----------
BEM3_YEAST/635-741------------------NVKDG--SLL----LRR------PK--....................TLTG-----------
KIF1A_MOUSE/1581-1678------------------VSKKG--YLH----FLE------..--......................PH-----------
PAC1_CAEEL/612-726------------------VARQT--WVK----HQE------IA--L..................GKSGK-----------
MIG10_CAEEL/457-566------------------PEMEG--FLY----LKS------..--......................DG-----------
GRP1_CAEEL/262-380------------------AEREG--WLF----KQS------SN--...................PLFSG-----------
YOTB_CAEEL/36-131------------------LVGEG--VLV----KMC------..--........................-----------
CRAC_DICDI/23-122------------------VSYSS--IMK----KAG------..--......................GN-----------
OPY1_YEAST/216-318------------------QVCSG--ILY----TKV------KK--...................KKLFN-----------
SIP3_YEAST/310-423------------------PEKSG--WLY----MKT------QV--....................GKPT-----------
YHT1_YEAST/194-304------------------RIHSD--LVH----RSD------..--.......................Q-----------
YSP1_YEAST/309-421------------------KGLSG--WLY----MKT------TV--...................GHDPK-----------
BEM2_YEAST/1832-1948------------------KKIGG--FFR----RPF------SI--...................GGFNT-----------
BOI2_YEAST/769-887------------------ADFSG--WMS----KKG------..--.....................SGA-----------
SLM1_YEAST/469-581------------------EIKSG--FLE----RRS------..--......................KF-----------
RHG25_HUMAN/47-151------------------PIKMG--WLK----KQR------..--......................SI-----------
TG325_CAEEL/387-505------------------TIRCG--DLE----RSE------ND--EPA..............EKVVKPK-----------
BUD4_YEAST/1303-1413------------------IYKEG--YLL----QDG------..--.....................GDL-----------
ASK10_YEAST/482-720------------------CIKAG--YFL----KKS------..--......................EL-----------
CTRO_MOUSE/1470-1589------------------LHLEG--WMK----VPR------N.--....................NKRG-----------
BMX_HUMAN/5-111------------------SILEE--LLL----KRS------QQ--...................KKKMS-----------
BUD4_CANAL/1577-1685------------------NYFEG--YLH----QEG------..--......................GD-----------
CA120_YEAST/76-204------------------RYHEG--VFL----ILQ------DL--N.................NNGTHA-----------
VAV_RAT/403-504------------------PKIDG--ELK----ITS------..--......................VE-----------
KRAC_DICDI/6-99------------------IKHEG--FLT----KEG------..--......................GG-----------
RGRF2_MOUSE/23-133------------------GTKRG--FLS----KKA------..--......................AE-----------
MYO10_BOVIN/1207-1304------------------ALKQG--WLH----KKG------GG--...................SSTLS-----------
SIF1_DROME/849-955------------------LSVKK--WLL----RKK------HQ--...................IELAR-----------
SIF1_DROME/1672-1793------------------LNISD--FLG----KIK------..--.......................K-----------
P91678_DROME/205-307------------------STKYG--QLQ----RIV------P.--....................KRLF-----------
MPRIP_MOUSE/387-482------------------NFKKG--WLT----KQY------..--.......................E-----------
FGD1_HUMAN/591-689------------------LIKEG--HIL----KLS------..--......................AK-----------
FGD1_HUMAN/822-921------------------SVICS--FLH----YME------..--......................KG-----------
APSA_EMENI/1394-1504------------------TMIGE--FLW----KYT------RR--A..................VSGEI-----------
NUM1_YEAST/2574-2683------------------TVIGE--YLF----KYY------PR--...................LGPFG-----------
SPTCB_DROME/2148-2259------------------EGHEG--YVT----RKH------EW--DS................TTKKAS-----------
SPTB2_HUMAN/2198-2307------------------AQMEG--FLN----RKH------EW--EA................HNKKAS-----------
SOS2_MOUSE/443-545------------------FIMEG--PLT----RIG------..--........................-----------
GRB7_MOUSE/229-341------------------PEIQG--FLQ----LRG------SG--....................RGSG-----------
NRKB_TRYBB/332-429------------------VTHRG--HVN----KLG------..--.....................GGN-----------
ITK_MOUSE/5-117------------------ILLEE--QLI----KKS------QQ--...................KRRTS-----------
BTK_HUMAN/4-133------------------VILES--IFL----KRS------QQ--...................KKKTS-----------
SKG3_YEAST/91-221------------------RYHYG--IFL----ILH------DL--K.................TDGTPA-----------
ATG26_YEAST/239-336------------------VKMSG--NLN----IRT------..--.......................K-----------
TUS1_YEAST/716-877------------------LVLSG--TVY----KKR------..--......................DL-----------
3BP2_MOUSE/27-130------------------VAKAG--YLH----KKG------G.--....................TQLQ-----------
YP091_YEAST/114-266------------------TALQE--QIL----QRT------..--.......................D-----------
ANI2_CAEEL/893-1005------------------VEYRG--FLY----LFD------ER--....................SPNG-----------
SHK2_SCHPO/24-125------------------IIRSG--WVM----LKE------D.--.....................KMK-----------
RGA2_SCHPO/720-836------------------AQKEG--VLL----KYI------..--.......................E-----------
CNT6_SCHPO/527-632------------------IFKEG--LLL----VFG------AT--ELG..............TDLAMVS-----------
YDG1_SCHPO/549-677------------------VFKLG--ILI----QNE------KV--....................RKDR-----------
OSH2_YEAST/290-386------------------PTYKG--FLK----KWT------..--......................NF-----------
SKM1_YEAST/4-118------------------VKKEG--WIS----YKV------D.--.....................GLF-----------
ARHG5_HUMAN/1391-1502------------------LVKSG--ELT----ALE------FS--A.................SPGLRR-----------
AKP13_HUMAN/2232-2333------------------LVRDG--SVF----LKN------..--.......................A-----------
ABR_HUMAN/302-459------------------LVKDG--FLV----EVS------..--........................-----------
GRB10_HUMAN/291-399------------------PEIQG--FLH----VKE------..--......................LG-----------
PLD1_HUMAN/220-328------------------KGIEG--MIM----KRS------GG--HRIPG..........LNCCGQGRA-----------
ROCK1_HUMAN/1119-1212------------------SRIEG--WLS----VPN------R.--....................GNIK-----------
GAB1_HUMAN/6-116------------------VVCSG--WLR----KSP------PE--....................KKLK-----------
SNTB1_HUMAN/323-433------------------IRHLG--WLA----EKV------P.--.....................GES-----------
ARHG7_HUMAN/480-578------------------VTYMS--QVL----IQC------..--......................AG-----------
ACAP1_HUMAN/266-360------------------LVMEG--HLF----KRA------..--.....................SNA-----------
ARHG6_HUMAN/450-548------------------VIFMS--QVM----VQY------..--......................GA-----------
KPCD1_HUMAN/423-541------------------VMKEG--WMV----HYT------..--......................SK-----------
CYH1_HUMAN/261-377------------------PDREG--WLL----KLG------..--.....................GGR-----------
Q17777_CAEEL/241-343------------------PILEG--VLS----VQH------..--.....................VEE-----------
AKT1_CAEEL/16-118------------------VVIEG--WLH----KKG------..--......................EH-----------
Q18284_CAEEL/578-673------------------LIRQS--EVM----KQT------..--........................-----------
Q18420_CAEEL/249-346------------------MEKSG--YWT----QLT------..--.....................DSR-----------
UN112_CAEEL/406-507------------------ADYLK--YMK----PKK------..--.....................LAA-----------
Q20151_CAEEL/20-135------------------RLKDG--EIL----KYT------S.--.....................GIF-----------
Q21025_CAEEL/833-940------------------GRMNG--WLR----VYR------D.--.....................DMT-----------
GAP1_CAEEL/412-507------------------VFKFG--NLQ----QVD------RS--R..................LAWKK-----------
Q23419_CAEEL/18-114------------------SAICG--YLH----RIE------V.--....................RSIG-----------
Q23980_DROME/1145-1252------------------VEIQG--SLE----RKH------GL--QS................GGKKAP-----------
Q24284_DROME/15-132------------------MLERG--TIV----TKL------..--.....................YGK-----------
IRS1_CHLAE/13-115------------------VRKVG--YLR----KPK------..--........................-----------
SNTA1_RABIT/294-401------------------IKQIG--WLT----EQL------..--.......................P-----------
Q29517_RABIT/10-119------------------VLLKG--SQL----LKV------..--......................KS-----------
VAV_CAEEL/471-598------------------VNLDG--EVK----MAE------S.--....................TLTQ-----------
SECG_DICDI/785-895------------------VEKKG--WLT----KQG------..--......................GR-----------
RDCII_DICDI/354-461------------------IVKEG--WLK----RKS------I.--....................SSSN-----------
RGPS1_HUMAN/432-543------------------PTMEG--PLR----RKT------LL--K.................EGRKPA-----------
ARHGG_HUMAN/502-620------------------LLKRG--ELF----LVE------ET--...................GLFRK-----------
RHG26_CHICK/266-369------------------YTMEG--YLY----VQE------K.--.....................RHF-----------
TIAM1_MOUSE/434-547------------------VRKAG--ALA----VKN------FL--VHKK............NKKVESAT-----------
TIAM1_MOUSE/1261-1395------------------DLSMG--DLL----LHT------SV--IWLN............PPASLGKW-----------
AKT2_MOUSE/6-108------------------VIKEG--WLH----KRG------..--......................EY-----------
ARHG2_MOUSE/474-572------------------LIHEG--CLL----WKT------..--.......................A-----------
VAV2_MOUSE/401-502------------------PKIDG--ELK----VRS------..--......................IV-----------
PLCL1_RAT/115-224------------------FMQAG--CEL----KKV------..--......................RP-----------
PLCD4_RAT/17-124------------------LMQKG--TMM----RKV------..--......................RT-----------
SH2B1_RAT/247-376------------------IQREE--LLS----FMG------AE--EAAPDPAGVGRGGGAAGLTSGGGG-----------
PHLB1_RAT/722-824------------------KVCRG--YLI----KMG------..--......................GK-----------
Q63629_RAT/255-358------------------YLKEG--YME----KTG------..--.....................PKQ-----------
RASA2_RAT/604-704------------------HLKEG--EMY----KRA------QG--...................RTRIG-----------
DGKH_MESAU/60-152------------------SIKEG--QLL----KQT------..--......................SS-----------
ARHG8_HUMAN/387-501------------------LLCHG--ELR----SKS------..--........................-----------
CAPS1_MOUSE/520-622------------------MKHSG--YLW----TIG------..--.....................KNV-----------
AKT1_DROME/107-211------------------VVKEG--WLM----KRG------..--......................EH-----------
AFAP1_CHICK/154-249------------------AKICA--FLL----RKK------..--.......................R-----------
AFAP1_CHICK/348-441------------------VPTCG--YLN----VLS------..--........................-----------
Q91492_TORCA/276-383------------------LRHVG--WLT----EQV------..--.......................S-----------
MUG79_SCHPO/1044-1158------------------WHRRG--MIS----YKK------MV--LS................KNNRWV-----------
Q93569_CAEEL/7-101------------------LPTNG--VMK----KWT------..--......................NY-----------
SNT1_CAEEL/228-340------------------VRHMG--WIA----EQV------S.--.....................ENG-----------
FERM2_HUMAN/381-476------------------VFKPK--KLT----LKG------..--........................-----------
DOK1_HUMAN/4-119------------------AVMEG--PLF----LQS------Q.--.....................RFG-----------
ANLN_DROME/1107-1230------------------VEYKG--FLT----MFE------D.--.....................ISG-----------
DOS_DROME/4-113------------------TFYEG--WLI----KSP------PT--....................KRIW-----------

PF15413

A0CUJ8_PARTE/105-200--------------------IEG--FLM....KKS------------------------------PH.W-----------
A7SI59_NEMVE/523-628--------------------KCG--YLEMKLPRKQ------------------------------RKVT-----------
C4Y4Q1_CLAL4/136-269--------------------SKP--VIK....SSG------------------------------SK..-----------
C6HG43_AJECH/87-193--------------------KEG--YVR....CKE------------------------------DK.F-----------
D7KQC6_ARALL/95-227--------------------VAG--IMY....KWV------------------------------NY..-----------
E5T4G3_TRISP/39-138--------------------MKG--YVW....HQR------------------------------KR..-----------
E9C7L7_CAPO3/130-226--------------------IHG--WLN....KLG------------------------------AKGL-----------

PF15409

B6JVE7_SCHJY/144-232----------------------G--ILL----KKR-------------------------------RKK-----------
C5K2A6_AJEDS/215-303----------------------G--ILQ----KRR-------------------------------RKR-----------
E3RG70_PYRTT/221-309----------------------G--VLQ----KKR-------------------------------RKR-----------
H1VVI1_COLHI/216-304----------------------G--ILH----KRR-------------------------------RKK-----------
C8VHJ7_EMENI/110-198----------------------G--LLL----KRR-------------------------------RKR-----------
Q6C4Y2_YARLI/155-243----------------------G--ILL----KKR-------------------------------RKK-----------
G3B6N0_CANTC/156-243----------------------G--VLL----KKR-------------------------------RKK-----------
A3LTM2_PICST/192-279----------------------S--ILL----KKR-------------------------------RKK-----------
G8YKE6_PICSO/214-301----------------------S--VLL----KKR-------------------------------RKV-----------
H8X718_9ASCO/198-285----------------------S--VML----KKR-------------------------------RKK-----------
F2UGB6_SALS5/1490-1577----------------------G--WFV----KKA-------------------------------HKR-----------

PF15406

B6K769_SCHJY/110-235----------------NYYYRKR--FYG----SLTETDKTATESNPSNGDEEGEGVEEPKEAPAPSSRD-----------
G2X9M4_VERDV/99-204----------------NFIYSKQ--FFW----FGT.DA...VE..PSTLSHYRRS.....EKNVEAG..-----------
E3Q3I3_COLGM/92-197----------------NFIYSKE--FFW----FGN.DA...VE..SKSLSSYLKS.....E...KSAET-----------
G4MXJ0_MAGO7/107-216----------------NFIYTKR--FFW----FGT.DA...VE..PKNLASFLKS.....EKSTESA..-----------
G2PZQ3_THIHA/101-208----------------NFLYTKQ--LFW----FGS.......E..PVDLKSIASF...KADKVTDV...-----------
A6STK7_BOTFB/10-118----------------SFIFQKK--HFW----FGS.EP...VE..HKNLSSYLRG..EKPDV.......-----------
G4UAB8_NEUT9/95-202----------------NLLFSKK--FFW----FGN.EA...VD..LKSISSFKAD......K...AADV-----------
B2A9W4_PODAN/92-199----------------NFLYTKT--LFW----FGS.......E..PVNVKEIASF...KAEKAA....D-----------
F9G078_FUSOF/114-219----------------NLIPSKE--FFF----FGT.EA...VE..PKALSHYLKS.....E...KSAET-----------
H0EZ07_GLAL7/83-191----------------SFIFQKK--FFW----FGT.DA...VE..TKALSSYLRG..EK...DTAA...-----------
G0SHV9_CHATD/90-197----------------NFLYNKQ--FFW----FGT.DA...VD..LKAISSFKAD......KVADV...-----------
F0XAK4_GROCL/91-200----------------KFLYTKK--FFW----FGN.DA...LS..AKDLAAYVKS.........EKATD-----------
H6BUU9_EXODN/90-198----------------KFFFTKH--YFW----LSDEPL...TS..ESLASFLRSE..........KPEG-----------

PF15408

B6JZV3_SCHJY/839-941---------------------EG--YLY----VDE---------------------------------------------
MID1_SCHPO/805-907---------------------EG--YLY----RLE---------------------------------------------

PF15411

SCD1_SCHPO/427-542------------------LQYFG--QLL----VWD-------------------------------VVN-----------
B6JVU8_SCHJY/389-504------------------LKHFG--SLL----VWE-------------------------------IVP-----------
E6ZVA8_SPORE/481-616------------------IKTFG--LLL----LSD-------------------------------VFM-----------
D5GGD7_TUBMM/420-541------------------LEHFG--ELL----LHG-------------------------------QFS-----------
G1XAU9_ARTOA/438-556------------------IDHFG--DLL----LYG-------------------------------QFT-----------
I1S1B1_GIBZE/431-552------------------VEQFG--KLL----LHG-------------------------------VYG-----------
G7E2X4_MIXOS/391-510------------------ISTFG--NLL----LED-------------------------------TFM-----------
B6QQH4_PENMQ/385-509------------------VEGFG--ELL----RFG-------------------------------TFT-----------
G0T0J6_RHOG2/494-613------------------INSFG--DLL----LQE-------------------------------TFV-----------
D1MYR8_9HYPO/434-550------------------VESFG--KLL----LHG-------------------------------VYG-----------
F7VM13_SORMK/436-557------------------VDNFG--SLL----LHG-------------------------------VYT-----------
E9CVX1_COCPS/381-505------------------VEAFG--ELL----RFG-------------------------------TFI-----------
E3QQB9_COLGM/431-552------------------VEQFG--RLL----MHG-------------------------------VYT-----------
Q2GPG0_CHAGB/418-539------------------VDHFG--DLL----MHG-------------------------------VYT-----------
F0X7S3_GROCL/410-531------------------VEHFG--KLL----LHG-------------------------------VHT-----------
G4NAK1_MAGO7/442-563------------------VDQFG--SLL----LHG-------------------------------VHT-----------
F2PSL1_TRIEC/255-378------------------LDQFG--DLL----RYG-------------------------------TFT-----------
G3JRH1_CORMM/592-713------------------VEQFG--CLL----LHG-------------------------------IYG-----------
F9X6S4_MYCGM/383-505------------------VAQFG--ELL----LYG-------------------------------TFT-----------
B2VWD7_PYRTR/471-593------------------IEGFG--DLL----LHG-------------------------------QYT-----------
I1C104_RHIO9/375-487------------------IDNFG--NLL----HHD-------------------------------KLM-----------
Q6CBW7_YARLI/467-578------------------LEDFG--DLL----YMD-------------------------------HLT-----------
H6BPC6_EXODN/386-507------------------IAALG--ELL----LHG-------------------------------TFN-----------
I1BLT9_RHIO9/200-314------------------IDGFG--SLL----LHD-------------------------------KLS-----------
Q5KFX7_CRYNJ/908-1028------------------VDSLG--QLR----LFD-------------------------------ILT-----------
Q4P6E0_USTMA/491-614------------------IEHFG--PLA----LHD-------------------------------LLN-----------
F4PBV1_BATDJ/346-455------------------LEDFG--NLL----LTD-------------------------------KFY-----------
I1C1Q1_RHIO9/363-476------------------LEVYG--NLL----LQD-------------------------------KLM-----------
D8Q1A2_SCHCM/269-391------------------LSDLG--PLQ----MYD-------------------------------LLT-----------
A5DJC8_PICGU/472-589------------------VKEMG--ELL----HHG-------------------------------IIG-----------
A8N8V8_COPC7/386-508------------------LSDLG--PLQ----MYD-------------------------------LLS-----------
F4RFQ9_MELLP/828-937------------------LTDFG--SLK----LHD-------------------------------RIQ-----------
G3J9K1_CORMM/454-571------------------FERFG--QLR----LYG-------------------------------TLH-----------
G9NM35_HYPAI/326-439------------------FDRFG--QLR----LCG-------------------------------TLR-----------
G1X4D9_ARTOA/384-499------------------VSRFG--KLR----LFG-------------------------------TIK-----------
F9X5J1_MYCGM/455-563------------------FDRFG--KLL----LHG-------------------------------LVS-----------
Q7PLZ7_ANOGA/417-526------------------LEQYG--RLL----LDG-------------------------------DLN-----------
C4JQ35_UNCRE/310-422------------------FDRFG--KLK----LHG-------------------------------KLK-----------
C5P3B7_COCP7/314-426------------------FDRFG--KLR----LHG-------------------------------RLK-----------

PF14593

Q7PUX5_ANOGA/445-547----SLWQPFAD...GDEILKYG--IIY----KR.------------------------------.KGL-----------
D6WGV3_TRICA/369-471----SVYHELVE...GNLILKQG--IVE----KR.------------------------------.KGI-----------
E2A088_CAMFO/460-562----NQWDTFVE...GNLILKQG--FVN----KR.------------------------------.KGL-----------
Q76BX2_ASTPE/464-566----CKWHRFVE...GNLILKMA--SID----KR.------------------------------.RGL-----------
PDPK1_MOUSE/449-551----NPWHQFVE...NNLILKMG--PVD----KR.------------------------------.KGL-----------
A8XME2_CAEBR/317-419----NDYHQLLD...GYLVLKQG--ILH----KK.------------------------------.RGF-----------
F0ZQF1_DICPU/137-240----QQWNSFLLP.NDEIILACS--LTL----KR.------------------------------.SGL-----------
Q172S2_AEDAE/402-506----DMWHSFAE...GELILKKG--FVN----KR.------------------------------.KGA-----------
A8PPP4_BRUMA/323-425----HKYHRFVE...GNLIIKSG--LLD----KK.------------------------------.KGL-----------
E3MA10_CAERE/460-562----NPFHIFTG...NMLILKQG--YLE----KK.------------------------------.RGL-----------
A8X5P7_CAEBR/474-576----NEWRVYTP...QNLILKYG--YLN----KK.------------------------------.RGL-----------
D2VK59_NAEGR/353-456----EKYSLFLLK..NESVVYTR--KVV----KR.------------------------------.RKL-----------
B5DR97_DROPS/703-805----DKWHVFAD...GEVILKKG--FVN----KR.------------------------------.KGL-----------
F0W8Q4_9STRA/392-494----SLWNRFLLD..DELIKMCG--LIS----KR.------------------------------.KGL-----------
D8QMJ5_SELML/388-489----EPWQKFLFE..GETILASS--RVR----KF.------------------------------.RKL-----------
C1KFX1_9CNID/346-448----TKWDQFVE...GHAIIKMG--IIE----KR.------------------------------.KGL-----------
E9CBD6_CAPO3/483-586----SQWHRFVQV..DELIIKTG--IIH----KR.------------------------------.KGL-----------
C4QMA7_SCHMA/364-466----NPFNRFVR...GRLILKQG--ILF----KR.------------------------------.RGL-----------
F0ZSM2_DICPU/404-506----KKWSNLINK..DETIVCQG--LVW----KR.------------------------------.KGF-----------
E3WL97_ANODA/469-571----AMWEPFAE...GEKILKLG--YVH----KR.------------------------------.KGL-----------
B0X1B0_CULQU/404-508----DIWHPFTN...DELIIKRG--FVN----KR.------------------------------.KGA-----------
E5SYD2_TRISP/403-505----NIYDQFVE...GNLIIKSG--YLE----KR.------------------------------.KGL-----------
Q9XF68_ORYSA/242-348----SRWQDFLEP..GESVVLIS--KLK----KI.------------------------------.NKL-----------
E4XZ21_OIKDI/382-502----NRWATFVDD..DELIIKLG--YMY----KK.------------------------------.RGL-----------
A2DAR5_TRIVA/371-472----SHMEQFLLS..GEHIIYEG--DIQ----KR.------------------------------.VFL-----------
F0ZMQ8_DICPU/111-220----NRSRAFTSPELPKPSLLQG--YLK----KQG------------------------------EKGI-----------
Q9BMX6_APLCA/717-819----NPFHQFVE...DNLILRQG--FVD----KR.------------------------------.KGL-----------
D3BJW1_POLPA/401-501----IVWNRFLLP.NNEIILAIA--TLE----KK.------------------------------.TGL-----------
E9H687_DAPPU/410-512----PQWHNLVD...KKLILKQG--LID----KR.------------------------------.KGL-----------
D8M3A3_BLAHO/75-180----EAIERVLGE..GERCRYAS--IVV----HV.------------------------------.HQS-----------
F2U695_SALS5/410-513----SPWHSFLNE..GELIIKTG--LVD----KR.------------------------------.RGL-----------

PF12814

A4HEV0_LEIBR/313-423----------LLSSTLEKLKVGD--WFY----KWT-------------------------------RVN...........
A6RUJ3_BOTFB/967-1099----------TVVDAIAQTMVGE--WMF----KYV-------------------------------RRR..KSFGVSDHD
A8NC45_COPC7/1477-1596----------TVIHAITQTMIGE--FLY----KYT-------------------------------RKTIGKGH......
A8Q694_MALGO/495-613----------EVADAIIQCMRGE--WLY----KYA-------------------------------PQR..RLLG.....
B2VUN2_PYRTR/943-1083----------SVVDAIAAAMIGE--FMW----KYV-------------------------------RKR..KAFGGPETS
B6JVF8_SCHJY/810-930----------ITEECIAWVTQGS--YMH----KRI-------------------------------RGF......SR...
B8M115_TALSN/905-1052----------NVVDAIAQTMVGE--WMF----KYV-------------------------------RRR..KSFGMSDNK
C0SAF8_PARBP/1004-1151----------SVVDAIAQTMVGE--WMW----KYV-------------------------------RRR..KSFGMTENN
C1H210_PARBA/1232-1352----------RMIQAITQTMIGE--FLW----KYT-------------------------------RRT.VRPDL.....
C5DMW2_LACTC/3405-3524----------SIIPALTQTVIGE--YLH----KYY-------------------------------RRL.GAFSQ.....
C5DY62_ZYGRC/2362-2478----------SIIPALTQTVIGE--YLY----KYY-------------------------------QVF.GVGG......
C5FCE3_ARTOC/935-1060----------SVVDAIAQTMVGE--WMY----KYV-------------------------------RRR..KSFGMSESS
C5FWA2_ARTOC/1261-1380----------RMIQAITQTMIGE--YLW----KYT-------------------------------RKP.GRPEF.....
C5MCT5_CANTT/3605-3725----------SMIPAITQVVIGE--YLF----KYY-------------------------------RRL.GPFKV.....
Q0TVR4_PHANO/1388-1507----------RMIQAITQTMIGE--YLW----KYT-------------------------------RKT.GREGL.....
Q23GA5_TETTS/12-127----------QIIQNFKMMTSGA--FFI----KHH-------------------------------RFT...........
Q2TZB5_ASPOR/919-1066----------SVVDAIAQTMVGE--WMF----KYV-------------------------------RRR..RSFGGVGEA
Q4P966_USTMA/1901-2021----------AIIHAITQTMIGE--YMY----KYT-------------------------------RKSMGRGGH.....
Q4Q999_LEIMA/446-556----------LLSATLEKLQLGD--WFY----KWT-------------------------------RIK...........
Q4YWB8_PLABA/90-206----------YLPVCIEKMKEGE--YVY----KWN-------------------------------NNN...........
Q5KMI7_CRYNJ/1724-1843----------QTIHAITQTMIGE--YLY----KYT-------------------------------RRAVGKGQ......
Q5MG88_TOXGO/125-237----------DTREALQTLAEGS--FLL----KWC-------------------------------KTN...........
Q6CF84_YARLI/3022-3141----------NMIAVVTQTMIGE--YLF----KYT-------------------------------RRF.GSVSG.....
Q6FVK1_CANGA/1920-2038----------TMIPALTQTVIGE--YLY----KYY-------------------------------PKL.GHIGG.....
Q9C2A3_NEUCS/971-1096----------SVVDAIAKTMVGE--WMF----KYV-------------------------------RRR..KSFGMTDK.
MCP5_SCHPO/840-959----------SVNKLMKHVMMGN--EMM----KYP-------------------------------RSE..SFKM.....

PF15405

A7TQH3_VANPO/867-996------------------IKHEG--ILS----RKE-----------------------------LSKSD-----------
A8QCG1_MALGO/650-787------------------LVFKN--ALK----KRG-----------------------------TQSDS-----------
B0Y407_ASPFC/727-851------------------MLTKM--AFR----KAP-----------------------------TDS..-----------
B2ATW7_PODAN/781-899------------------MVYKT--QFK----KTP-----------------------------TET.T-----------
B6HR54_PENCW/741-867------------------MLMKM--SFK----KTT-----------------------------ADS..-----------
B6K4Z0_SCHJY/799-929------------------LIFKG--PLK----KKN-----------------------------AGSAS-----------
B6K7Q5_SCHJY/658-790------------------LIFKG--TLR----RKT-----------------------------SGSSY-----------
C5DFA7_LACTC/775-905------------------IKHEG--VLS----RKE-----------------------------LTKSD-----------
D5G4S8_TUBMM/733-864------------------LIFKG--SLK----KSA-----------------------------TQDGG-----------
D6RNQ8_COPC7/510-650------------------MVYKG--TLN----KRD-----------------------------G....-----------
E3KTU1_PUCGT/826-974------------------LIYKG--QLK----KRG-----------------------------GSGSD-----------
E4ZWW2_LEPMJ/934-1064------------------LVFKG--TLK----KTP-----------------------------TEA.T-----------
E6RBG3_CRYGW/694-836------------------LVHKG--PLK----RRG-----------------------------GNREE-----------
E7R275_PICAD/758-897------------------LLYQC--VLK----KRN-----------------------------YQDKE-----------
F0XUN9_GROCL/777-902------------------LVFKS--QLK----KSP-----------------------------ADP..-----------
F2QX04_PICP7/790-895------------------YLHKC--ELK----KRN-----------------------------YQDKE-----------
F2Z621_KLULA/763-894------------------IKHEG--LLS----RKE-----------------------------ITKNE-----------
F4PBC1_BATDJ/457-572------------------L....--.ML----KRS-----------------------------GNDM.-----------
F4RK51_MELLP/486-612------------------LIFKG--QLK----KRG-----------------------------GGGSD-----------
F8P447_SERL9/728-864------------------LVYKG--ALN----KRG-----------------------------GGQGD-----------
F9X7Y7_MYCGM/750-877------------------LIFKS--ALK----KTP-----------------------------TAE..-----------
G0V5Q3_NAUCC/849-979------------------IKHEG--ILS----RKE-----------------------------LSKAD-----------
G1XBW2_ARTOA/827-954------------------LIFKG--SLK----RSP-----------------------------TDTGT-----------
G2WW94_VERDV/764-891------------------IVFKS--QLR----KTP-----------------------------HDS..-----------
G2YJS9_BOTF4/50-174------------------LIHKG--PLK----KTP-----------------------------TDP..-----------
G4NKJ4_MAGO7/790-913------------------LVFKS--QMK----KSP-----------------------------TDP..-----------
G7DY91_MIXOS/924-1056------------------MIYKG--PLK----KRG-----------------------------GTQSE-----------
G8BPI3_TETPH/796-928------------------IKHEG--ILF----RKE-----------------------------ISKTD-----------
G8ZUV3_TORDC/841-971------------------IKHEG--VLS----RKE-----------------------------LSKSD-----------
G9N7F4_HYPVG/769-895------------------LVFKS--QFK----KSP-----------------------------TDP..-----------
H0GGJ3_9SACH/518-648------------------IKHEG--LLS----RKD-----------------------------VNKTD-----------
H1UV38_COLHI/767-893------------------LVFKS--QLK----KTP-----------------------------QDA..-----------
I1BJ67_RHIO9/768-907------------------IIMKG--TWK----KSS-----------------------------GSESS-----------
I1BQA0_RHIO9/235-373------------------LLMKG--RMK----RKG-----------------------------NTSSE-----------
I1C1X6_RHIO9/740-879------------------IIMKG--TWK----KSS-----------------------------GSESS-----------
I1CB67_RHIO9/496-608------------------IVLKG--SLK----KKV-----------------------------LNNVS-----------
Q4P7K1_USTMA/348-484------------------LVFKG--PLK----KRG-----------------------------GTQSE-----------
Q6CDY6_YARLI/831-954------------------IIFKG--SLK----KRT-----------------------------QDT.Q-----------
Q752J0_ASHGO/816-948------------------IMHEG--LLS----RKE-----------------------------LTKSD-----------
Q7SHY5_NEUCR/784-908------------------LVYKA--QFK----KSP-----------------------------TEN..-----------
RGF2_SCHPO/670-802------------------LIFKG--VVK----LKA-----------------------------SSYSN-----------
RGF1_SCHPO/844-972------------------LIFKG--PLK----KRS-----------------------------AGSTS-----------

PF08458

Q7XC71_ORYSJ/259-367----------------------G--ELL----KRT-------------------------------RKG-----------
Q8VY20_ARATH/362-472----------------------C--ELL----KRT-------------------------------RKG-----------
Q8W4K5_ARATH/378-487----------------------T--ELL----KRT-------------------------------RGG-----------
Q8S7E8_ORYSJ/138-241----------------------T--TLR----VRL-------------------------------PCG-----------
O23578_ARATH/260-368----------------------G--ELM----QCA-------------------------------RNG-----------
Q8S7Q8_ORYSJ/273-375----------------------T--ILR----VCL-------------------------------PCG-----------
Q9LKC2_ARATH/340-450----------------------C--ELL----KRT-------------------------------RKG-----------
Q9FGL4_ARATH/282-390----------------------G--ELV----QCA-------------------------------RNG-----------
Q949B7_ORYSA/260-379----------------------G--TLL----KRS-------------------------------RKG-----------

PF15404

A6ZY67_YEAS7/1032-1228--------------------QKG--PLY----QKP-------------------------------HKH-----------
C5DN47_LACTC/1032-1239--------------------QNG--VLY----QKA-------------------------------RKH-----------
G0WGW0_NAUDC/1002-1189--------------------QKG--ILY----QKP-------------------------------KKH-----------
G0V9Z1_NAUCC/1010-1197--------------------QKG--ILY----WKP-------------------------------KKH-----------
C5DSP7_ZYGRC/1057-1243--------------------HRG--VLH----QKP-------------------------------KKH-----------
G8JS70_ERECY/1003-1198--------------------HQG--ILY----QKP-------------------------------RKH-----------
G8ZX42_TORDC/989-1169--------------------HKG--ILY----QKP-------------------------------KKH-----------
Q74ZU3_ASHGO/998-1187--------------------HQG--ILY----QKP-------------------------------RKH-----------
H6CBI5_EXODN/881-1078--------------------MSG--SLY----LKP-------------------------------HRR-----------
E5A6C0_LEPMJ/941-1113--------------------MSG--MLY----RKP-------------------------------RIH-----------
F9XLM8_MYCGM/682-862--------------------MSG--ALF----RKP-------------------------------RKH-----------
F2T6E6_AJEDA/871-1037--------------------MSG--TLY----CKP-------------------------------RRR-----------
E7RAB4_PICAD/902-1094--------------------MSG--VLY----QKR-------------------------------KKH-----------
A3GEX7_PICST/684-865--------------------MSG--YLY----QKS-------------------------------KKH-----------
H2AR29_KAZAF/997-1185--------------------QKG--LLF----LKP-------------------------------RKH-----------
D5G6N9_TUBMM/935-1096--------------------MSG--VLY----RKP-------------------------------RRH-----------
C0SDS0_PARBP/901-1069--------------------MSG--NLY----CKI-------------------------------RRR-----------
A1CLB3_ASPCL/876-1043--------------------MSG--QLY----RKP-------------------------------RRH-----------
C5PF94_COCP7/925-1091--------------------MSG--NLY----RKP-------------------------------RRH-----------
Q6CKB3_KLULA/919-1083--------------------HQG--LIY----HKS-------------------------------RKH-----------
G3AEW4_SPAPN/678-854--------------------KSG--FLY----HKR-------------------------------KKH-----------
G1XK76_ARTOA/820-982--------------------YSG--HLY----QKQ-------------------------------TRH-----------
B6H2T1_PENCW/909-1076--------------------MSG--NLY----RKP-------------------------------RRH-----------
A7TM50_VANPO/1058-1235--------------------SKG--FLY----QKM-------------------------------KKH-----------
A5DM32_PICGU/798-966--------------------MYG--HLF----SKT-------------------------------KMH-----------
E6ZQ69_SPORE/1863-2064--------------------RSG--KLF----HKK-------------------------------SSY-----------
G8BMZ3_TETPH/890-1075--------------------HQG--YIC----QKK-------------------------------NKY-----------
G4TI65_PIRID/968-1141--------------------RAG--RLY----MAT-------------------------------GAK-----------
E6R4C5_CRYGW/559-712--------------------LSG--RLY----MKQ-------------------------------GSH-----------
A8NQT9_COPC7/886-1037--------------------KGG--KVY----MRK-------------------------------GLR-----------
B0CVV2_LACBS/512-664--------------------KGG--KVY----TRK-------------------------------GYR-----------
F4REX6_MELLP/921-1086--------------------RSG--KLH----KKS-------------------------------YKG-----------

PF00640

APBA3_RAT/216-354-------------FGAKYLGSTQ--LLS----E-----------------------------------------------
APBB2_HUMAN/590-712-------------FHVQYLGMLP--VDK----P-----------------------------------------------
APBB2_HUMAN/419-555-------------FAVRSLGWVE--MAE----E-----------------------------------------------
SHC1_HUMAN/162-318-------------YLVRYMGCVE--VLQ----S-----------------------------------------------
SHC2_HUMAN/153-308-------------YVVRYMGCIE--VLR----S-----------------------------------------------
ANS1A_HUMAN/942-1068-------------YEANYLGS..--MLI----K-----------------------------------------------
APBA1_HUMAN/461-618-------------FAANYLGSTQ--LLS----D-----------------------------------------------
JIP1_RAT/564-698-------------FRVKFLGSVQ--VPY----H-----------------------------------------------
APBB1_RAT/544-665-------------FQVYYLGNVP--VAK----P-----------------------------------------------
JIP2_HUMAN/683-814-------------FDVQFLGSVE--VPC----H-----------------------------------------------
Q24080_DROME/34-184-------------FNVRYTGCVE--VKT----S-----------------------------------------------
DAB1_MOUSE/42-168-------------YKAKLIGIDE--VSA----A-----------------------------------------------
LIN10_CAEEL/607-762-------------FRARYLGSTQ--MLC----E-----------------------------------------------
APBB3_RAT/289-415-------------YEALYMGILP--VTK----A-----------------------------------------------
NUMB_DROME/83-205-------------FSVKYLGCVE--VFE----S-----------------------------------------------
CAPON_RAT/32-170-------------FEAKYVGSLD--VPR----P-----------------------------------------------
APBB3_RAT/117-255-------------FAVRSLGWVE--VPE----E-----------------------------------------------
APBA3_HUMAN/221-359-------------FGARYLGSTQ--LVS----E-----------------------------------------------
APBA2_MOUSE/373-531-------------FAANYLGSTQ--LLS----E-----------------------------------------------
CED6_CAEEL/61-194-------------YVARFLGCVE--TPK----A-----------------------------------------------
SHC3_HUMAN/155-311-------------YVVKYLGCIE--VLR----S-----------------------------------------------
DAB2_MOUSE/50-176-------------YKAKLIGIDD--VPD----A-----------------------------------------------
NUMB_MOUSE/39-172-------------FPVKYLGHVE--VDE----S-----------------------------------------------
APBB1_RAT/371-510-------------FAVRSLGWVE--MTE----E-----------------------------------------------
DAB_DROME/51-175-------------FKAKLIGILE--VGE----A-----------------------------------------------

PF08416

EPS8_MOUSE/64-194------------QYRVEHLTTFV--LDR----K-----------------------------------------------
ES8L1_HUMAN/35-165------------QYPVNHLVTFC--LGE----D-----------------------------------------------
TENS3_HUMAN/1310-1444------------ACNVWYLNSVE--MES----L-----------------------------------------------
Q5XH20_XENLA/51-177------------QHRVEHLLTCD--LDN----E-----------------------------------------------
Q7ZUV6_DANRE/51-181------------QYHVEHLTTFV--MDR----K-----------------------------------------------
A7E2A6_HUMAN/1275-1408------------ACSVLYLTSVE--TES----L-----------------------------------------------
Q4RXQ8_TETNG/64-188------------QYRVEHLFTFE--LDG----R-----------------------------------------------
Q9VHC3_DROME/580-716------------ATNVLWLYSCD--TES----L-----------------------------------------------
Q6NU33_XENLA/61-191------------QYHIEHLTTFV--MDR----K-----------------------------------------------
Q6PJM3_HUMAN/301-437------------ACNVLFINSVD--MES----L-----------------------------------------------
P92160_CAEEL/272-416------------ACNVVYVGSVD--VES----L-----------------------------------------------
Q3T129_BOVIN/28-149------------QHRVEHLMTCK--LGT----Q-----------------------------------------------
Q3T0F6_BOVIN/51-181------------QYHVQHLATFI--MDK----S-----------------------------------------------
Q7T3A3_DANRE/50-171------------QYRVEHLFTCA--LDG----R-----------------------------------------------

PF14719

F1SFG1_PIG/69-256------------TYTVLYLGNAT--TIQ----A-----------------------------------------------
C3ZEC0_BRAFL/18-200------------TYSCVYLGNAA--TLH----A-----------------------------------------------
A2AM80_MOUSE/71-265------------TYTVWYLGNAV--TLH----A-----------------------------------------------
Q20652_CAEEL/34-211------------SYNVIYLGNVL--TIM----A-----------------------------------------------
F1L1C4_ASCSU/64-246------------TYNVVYLGNVL--TVM----A-----------------------------------------------
B4LZF0_DROVI/288-472------------EYKVSYLGNVL--TGW----A-----------------------------------------------
E1FRI2_LOALO/49-231------------TYHVVYLGNVL--TII----A-----------------------------------------------
E5SI18_TRISP/18-200------------TYTVVYLGNVP--TSI----A-----------------------------------------------
E9GIB1_DAPPU/14-199------------SFKVVYLGNVL--TGW----A-----------------------------------------------
E0VC17_PEDHC/15-198------------TYKVSYLGNVL--TGL----A-----------------------------------------------

PF10480

ITBP1_HUMAN/1-200SGQSNNNSDTCAEFRIKYVGAIE--KLK----L-----------------------------------------------
Q5RG21_DANRE/1-198SG..NAVSDASAEFRVKYVGAIE--KLQ----F-----------------------------------------------

PF09380

Q7QB86_ANOGA/230-322-----GKDGCE..YH.LGLTPTG--ILV----F-----------------------------------------------
FARP2_MOUSE/238-328-----DREGTK..IN.LAVSHMG--VLV----F-----------------------------------------------
FRPD2_HUMAN/557-646-----RRPEEE..MA.LGICAKG--VIV----Y-----------------------------------------------
E41L5_MOUSE/239-331-----ARDGND..YS.LGLTPTG--VLV----F-----------------------------------------------
O17905_CAEEL/223-313-----DIDGND..AA.LSVMHLG--IKV----F-----------------------------------------------
FRM4A_HUMAN/225-326-----DKQGIP..WW.LGLSYKG--IFQ----Y-----------------------------------------------
PTN3_HUMAN/226-316-----DLHNLD..LM.IGIASAG--VAV----Y-----------------------------------------------
Q29ET4_DROPS/237-305-----DSSGKD..LQ.LGVSAVG--LLV----F-----------------------------------------------
A4QNY2_DANRE/770-859-----KRSLTG..IM.LGIYSKG--VLI----F-----------------------------------------------
Q5SZU5_HUMAN/141-234-----DKKEGRPTVI.LGLALRG--VHI----Y-----------------------------------------------
Q4SR04_TETNG/263-364-----DKQEIP..WW.LGVSHKG--IGQ----Y-----------------------------------------------
MERH_DROME/220-309-----NKNKTK..LW.LGVTSVG--LNI----Y-----------------------------------------------
A2ASR3_MOUSE/132-220-----DVSGNA..AF.LAFTPFG--FVV----L-----------------------------------------------
Q4T916_TETNG/118-207-----KPHEGE..IV.LGVCAKG--VIL----Y-----------------------------------------------
Q16F39_AEDAE/217-307-----NKKNTA..VY.VGVTALG--LNI----Y-----------------------------------------------
Q9VKY7_DROME/209-301-----DHRGSQ..QY.VGINNTG--IST----F-----------------------------------------------
Q17GE0_AEDAE/263-353-----DSAGKE..LS.LGVSSIG--LLV----Y-----------------------------------------------
A2AUK8_MOUSE/292-382-----DSEGID..IM.LGVCANG--LLI----Y-----------------------------------------------
Q4S8Q6_TETNG/206-302-----NKKGTE..LW.LGVDALG--LNI----Y-----------------------------------------------
A7SRN5_NEMVE/219-309-----DKDNVD..LE.LAAANMG--IIV----F-----------------------------------------------
Q8I093_CAEEL/223-359-----NENNDK..CI.LSIGYKG--IYI----Y-----------------------------------------------
Q7PMF4_ANOGA/228-311-----NDTGLE..VM.LGISVSG--IIV----A-----------------------------------------------
Q8K2R0_MOUSE/21-111-----DREGTK..IN.LAVANTG--ILV----F-----------------------------------------------
Q2M1E6_DROME/268-358-----DVEGVP..LN.LAVAHMG--ITV----F-----------------------------------------------
Q8JG61_DANRE/197-287-----DASGED..VM.LGVCSEG--LIV----Y-----------------------------------------------
Q1MTL1_DANRE/226-316-----DHCNTE..IY.VGVLSAG--ISV----Y-----------------------------------------------
Q4S0A7_TETNG/201-298-----DREGTR..LS.LTVAHTG--VLV----F-----------------------------------------------
Q6GPK7_XENLA/226-316-----DLHNLD..LL.IGIASGG--IAV----Y-----------------------------------------------
Q9NDP4_CIOIN/233-326-----DNDEED..LD.VGVTSTG--MLL----Y-----------------------------------------------
Q5DAD7_SCHJA/210-299-----NTKQTD..LW.LGISALG--LNM----Y-----------------------------------------------
Q4SDP7_TETNG/210-299-----NKKGTD..LW.LGVDALG--INI----Y-----------------------------------------------
A7RWH0_NEMVE/210-299-----NKKGTA..IS.LGIDCRG--LNI----Y-----------------------------------------------
Q4RQ84_TETNG/174-267-----DKKEERGTAL.LGLTLRG--MQV----Y-----------------------------------------------
Q94815_TAESA/212-301-----NKKGTS..LV.LGVDALG--LSI----Y-----------------------------------------------
Q7PRJ8_ANOGA/219-309-----NKKNTE..VW.LGVTALG--LNI----Y-----------------------------------------------
A8X9K5_CAEBR/230-319-----DANNLL..IE.IGVGAVG--IKV----F-----------------------------------------------
Q28006_BOVIN/787-876-----KKSQTG..IL.LGVCSKG--VLV----F-----------------------------------------------
Q4RI64_TETNG/212-305-----NANNVP..LM.VGLASSG--VAI----F-----------------------------------------------
Q05CU6_HUMAN/210-299-----NKKGTE..LW.LGVDALG--LNI----Y-----------------------------------------------
Q3UH12_MOUSE/129-218-----DLEGVD..II.LGVCSSG--LLV----Y-----------------------------------------------
A7SJJ3_NEMVE/179-269-----DGNGDE..VL.VGVSYAG--VLV----F-----------------------------------------------
A7T1E3_NEMVE/204-296-----GDEGQA..VT.IAISAWG--VEV----F-----------------------------------------------
PTP1_CAEEL/230-319-----DANHLP..IE.IGVGAVG--IKV----F-----------------------------------------------
A7SBA4_NEMVE/205-308-----DKGSIP..WW.LGLSPRG--IGV----Y-----------------------------------------------
Q5LK46_CAEEL/220-307-----NNKETD..LH.LGISAQG--LGI----Y-----------------------------------------------
Q4RMH6_TETNG/655-741-----DSTGTD..VT.LGSCLDG--IIV----K-----------------------------------------------
Q4REG2_TETNG/277-370-----DKKEVEASLT.LGLTLRG--IQI----F-----------------------------------------------
PTN4_MOUSE/226-316-----DQSNNE..IL.IGVMSGG--ILI----Y-----------------------------------------------
A7S031_NEMVE/180-270-----DQHKIE..YE.LGLTPRG--ILV----A-----------------------------------------------
Q4RRW4_TETNG/220-358-----NKRDTD..LL.LGVDAQG--LHI----Y-----------------------------------------------
Q4SAZ3_TETNG/102-217-----DGEGMR..IN.LAVTHSG--VLV----F-----------------------------------------------
Q16TI3_AEDAE/200-283-----DEHGGD..VT.LGISVSG--IIV----A-----------------------------------------------
Q4RI64_TETNG/1158-1250-----GRDGGE..YA.LGLTPTG--ILV----F-----------------------------------------------
Q16YM3_AEDAE/262-348-----NKNETGMGSVSLSIYAKG--IRI----A-----------------------------------------------
FRMD3_HUMAN/229-316-----DSTGTT..TF.LGFTAAG--FVV----F-----------------------------------------------
A4F2N5_9ASCI/216-329-----NNKGSE..LC.LGINAVS--VNV----Y-----------------------------------------------
A7RUW8_NEMVE/238-328-----DHDGTD..LF.LGVSALG--LTV----Y-----------------------------------------------
Q9U566_DROSL/232-320-----DTLGND..LL.LGLAIHG--MVV----N-----------------------------------------------
FRMD7_HUMAN/196-286-----DGEGMQ..IH.LAVAHMG--VLV----L-----------------------------------------------
MERL_HUMAN/226-315-----NKKGTE..LL.LGVDALG--LHI----Y-----------------------------------------------
A8Y3W1_CAEBR/270-367-----KMDNTD..NAVLGINAKG--IEM----C-----------------------------------------------
Q6NXW5_MOUSE/226-312-----DSQGSD..IS.IGACLDG--IFV----K-----------------------------------------------

PF10756

Q1BAS0_MYCSS/59-130-------------RLRTVADRDT..VTA----R-----------------------------------------------
A1UE92_MYCSK/59-130-------------RLRTVADRDT..VTA----R-----------------------------------------------
A3PXP6_MYCSJ/59-130-------------RLRTVADRDT..VTA----R-----------------------------------------------
A1T6Y6_MYCVP/40-111-------------RYRTVADRDT..VTA----R-----------------------------------------------
A4TE10_MYCGI/115-186-------------RYRTVADRDT..VTA----R-----------------------------------------------
A0QUX5_MYCS2/56-127-------------RLQTKADRNT..VTA----R-----------------------------------------------
A1KMZ9_MYCBP/39-110-------------RLRTLADERG..VTV----R-----------------------------------------------
CFP6_MYCBO/39-110-------------RLRTLADERG..VTV----R-----------------------------------------------
A2VLX4_MYCTU/25-96-------------RLRTLADERG..VTV----R-----------------------------------------------
A5WRQ7_MYCTF/52-123-------------RLRTLADERG..VTV----R-----------------------------------------------
A5U716_MYCTA/39-110-------------RLRTLADERG..VTV----R-----------------------------------------------
CFP6_MYCTU/39-110-------------RLRTLADERG..VTV----R-----------------------------------------------
A4KKR2_MYCTU/52-123-------------RLRTLADERG..VTV----R-----------------------------------------------
A0QJC8_MYCA1/42-113-------------RLRTVADDHG..VTV----R-----------------------------------------------
A0PPX9_MYCUA/46-117-------------RVRTVADENG..VTA----R-----------------------------------------------
Q0S2H6_RHOSR/133-204-------------RVRTTVTPDG..LEV----R-----------------------------------------------
A4FMQ8_SACEN/47-118-------------RTRTTIDATH..VTT----R-----------------------------------------------
Q5YRV9_NOCFA/80-151-------------RTRTVVTGDG..LEL----R-----------------------------------------------
A8M5F2_SALAI/52-123-------------RAGTDATSQG..LRL----R-----------------------------------------------
A4X496_SALTO/52-123-------------RAGTDANSQG..LRL----R-----------------------------------------------
Q8NQZ8_CORGL/37-108-------------KSSTIVDEQG..ITA----N-----------------------------------------------
Q6M5S3_CORGL/51-122-------------KSSTIVDEQG..ITA----N-----------------------------------------------
A4QDN0_CORGB/60-131-------------KSSTIVDEQG..ITA----N-----------------------------------------------
Q8FPX5_COREF/69-140-------------KSATVVDGTG..IEA----R-----------------------------------------------
Q6NHN5_CORDI/53-124-------------RSSTTVSESG..IEA----R-----------------------------------------------
Q4JUN4_CORJK/53-125-------------WVRTTVTDKA..ITT----R-----------------------------------------------
Q2IEC1_ANADE/109-180-------------RARVVVHDTG..LER----V-----------------------------------------------
A0QWV2_MYCS2/76-146-------------RPRLRIGPSG..MAV----R-----------------------------------------------
A5U2B9_MYCTA/72-142-------------RPRLRVGSAG..LSV----R-----------------------------------------------
Y1452_MYCBO/72-142-------------RPRLRVGSAG..LSV----R-----------------------------------------------
A1KIK6_MYCBP/72-142-------------RPRLRVGSAG..LSV----R-----------------------------------------------
A4KGX3_MYCTU/72-142-------------RPRLRVGSAG..LSV----R-----------------------------------------------
Y1417_MYCTU/72-142-------------RPRLRVGSAG..LSV----R-----------------------------------------------
A5WMA0_MYCTF/72-142-------------RPRLRVGSAG..LSV----R-----------------------------------------------
Q741E9_MYCPA/73-143-------------RPRLRIGPAG..VSV----R-----------------------------------------------
A0QI07_MYCA1/73-143-------------RPRLRIGPAG..VSV----R-----------------------------------------------
A0PPL8_MYCUA/74-144-------------RPRLRIGAAG..ISV----R-----------------------------------------------
Q9CCP2_MYCLE/74-144-------------RPRLRVGAAG..LLV----R-----------------------------------------------
A4TC11_MYCGI/69-139-------------RPRLRVGPSG..VAV----R-----------------------------------------------
A1T8K3_MYCVP/70-140-------------RPRLRVGPSG..VAV----R-----------------------------------------------
A1UFM9_MYCSK/68-138-------------RPRVRVGPRG..LAV----R-----------------------------------------------
Q1B9D4_MYCSS/68-138-------------RPRVRVGPRG..LAV----R-----------------------------------------------
A3PZ90_MYCSJ/68-138-------------RPRVRVGPRG..LAV----R-----------------------------------------------
Q0S0K0_RHOSR/72-142-------------RPRLRVGPRG..IAV----R-----------------------------------------------
Q5YTP5_NOCFA/86-156-------------RPRVRAGAEG..VAV----R-----------------------------------------------
A4FBK6_SACEN/71-141-------------RPRMRADSAG..IEV----R-----------------------------------------------
A4QEG7_CORGB/114-184-------------RPRVRANEDG..VEV----R-----------------------------------------------
Q8NQ54_CORGL/114-184-------------RPRVRANEDG..VEV----R-----------------------------------------------
Q8FT59_COREF/117-187-------------RARVRANEDG..VEV----R-----------------------------------------------
Q6NH30_CORDI/107-177-------------RPRVRANEDG..VEV----R-----------------------------------------------
O24754_CORAM/105-175-------------RPRLRANSDG..VEI----R-----------------------------------------------
Q4JVI7_CORJK/71-141-------------RPHVKVNSEG..VEV----R-----------------------------------------------
A4X643_SALTO/103-173-------------RPRVEADGRR..VRV----Q-----------------------------------------------
A8LY42_SALAI/72-142-------------RPKVEADAQR..VRV----Q-----------------------------------------------
Q47QZ7_THEFY/72-143-------------RPRLELTEHR..VTV----V-----------------------------------------------
Q827L6_STRAW/68-139-------------RPKVVADESG..VTV----V-----------------------------------------------
A3KKZ4_STRAM/69-140-------------RPRVVADDTG..VTV----V-----------------------------------------------
Q9RKZ5_STRCO/70-141-------------RPRVDADETG..VTV----V-----------------------------------------------
A1SJH2_NOCSJ/82-152-------------RCRVIAEPER..LVV----V-----------------------------------------------
A3TLM6_9MICO/70-140-------------SVRAVPGDEG..LTI----Q-----------------------------------------------
A6WC99_KINRD/77-147-------------SVRARADAEG..LEV----R-----------------------------------------------
A3PSE7_MYCSJ/58-136-------------RPKLAITPEG..VAV----R-----------------------------------------------
A1U8T0_MYCSK/58-136-------------RPKLAITPEG..VAV----R-----------------------------------------------
Q1BG51_MYCSS/58-136-------------RPKLAITPEG..VAV----R-----------------------------------------------
A0PKC3_MYCUA/58-136-------------RPKLAITREG..LAI----R-----------------------------------------------
A5TY78_MYCTA/58-136-------------RPRLAITPDG..LAI----R-----------------------------------------------
A5WI64_MYCTF/58-136-------------RPRLAITPDG..LAI----R-----------------------------------------------
Y010_MYCTU/58-136-------------RPRLAITPDG..LAI----R-----------------------------------------------
A2VMV2_MYCTU/58-136-------------RPRLAITPDG..LAI----R-----------------------------------------------
A4KN42_MYCTU/37-115-------------RPRLAITPDG..LAI----R-----------------------------------------------
Q9CDE8_MYCLE/58-136-------------RPKLAINPDG..LAV----Q-----------------------------------------------
Q744S0_MYCPA/58-136-------------RPKLAITPDG..LAV----R-----------------------------------------------
A0Q8S7_MYCA1/10-88-------------RPKLAITPDG..LAV----R-----------------------------------------------
A1T119_MYCVP/58-136-------------RPKLAITDGS..LTY----R-----------------------------------------------
A4T4V1_MYCGI/58-136-------------RPKLAISDDA..LVY----R-----------------------------------------------
Q5Z3S4_NOCFA/64-148-------------RPRLEVRPGSPPVLV----V-----------------------------------------------
Q0SAE3_RHOSR/62-146-------------RPRLAVDKEGGGIVV----N-----------------------------------------------
A4F5R5_SACEN/60-137-------------RPRLSADAAG..ITV----R-----------------------------------------------
A8LWD3_SALAI/68-146-------------PVRLAADPEG..LTV----V-----------------------------------------------
A4XDA1_SALTO/68-146-------------PVRLAVDPEG..LTV----V-----------------------------------------------
A8LCF4_FRASN/69-148-------------RPTLRLGPGG..IDY----V-----------------------------------------------
Q0RB02_FRAAA/82-161-------------RPTLRVSPAG..LDL----V-----------------------------------------------
Q7VS84_BORPE/85-153-------------ISVTRIDESG....L----R-----------------------------------------------
Q7W1V7_BORPA/85-153-------------ISVTRIDESG....L----R-----------------------------------------------
Q7WQT3_BORBR/85-153-------------ISVTRIDESG....L----R-----------------------------------------------
Q9X8Z2_STRCO/64-149-------------TLEVGADAYG..VRY----G-----------------------------------------------
Q93NX3_9ACTO/64-147-------------TAQVRADAYG..LHS----R-----------------------------------------------
Q8TW66_METKA/65-149-------------GNQVELTPDA..VIL----K-----------------------------------------------
A3ZYD7_9PLAN/70-141-------------PAMFEIGPRG..IVQ----R-----------------------------------------------
Q6ADX4_LEIXX/63-147-------------RPHLTVSDDG..LEL----V-----------------------------------------------
A4ALH2_9ACTN/59-141-------------RPEVRVTSAG..VTL----R-----------------------------------------------
A5CT27_CLAM3/59-141-------------HPRVRIATEG..VEI----R-----------------------------------------------
A0JYT3_ARTS2/61-144-------------MPAVVIHDGG..ITL----E-----------------------------------------------
Q47LS7_THEFY/56-142-------------RPKVVATEDG..VRL----V-----------------------------------------------
Q82I13_STRAW/80-156-------------RPAVFANEDR..LRI----R-----------------------------------------------

PF11605

VPS36_DROME/2-94----------------------N--RFA----Y-----------------------------------------------
Q4QDE7_LEIMA/5-95----------------------E--WKT----D-----------------------------------------------
Q5TPR5_ANOGA/2-94----------------------N--RFE----Y-----------------------------------------------
Q5AHK1_CANAL/13-100----------------------L--INR----S-----------------------------------------------
Q19519_CAEEL/2-89----------------------N--RLS----W-----------------------------------------------
Q6CAN8_YARLI/6-95----------------------E--LNN----S-----------------------------------------------
A5DUJ7_LODEL/11-99----------------------K--INR----S-----------------------------------------------
Q6CWP4_KLULA/12-100----------------------E--IAG----S-----------------------------------------------
Q5AXE3_EMENI/547-615----------------------E--LTT----A-----------------------------------------------
A3LUC0_PICST/11-98----------------------L--VNR----S-----------------------------------------------
A5DGQ5_PICGU/60-147----------------------S--VNR----S-----------------------------------------------
Q4PA51_USTMA/9-97----------------------A--SNS----S-----------------------------------------------
Q6BSQ4_DEBHA/12-99----------------------S--VNR----S-----------------------------------------------
A7A1T8_YEAS7/8-96----------------------E--TTS----S-----------------------------------------------
VPS36_DICDI/8-94----------------------T--RVI----N-----------------------------------------------
Q6FPE3_CANGA/8-96----------------------E--TTE----S-----------------------------------------------
VPS36_SCHPO/6-94----------------------E--TTP----S-----------------------------------------------
VPS36_ARATH/18-111----------------------E--VTT----S-----------------------------------------------
Q757C1_ASHGO/15-103----------------------E--TTA----S-----------------------------------------------
A7TGC6_VANPO/8-96----------------------E--TTS----S-----------------------------------------------
Q4DRE4_TRYCC/5-94----------------------E--WQT----.-----------------------------------------------
A4HA31_LEIBR/5-95----------------------K--LNT----D-----------------------------------------------

PF02893

MTMR2_MOUSE/71-139----------------------A--EME----.-----------------------------------------------
TBCD8_MOUSE/285-353----------------------E--FFR----.-----------------------------------------------
UGT52_DICDI/881-948----------------------I--KIK----.-----------------------------------------------
FAN_HUMAN/176-247----------------------R--LAR----.-----------------------------------------------
GRAM4_HUMAN/445-523----------------------G--NFH----.-----------------------------------------------
GRM1B_HUMAN/96-163----------------------E--DFR----.-----------------------------------------------
B9A6K8_HUMAN/288-356----------------------E--CYR----.-----------------------------------------------
MTMR5_HUMAN/882-968----------------------P--KLL----.-----------------------------------------------
B9A6K8_HUMAN/142-209----------------------L--KMR----.-----------------------------------------------
Q9VP46_DROME/136-203----------------------S--KFR----.-----------------------------------------------
Q9VP46_DROME/282-350----------------------E--EFR----.-----------------------------------------------
GYP2_SCHPO/20-85----------------------L--DPA----.-----------------------------------------------
Q9TXP3_CAEEL/783-872----------------------E--HLK----K-----------------------------------------------
YL072_YEAST/164-231----------------------K--KFR----.-----------------------------------------------
GYP2_YEAST/29-116----------------------E--KFR----.-----------------------------------------------
YFE2_YEAST/198-265----------------------K--DFH----.-----------------------------------------------
ATG26_YEAST/570-636----------------------E--RFR----.-----------------------------------------------
MTM1_HUMAN/29-97----------------------R--DLT----.-----------------------------------------------
ATG26_PICPG/586-652----------------------S--RFR----.-----------------------------------------------
YGZ7_SCHPO/197-264----------------------R--DFH----.-----------------------------------------------
Q18966_CAEEL/9-83----------------------P--DGL----.-----------------------------------------------
Q9VGH9_DROME/922-1002----------------------P--KIQ----.-----------------------------------------------
YHO0_YEAST/548-617----------------------A--EFH----.-----------------------------------------------
YSP2_YEAST/647-716----------------------S--EFH----.-----------------------------------------------
GEML1_ARATH/138-215----------------------K--VFK----.-----------------------------------------------
WBP2_MOUSE/1-84----------------------M--ALN----.-----------------------------------------------
ATG26_CANAL/816-880----------------------R--NFQ----.-----------------------------------------------
Q9ZTW0_HORVU/229-307----------------------K--LYK----.-----------------------------------------------
Q9VMI9_DROME/40-113----------------------G--ILR----D-----------------------------------------------
Q9VU19_DROME/11-82----------------------G--VL.----.-----------------------------------------------
C2GR1_ARATH/688-754----------------------S--AFQ----.-----------------------------------------------
MTMR1_HUMAN/104-161----------------------E--SIK----.-----------------------------------------------
Q18075_CAEEL/23-84----------------------L--LYT----.-----------------------------------------------

PF14844

LVSD_DICDI/2064-2162----------------------K--LEF----S-----------------------------------------------
Q0KHV9_DROME/2916-3020----------------------P--VNI----S-----------------------------------------------
C1E8K2_MICSR/38-147----------------------K--ILL----S-----------------------------------------------
F1QJA6_DANRE/2074-2178----------------------P--VNL----S-----------------------------------------------
A9SKJ8_PHYPA/1974-2088----------------------K--LIL----E-----------------------------------------------
E7EZD1_DANRE/2173-2277----------------------P--VVL----S-----------------------------------------------
LYST_MOUSE/3000-3102----------------------S--IRV----N-----------------------------------------------
E2RM94_CANFA/597-690----------------------K--LVL----S-----------------------------------------------
A5B5Q4_VITVI/1437-1541----------------------R--IVL----E-----------------------------------------------
B4HU25_DROSE/77-170----------------------K--LVM----S-----------------------------------------------
Q4RI15_TETNG/1957-2053----------------------K--LVL----S-----------------------------------------------
D0NB84_PHYIT/1693-1817----------------------Q--VYA----S-----------------------------------------------
B8AGC7_ORYSI/1908-2017----------------------R--IIV----E-----------------------------------------------
D3B4G5_POLPA/1060-1165----------------------K--VVA----V-----------------------------------------------
E9BTN9_LEIDB/3473-3580----------------------P--SLL----S-----------------------------------------------
A9V098_MONBE/74-174----------------------V--PLF----S-----------------------------------------------
LVSC_DICDI/1705-1818----------------------K--LIY----S-----------------------------------------------
E9CEC6_CAPO3/3668-3773----------------------A--ILL----S-----------------------------------------------
D3BQI1_POLPA/231-322----------------------R--NML----E-----------------------------------------------
F0ZLG9_DICPU/1569-1668----------------------K--LIY----T-----------------------------------------------
D8S3X7_SELML/1882-1980----------------------R--LLL----E-----------------------------------------------
Q5TUA8_ANOGA/79-172----------------------K--IVI----T-----------------------------------------------
Q01AN8_OSTTA/2194-2290----------------------K--VIF----S-----------------------------------------------
C3YYV6_BRAFL/1806-1900----------------------K--QKL----Q-----------------------------------------------
E9CED0_CAPO3/1920-2025----------------------R--VLL----S-----------------------------------------------
LVSF_DICDI/293-384----------------------R--NIL----E-----------------------------------------------
C3Y0L9_BRAFL/2973-3076----------------------A--IRY----T-----------------------------------------------
D7LRV7_ARALL/2028-2133----------------------R--IIL----E-----------------------------------------------
D8M509_BLAHO/332-453----------------------T--ILF----T-----------------------------------------------
D2UYK5_NAEGR/2485-2591----------------------T--ILK----D-----------------------------------------------
E4X0F7_OIKDI/1583-1687----------------------A--ITY----S-----------------------------------------------
F0ZTM1_DICPU/1937-2035----------------------I--LEF----S-----------------------------------------------
E9GKY9_DAPPU/2065-2169----------------------P--VNL----S-----------------------------------------------
E9C1E6_CAPO3/193-284----------------------R--IVT----E-----------------------------------------------
A9V898_MONBE/2770-2881----------------------R--VQA----V-----------------------------------------------
F2UGS7_SALS5/2284-2404----------------------A--HIL----H-----------------------------------------------
A2DFN3_TRIVA/1803-1904----------------------L--TFI----H-----------------------------------------------
B3RRZ7_TRIAD/111-205----------------------K--MIL----T-----------------------------------------------
E1FZ76_LOALO/328-427----------------------R--IIL----S-----------------------------------------------
B3RWH0_TRIAD/273-377----------------------P--IVC----A-----------------------------------------------
D3BT75_POLPA/2598-2696----------------------K--IIY----S-----------------------------------------------
F1KPT4_ASCSU/1732-1836----------------------N--TSY----S-----------------------------------------------
F0WHU1_9STRA/1484-1601----------------------H--ILV----R-----------------------------------------------
F1KPL1_ASCSU/2436-2535----------------------R--IRV----S-----------------------------------------------
NBEA_CAEEL/1694-1798----------------------S--ACF----S-----------------------------------------------
A7SQQ4_NEMVE/217-312----------------------K--VVL----E-----------------------------------------------
Q22HC6_TETTS/2401-2508----------------------E--VQF----T-----------------------------------------------

PF03517

ICLN_ARATH/49-167-------------GTLYITSR.K--LIW----L.S.......D.VDMA.....................-----------
B9Q2B0_TOXGO/47-162-------------GTFYITSR.R--IAW----L.AKPGAASGD.E.QR.....................-----------
A1DEP8_NEOFI/99-240-------------VDVWVTSD.K--FLL----Y.T.............PT...................-----------
A1ZAW5_DROME/33-179-------------GTVYIAQN.T--LSW----Q.P......T......E....................-----------
A2QMX0_ASPNC/82-226-------------VNVWVTSE.K--FLL----H.N.............PT...................-----------
LOT5_PICST/75-215-------------VSLFVLNTSL--IVW----F.NS....AD...........................-----------
A4S3U5_OSTLU/82-224-------------GELYITDA.R--VAF----V.PRDP.TST...........................-----------
A5CAA6_VITVI/49-167-------------GTLFISTK.Q--VIW----L.S.............DV...................-----------
LOT5_PICGU/78-210-------------VDLYVLNS.C--LLL----W.S.............AT...................-----------
LOT5_LODEL/63-191-------------CSIFVLSS.C--FII----W.S.............ET...................-----------
A6QTC2_AJECN/141-306-------------VDVWVTSE.R--LLL----Y.S.............QR...................-----------
A6RQ79_BOTFB/74-191-------------VDAYISTE.N--VTI----F.N.............NT...................-----------
LOT5_YEAS7/82-244-------------TDLFILNSCI--IIW----F.NG....LG...........................-----------
A7RR20_NEMVE/33-147-------------GVLYIAQE.R--LSW----S.N.............E....................-----------
LOT5_VANPO/82-248-------------VELFILNKCI--LMW----F.KD....LG...........................-----------
A8NTF5_COPC7/63-194-------------GTLLVLTS.V--LVF----V.S......S......T....................-----------
A8Y0J2_CAEBR/34-180-------------GTLYVTGS.E--VTW----I.S.............SA...................-----------
A9NQA9_PICSI/43-164-------------GTLYITTK.R--LIW----L.S.............DV...................-----------
A9S1N0_PHYPA/47-165-------------GTLYVTTR.R--LVW----L.S.............NE...................-----------
A9ULH1_XENTR/33-162-------------GTLYIAES.R--LSW----L.N......G......S....................-----------
A9VD70_MONBE/35-180-------------GKLSITDV.D--VAW----W.S.............AD...................-----------
B0DAB3_LACBS/60-176-------------GTLYVLTS.V--LVF----M.S......S......A....................-----------
B0FLX5_FUSOX/110-226-------------VDVFVNSE.A--LTI----F.S.............PK...................-----------
B0WD72_CULQU/34-182-------------GELHLTES.S--LIW----T.C.............EE...................-----------
B2B612_PODAN/138-262-------------LDVFVTSQ.N--LVL----F.S.............PQ...................-----------
B2WLS9_PYRTR/75-197-------------VDVWVTSE.N--LIL----F.Q.............TT...................-----------
B3MIF9_DROAN/33-169-------------GTIYIAQN.T--LSW----Q.P......S......D....................-----------
B3S5M1_TRIAD/33-150-------------GTLYIAAS.M--LTW----S.NN....EG...........................-----------
B4FU22_MAIZE/47-164-------------GTLYLTTR.R--VIW----V.S.............D....................-----------
B4J796_DROGR/33-197-------------GRIYISQN.T--LSW----Q.P......M......D....................-----------
B4MIS2_DROWI/33-184-------------GTVYIAQN.S--LSW----Q.P......S......D....................-----------
B5X8R1_SALSA/33-161-------------GTLYVAET.R--LSW----F.D......G......S....................-----------
B5X9U7_SALSA/56-181-------------GTLYIAET.C--VSW----F.D......G......S....................-----------
B6HHS4_PENCW/87-223-------------VDIWVTSD.K--FLL----F...............SR...................-----------
B6K3T8_SCHJY/53-175-------------IIIIITSK.N--LLL----F.D.............ES...................-----------
B6QED0_PENMQ/87-259-------------VDVFVTSD.K--FLL----Y...............RP...................-----------
B7FMN0_MEDTR/42-162-------------GTLYITTK.Q--VIW----V.S.............DV...................-----------
B7P9B2_IXOSC/33-159-------------GTLYIAES.R--VSW----V.GE....NS...........................-----------
B8AK26_ORYSI/47-166-------------GTLFVTTR.R--VIW----L.S.............ET...................-----------
B8BFW3_ORYSI/47-166-------------GTLFITTR.R--VIW----V.S.............EV...................-----------
B8BUW5_THAPS/168-320-------------GDLLVTSL.R--VLF----V.P......P......SN...................-----------
B8NUB0_ASPFN/89-218-------------VDVWVTSD.K--FLL----Y.N.............PT...................-----------
B8NZE3_POSPM/63-180-------------GTLYVIES.F--LVF----M.S......A......T....................-----------
B9I4K9_POPTR/49-167-------------GTLYISTK.K--VVW----L.S.............DV...................-----------
B9R9P4_RICCO/49-168-------------GTLFISTK.K--VIW----L.S.............DV...................-----------
B9W785_CANDC/63-184-------------VSLFVLNTSF--IIW----F.NL....NN...........................-----------
C0S818_PARBP/100-260-------------IDVWV.....--...----................SS...................-----------
C1BLM5_OSMMO/33-163-------------GTLLIAET.R--VSW----F.N......G......S....................-----------
C1BT70_9MAXI/33-168-------------GTLYISES.R--VSW----V.G.............E....................-----------
C1EAA0_MICSR/47-200-------------GTLHITTR.R--LVW----F........GDG....A....................-----------
C4JLR6_UNCRE/89-230-------------VDVWVTSE.K--LLL----Y.N.............PS...................-----------
C4R4H9_PICPG/69-202-------------CFVYVLNTCL--VLW----F.ES....GR...........................-----------
C4WYC8_ACYPI/33-183-------------GTLYVAES.K--LYW----K.ND.....A......T....................-----------
C4XYE0_CLAL4/70-200-------------VALFVLDTSL--VLW----S.DR....CS...........................-----------
C5DFH3_LACTC/77-239-------------VDFFILNTCM--VIW----I.NT....LD...........................-----------
C5DS18_ZYGRC/74-243-------------VELFILSTGI--LLW----F.NQ....LG...........................-----------
C5FIH0_ARTOC/100-255-------------INVWVTSE.K--LLL----F.S.............TE...................-----------
C5JF20_AJEDS/150-324-------------IDVWVTSE.R--LLL----Y.S.............QP...................-----------
C5M0L7_PERM5/411-532-------------GVILMTST.R--FVW----L.S.............IE...................-----------
C5ME47_CANTT/63-184-------------VSLFILNSSV--VIW----F.NN....NN...........................-----------
C5P4Z2_COCP7/90-232-------------VDVWVTSE.K--LLL----Y...............NA...................-----------
C5WQX7_SORBI/47-165-------------GTLFITTR.R--MIW----L.S.............EA...................-----------
C7YUN3_NECH7/83-199-------------VDVFVSSE.N--VIL----F.S.............LK...................-----------
C8V9L5_EMENI/93-223-------------LEIWVTSD.K--FFV----Y.N.............TS...................-----------
C9SS04_VERA1/113-222-------------IDLFVNSE.N--FTV----Y.S.............AT...................-----------
D0MW27_PHYIT/62-159-------------GALFVTTS.R--VLW----LGA.............AM...................-----------
D2H3S9_AILME/35-156-------------GTLYIAES.R--LSW----L.D......G......S....................-----------
D2U835_9ROSI/49-168-------------GTLYITSK.Q--VVW----L.S.............DV...................-----------
D2VE54_NAEGR/89-219-------------FHLYVMSE.H--LLL----F.N.............M....................-----------
D3AWK5_POLPA/41-182-------------GELVLTSK.N--VRW----T.G.............E....................-----------
D3TMJ1_GLOMM/33-174-------------GTLSISQS.A--LGW----Q.P......D......H....................-----------
D4DKR6_TRIVH/99-216-------------VSVWVTSE..--...----.....................................-----------
D5GPC9_TUBMM/75-207-------------IELLIISQ.T--LTL----Y.N.............AP...................-----------
D6WHX2_TRICA/33-160-------------GTLFVSER.T--LSW----Q.KD....GT...........................-----------
D7G4C9_ECTSI/52-165-------------GSLTVTTT.R--VVW----L.S.............SE...................-----------
D8Q594_SCHCM/62-183-------------GTLFVIEN.A--LFF----M.S......A......S....................-----------
D8R326_SELML/48-170-------------GTLYITTR.R--LVW----L.S.............DR...................-----------
D8TWT3_VOLCA/56-171-------------GVLHLTTR.R--VVW----VPG.............SQ...................-----------
E0VCN6_PEDHC/33-152-------------GTLFIAES.Y--LSW----..G......S......D....................-----------
E1GH06_LOALO/36-197-------------GELTVAES.S--VTW----I.S......N......I....................-----------
E1ZS71_CHLVA/50-172-------------GSLFITEW.R--IVW----L.S.............AA...................-----------
E2AYH0_CAMFO/33-160-------------GTFYITES.V--LSW----M.D......N......D....................-----------
E3MRC6_CAERE/33-179-------------GTLYITDS.A--VTW----I.S.............RA...................-----------
E3QTP6_COLGM/107-222-------------VSVFVNSE.N--FTI----F.S.............EA...................-----------
E3TFM3_ICTPU/33-149-------------GTLCVAES.R--VSW----V.D......G......S....................-----------
E4X6Q6_OIKDI/31-151-------------ADIFITED.D--VRF----I.G.............E....................-----------
E5AE79_LEPMJ/75-200-------------VAIWVSSQ.N--LIF----F.Q.............TS...................-----------
E5SJS0_TRISP/31-178-------------GTLFICYN.G--IIW----A.NE....NK...........................-----------
E6R1Y0_CRYGW/62-207-------------GKLYVTEE.S--VAF----I.PNP..PST...........................-----------
E6ZKI1_SPORE/90-225-------------GELWLTER.E--LSF----L.A.............SK...................-----------
E9CD59_CAPO3/34-165-------------GTLVVAHD.A--LYW----W.N......S......A....................-----------
E9E872_METAQ/84-201-------------VDVFVNSE.H--FTI----F.S.............EK...................-----------
E9H646_DAPPU/33-155-------------GTLYIAES.R--VSW----V.S......A......T....................-----------
F0WL16_9STRA/59-162-------------GKVYVTTR.R--AIW----I.SN.....T......SS...................-----------
F0XG98_GROCL/95-242-------------VDVFVGSE.T--LSL----Y.C.............PA...................-----------
F0ZDK9_DICPU/33-167-------------GHLYVTNK.N--IRW----I.SQD...KQ...........................-----------
F1L444_ASCSU/85-210-------------GDLIISEG.S--VTW----I.C.............SQ...................-----------
F1QDS7_DANRE/33-166-------------GTLFVAEA.Q--LSW----F.D......G......S....................-----------
F2DSJ7_HORVD/47-166-------------GTLFITTR.R--VIW----L.S.............EA...................-----------
F2UJQ4_SALS5/35-160-------------GDFVVTEE.D--MYW----W.C.............PA...................-----------
LOT5_DEBHA/75-213-------------VSLFVLNTCV--IIW----L.DE....IQ...........................-----------
YIU1_SCHPO/53-192-------------ITLLVTSQ.S--FIL----F.D.............EE...................-----------
Q00ZV5_OSTTA/292-403-------------CELFVTTS.R--VVF----A.S.............M....................-----------
Q0CIH1_ASPTN/83-217-------------VDVWVTSD.K--FLL----Y.N.............PT...................-----------
Q0UAR5_PHANO/75-198-------------VEIWVNSE.N--LTL----F.Q.............TT...................-----------
Q2TU72_FASHE/33-209-------------GSLSITER.C--FSW----T.G......D...........................-----------
Q4PHI8_USTMA/90-237-------------GQLWLTEQ.Y--ITF----L.S.............SE...................-----------
Q4UE37_THEAN/53-155-------------GNLYLTNL.K--LIW----L.N.............SD...................-----------
Q54Q91_DICDI/34-173-------------GHIYVTNK.N--VHW----I.SKN...NI...........................-----------
Q5TW40_ANOGA/34-170-------------GSLHLTVG.S--CIW----S.C.............EE...................-----------
Q6C5D1_YARLI/86-206-------------GKIYVLTS.H--VTL----W.F.............AQ...................-----------
LOT5_KLULA/83-248-------------SDLFVLNTCV--LIW----F.QD....WE...........................-----------
Q6FWF9_CANGA/65-256-------------VEVYILEGRL--MLW----I.KHP..DIN...........................-----------
LOT5_ASHGO/69-217-------------TDLFVLDSCI--LLW----P.AH....AL...........................-----------
Q7RFA5_PLAYO/43-232-------------GKLYILEK.R--IIW----V.PN.....KDENNKKEKITGFKDITTNNVYLNHYEK-----------

PF10882

E8ZQG4_CLOB0/63-164-------------VDYSL--DKE--NIY----I-----------------------------------------------
D2RH36_ARCPA/66-169-------------TSIVL--NDQ--IEV----I-----------------------------------------------
Q892T1_CLOTE/66-167-------------VNYTM--NEK--SLN----I-----------------------------------------------
B1BIL0_CLOPF/63-164-------------LVYEV--NDD--YIE----I-----------------------------------------------
B9LAJ8_CHLSY/77-176-------------LRYSL--DRN--GLY----V-----------------------------------------------
A5N6R3_CLOK5/63-164-------------LKYFI--DTE--NLY----I-----------------------------------------------
A9B463_HERA2/77-175-------------LHYRV--DRN--ALT----I-----------------------------------------------
C9PZP2_9BACT/69-168-------------RKVTL--NDT--TLI----I-----------------------------------------------
D9SW68_CLOC7/63-164-------------MEYIL--REE--YLE----I-----------------------------------------------
D8GPI2_CLOLD/64-165-------------LKYSM--DEE--NLY----I-----------------------------------------------
D7JGR0_9BACT/59-159-------------LYVTI--DKS--RFI----L-----------------------------------------------
Q67L16_SYMTH/48-147-------------MRYEV--TPE--ALR----I-----------------------------------------------
D5XC81_THEPJ/68-168-------------LEYRI--EGE--DLV----I-----------------------------------------------
C5CH43_KOSOT/70-173-------------MKYIC--TDT--HLL----L-----------------------------------------------
A5ZGT7_9BACE/66-165-------------SFICL--EKD--QLV----I-----------------------------------------------
C5VRR7_CLOBO/63-164-------------LKYIV--NER--DLH----I-----------------------------------------------
C6PTX6_9CLOT/63-164-------------LKYFV--DDD--GIQ----I-----------------------------------------------
D7JGQ9_9BACT/71-172-------------LKVIV--DKG--TIY----I-----------------------------------------------
B8G387_CHLAD/77-176-------------LRYTI--DRN--GLY----I-----------------------------------------------
F2KQG8_ARCVS/58-157-------------KEVLL--EDG--GVV----I-----------------------------------------------
B1I1Z1_DESAP/63-162-------------RGFRV--SPE--GVI----I-----------------------------------------------
F0KD96_CLOAE/63-164-------------LKYCY--DNE--NFY----V-----------------------------------------------
A3HRM5_9BACT/66-167-------------RRYTI--GEG--KLT----I-----------------------------------------------
B1BDC7_CLOBO/63-164-------------LKYII--DED--YLH----I-----------------------------------------------
E8N364_ANATU/72-171-------------GQYIL--ERE--GLR----L-----------------------------------------------
A2BJK7_HYPBU/63-163-------------VRASL--DID--TLH----V-----------------------------------------------
E1II11_9CHLR/77-175-------------LSYGL--DRN--GFY----I-----------------------------------------------

PF06713

YYAB_BACSU/60-136-------------LKYVL..KEH--HLI----I-----------------------------------------------
A7GTV4_BACCN/61-123-------------KKHIV..KNG--VL.----.-----------------------------------------------
A6T2Q0_JANMA/61-134-------------TRYTL..EAS--RLL----V-----------------------------------------------
Q5WGJ5_BACSK/65-143-------------IKFVL..TEE--HLL----I-----------------------------------------------
Q5WLL6_BACSK/65-138-------------TGYTL..SGS--RLK----I-----------------------------------------------
Q6HLV3_BACHK/52-125-------------TKYIV..GEE--TIT----I-----------------------------------------------
Q5WBM1_BACSK/61-138-------------MYYEL..QEE--GLY----V-----------------------------------------------
Q8A2X0_BACTN/53-129-------------TVYTV.STDG--VLE----I-----------------------------------------------
Q9K9B1_BACHD/42-116-------------TYDRI..DGD--RLF----A-----------------------------------------------
Q650Q2_BACFR/53-129-------------TVYTV.TADG--LLL----L-----------------------------------------------
A6KZD8_BACV8/54-130-------------STYTL.TADG--KLV----V-----------------------------------------------
A5WI48_PSYWF/64-136-------------IKYTL..TAD--TLL----V-----------------------------------------------
Q8ELH5_OCEIH/56-129-------------TRYRI..DNN--TLR----I-----------------------------------------------
A4BZG7_9FLAO/58-133-------------TSYKI..ENN--EFI----Y-----------------------------------------------
Q9KEX6_BACHD/65-138-------------TGYTV..TED--WLV----I-----------------------------------------------
Q67SW8_SYMTH/62-135-------------TGYAV..TEN--ELV----I-----------------------------------------------
Q633A6_BACCZ/61-123-------------KKHKV..ENG--VL.----.-----------------------------------------------
A7UYW5_BACUN/53-129-------------TTYTV.TPDG--KLV----L-----------------------------------------------
Q813R4_BACCR/53-128-------------SHYNI..TES--SLV----V-----------------------------------------------
Q5WM07_BACSK/64-139-------------TKYVLKPDSR--TIV----V-----------------------------------------------
Q8ETD0_OCEIH/64-141-------------LCYIF..FYD--YLL----V-----------------------------------------------
A9VJV3_BACWK/52-125-------------TKYIV..KEE--III----I-----------------------------------------------
Q2BCY1_9BACI/62-139-------------VKYIF..YKD--CLF----I-----------------------------------------------
A7AH02_9PORP/54-129-------------TWYKI.TADG--HLI----A-----------------------------------------------
A4ASP1_MARSH/60-135-------------TNYEL..HKD--GFI----Y-----------------------------------------------
A7LYH2_BACOV/53-129-------------TTYTL.TTDG--NLE----V-----------------------------------------------
A6KZD7_BACV8/56-123-------------TIYIV.KDNG--VLE----I-----------------------------------------------
A4CQ29_ROBBH/54-128-------------IRYEL..REE--TLH----V-----------------------------------------------
Q4V1T4_BACCZ/53-127-------------STYKI..TDK--SLI----I-----------------------------------------------
A6EQ87_9BACT/59-133-------------TRYKI..LGT--ELQ----I-----------------------------------------------
A4ANC2_MARSH/53-127-------------TYYVI..DGK--TLK----V-----------------------------------------------
A3J6N6_9FLAO/59-136-------------TFYKI..ENT--CLH----W-----------------------------------------------
A7GNM9_BACCN/53-127-------------STYKF..TSS--SLI----I-----------------------------------------------
Q64WH9_BACFR/55-123-------------CKYIV.KQNG--DLQ----I-----------------------------------------------
Q5WDR5_BACSK/61-138-------------ITYEL..KEE--GLF----V-----------------------------------------------
Q8EQJ6_OCEIH/52-125-------------TGYRI..DND--KIL----I-----------------------------------------------
A6CHZ7_9BACI/57-130-------------TCYIF..KEQ--KLL----I-----------------------------------------------
Q99IS9_9BACT/61-134-------------TRYVL..GQG--QLR----V-----------------------------------------------
A6TN63_ALKMQ/64-137-------------TNYGI..SKG--ILK----I-----------------------------------------------
A5ZET0_9BACE/53-129-------------TAYTV.TTNG--NIE----I-----------------------------------------------
A6LGE4_PARD8/53-128-------------TYYRI.TEDD--MLI----A-----------------------------------------------
Q7USX7_RHOBA/65-137-------------CRYTL..LDD--ALS----I-----------------------------------------------
Q81GH2_BACCR/2-75-------------AKYIA..EKE--TIT----I-----------------------------------------------
A6CKW3_9BACI/69-152-------------TYYEI..NDR--VLR----I-----------------------------------------------
Q8CV26_OCEIH/61-135-------------TGYQI..VND--IVK----V-----------------------------------------------
A3XNY3_LEEBM/58-133-------------TSYSL..TSS--FLN----Y-----------------------------------------------

PF14470

A1KX55_9CAUD/97-188------------------------------------------------C--TD-L---R---LLFLDK---..GM-----
B1BWF3_CLOPF/113-210------------------------------------------------I--TN-K---R---IIMAQK---..KQ-----
B6QZJ6_9RHOB/59-150------------------------------------------------L--TD-K---R---VIFLDK---..GM-----
D0G8V7_CLOBO/33-124------------------------------------------------C--TN-K---R---VIFLDK---..GM-----
Q73PJ3_TREDE/33-124------------------------------------------------C--TE-E---R---IILLDK---..GM-----
Q8XP28_CLOPE/122-213------------------------------------------------C--TN-K---R---VLMLDK---..GM-----
D4GR98_HALVD/78-183------------------------------------------------V--TD-Q---R---IILTAA---..G.-----
D4GR98_HALVD/240-354------------------------------------------------A--TN-K---R---VVVKIP---..Q.-----
C7N8P3_LEPBD/33-124------------------------------------------------S--TS-K---R---IIFLDK---..GM-----
Q1CPJ8_STRPF/52-143------------------------------------------------L--TQ-K---R---ILFIDK---..GM-----
B4TIA1_SALHS/41-132------------------------------------------------L--TN-K---R---VIFLDK---..GM-----
E6L634_9PROT/33-123------------------------------------------------A--TN-K---R---LIFVNK---..SI-----
A7GAX1_CLOBL/113-210------------------------------------------------I--TN-R---R---IMLSQK---..SA-----
Q9B015_9CAUD/43-134------------------------------------------------I--TN-F---R---LFFLNN---..GM-----
C9MW71_9FUSO/32-123------------------------------------------------S--TS-K---R---IILLDK---..GM-----
D0ABI1_ENTFC/115-211------------------------------------------------L--TN-K---R---LIVAQQ---..KM-----
C2EMA4_9LACO/66-157------------------------------------------------C--TN-Q---R---LIILSK---..KM-----
C2NBD8_BACCE/105-201------------------------------------------------I--SN-K---R---IMFGQK---..TM-----
A0RJ01_BACAH/12-110------------------------------------------------L--TN-K---R---LFFYGP---..DV-----
D1Y7N3_9BACT/74-169------------------------------------------------A--TN-R---R---FMVLDS---..GI-----
B0A9U9_9FIRM/35-125------------------------------------------------C--TD-E---R---VVLLDK---..GI-----
C2NVG4_BACCE/15-112------------------------------------------------A--TN-K---R---LLFFSQ---..Y.-----
C5QQG0_STAEP/16-114------------------------------------------------A--TN-Q---R---VIFFSK---..R.-----
C9S1F4_GEOSY/15-114------------------------------------------------A--TD-R---R---LVFYGK---..RT-----
D9STE0_CLOC7/154-250------------------------------------------------V--TD-K---R---FIMAQK---..KM-----
D4YUJ5_9LACO/65-159------------------------------------------------C--TN-Q---R---LIILSK---..KI-----
C2WDE4_BACCE/12-110------------------------------------------------L--TN-K---R---LFFCGP---..DV-----
F0BTF6_9XANT/28-122------------------------------------------------L--TN-R---R---FIVVYP---..KL-----
C2RX88_BACCE/12-111------------------------------------------------A--TN-K---R---LFFYGP---..DL-----
F0PPB5_BACT0/12-116------------------------------------------------A--TN-K---R---LLFCSD---..AM-----
A0M4L3_GRAFK/28-124------------------------------------------------L--TN-K---R---IIFCRP---..KS-----
C2PSH1_BACCE/35-136------------------------------------------------A--TN-R---R---VIFYGQ---SFKC-----
E4SKV3_LACAR/66-157------------------------------------------------C--TN-Q---N---LIILSK---..KH-----
C2X664_BACCE/12-105------------------------------------------------A--TT-R---R---LLFYGK---..FP-----
Q4L537_STAHJ/16-114------------------------------------------------A--TD-E---R---IIFCAK---..R.-----
B1RCX7_CLOPF/12-109------------------------------------------------A--TN-K---R---VFFYEL---..N.-----
D5BGD3_ZUNPS/37-134------------------------------------------------L--TN-K---R---IIFCRP---..KT-----
C3I3B9_BACTU/68-162------------------------------------------------L--TD-K---R---YIYYGI---..R.-----
A2BKM8_HYPBU/14-108------------------------------------------------V--TT-R---R---IIVFDE---..KL-----
B3Z200_BACCE/12-116------------------------------------------------A--TN-K---R---LLFCAD---..YM-----
Q5JHI4_PYRKO/17-110------------------------------------------------V--TD-R---R---IIYLDE---..KV-----
Y689_ARCFU/15-109------------------------------------------------V--TD-R---R---IIYLDQ---..KI-----
F0NRS4_LACHH/66-157------------------------------------------------C--SN-R---N---LIILKK---..KH-----
E5WCD5_9BACI/12-111------------------------------------------------A--TN-K---R---LLFYGI---PASG-----
A3J3Z6_9FLAO/29-125------------------------------------------------V--TN-K---R---IILCKP---..KN-----
Q6HPH0_BACHK/12-105------------------------------------------------A--TT-R---R---LLFYGK---..FP-----
A3V5V9_9RHOB/43-146------------------------------------------------L--TS-E---R---VLCLDH---..AM-----
C6XZU2_PEDHD/28-124------------------------------------------------V--SN-K---R---IFYC<