Sequence alignment for CL0266

PF10882

D2RH36_ARCPA/66-169--------------------------------------------------------------------------------
Q892T1_CLOTE/66-167--------------------------------------------------------------------------------
A5N6R3_CLOK5/63-164--------------------------------------------------------------------------------
A9B463_HERA2/77-175--------------------------------------------------------------------------------
D9SW68_CLOC7/63-164--------------------------------------------------------------------------------
Q67L16_SYMTH/48-147--------------------------------------------------------------------------------
D5XC81_THEPJ/68-168--------------------------------------------------------------------------------
C5CH43_KOSOT/70-173--------------------------------------------------------------------------------
F2KQG8_ARCVS/58-157--------------------------------------------------------------------------------
B1I1Z1_DESAP/63-162--------------------------------------------------------------------------------
A3HRM5_9BACT/66-167--------------------------------------------------------------------------------
E8N364_ANATU/72-171--------------------------------------------------------------------------------
A2BJK7_HYPBU/63-163--------------------------------------------------------------------------------
A5I617_CLOBH/64-163--------------------------------------------------------------------------------
A6L350_BACV8/68-162--------------------------------------------------------------------------------
A9WIF8_CHLAA/77-175--------------------------------------------------------------------------------
Y1301_CLOAB/63-163--------------------------------------------------------------------------------
Q8XIV7_CLOPE/64-163--------------------------------------------------------------------------------
U5S0J0_9CLOT/64-164--------------------------------------------------------------------------------

PF06713

L8ATU0_BACIU/60-136--------------------------------------------------------------------------------
A7GTV4_BACCN/61-123--------------------------------------------------------------------------------
A6T2Q0_JANMA/61-134--------------------------------------------------------------------------------
Q5WGJ5_BACSK/65-143--------------------------------------------------------------------------------
Q5WLL6_BACSK/65-138--------------------------------------------------------------------------------
Q6HLV3_BACHK/52-125--------------------------------------------------------------------------------
Q5WBM1_BACSK/61-138--------------------------------------------------------------------------------
D7IH66_9BACE/53-129--------------------------------------------------------------------------------
Q9K9B1_BACHD/42-116--------------------------------------------------------------------------------
A0A015MXD4_BACFG/53-129--------------------------------------------------------------------------------
A6KZD8_BACV8/54-130--------------------------------------------------------------------------------
A5WI48_PSYWF/64-136--------------------------------------------------------------------------------
Q8ELH5_OCEIH/56-129--------------------------------------------------------------------------------
A4BZG7_9FLAO/58-133--------------------------------------------------------------------------------
Q9KEX6_BACHD/65-138--------------------------------------------------------------------------------
Q67SW8_SYMTH/62-135--------------------------------------------------------------------------------
Q633A6_BACCZ/61-123--------------------------------------------------------------------------------
A7UYW5_BACUN/53-129--------------------------------------------------------------------------------
C2SZ95_BACCE/53-128--------------------------------------------------------------------------------
Q5WM07_BACSK/64-139--------------------------------------------------------------------------------
Q8ETD0_OCEIH/64-141--------------------------------------------------------------------------------
A9VJV3_BACWK/52-125--------------------------------------------------------------------------------
Q2BCY1_9BACI/62-139--------------------------------------------------------------------------------
A7AH02_9PORP/54-129--------------------------------------------------------------------------------
A4ASP1_MARSH/60-135--------------------------------------------------------------------------------
A7LYH2_BACO1/53-129--------------------------------------------------------------------------------
A6KZD7_BACV8/56-123--------------------------------------------------------------------------------
A4CQ29_ROBBH/54-128--------------------------------------------------------------------------------
Q4V1T4_BACCZ/53-127--------------------------------------------------------------------------------
A6EQ87_9BACT/59-133--------------------------------------------------------------------------------
A4ANC2_MARSH/53-127--------------------------------------------------------------------------------
A3J6N6_9FLAO/59-136--------------------------------------------------------------------------------
A7GNM9_BACCN/53-127--------------------------------------------------------------------------------
A0A016A011_BACFG/55-123--------------------------------------------------------------------------------
Q5WDR5_BACSK/61-138--------------------------------------------------------------------------------
Q8EQJ6_OCEIH/52-125--------------------------------------------------------------------------------
A6CHZ7_9BACI/57-130--------------------------------------------------------------------------------
Q99IS9_9BACT/61-134--------------------------------------------------------------------------------
A6TN63_ALKMQ/64-137--------------------------------------------------------------------------------
A5ZET0_9BACE/53-129--------------------------------------------------------------------------------
A6LGE4_PARD8/53-128--------------------------------------------------------------------------------
K5DA95_RHOBT/65-137--------------------------------------------------------------------------------
C2SXV9_BACCE/2-75--------------------------------------------------------------------------------
A6CKW3_9BACI/69-152--------------------------------------------------------------------------------
Q8CV26_OCEIH/61-135--------------------------------------------------------------------------------
A3XNY3_LEEBM/58-133--------------------------------------------------------------------------------

PF15405

A7TQH3_VANPO/867-996--------------------------------------------------------------------------------
A8QCG1_MALGO/650-787--------------------------------------------------------------------------------
B6HR54_PENCW/741-867--------------------------------------------------------------------------------
B6K4Z0_SCHJY/799-929--------------------------------------------------------------------------------
B6K7Q5_SCHJY/658-790--------------------------------------------------------------------------------
C5DFA7_LACTC/775-905--------------------------------------------------------------------------------
D5G4S8_TUBMM/733-864--------------------------------------------------------------------------------
D6RNQ8_COPC7/510-650--------------------------------------------------------------------------------
E3KTU1_PUCGT/826-974--------------------------------------------------------------------------------
E4ZWW2_LEPMJ/934-1064--------------------------------------------------------------------------------
F0XUN9_GROCL/777-902--------------------------------------------------------------------------------
F2Z621_KLULA/763-894--------------------------------------------------------------------------------
F9X7Y7_MYCGM/750-877--------------------------------------------------------------------------------
G0V5Q3_NAUCC/849-979--------------------------------------------------------------------------------
G1XBW2_ARTOA/827-954--------------------------------------------------------------------------------
G2WW94_VERDV/764-891--------------------------------------------------------------------------------
G2YJS9_BOTF4/50-174--------------------------------------------------------------------------------
G4NKJ4_MAGO7/790-913--------------------------------------------------------------------------------
G7DY91_MIXOS/924-1056--------------------------------------------------------------------------------
G8BPI3_TETPH/796-928--------------------------------------------------------------------------------
G8ZUV3_TORDC/841-971--------------------------------------------------------------------------------
G9N7F4_HYPVG/769-895--------------------------------------------------------------------------------
H1UV38_COLHI/767-893--------------------------------------------------------------------------------
I1BJ67_RHIO9/768-907--------------------------------------------------------------------------------
I1BQA0_RHIO9/235-373--------------------------------------------------------------------------------
I1C1X6_RHIO9/740-879--------------------------------------------------------------------------------
Q4P7K1_USTMA/348-484--------------------------------------------------------------------------------
Q6CDY6_YARLI/831-954--------------------------------------------------------------------------------
Q752J0_ASHGO/816-948--------------------------------------------------------------------------------
RGF2_SCHPO/670-802--------------------------------------------------------------------------------
RGF1_SCHPO/844-972--------------------------------------------------------------------------------
E7NHW6_YEASO/518-648--------------------------------------------------------------------------------
F8Q550_SERL3/776-912--------------------------------------------------------------------------------
G4U7U0_NEUT9/784-907--------------------------------------------------------------------------------
Q4WUI2_ASPFU/728-851--------------------------------------------------------------------------------
Q5KB00_CRYNJ/694-836--------------------------------------------------------------------------------
W1QFJ3_OGAPD/758-896--------------------------------------------------------------------------------

PF16652

F4Q0K6_DICFS/582-649--------------------------------------------------------------------------------
I1FPV5_AMPQE/1081-1156--------------------------------------------------------------------------------
H3D2Y5_TETNG/477-540--------------------------------------------------------------------------------
F1RB67_DANRE/459-521--------------------------------------------------------------------------------
E7F4U1_DANRE/476-538--------------------------------------------------------------------------------
A2RUX1_DANRE/474-535--------------------------------------------------------------------------------
H2VDT5_TAKRU/287-350--------------------------------------------------------------------------------
M4AJZ7_XIPMA/768-830--------------------------------------------------------------------------------
G1KIR4_ANOCA/1103-1165--------------------------------------------------------------------------------
M4A6K1_XIPMA/1086-1148--------------------------------------------------------------------------------
G3PXN6_GASAC/306-375--------------------------------------------------------------------------------
F6ZCG9_XENTR/229-291--------------------------------------------------------------------------------
I1U3D6_ORYLA/350-412--------------------------------------------------------------------------------
F1NJU1_CHICK/482-544--------------------------------------------------------------------------------
E1B9G8_BOVIN/334-396--------------------------------------------------------------------------------
Q16R60_AEDAE/362-435--------------------------------------------------------------------------------
Q7PMK0_ANOGA/1503-1577--------------------------------------------------------------------------------
B3MD72_DROAN/1772-1839--------------------------------------------------------------------------------
B4MQQ2_DROWI/1788-1856--------------------------------------------------------------------------------
G6CLT4_DANPL/748-815--------------------------------------------------------------------------------
H3E6I2_PRIPA/644-713--------------------------------------------------------------------------------
G0MI70_CAEBE/978-1047--------------------------------------------------------------------------------
F1KQK1_ASCSU/1029-1098--------------------------------------------------------------------------------
J9FEQ9_WUCBA/734-803--------------------------------------------------------------------------------
L7MEV5_9ACAR/1159-1235--------------------------------------------------------------------------------
B7QI72_IXOSC/241-315--------------------------------------------------------------------------------
K1RR99_CRAGI/1042-1116--------------------------------------------------------------------------------
B3SCV3_TRIAD/907-987--------------------------------------------------------------------------------
F1QUN4_DANRE/946-1020--------------------------------------------------------------------------------
H2RNA8_TAKRU/921-999--------------------------------------------------------------------------------
I3KR26_ORENI/954-1032--------------------------------------------------------------------------------
R7VJM8_CAPTE/1319-1392--------------------------------------------------------------------------------
C3XR85_BRAFL/199-274--------------------------------------------------------------------------------
A7SRI8_NEMVE/240-313--------------------------------------------------------------------------------
B0JZC2_XENTR/705-778--------------------------------------------------------------------------------
M3W909_FELCA/644-717--------------------------------------------------------------------------------
F7DVU8_ORNAN/534-606--------------------------------------------------------------------------------
J9JQX8_ACYPI/1076-1146--------------------------------------------------------------------------------
H9K9Y6_APIME/1712-1783--------------------------------------------------------------------------------
E9GNC8_DAPPU/245-319--------------------------------------------------------------------------------
R4WDG5_9HEMI/459-523--------------------------------------------------------------------------------
H3CRZ0_TETNG/625-698--------------------------------------------------------------------------------
M3ZX67_XIPMA/702-775--------------------------------------------------------------------------------
H3AFG5_LATCH/610-683--------------------------------------------------------------------------------
H1A431_TAEGU/397-468--------------------------------------------------------------------------------
Q6XS95_XENLA/999-1072--------------------------------------------------------------------------------
H2TY33_TAKRU/922-995--------------------------------------------------------------------------------
H9GMJ3_ANOCA/960-1033--------------------------------------------------------------------------------
F7E9P4_XENTR/995-1064--------------------------------------------------------------------------------
F6WE69_HORSE/989-1062--------------------------------------------------------------------------------
E7FDV8_DANRE/967-1040--------------------------------------------------------------------------------
L8HIM8_ACACA/86-163--------------------------------------------------------------------------------
G4M1K0_SCHMA/1380-1453--------------------------------------------------------------------------------
E9C6R0_CAPO3/758-815--------------------------------------------------------------------------------
I1FJT4_AMPQE/34-101--------------------------------------------------------------------------------
E9CIT4_CAPO3/1629-1696--------------------------------------------------------------------------------
H6QNV2_PUCGT/1939-2007--------------------------------------------------------------------------------
F4S205_MELLP/1799-1860--------------------------------------------------------------------------------
E5SHC2_TRISP/1437-1506--------------------------------------------------------------------------------
F1KQJ6_ASCSU/1385-1453--------------------------------------------------------------------------------
A8NHP3_BRUMA/115-184--------------------------------------------------------------------------------
E2B7P2_HARSA/286-356--------------------------------------------------------------------------------
K7JHQ7_NASVI/280-349--------------------------------------------------------------------------------
D6WH10_TRICA/455-522--------------------------------------------------------------------------------
N6TRI8_DENPD/1372-1439--------------------------------------------------------------------------------
E9GGN7_DAPPU/1507-1577--------------------------------------------------------------------------------
B7PVP6_IXOSC/339-409--------------------------------------------------------------------------------
K1RGX4_CRAGI/988-1055--------------------------------------------------------------------------------
R7US78_CAPTE/312-382--------------------------------------------------------------------------------
A7RUY7_NEMVE/99-171--------------------------------------------------------------------------------
C3ZLK0_BRAFL/982-1048--------------------------------------------------------------------------------
H2XVQ2_CIOIN/1434-1504--------------------------------------------------------------------------------
G1QVX0_NOMLE/237-307--------------------------------------------------------------------------------
F1R0Z9_DANRE/1475-1545--------------------------------------------------------------------------------
A3KQK0_DANRE/238-307--------------------------------------------------------------------------------
H3DK01_TETNG/1364-1434--------------------------------------------------------------------------------
I3IVP3_ORENI/1445-1515--------------------------------------------------------------------------------
I4YGU5_WALSC/1457-1509--------------------------------------------------------------------------------
G7DWX8_MIXOS/1684-1737--------------------------------------------------------------------------------
M7XIH0_RHOT1/1697-1751--------------------------------------------------------------------------------
G4TEE5_PIRID/1837-1889--------------------------------------------------------------------------------
M5GAJ2_DACSP/1877-1929--------------------------------------------------------------------------------
R7SD96_TREMS/1940-1990--------------------------------------------------------------------------------
E2L4V2_MONPE/64-116--------------------------------------------------------------------------------
J9VV31_CRYNH/1828-1878--------------------------------------------------------------------------------
R7SKN3_DICSQ/1831-1883--------------------------------------------------------------------------------
D8PUQ3_SCHCM/1823-1875--------------------------------------------------------------------------------
M2QQ29_CERS8/915-967--------------------------------------------------------------------------------
K5XIT5_AGABU/1929-1981--------------------------------------------------------------------------------
A8PA90_COPC7/1965-2017--------------------------------------------------------------------------------
B0D2P7_LACBS/1825-1877--------------------------------------------------------------------------------

PF15410

E5RJ29_HUMAN/721-832--------------------------------------------------------------------------------
H2SLA8_TAKRU/516-627--------------------------------------------------------------------------------
B7QFP5_IXOSC/177-288--------------------------------------------------------------------------------
I1BQ29_RHIO9/379-506--------------------------------------------------------------------------------
D4YWC5_CAEEL/387-497--------------------------------------------------------------------------------
E3JSD7_PUCGT/1317-1461--------------------------------------------------------------------------------
YDYB_SCHPO/679-804--------------------------------------------------------------------------------
F6X1S7_XENTR/10-124--------------------------------------------------------------------------------
E9H3M8_DAPPU/491-615--------------------------------------------------------------------------------
G4VKT4_SCHMA/511-627--------------------------------------------------------------------------------
E5SKG2_TRISP/325-435--------------------------------------------------------------------------------
I1CBT7_RHIO9/688-826--------------------------------------------------------------------------------
A8PYL1_BRUMA/369-479--------------------------------------------------------------------------------
E1JIT7_DROME/792-903--------------------------------------------------------------------------------
U1M7X4_ASCSU/467-577--------------------------------------------------------------------------------
W5JQ26_ANODA/1159-1272--------------------------------------------------------------------------------

PF00169

CTRO_MOUSE/1470-1589--------------------------------------------------------------------------------
ARHG6_HUMAN/450-548--------------------------------------------------------------------------------
SPTCB_DROME/2148-2259--------------------------------------------------------------------------------
CA120_YEAST/76-204--------------------------------------------------------------------------------
VAV_RAT/403-504--------------------------------------------------------------------------------
PLCD4_RAT/17-124--------------------------------------------------------------------------------
PLD1_HUMAN/220-328--------------------------------------------------------------------------------
ARHG5_HUMAN/1391-1502--------------------------------------------------------------------------------
Q93569_CAEEL/7-101--------------------------------------------------------------------------------
SOS2_MOUSE/443-545--------------------------------------------------------------------------------
PSD1_HUMAN/757-869--------------------------------------------------------------------------------
YHT1_YEAST/194-304--------------------------------------------------------------------------------
SIP3_YEAST/310-423--------------------------------------------------------------------------------
YOTB_CAEEL/36-131--------------------------------------------------------------------------------
ARHG8_HUMAN/387-501--------------------------------------------------------------------------------
TIAM1_MOUSE/1261-1395--------------------------------------------------------------------------------
DOK1_HUMAN/4-119--------------------------------------------------------------------------------
BMX_HUMAN/5-111--------------------------------------------------------------------------------
CAPS1_MOUSE/520-622--------------------------------------------------------------------------------
PLCG1_HUMAN/33-142--------------------------------------------------------------------------------
PLEK_HUMAN/245-347--------------------------------------------------------------------------------
RDCII_DICDI/354-461--------------------------------------------------------------------------------
OSH2_YEAST/290-386--------------------------------------------------------------------------------
GRB7_MOUSE/229-341--------------------------------------------------------------------------------
TIAM1_MOUSE/434-547--------------------------------------------------------------------------------
SLM1_YEAST/469-581--------------------------------------------------------------------------------
TG325_CAEEL/387-505--------------------------------------------------------------------------------
CYH1_HUMAN/261-377--------------------------------------------------------------------------------
SIF1_DROME/849-955--------------------------------------------------------------------------------
RGA2_SCHPO/720-836--------------------------------------------------------------------------------
APSA_EMENI/1394-1504--------------------------------------------------------------------------------
SH2B1_RAT/247-376--------------------------------------------------------------------------------
Q17777_CAEEL/241-343--------------------------------------------------------------------------------
MIG10_CAEEL/457-566--------------------------------------------------------------------------------
SNT1_CAEEL/228-340--------------------------------------------------------------------------------
GAB1_HUMAN/6-116--------------------------------------------------------------------------------
BUD4_CANAL/1577-1685--------------------------------------------------------------------------------
SKM1_YEAST/4-118--------------------------------------------------------------------------------
SECG_DICDI/785-895--------------------------------------------------------------------------------
VAV2_MOUSE/401-502--------------------------------------------------------------------------------
PLEK_HUMAN/5-101--------------------------------------------------------------------------------
ARHGG_HUMAN/502-620--------------------------------------------------------------------------------
AKT1_DROME/107-211--------------------------------------------------------------------------------
PLCL1_RAT/115-224--------------------------------------------------------------------------------
FGD1_HUMAN/822-921--------------------------------------------------------------------------------
ARHG2_MOUSE/474-572--------------------------------------------------------------------------------
RHG25_HUMAN/47-151--------------------------------------------------------------------------------
FGD1_HUMAN/591-689--------------------------------------------------------------------------------
AKT2_MOUSE/6-108--------------------------------------------------------------------------------
ATG26_YEAST/239-336--------------------------------------------------------------------------------
Q21025_CAEEL/833-940--------------------------------------------------------------------------------
BEM2_YEAST/1832-1948--------------------------------------------------------------------------------
ITK_MOUSE/5-117--------------------------------------------------------------------------------
DOS_DROME/4-113--------------------------------------------------------------------------------
CRAC_DICDI/23-122--------------------------------------------------------------------------------
SIF1_DROME/1672-1793--------------------------------------------------------------------------------
SPTB2_HUMAN/2198-2307--------------------------------------------------------------------------------
TRIO_HUMAN/2158-2271--------------------------------------------------------------------------------
MUG79_SCHPO/1044-1158--------------------------------------------------------------------------------
SHK2_SCHPO/24-125--------------------------------------------------------------------------------
NUM1_YEAST/2574-2683--------------------------------------------------------------------------------
Q18420_CAEEL/249-346--------------------------------------------------------------------------------
ACAP1_HUMAN/266-360--------------------------------------------------------------------------------
ANLN_DROME/1107-1230--------------------------------------------------------------------------------
SEC74_SCHPO/549-677--------------------------------------------------------------------------------
GRP1_CAEEL/262-380--------------------------------------------------------------------------------
UN104_CAEEL/1461-1558--------------------------------------------------------------------------------
KPCD1_HUMAN/423-541--------------------------------------------------------------------------------
RGRF2_MOUSE/23-133--------------------------------------------------------------------------------
ANI2_CAEEL/893-1005--------------------------------------------------------------------------------
SKG3_YEAST/91-221--------------------------------------------------------------------------------
3BP2_MOUSE/27-130--------------------------------------------------------------------------------
RGRF1_RAT/457-582--------------------------------------------------------------------------------
CNT6_SCHPO/527-632--------------------------------------------------------------------------------
BOI2_YEAST/769-887--------------------------------------------------------------------------------
PAC1_CAEEL/612-726--------------------------------------------------------------------------------
YP091_YEAST/135-266--------------------------------------------------------------------------------
TEC_MOUSE/5-111--------------------------------------------------------------------------------
BTK_HUMAN/4-133--------------------------------------------------------------------------------
GPRK1_DROME/558-657--------------------------------------------------------------------------------
YSP1_YEAST/309-421--------------------------------------------------------------------------------
MPRIP_MOUSE/387-482--------------------------------------------------------------------------------
RASA2_RAT/604-704--------------------------------------------------------------------------------
GRB10_HUMAN/291-399--------------------------------------------------------------------------------
VAV_CAEEL/471-598--------------------------------------------------------------------------------
SOS_DROME/481-588--------------------------------------------------------------------------------
YB35_SCHPO/255-349--------------------------------------------------------------------------------
O02134_CAEEL/257-375--------------------------------------------------------------------------------
UN112_CAEEL/406-507--------------------------------------------------------------------------------
TRIO_HUMAN/1480-1591--------------------------------------------------------------------------------
RHG26_CHICK/266-369--------------------------------------------------------------------------------
PHLB1_RAT/722-824--------------------------------------------------------------------------------
ABR_HUMAN/302-459--------------------------------------------------------------------------------
RGRF1_RAT/23-129--------------------------------------------------------------------------------
SNTB1_HUMAN/323-433--------------------------------------------------------------------------------
AFAP1_CHICK/154-249--------------------------------------------------------------------------------
OPY1_YEAST/216-318--------------------------------------------------------------------------------
KIF1A_MOUSE/1581-1678--------------------------------------------------------------------------------
ARHG7_HUMAN/480-578--------------------------------------------------------------------------------
BUD4_YEAST/1303-1413--------------------------------------------------------------------------------
DYN1_RAT/520-625--------------------------------------------------------------------------------
Q20151_CAEEL/20-135--------------------------------------------------------------------------------
SNTA1_RABIT/294-401--------------------------------------------------------------------------------
BEM3_YEAST/635-741--------------------------------------------------------------------------------
RGPS1_HUMAN/432-543--------------------------------------------------------------------------------
AKT1_CAEEL/16-118--------------------------------------------------------------------------------
AKP13_HUMAN/2232-2333--------------------------------------------------------------------------------
F4JNE2_ARATH/803-908--------------------------------------------------------------------------------
O88768_RAT/254-355--------------------------------------------------------------------------------
Q57YQ0_TRYB2/332-428--------------------------------------------------------------------------------
Q7KV69_DROME/3748-3851--------------------------------------------------------------------------------
Q8MSU1_DROME/95-195--------------------------------------------------------------------------------

PF15409

B6JVE7_SCHJY/144-232--------------------------------------------------------------------------------
E3RG70_PYRTT/221-309--------------------------------------------------------------------------------
H1VVI1_COLHI/216-304--------------------------------------------------------------------------------
C8VHJ7_EMENI/110-198--------------------------------------------------------------------------------
Q6C4Y2_YARLI/155-243--------------------------------------------------------------------------------
G3B6N0_CANTC/156-243--------------------------------------------------------------------------------
A3LTM2_PICST/192-279--------------------------------------------------------------------------------
G8YKE6_PICSO/214-301--------------------------------------------------------------------------------
F2UGB6_SALR5/1490-1577--------------------------------------------------------------------------------
C5GMH2_AJEDR/215-302--------------------------------------------------------------------------------
G8BIT9_CANPC/202-289--------------------------------------------------------------------------------

PF15413

E9C7L7_CAPO3/130-226--------------------------------------------------------------------------------
C4Y4Q1_CLAL4/136-269--------------------------------------------------------------------------------
D7KQC6_ARALL/95-227--------------------------------------------------------------------------------
C6HG43_AJECH/87-193--------------------------------------------------------------------------------
E5T4G3_TRISP/39-138--------------------------------------------------------------------------------
A0CUJ8_PARTE/105-200--------------------------------------------------------------------------------
A7SI59_NEMVE/523-628--------------------------------------------------------------------------------

PF15406

B6K769_SCHJY/110-235--------------------------------------------------------------------------------
G2X9M4_VERDV/99-204--------------------------------------------------------------------------------
E3Q3I3_COLGM/92-197--------------------------------------------------------------------------------
G4MXJ0_MAGO7/107-216--------------------------------------------------------------------------------
G2PZQ3_THIHA/101-208--------------------------------------------------------------------------------
G4UAB8_NEUT9/95-202--------------------------------------------------------------------------------
B2A9W4_PODAN/92-199--------------------------------------------------------------------------------
F9G078_FUSOF/114-219--------------------------------------------------------------------------------
H0EZ07_GLAL7/83-191--------------------------------------------------------------------------------
G0SHV9_CHATD/90-197--------------------------------------------------------------------------------
F0XAK4_GROCL/91-200--------------------------------------------------------------------------------
H6BUU9_EXODN/90-198--------------------------------------------------------------------------------

PF14593

Q7PUX5_ANOGA/445-547--------------------------------------------------------------------------------
D6WGV3_TRICA/369-471--------------------------------------------------------------------------------
E2A088_CAMFO/460-562--------------------------------------------------------------------------------
PDPK1_MOUSE/449-551--------------------------------------------------------------------------------
A8XME2_CAEBR/317-419--------------------------------------------------------------------------------
F0ZQF1_DICPU/137-240--------------------------------------------------------------------------------
Q172S2_AEDAE/402-506--------------------------------------------------------------------------------
E3MA10_CAERE/460-562--------------------------------------------------------------------------------
A8X5P7_CAEBR/474-576--------------------------------------------------------------------------------
D2VK59_NAEGR/353-456--------------------------------------------------------------------------------
B5DR97_DROPS/703-805--------------------------------------------------------------------------------
D8QMJ5_SELML/388-489--------------------------------------------------------------------------------
E9CBD6_CAPO3/483-586--------------------------------------------------------------------------------
C4QMA7_SCHMA/364-466--------------------------------------------------------------------------------
F0ZSM2_DICPU/404-506--------------------------------------------------------------------------------
B0X1B0_CULQU/404-508--------------------------------------------------------------------------------
E5SYD2_TRISP/403-505--------------------------------------------------------------------------------
E4XZ21_OIKDI/382-502--------------------------------------------------------------------------------
A2DAR5_TRIVA/371-472--------------------------------------------------------------------------------
F0ZMQ8_DICPU/111-220--------------------------------------------------------------------------------
D3BJW1_POLPA/401-501--------------------------------------------------------------------------------
E9H687_DAPPU/410-512--------------------------------------------------------------------------------
D8M3A3_BLAHO/75-180--------------------------------------------------------------------------------
F2U695_SALR5/410-513--------------------------------------------------------------------------------
A8PPP4_BRUMA/451-551--------------------------------------------------------------------------------
I1NTT9_ORYGL/392-497--------------------------------------------------------------------------------
W5J907_ANODA/470-570--------------------------------------------------------------------------------

PF15411

L8FXT1_PSED2/322-458--------------------------------------------------------------------------------
U4LT07_PYROM/417-540--------------------------------------------------------------------------------
L8GCG2_PSED2/446-567--------------------------------------------------------------------------------
G8B9T7_CANPC/472-606--------------------------------------------------------------------------------
S8E8S9_FOMPI/218-342--------------------------------------------------------------------------------
C0S734_PARBP/64-174--------------------------------------------------------------------------------
E7FHG6_ASHGO/465-600--------------------------------------------------------------------------------
C5DFZ5_LACTC/451-585--------------------------------------------------------------------------------
Q5B2R3_EMENI/457-581--------------------------------------------------------------------------------
A1CE88_ASPCL/310-419--------------------------------------------------------------------------------
Q6CBW7_YARLI/468-578--------------------------------------------------------------------------------
Q5KFX7_CRYNJ/909-1028--------------------------------------------------------------------------------
C5DV96_ZYGRC/480-617--------------------------------------------------------------------------------
K0KM79_WICCF/509-632--------------------------------------------------------------------------------
J0HE23_COCIM/382-505--------------------------------------------------------------------------------
B6QI46_PENMQ/316-424--------------------------------------------------------------------------------
G7XEK3_ASPKW/313-424--------------------------------------------------------------------------------
J3QBA5_PUCT1/361-480--------------------------------------------------------------------------------
B6JVU8_SCHJY/392-503--------------------------------------------------------------------------------
I1BLT9_RHIO9/201-314--------------------------------------------------------------------------------
E6ZVA8_SPORE/482-616--------------------------------------------------------------------------------
A8PVU8_MALGO/415-566--------------------------------------------------------------------------------
M1VVE6_CLAP2/435-562--------------------------------------------------------------------------------
C4XY43_CLAL4/465-600--------------------------------------------------------------------------------
S2KBJ9_MUCC1/386-503--------------------------------------------------------------------------------
G4T894_PIRID/458-613--------------------------------------------------------------------------------
E3K951_PUCGT/463-582--------------------------------------------------------------------------------
M3J399_CANMX/484-622--------------------------------------------------------------------------------
U9SS96_RHIID/417-534--------------------------------------------------------------------------------
H6C2C5_EXODN/429-537--------------------------------------------------------------------------------
M2N2Q4_BAUCO/388-510--------------------------------------------------------------------------------
W1QFU0_OGAPD/431-554--------------------------------------------------------------------------------
Q6CTG1_KLULA/462-594--------------------------------------------------------------------------------
R7Z2B7_CONA1/307-419--------------------------------------------------------------------------------
M7X9M7_RHOT1/492-610--------------------------------------------------------------------------------
F2SVI5_TRIRC/339-454--------------------------------------------------------------------------------
R0IDL4_SETT2/326-435--------------------------------------------------------------------------------
SCD1_SCHPO/428-541--------------------------------------------------------------------------------
B0CTT2_LACBS/383-504--------------------------------------------------------------------------------
I1S1B1_GIBZE/432-552--------------------------------------------------------------------------------
M2NHU0_BAUCO/429-542--------------------------------------------------------------------------------
S3D7J5_GLAL2/462-592--------------------------------------------------------------------------------
Q2GPG0_CHAGB/419-538--------------------------------------------------------------------------------
A5E275_LODEL/534-703--------------------------------------------------------------------------------
A5DJC8_PICGU/473-589--------------------------------------------------------------------------------
D5GGD7_TUBMM/421-541--------------------------------------------------------------------------------
G8XZ82_PICSO/475-610--------------------------------------------------------------------------------
I2GVT9_TETBL/484-621--------------------------------------------------------------------------------
N1JBG8_BLUG1/461-585--------------------------------------------------------------------------------
G1XAU9_ARTOA/439-555--------------------------------------------------------------------------------
G7E2X4_MIXOS/392-510--------------------------------------------------------------------------------
B0D191_LACBS/477-620--------------------------------------------------------------------------------
B4R7P5_DROSI/265-372--------------------------------------------------------------------------------
S7ZA81_PENO1/323-431--------------------------------------------------------------------------------
S7ZSU9_PENO1/383-506--------------------------------------------------------------------------------
Q7PLZ7_ANOGA/418-525--------------------------------------------------------------------------------
N1JM33_BLUG1/404-516--------------------------------------------------------------------------------
R4XCX7_TAPDE/388-502--------------------------------------------------------------------------------
G9NQW5_HYPAI/397-517--------------------------------------------------------------------------------
Q0U2Z5_PHANO/430-542--------------------------------------------------------------------------------
H6BPC6_EXODN/387-506--------------------------------------------------------------------------------
F0X7S3_GROCL/411-531--------------------------------------------------------------------------------
G3J9K1_CORMM/455-571--------------------------------------------------------------------------------
B2VWD7_PYRTR/472-592--------------------------------------------------------------------------------
S9W2N8_SCHCR/425-538--------------------------------------------------------------------------------
Q4P6E0_USTMA/492-614--------------------------------------------------------------------------------
K5UKM2_PHACS/138-258--------------------------------------------------------------------------------
D5G6T9_TUBMM/297-409--------------------------------------------------------------------------------
C4QYR2_PICPG/477-615--------------------------------------------------------------------------------
E9CRC3_COCPS/316-427--------------------------------------------------------------------------------
G4TBK8_PIRID/436-574--------------------------------------------------------------------------------
M7TPR1_BOTF1/430-561--------------------------------------------------------------------------------
M3C0H4_SPHMS/505-618--------------------------------------------------------------------------------
D8Q9F8_SCHCM/416-560--------------------------------------------------------------------------------
U5H7X6_USTV1/405-528--------------------------------------------------------------------------------
D6RLF0_COPC7/420-561--------------------------------------------------------------------------------
M2RFB3_CERS8/410-543--------------------------------------------------------------------------------
G3ANH9_SPAPN/475-609--------------------------------------------------------------------------------
D8Q1A2_SCHCM/270-391--------------------------------------------------------------------------------
I1BWV5_RHIO9/177-288--------------------------------------------------------------------------------
R9AUY5_WALI9/1302-1440--------------------------------------------------------------------------------
M7SFW8_EUTLA/395-516--------------------------------------------------------------------------------
F9X5J1_MYCGM/456-563--------------------------------------------------------------------------------
J3PFZ1_GAGT3/436-555--------------------------------------------------------------------------------
D8Q823_SCHCM/499-642--------------------------------------------------------------------------------
V2XX15_MONRO/414-554--------------------------------------------------------------------------------
R1EWD6_BOTPV/334-449--------------------------------------------------------------------------------
F4RFQ9_MELLP/829-937--------------------------------------------------------------------------------
Q0CQU8_ASPTN/384-507--------------------------------------------------------------------------------
M7X2J5_RHOT1/436-549--------------------------------------------------------------------------------
E3K331_PUCGT/477-609--------------------------------------------------------------------------------
B8N7H3_ASPFN/313-422--------------------------------------------------------------------------------
G4TIK6_PIRID/427-548--------------------------------------------------------------------------------
S2JJT5_MUCC1/389-502--------------------------------------------------------------------------------
Q59YK6_CANAL/488-627--------------------------------------------------------------------------------
C4JQ35_UNCRE/311-422--------------------------------------------------------------------------------
K5UWD4_PHACS/357-490--------------------------------------------------------------------------------
G1X4D9_ARTOA/385-499--------------------------------------------------------------------------------
K1X859_MARBU/542-671--------------------------------------------------------------------------------
V2XVI9_MONRO/375-500--------------------------------------------------------------------------------
G7E3N8_MIXOS/651-756--------------------------------------------------------------------------------
R7YYY5_CONA1/430-547--------------------------------------------------------------------------------
C5MGV9_CANTT/489-625--------------------------------------------------------------------------------
C5FRQ7_ARTOC/318-432--------------------------------------------------------------------------------
U1GBI6_ENDPU/442-552--------------------------------------------------------------------------------
I4YHQ5_WALSC/334-473--------------------------------------------------------------------------------
G9A084_TORDC/483-619--------------------------------------------------------------------------------
L8X1U6_THACA/215-352--------------------------------------------------------------------------------
A3LZC0_PICST/478-611--------------------------------------------------------------------------------
Q4WNB0_ASPFU/340-448--------------------------------------------------------------------------------
A6QW04_AJECN/372-506--------------------------------------------------------------------------------
V5F1S4_PSEBG/497-617--------------------------------------------------------------------------------
N1PRD2_MYCP1/450-560--------------------------------------------------------------------------------
I2FVD8_USTH4/497-618--------------------------------------------------------------------------------
T5A7N1_OPHSC/118-233--------------------------------------------------------------------------------
K5XKC0_AGABU/416-562--------------------------------------------------------------------------------
Q0CRE8_ASPTN/313-423--------------------------------------------------------------------------------
S8AFW7_DACHA/364-476--------------------------------------------------------------------------------
A8N8V8_COPC7/387-508--------------------------------------------------------------------------------
F9FY02_FUSOF/674-792--------------------------------------------------------------------------------
U1GPE5_ENDPU/390-513--------------------------------------------------------------------------------
M7PCK0_PNEMU/420-534--------------------------------------------------------------------------------
Q5KB43_CRYNJ/514-650--------------------------------------------------------------------------------
Q6BPP7_DEBHA/481-615--------------------------------------------------------------------------------
G3BAJ1_CANTC/418-554--------------------------------------------------------------------------------
A7EK75_SCLS1/461-587--------------------------------------------------------------------------------
F2PSL1_TRIEC/256-378--------------------------------------------------------------------------------
J4G1P6_FIBRA/406-539--------------------------------------------------------------------------------
V5G094_BYSSN/505-615--------------------------------------------------------------------------------
I1C104_RHIO9/376-487--------------------------------------------------------------------------------
I1C1Q1_RHIO9/364-476--------------------------------------------------------------------------------
K1VGG6_TRIAC/2195-2311--------------------------------------------------------------------------------
K1VJL7_TRIAC/512-645--------------------------------------------------------------------------------
G4UNC3_NEUT9/434-548--------------------------------------------------------------------------------
K9FWT5_PEND2/333-440--------------------------------------------------------------------------------
F8Q3T8_SERL3/370-493--------------------------------------------------------------------------------
M3AK59_MYCFI/360-473--------------------------------------------------------------------------------
U4LNN6_PYROM/533-643--------------------------------------------------------------------------------
S2JSL7_MUCC1/375-485--------------------------------------------------------------------------------
U5HFN6_USTV1/451-567--------------------------------------------------------------------------------
F4PBV1_BATDJ/347-455--------------------------------------------------------------------------------
N4U9U3_FUSC1/553-669--------------------------------------------------------------------------------
L2FUK4_COLGN/432-552--------------------------------------------------------------------------------

PF15404

A7TM50_VANPO/1059-1235--------------------------------------------------------------------------------
W1Q8K3_OGAPD/779-971--------------------------------------------------------------------------------
Q74ZU3_ASHGO/998-1187--------------------------------------------------------------------------------
SPO71_YEAST/1032-1228--------------------------------------------------------------------------------
E6ZQ69_SPORE/1863-2064--------------------------------------------------------------------------------
A5DM32_PICGU/798-966--------------------------------------------------------------------------------
E5A6C0_LEPMJ/941-1113--------------------------------------------------------------------------------
C4XYT4_CLAL4/366-533--------------------------------------------------------------------------------
C5DN47_LACTC/1032-1239--------------------------------------------------------------------------------
G3AEW4_SPAPN/678-854--------------------------------------------------------------------------------
K2SB20_MACPH/554-726--------------------------------------------------------------------------------
Q6BI79_DEBHA/853-1032--------------------------------------------------------------------------------
C5MDI2_CANTT/674-843--------------------------------------------------------------------------------
G0WGW0_NAUDC/1002-1189--------------------------------------------------------------------------------
C6HN26_AJECH/774-941--------------------------------------------------------------------------------
F9XLM8_MYCGM/682-862--------------------------------------------------------------------------------
A3GEX7_PICST/684-865--------------------------------------------------------------------------------
G0V9Z1_NAUCC/1010-1197--------------------------------------------------------------------------------
C5DSP7_ZYGRC/1057-1243--------------------------------------------------------------------------------
J7RPQ9_KAZNA/1010-1198--------------------------------------------------------------------------------
I2H637_TETBL/1344-1532--------------------------------------------------------------------------------
G8JS70_ERECY/1003-1198--------------------------------------------------------------------------------
C1GFY0_PARBD/994-1162--------------------------------------------------------------------------------
H2AR29_KAZAF/997-1185--------------------------------------------------------------------------------
Q5B8I2_EMENI/860-1039--------------------------------------------------------------------------------
R7YP31_CONA1/928-1101--------------------------------------------------------------------------------
H6CBI5_EXODN/881-1078--------------------------------------------------------------------------------
G8BMZ3_TETPH/890-1075--------------------------------------------------------------------------------
G8ZX42_TORDC/989-1169--------------------------------------------------------------------------------
I2FT70_USTH4/1877-2075--------------------------------------------------------------------------------
K0KGT7_WICCF/952-1124--------------------------------------------------------------------------------
C4QYG2_PICPG/900-1077--------------------------------------------------------------------------------
S6EKT4_ZYGB2/1054-1241--------------------------------------------------------------------------------
G4TI65_PIRID/969-1141--------------------------------------------------------------------------------
Q59RJ1_CANAL/654-826--------------------------------------------------------------------------------
G8YNP7_PICSO/857-1036--------------------------------------------------------------------------------

PF16453

I3KJC1_ORENI/919-1056--------------------------------------------------------------------------------
G4VHF8_SCHMA/805-958--------------------------------------------------------------------------------
T1IEB3_RHOPR/597-731--------------------------------------------------------------------------------
W5KJD3_ASTMX/719-855--------------------------------------------------------------------------------
E4XUI6_OIKDI/553-682--------------------------------------------------------------------------------
B3RIN4_TRIAD/498-638--------------------------------------------------------------------------------
G7YBM9_CLOSI/933-1089--------------------------------------------------------------------------------
F7CUJ9_MACMU/755-888--------------------------------------------------------------------------------
A7SN35_NEMVE/238-373--------------------------------------------------------------------------------
T1J4F0_STRMM/849-983--------------------------------------------------------------------------------
T1EEU4_HELRO/262-396--------------------------------------------------------------------------------
H0ZQZ2_TAEGU/623-760--------------------------------------------------------------------------------
G0P5R6_CAEBE/296-431--------------------------------------------------------------------------------
B5DPT2_DROPS/972-1106--------------------------------------------------------------------------------
U1LWW7_ASCSU/486-618--------------------------------------------------------------------------------
H0X983_OTOGA/745-880--------------------------------------------------------------------------------
H2ZJJ7_CIOSA/136-270--------------------------------------------------------------------------------
E9H1A2_DAPPU/210-344--------------------------------------------------------------------------------
H0Y0X9_OTOGA/718-858--------------------------------------------------------------------------------
A8QG19_BRUMA/431-563--------------------------------------------------------------------------------
G5BAI1_HETGA/849-978--------------------------------------------------------------------------------
M3ZNX4_XIPMA/848-985--------------------------------------------------------------------------------
B7PGL9_IXOSC/498-632--------------------------------------------------------------------------------
F6QVV0_MONDO/912-1046--------------------------------------------------------------------------------
T1KGE2_TETUR/524-650--------------------------------------------------------------------------------
W4XI21_STRPU/232-361--------------------------------------------------------------------------------
H3E9J4_PRIPA/334-474--------------------------------------------------------------------------------
K1RB92_CRAGI/149-283--------------------------------------------------------------------------------

PF08458

D7MNV5_ARALL/293-395--------------------------------------------------------------------------------
M0RLK3_MUSAM/290-394--------------------------------------------------------------------------------
F4J0Y8_ARATH/263-368--------------------------------------------------------------------------------
W1P3J2_AMBTC/338-444--------------------------------------------------------------------------------
I1IC90_BRADI/270-381--------------------------------------------------------------------------------
B9IKK1_POPTR/328-431--------------------------------------------------------------------------------
M4E4U9_BRARP/346-452--------------------------------------------------------------------------------
W1PTL4_AMBTC/149-254--------------------------------------------------------------------------------
I1QW38_ORYGL/91-190--------------------------------------------------------------------------------
W1NU10_AMBTC/323-428--------------------------------------------------------------------------------
M8A701_TRIUA/248-349--------------------------------------------------------------------------------
D7MCD2_ARALL/309-414--------------------------------------------------------------------------------
B9SFG0_RICCO/365-471--------------------------------------------------------------------------------
W5AJN2_WHEAT/35-140--------------------------------------------------------------------------------
J3N518_ORYBR/323-423--------------------------------------------------------------------------------
M1BPD2_SOLTU/369-475--------------------------------------------------------------------------------
Q9LKC2_ARATH/341-447--------------------------------------------------------------------------------
M0SV78_MUSAM/342-448--------------------------------------------------------------------------------
M4DV70_BRARP/294-395--------------------------------------------------------------------------------
K7VKA4_MAIZE/319-424--------------------------------------------------------------------------------
F6HYN8_VITVI/262-363--------------------------------------------------------------------------------
Q6H686_ORYSJ/268-383--------------------------------------------------------------------------------
D7TE14_VITVI/362-468--------------------------------------------------------------------------------
B9RS23_RICCO/302-407--------------------------------------------------------------------------------
I1K0R2_SOYBN/272-376--------------------------------------------------------------------------------
K7LWY0_SOYBN/274-374--------------------------------------------------------------------------------
D8RGF1_SELML/288-392--------------------------------------------------------------------------------
B9SXD6_RICCO/265-367--------------------------------------------------------------------------------
M0RMU8_MUSAM/263-363--------------------------------------------------------------------------------
D8SWC9_SELML/319-425--------------------------------------------------------------------------------
K4CLR2_SOLLC/308-410--------------------------------------------------------------------------------
K7KIW3_SOYBN/237-340--------------------------------------------------------------------------------
I1PMP1_ORYGL/278-376--------------------------------------------------------------------------------
K7TQI6_MAIZE/313-412--------------------------------------------------------------------------------
W5EUW3_WHEAT/51-154--------------------------------------------------------------------------------
I1QW40_ORYGL/167-265--------------------------------------------------------------------------------
M1A0U2_SOLTU/269-372--------------------------------------------------------------------------------
Q683C3_ARATH/224-330--------------------------------------------------------------------------------
C5WRE5_SORBI/262-366--------------------------------------------------------------------------------
I1QVX3_ORYGL/260-364--------------------------------------------------------------------------------
M0RPD8_MUSAM/283-380--------------------------------------------------------------------------------
B9MUQ4_POPTR/263-367--------------------------------------------------------------------------------
B9HUR4_POPTR/371-477--------------------------------------------------------------------------------
K7LH35_SOYBN/217-323--------------------------------------------------------------------------------
B9T6W9_RICCO/245-345--------------------------------------------------------------------------------
B9IM62_POPTR/279-379--------------------------------------------------------------------------------
D7M9P3_ARALL/9-113--------------------------------------------------------------------------------
C5XJN3_SORBI/304-414--------------------------------------------------------------------------------
I1IZA0_BRADI/284-384--------------------------------------------------------------------------------
A9T2K8_PHYPA/290-395--------------------------------------------------------------------------------
W1PB96_AMBTC/286-390--------------------------------------------------------------------------------
K7UXW2_MAIZE/301-411--------------------------------------------------------------------------------
Q5U1F1_ARATH/283-387--------------------------------------------------------------------------------
W5AUL7_WHEAT/72-173--------------------------------------------------------------------------------
M0TPF7_MUSAM/219-319--------------------------------------------------------------------------------
C5WS39_SORBI/227-333--------------------------------------------------------------------------------
W5G7U5_WHEAT/33-145--------------------------------------------------------------------------------

PF09380

Q7QB86_ANOGA/230-322--------------------------------------------------------------------------------
FARP2_MOUSE/238-328--------------------------------------------------------------------------------
FRPD2_HUMAN/557-646--------------------------------------------------------------------------------
E41L5_MOUSE/239-331--------------------------------------------------------------------------------
O17905_CAEEL/223-313--------------------------------------------------------------------------------
FRM4A_HUMAN/225-326--------------------------------------------------------------------------------
PTN3_HUMAN/226-316--------------------------------------------------------------------------------
A4QNY2_DANRE/770-859--------------------------------------------------------------------------------
MERH_DROME/220-309--------------------------------------------------------------------------------
Q16F39_AEDAE/217-307--------------------------------------------------------------------------------
Q9VKY7_DROME/209-301--------------------------------------------------------------------------------
Q17GE0_AEDAE/263-353--------------------------------------------------------------------------------
A2AUK8_MOUSE/292-382--------------------------------------------------------------------------------
A7SRN5_NEMVE/219-309--------------------------------------------------------------------------------
Q8I093_CAEEL/223-359--------------------------------------------------------------------------------
Q7PMF4_ANOGA/228-311--------------------------------------------------------------------------------
Q2M1E6_DROME/268-358--------------------------------------------------------------------------------
Q8JG61_DANRE/197-287--------------------------------------------------------------------------------
Q1MTL1_DANRE/226-316--------------------------------------------------------------------------------
A7RWH0_NEMVE/210-299--------------------------------------------------------------------------------
Q7PRJ8_ANOGA/219-309--------------------------------------------------------------------------------
A8X9K5_CAEBR/230-319--------------------------------------------------------------------------------
A7SJJ3_NEMVE/179-269--------------------------------------------------------------------------------
A7T1E3_NEMVE/204-296--------------------------------------------------------------------------------
A7SBA4_NEMVE/205-308--------------------------------------------------------------------------------
Q5LK46_CAEEL/220-307--------------------------------------------------------------------------------
A7S031_NEMVE/180-270--------------------------------------------------------------------------------
Q16TI3_AEDAE/200-283--------------------------------------------------------------------------------
Q16YM3_AEDAE/262-348--------------------------------------------------------------------------------
FRMD3_HUMAN/229-316--------------------------------------------------------------------------------
A7RUW8_NEMVE/238-328--------------------------------------------------------------------------------
FRMD7_HUMAN/196-286--------------------------------------------------------------------------------
MERL_HUMAN/226-315--------------------------------------------------------------------------------
A8Y3W1_CAEBR/270-367--------------------------------------------------------------------------------
B8JJL5_DANRE/42-128--------------------------------------------------------------------------------
E1BKT4_BOVIN/789-876--------------------------------------------------------------------------------
E9Q0S8_MOUSE/226-313--------------------------------------------------------------------------------
F6YGI4_CIOIN/233-323--------------------------------------------------------------------------------
F7CAC9_XENTR/210-299--------------------------------------------------------------------------------
FARP1_MOUSE/234-323--------------------------------------------------------------------------------
H3CCC0_TETNG/514-599--------------------------------------------------------------------------------
H3CPI3_TETNG/280-380--------------------------------------------------------------------------------
H3CYW0_TETNG/210-299--------------------------------------------------------------------------------
H3D2P3_TETNG/215-308--------------------------------------------------------------------------------
H3DGP3_TETNG/244-328--------------------------------------------------------------------------------
H3DIN7_TETNG/226-306--------------------------------------------------------------------------------
I3N7A6_SPETR/13-96--------------------------------------------------------------------------------
M4AFA5_XIPMA/6-94--------------------------------------------------------------------------------
Q05768_ECHMU/212-301--------------------------------------------------------------------------------
PTN21_MOUSE/226-309--------------------------------------------------------------------------------

PF10756

A1T6Y6_MYCVP/40-111--------------------------------------------------------------------------------
A0QUX5_MYCS2/56-127--------------------------------------------------------------------------------
Q0S2H6_RHOSR/133-204--------------------------------------------------------------------------------
A4FMQ8_SACEN/47-118--------------------------------------------------------------------------------
Q5YRV9_NOCFA/80-151--------------------------------------------------------------------------------
A4X496_SALTO/52-123--------------------------------------------------------------------------------
Q8NQZ8_CORGL/37-108--------------------------------------------------------------------------------
Q8FPX5_COREF/69-140--------------------------------------------------------------------------------
Q6NHN5_CORDI/53-124--------------------------------------------------------------------------------
Q4JUN4_CORJK/53-125--------------------------------------------------------------------------------
Q2IEC1_ANADE/109-180--------------------------------------------------------------------------------
A0QWV2_MYCS2/76-146--------------------------------------------------------------------------------
Q741E9_MYCPA/73-143--------------------------------------------------------------------------------
Q9CCP2_MYCLE/74-144--------------------------------------------------------------------------------
A1T8K3_MYCVP/70-140--------------------------------------------------------------------------------
Q0S0K0_RHOSR/72-142--------------------------------------------------------------------------------
Q5YTP5_NOCFA/86-156--------------------------------------------------------------------------------
A4FBK6_SACEN/71-141--------------------------------------------------------------------------------
Q8NQ54_CORGL/114-184--------------------------------------------------------------------------------
Q6NH30_CORDI/107-177--------------------------------------------------------------------------------
Q4JVI7_CORJK/71-141--------------------------------------------------------------------------------
A4X643_SALTO/103-173--------------------------------------------------------------------------------
Q47QZ7_THEFY/72-143--------------------------------------------------------------------------------
Q827L6_STRAW/68-139--------------------------------------------------------------------------------
A1SJH2_NOCSJ/82-152--------------------------------------------------------------------------------
A6WC99_KINRD/77-147--------------------------------------------------------------------------------
Q9CDE8_MYCLE/58-136--------------------------------------------------------------------------------
Q744S0_MYCPA/58-136--------------------------------------------------------------------------------
A1T119_MYCVP/58-136--------------------------------------------------------------------------------
Q5Z3S4_NOCFA/64-148--------------------------------------------------------------------------------
Q0SAE3_RHOSR/62-146--------------------------------------------------------------------------------
A4F5R5_SACEN/60-137--------------------------------------------------------------------------------
A4XDA1_SALTO/68-146--------------------------------------------------------------------------------
A8LCF4_FRASN/69-148--------------------------------------------------------------------------------
Q0RB02_FRAAA/82-161--------------------------------------------------------------------------------
Q9X8Z2_STRCO/64-149--------------------------------------------------------------------------------
Q8TW66_METKA/65-149--------------------------------------------------------------------------------
Q6ADX4_LEIXX/63-147--------------------------------------------------------------------------------
A0JYT3_ARTS2/61-144--------------------------------------------------------------------------------
Q47LS7_THEFY/56-142--------------------------------------------------------------------------------
Q82I13_STRAW/80-156--------------------------------------------------------------------------------
B0RFT7_CLAMS/59-140--------------------------------------------------------------------------------
B2HI57_MYCMM/58-135--------------------------------------------------------------------------------
B2HIG3_MYCMM/52-122--------------------------------------------------------------------------------
Y1417_MYCTU/72-141--------------------------------------------------------------------------------
Y010_MYCTU/58-135--------------------------------------------------------------------------------

PF00638

RANG_HUMAN/37-161--------------------------------------------------------------------------------
RBP2_HUMAN/2321-2442--------------------------------------------------------------------------------
YRB2_YEAST/204-327--------------------------------------------------------------------------------
NUP2_YEAST/598-718--------------------------------------------------------------------------------
RBP2_HUMAN/2024-2145--------------------------------------------------------------------------------
YRB1_YEAST/75-197--------------------------------------------------------------------------------
RBP2_HUMAN/2922-3043--------------------------------------------------------------------------------
RBP2_HUMAN/1183-1304--------------------------------------------------------------------------------

PF00568

LAS17_YEAST/13-124--------------------------------------------------------------------------------
Q9VAT0_DROME/31-140--------------------------------------------------------------------------------
O96607_DROME/1-107--------------------------------------------------------------------------------
WASL_RAT/28-135--------------------------------------------------------------------------------
VASP_HUMAN/1-110--------------------------------------------------------------------------------
HOME3_RAT/3-110--------------------------------------------------------------------------------
ENAH_MOUSE/1-108--------------------------------------------------------------------------------
WASP_HUMAN/36-145--------------------------------------------------------------------------------

PF06058

I4YGX0_WALSC/6-122--------------------------------------------------------------------------------
U6IUB4_HYMMI/4-119--------------------------------------------------------------------------------
M7P3V1_PNEMU/8-120--------------------------------------------------------------------------------
H1V3S0_COLHI/54-178--------------------------------------------------------------------------------
H2WG39_CAEJA/11-127--------------------------------------------------------------------------------
K0T1R6_THAOC/10-135--------------------------------------------------------------------------------
G7DZX0_MIXOS/485-600--------------------------------------------------------------------------------
B7G0L8_PHATC/10-124--------------------------------------------------------------------------------
K1RLV6_CRAGI/4-119--------------------------------------------------------------------------------
Q5CQ73_CRYPI/16-136--------------------------------------------------------------------------------
E3KCY6_PUCGT/4-124--------------------------------------------------------------------------------
Q00YW6_OSTTA/22-138--------------------------------------------------------------------------------
D3AZC1_POLPA/8-123--------------------------------------------------------------------------------
C5LA18_PERM5/11-142--------------------------------------------------------------------------------
F4P0I1_BATDJ/9-123--------------------------------------------------------------------------------
J3NZ48_GAGT3/56-175--------------------------------------------------------------------------------
A2DA02_TRIVA/16-133--------------------------------------------------------------------------------
F0V826_NEOCL/23-153--------------------------------------------------------------------------------
I1GL53_BRADI/114-230--------------------------------------------------------------------------------
I3EEQ1_NEMP3/9-124--------------------------------------------------------------------------------
D8RZ35_SELML/9-130--------------------------------------------------------------------------------
E4XC40_OIKDI/8-126--------------------------------------------------------------------------------
C5X2N4_SORBI/23-139--------------------------------------------------------------------------------
M7XHX0_RHOT1/38-154--------------------------------------------------------------------------------
R8BPG1_TOGMI/63-194--------------------------------------------------------------------------------
M2TEG9_COCSN/39-153--------------------------------------------------------------------------------
A0E4X8_PARTE/3-121--------------------------------------------------------------------------------
T1KEM3_TETUR/10-125--------------------------------------------------------------------------------
T1FY06_HELRO/9-134--------------------------------------------------------------------------------
G2YCV2_BOTF4/42-168--------------------------------------------------------------------------------
B6AAA0_CRYMR/30-163--------------------------------------------------------------------------------
K4AAP8_SETIT/35-151--------------------------------------------------------------------------------
F0ZJ48_DICPU/8-124--------------------------------------------------------------------------------
DCP1_ARATH/16-132--------------------------------------------------------------------------------
W5NIT2_LEPOC/19-133--------------------------------------------------------------------------------
T1HJB8_RHOPR/7-122--------------------------------------------------------------------------------
A8ITI1_CHLRE/8-118--------------------------------------------------------------------------------
F6WP26_CIOIN/10-126--------------------------------------------------------------------------------
A7APD0_BABBO/28-146--------------------------------------------------------------------------------
E5SY77_TRISP/4-116--------------------------------------------------------------------------------
Q8IJ85_PLAF7/295-416--------------------------------------------------------------------------------
M5C8H0_THACB/6-120--------------------------------------------------------------------------------
G0SH67_CHATD/20-150--------------------------------------------------------------------------------
M1WE34_CLAP2/44-168--------------------------------------------------------------------------------
M1AHB5_SOLTU/16-132--------------------------------------------------------------------------------
B0WEB0_CULQU/6-122--------------------------------------------------------------------------------
H3GFP6_PHYRM/15-137--------------------------------------------------------------------------------
D8TZD6_VOLCA/13-124--------------------------------------------------------------------------------
Q4U8T6_THEAN/27-148--------------------------------------------------------------------------------
K0KQA9_WICCF/30-164--------------------------------------------------------------------------------
N4UUY7_COLOR/53-178--------------------------------------------------------------------------------
F4S8K2_MELLP/4-127--------------------------------------------------------------------------------
L2GQ63_VITCO/22-141--------------------------------------------------------------------------------
J9E9N6_WUCBA/20-136--------------------------------------------------------------------------------
U6I2H7_ECHMU/4-119--------------------------------------------------------------------------------
I2G041_USTH4/8-117--------------------------------------------------------------------------------
U5H2N5_USTV1/11-127--------------------------------------------------------------------------------
L2GS13_VAVCU/7-118--------------------------------------------------------------------------------
G7Y9B7_CLOSI/250-364--------------------------------------------------------------------------------
H9JX56_BOMMO/7-120--------------------------------------------------------------------------------
A9RKT5_PHYPA/17-132--------------------------------------------------------------------------------
G4V8P0_SCHMA/4-121--------------------------------------------------------------------------------
E9FTR2_DAPPU/8-124--------------------------------------------------------------------------------
Q54KM1_DICDI/6-122--------------------------------------------------------------------------------
DCP1_SCHPO/8-123--------------------------------------------------------------------------------
W5N9S2_LEPOC/8-124--------------------------------------------------------------------------------
A9TRE6_PHYPA/17-133--------------------------------------------------------------------------------
Q9N363_CAEEL/12-128--------------------------------------------------------------------------------
C1N0Y3_MICPC/14-126--------------------------------------------------------------------------------
Q8SU45_ENCCU/6-121--------------------------------------------------------------------------------
C4LZ86_ENTHI/19-136--------------------------------------------------------------------------------
B8C1C7_THAPS/9-129--------------------------------------------------------------------------------
S2JSW1_MUCC1/6-118--------------------------------------------------------------------------------
J9K8Y4_ACYPI/7-123--------------------------------------------------------------------------------
U1NK85_ASCSU/13-126--------------------------------------------------------------------------------
M7SPD0_EUTLA/5-131--------------------------------------------------------------------------------
K7E8I5_ORNAN/46-162--------------------------------------------------------------------------------
C1FJ80_MICSR/13-127--------------------------------------------------------------------------------
T1EQJ1_HELRO/2-118--------------------------------------------------------------------------------
W5DQ23_WHEAT/26-142--------------------------------------------------------------------------------
D2VTY8_NAEGR/42-154--------------------------------------------------------------------------------
DCP1A_MOUSE/28-144--------------------------------------------------------------------------------
S9W4V6_SCHCR/8-120--------------------------------------------------------------------------------
M5E581_MALS4/7-124--------------------------------------------------------------------------------
E2BEK1_HARSA/6-122--------------------------------------------------------------------------------
D6X0J0_TRICA/7-122--------------------------------------------------------------------------------
B4MRP3_DROWI/6-122--------------------------------------------------------------------------------
C3YN74_BRAFL/6-122--------------------------------------------------------------------------------
M0SUM7_MUSAM/16-132--------------------------------------------------------------------------------

PF07933

J3NS94_GAGT3/46-217--------------------------------------------------------------------------------
A9TKE1_PHYPA/27-186--------------------------------------------------------------------------------
V4Z972_TOXGO/63-220--------------------------------------------------------------------------------
R7YGT9_CONA1/17-208--------------------------------------------------------------------------------
B8CDI7_THAPS/48-214--------------------------------------------------------------------------------
B3RZA3_TRIAD/4-160--------------------------------------------------------------------------------
U4LEE2_PYROM/5-164--------------------------------------------------------------------------------
D5GM90_TUBMM/4-176--------------------------------------------------------------------------------
B0CSR4_LACBS/7-165--------------------------------------------------------------------------------
G4N575_MAGO7/17-189--------------------------------------------------------------------------------
H0ZSD6_TAEGU/6-163--------------------------------------------------------------------------------
G1WZK6_ARTOA/6-197--------------------------------------------------------------------------------
I1EXS1_AMPQE/5-160--------------------------------------------------------------------------------
H3GBN1_PHYRM/10-186--------------------------------------------------------------------------------
F4RRV5_MELLP/8-177--------------------------------------------------------------------------------
T1I3S8_RHOPR/4-159--------------------------------------------------------------------------------
E3KK50_PUCGT/10-180--------------------------------------------------------------------------------
D0NAX8_PHYIT/6-160--------------------------------------------------------------------------------
B8BZP8_THAPS/17-203--------------------------------------------------------------------------------
C4M7C6_ENTHI/5-159--------------------------------------------------------------------------------
B7FUE2_PHATC/14-170--------------------------------------------------------------------------------
M7TSV8_EUTLA/17-196--------------------------------------------------------------------------------
K5UYW7_PHACS/9-170--------------------------------------------------------------------------------
M5E4Y9_MALS4/3-162--------------------------------------------------------------------------------
E4XX70_OIKDI/3-155--------------------------------------------------------------------------------
M2M4Z6_BAUCO/19-192--------------------------------------------------------------------------------
R1E743_BOTPV/16-210--------------------------------------------------------------------------------
E3QI84_COLGM/17-211--------------------------------------------------------------------------------
K1REF2_CRAGI/4-161--------------------------------------------------------------------------------
E9BXK3_CAPO3/3-162--------------------------------------------------------------------------------
A2EYL1_TRIVA/13-170--------------------------------------------------------------------------------
C5FJI7_ARTOC/14-217--------------------------------------------------------------------------------
F2UF95_SALR5/6-158--------------------------------------------------------------------------------
M5BJY1_THACB/6-167--------------------------------------------------------------------------------
G0RTU4_HYPJQ/17-183--------------------------------------------------------------------------------
D8LLJ9_ECTSI/11-173--------------------------------------------------------------------------------
R8BQ43_TOGMI/17-191--------------------------------------------------------------------------------
T1JKH1_STRMM/4-159--------------------------------------------------------------------------------
Q5KP23_CRYNJ/8-165--------------------------------------------------------------------------------
C9SUP5_VERA1/18-200--------------------------------------------------------------------------------
U7PYJ6_SPOS1/17-206--------------------------------------------------------------------------------
E1Z4K2_CHLVA/31-205--------------------------------------------------------------------------------
K2S272_MACPH/17-200--------------------------------------------------------------------------------
D8M8J1_BLAHO/6-151--------------------------------------------------------------------------------
G0S443_CHATD/21-207--------------------------------------------------------------------------------
W7WZB3_TETTS/6-151--------------------------------------------------------------------------------
D8LGE9_ECTSI/55-233--------------------------------------------------------------------------------
N1QGL9_SPHMS/17-199--------------------------------------------------------------------------------
V2XMV7_MONRO/9-173--------------------------------------------------------------------------------
M1WFF3_CLAP2/17-209--------------------------------------------------------------------------------
A7ESN8_SCLS1/17-192--------------------------------------------------------------------------------
D8RE88_SELML/14-170--------------------------------------------------------------------------------
U6IAW8_HYMMI/6-172--------------------------------------------------------------------------------
G3JU05_CORMM/17-193--------------------------------------------------------------------------------
K3X1F0_PYTUL/6-162--------------------------------------------------------------------------------
T1KZ98_TETUR/6-163--------------------------------------------------------------------------------
F0XFH0_GROCL/18-211--------------------------------------------------------------------------------
E4URP0_ARTGP/15-207--------------------------------------------------------------------------------
Q4P2B5_USTMA/4-180--------------------------------------------------------------------------------
U5FXY2_POPTR/19-179--------------------------------------------------------------------------------
U6HIL6_ECHMU/6-170--------------------------------------------------------------------------------
M0U9S4_MUSAM/18-180--------------------------------------------------------------------------------
E9EXV9_METAR/17-186--------------------------------------------------------------------------------
G2Q5R9_THIHA/20-227--------------------------------------------------------------------------------
M9M7V1_PSEA3/4-180--------------------------------------------------------------------------------
E9IZ98_SOLIN/3-158--------------------------------------------------------------------------------
F9XJ39_MYCGM/17-183--------------------------------------------------------------------------------
G7DY82_MIXOS/4-167--------------------------------------------------------------------------------
B8LTE1_TALSN/26-203--------------------------------------------------------------------------------
M2UB51_COCH5/16-202--------------------------------------------------------------------------------
Q7QF64_ANOGA/6-161--------------------------------------------------------------------------------
A7SIZ0_NEMVE/6-164--------------------------------------------------------------------------------
D0MQQ9_PHYIT/10-187--------------------------------------------------------------------------------
G2QYW0_THITE/20-241--------------------------------------------------------------------------------
M7XI76_RHOT1/4-179--------------------------------------------------------------------------------
N1J6Q3_BLUG1/17-189--------------------------------------------------------------------------------
W5L8W2_ASTMX/7-166--------------------------------------------------------------------------------
F0Y367_AURAN/15-181--------------------------------------------------------------------------------
M2YLK4_MYCFI/17-190--------------------------------------------------------------------------------
J9K5B3_ACYPI/4-159--------------------------------------------------------------------------------
C5GJB5_AJEDR/18-243--------------------------------------------------------------------------------
C0SB09_PARBP/18-236--------------------------------------------------------------------------------
G9MXD8_HYPVG/17-184--------------------------------------------------------------------------------
F7BVE6_MONDO/7-163--------------------------------------------------------------------------------
K5XGN4_AGABU/7-168--------------------------------------------------------------------------------
K1X9F4_MARBU/17-188--------------------------------------------------------------------------------
I1RNR3_GIBZE/17-183--------------------------------------------------------------------------------
D8S3Z0_SELML/19-178--------------------------------------------------------------------------------
S3DAW2_GLAL2/17-190--------------------------------------------------------------------------------
H3G0S5_PRIPA/4-152--------------------------------------------------------------------------------
J4IAW5_FIBRA/9-170--------------------------------------------------------------------------------
D4B3K7_ARTBC/15-225--------------------------------------------------------------------------------
T1FZF4_HELRO/5-166--------------------------------------------------------------------------------
D8PT94_SCHCM/8-167--------------------------------------------------------------------------------
A9TJQ4_PHYPA/5-167--------------------------------------------------------------------------------
U9STJ1_RHIID/5-161--------------------------------------------------------------------------------
S3CTF6_OPHP1/17-203--------------------------------------------------------------------------------
Q9N489_CAEEL/4-158--------------------------------------------------------------------------------
S2K9W2_MUCC1/5-162--------------------------------------------------------------------------------
N1PHQ0_MYCP1/17-184--------------------------------------------------------------------------------
K3WH06_PYTUL/15-205--------------------------------------------------------------------------------
G4V5L5_SCHMA/3-160--------------------------------------------------------------------------------
E9D275_COCPS/18-247--------------------------------------------------------------------------------
B7QCT5_IXOSC/4-160--------------------------------------------------------------------------------
Q6BG09_PARTE/3-157--------------------------------------------------------------------------------
J4WGT4_BEAB2/17-207--------------------------------------------------------------------------------
E4ZRT1_LEPMJ/16-197--------------------------------------------------------------------------------
E1FS06_LOALO/5-160--------------------------------------------------------------------------------
R5A3D0_TAPDE/5-161--------------------------------------------------------------------------------
F2PSB4_TRIEC/15-224--------------------------------------------------------------------------------
A6QU18_AJECN/18-250--------------------------------------------------------------------------------
Q0UID2_PHANO/16-176--------------------------------------------------------------------------------
C4M0K9_ENTHI/6-152--------------------------------------------------------------------------------
C4JRU2_UNCRE/18-241--------------------------------------------------------------------------------
G3P8M2_GASAC/9-166--------------------------------------------------------------------------------
C3XPI1_BRAFL/4-160--------------------------------------------------------------------------------
Q2GZY9_CHAGB/20-238--------------------------------------------------------------------------------
Q54U74_DICDI/5-157--------------------------------------------------------------------------------
W5KMI5_ASTMX/7-164--------------------------------------------------------------------------------
G7YV25_CLOSI/3-160--------------------------------------------------------------------------------
B2WG42_PYRTR/16-198--------------------------------------------------------------------------------
V5FWH7_BYSSN/18-204--------------------------------------------------------------------------------
F7GRX0_CALJA/6-161--------------------------------------------------------------------------------
H2XRE1_CIOIN/8-161--------------------------------------------------------------------------------
G6DKG0_DANPL/4-157--------------------------------------------------------------------------------
H2ZRB7_CIOSA/5-158--------------------------------------------------------------------------------
B4M1N5_DROVI/3-158--------------------------------------------------------------------------------
K0S700_THAOC/262-424--------------------------------------------------------------------------------
B7FRS4_PHATC/6-155--------------------------------------------------------------------------------
U5HFP6_USTV1/5-178--------------------------------------------------------------------------------
M4DFK4_BRARP/12-175--------------------------------------------------------------------------------
L5LPE8_MYODS/6-163--------------------------------------------------------------------------------
N4VI33_COLOR/17-213--------------------------------------------------------------------------------
F7VRW3_SORMK/18-194--------------------------------------------------------------------------------
S8AM96_DACHA/6-190--------------------------------------------------------------------------------
F8Q7V8_SERL3/8-169--------------------------------------------------------------------------------
A8BII4_GIAIC/3-157--------------------------------------------------------------------------------

PF12814

A8NC45_COPC7/1477-1596--------------------------------------------------------------------------------
A8Q694_MALGO/495-613--------------------------------------------------------------------------------
B2VUN2_PYRTR/943-1083--------------------------------------------------------------------------------
B6JVF8_SCHJY/810-930--------------------------------------------------------------------------------
B8M115_TALSN/905-1052--------------------------------------------------------------------------------
C0SAF8_PARBP/1004-1151--------------------------------------------------------------------------------
C1H210_PARBA/1232-1352--------------------------------------------------------------------------------
C5DMW2_LACTC/3405-3524--------------------------------------------------------------------------------
C5DY62_ZYGRC/2362-2478--------------------------------------------------------------------------------
C5FWA2_ARTOC/1261-1380--------------------------------------------------------------------------------
C5MCT5_CANTT/3605-3725--------------------------------------------------------------------------------
Q0TVR4_PHANO/1388-1507--------------------------------------------------------------------------------
Q2TZB5_ASPOR/919-1066--------------------------------------------------------------------------------
Q4P966_USTMA/1901-2021--------------------------------------------------------------------------------
Q4Q999_LEIMA/446-556--------------------------------------------------------------------------------
Q4YWB8_PLABA/90-206--------------------------------------------------------------------------------
Q5KMI7_CRYNJ/1724-1843--------------------------------------------------------------------------------
Q6CF84_YARLI/3022-3141--------------------------------------------------------------------------------
Q6FVK1_CANGA/1920-2038--------------------------------------------------------------------------------
MCP5_SCHPO/840-959--------------------------------------------------------------------------------
Q1K7R2_NEUCR/971-1102--------------------------------------------------------------------------------

PF16457

F2U545_SALR5/1386-1502--------------------------------------------------------------------------------
Q8IA75_CAEEL/74-191--------------------------------------------------------------------------------
H3C055_TETNG/9-126--------------------------------------------------------------------------------
G1MWI1_MELGA/27-143--------------------------------------------------------------------------------
G3NV89_GASAC/27-143--------------------------------------------------------------------------------
G1N5L5_MELGA/27-143--------------------------------------------------------------------------------
H2QM57_PANTR/9-125--------------------------------------------------------------------------------
F4NYW2_BATDJ/668-811--------------------------------------------------------------------------------
E4YI96_OIKDI/579-706--------------------------------------------------------------------------------
H2VI16_CAEJA/135-252--------------------------------------------------------------------------------
CED12_CAEBR/550-685--------------------------------------------------------------------------------
F1KWU1_ASCSU/567-696--------------------------------------------------------------------------------
D6W9U3_TRICA/165-281--------------------------------------------------------------------------------
F2TZR8_SALR5/544-669--------------------------------------------------------------------------------
B3RVM3_TRIAD/557-675--------------------------------------------------------------------------------
I1FTR2_AMPQE/570-688--------------------------------------------------------------------------------
B7Q0D1_IXOSC/536-660--------------------------------------------------------------------------------
E9C1Y2_CAPO3/536-660--------------------------------------------------------------------------------
C3ZV75_BRAFL/544-670--------------------------------------------------------------------------------
A7SLG8_NEMVE/536-660--------------------------------------------------------------------------------
C3YD81_BRAFL/369-491--------------------------------------------------------------------------------
G1KZV5_AILME/550-676--------------------------------------------------------------------------------
F7DYL0_HORSE/554-680--------------------------------------------------------------------------------
F6RLT2_XENTR/535-658--------------------------------------------------------------------------------
G1SYE9_RABIT/567-695--------------------------------------------------------------------------------
H3CTT0_TETNG/532-657--------------------------------------------------------------------------------
G1MUA8_MELGA/508-634--------------------------------------------------------------------------------
H2YA57_CIOSA/189-312--------------------------------------------------------------------------------
B7Q7M8_IXOSC/553-677--------------------------------------------------------------------------------
Q29N75_DROPS/548-672--------------------------------------------------------------------------------
B0WB15_CULQU/539-663--------------------------------------------------------------------------------
E9H9Z7_DAPPU/559-683--------------------------------------------------------------------------------
H9JLX2_BOMMO/556-681--------------------------------------------------------------------------------
D6WDN2_TRICA/534-656--------------------------------------------------------------------------------
E0VNX9_PEDHC/550-675--------------------------------------------------------------------------------
I1C1Z8_RHIO9/470-634--------------------------------------------------------------------------------
I1BJB6_RHIO9/153-333--------------------------------------------------------------------------------
G2Y444_BOTF4/505-670--------------------------------------------------------------------------------
G9P7T1_HYPAI/502-650--------------------------------------------------------------------------------
C7YQF4_NECH7/504-660--------------------------------------------------------------------------------
H1UW70_COLHI/501-660--------------------------------------------------------------------------------
G3JKD9_CORMM/498-655--------------------------------------------------------------------------------
E9DTQ0_METAQ/504-655--------------------------------------------------------------------------------
Q0C7D9_ASPTN/458-611--------------------------------------------------------------------------------
D5GMC6_TUBMM/478-630--------------------------------------------------------------------------------
Q5KFV3_CRYNJ/676-815--------------------------------------------------------------------------------
G7DXA4_MIXOS/1138-1273--------------------------------------------------------------------------------
Q4P5W9_USTMA/603-759--------------------------------------------------------------------------------
G4TUD7_PIRID/590-737--------------------------------------------------------------------------------
E2LF39_MONPE/31-172--------------------------------------------------------------------------------
B0CU21_LACBS/584-724--------------------------------------------------------------------------------
Q6CEB9_YARLI/515-645--------------------------------------------------------------------------------
F2QVJ2_PICP7/437-572--------------------------------------------------------------------------------
Q6BTL6_DEBHA/441-583--------------------------------------------------------------------------------
G3AUY9_SPAPN/448-610--------------------------------------------------------------------------------
C4Y9G4_CLAL4/452-596--------------------------------------------------------------------------------
G8Y676_PICSO/354-499--------------------------------------------------------------------------------
A5DKW2_PICGU/355-500--------------------------------------------------------------------------------
H8XAE8_CANO9/448-592--------------------------------------------------------------------------------
A3LSN2_PICST/356-478--------------------------------------------------------------------------------
G3BBH7_CANTC/358-490--------------------------------------------------------------------------------

PF11605

VPS36_DROME/2-94--------------------------------------------------------------------------------
Q4QDE7_LEIMA/5-95--------------------------------------------------------------------------------
Q5TPR5_ANOGA/2-94--------------------------------------------------------------------------------
Q5AHK1_CANAL/13-100--------------------------------------------------------------------------------
Q19519_CAEEL/2-89--------------------------------------------------------------------------------
Q6CAN8_YARLI/6-95--------------------------------------------------------------------------------
A5DUJ7_LODEL/11-99--------------------------------------------------------------------------------
Q6CWP4_KLULA/12-100--------------------------------------------------------------------------------
A3LUC0_PICST/11-98--------------------------------------------------------------------------------
A5DGQ5_PICGU/60-147--------------------------------------------------------------------------------
Q4PA51_USTMA/9-97--------------------------------------------------------------------------------
Q6BSQ4_DEBHA/12-99--------------------------------------------------------------------------------
VPS36_DICDI/8-94--------------------------------------------------------------------------------
Q6FPE3_CANGA/8-96--------------------------------------------------------------------------------
VPS36_SCHPO/6-94--------------------------------------------------------------------------------
VPS36_ARATH/18-111--------------------------------------------------------------------------------
Q757C1_ASHGO/15-103--------------------------------------------------------------------------------
A7TGC6_VANPO/8-96--------------------------------------------------------------------------------
Q4DRE4_TRYCC/5-94--------------------------------------------------------------------------------
A4HA31_LEIBR/5-95--------------------------------------------------------------------------------
E7KS64_YEASL/8-95--------------------------------------------------------------------------------

PF02893

Q9VU19_DROME/13-82--------------------------------------------------------------------------------
MTMR2_MOUSE/71-139--------------------------------------------------------------------------------
TBCD8_MOUSE/285-353--------------------------------------------------------------------------------
UGT52_DICDI/881-948--------------------------------------------------------------------------------
FAN_HUMAN/176-247--------------------------------------------------------------------------------
GRAM4_HUMAN/445-523--------------------------------------------------------------------------------
GRM1B_HUMAN/96-163--------------------------------------------------------------------------------
MTMR5_HUMAN/882-968--------------------------------------------------------------------------------
Q9VP46_DROME/136-203--------------------------------------------------------------------------------
Q9VP46_DROME/282-350--------------------------------------------------------------------------------
GYP2_SCHPO/20-85--------------------------------------------------------------------------------
Q9TXP3_CAEEL/783-872--------------------------------------------------------------------------------
YL072_YEAST/164-231--------------------------------------------------------------------------------
GYP2_YEAST/29-116--------------------------------------------------------------------------------
YFE2_YEAST/198-265--------------------------------------------------------------------------------
ATG26_YEAST/570-636--------------------------------------------------------------------------------
MTM1_HUMAN/29-97--------------------------------------------------------------------------------
ATG26_PICPG/586-652--------------------------------------------------------------------------------
YGZ7_SCHPO/197-264--------------------------------------------------------------------------------
Q18966_CAEEL/9-83--------------------------------------------------------------------------------
Q9VGH9_DROME/922-1002--------------------------------------------------------------------------------
YHO0_YEAST/548-617--------------------------------------------------------------------------------
YSP2_YEAST/647-716--------------------------------------------------------------------------------
GEML1_ARATH/138-215--------------------------------------------------------------------------------
WBP2_MOUSE/1-84--------------------------------------------------------------------------------
ATG26_CANAL/816-880--------------------------------------------------------------------------------
Q9VMI9_DROME/40-113--------------------------------------------------------------------------------
C2GR1_ARATH/688-754--------------------------------------------------------------------------------
I3NB22_SPETR/106-171--------------------------------------------------------------------------------
M0YCJ0_HORVD/230-306--------------------------------------------------------------------------------

PF08567

C0S578_PARBP/9-110--------------------------------------------------------------------------------
B4J482_DROGR/16-100--------------------------------------------------------------------------------
F4WXP5_ACREC/16-100--------------------------------------------------------------------------------
H2AUR0_KAZAF/8-105--------------------------------------------------------------------------------
M7TY82_BOTF1/10-100--------------------------------------------------------------------------------
B7Q4R8_IXOSC/16-102--------------------------------------------------------------------------------
G4VRZ6_SCHMA/16-100--------------------------------------------------------------------------------
G2QQE2_THIHA/9-102--------------------------------------------------------------------------------
H3HDA4_PHYRM/10-97--------------------------------------------------------------------------------
D8LFT0_ECTSI/21-108--------------------------------------------------------------------------------
I2GVF1_TETBL/8-94--------------------------------------------------------------------------------
E9G9U7_DAPPU/17-101--------------------------------------------------------------------------------
C4R8T2_PICPG/9-97--------------------------------------------------------------------------------
H2Z5J2_CIOSA/14-97--------------------------------------------------------------------------------
G8ZV89_TORDC/8-105--------------------------------------------------------------------------------
E1FYN0_LOALO/14-103--------------------------------------------------------------------------------
E3KFN3_PUCGT/17-117--------------------------------------------------------------------------------
F8PUT6_SERL3/11-94--------------------------------------------------------------------------------
G2XIN7_VERDV/9-97--------------------------------------------------------------------------------
G0RZ08_CHATD/9-102--------------------------------------------------------------------------------
C5FUC5_ARTOC/9-103--------------------------------------------------------------------------------
C5DU63_ZYGRC/8-105--------------------------------------------------------------------------------
TFB1_SCHPO/10-95--------------------------------------------------------------------------------
G4URS9_NEUT9/12-102--------------------------------------------------------------------------------
B6HTW4_PENCW/8-100--------------------------------------------------------------------------------
Q6FNK7_CANGA/8-105--------------------------------------------------------------------------------
G7E2C5_MIXOS/16-105--------------------------------------------------------------------------------
M3AKW8_MYCFI/9-93--------------------------------------------------------------------------------
C3Y693_BRAFL/15-100--------------------------------------------------------------------------------
M2V0J7_COCH5/7-93--------------------------------------------------------------------------------
J7R257_KAZNA/8-105--------------------------------------------------------------------------------
E9EZ62_METAR/9-99--------------------------------------------------------------------------------
N1PQD5_MYCP1/9-92--------------------------------------------------------------------------------
F9X734_MYCGM/9-93--------------------------------------------------------------------------------
N1QHE7_SPHMS/9-93--------------------------------------------------------------------------------
H2W045_CAEJA/16-106--------------------------------------------------------------------------------
Q0CQX7_ASPTN/9-105--------------------------------------------------------------------------------
M9MEQ8_PSEA3/15-106--------------------------------------------------------------------------------
G8JRE4_ERECY/8-105--------------------------------------------------------------------------------
M7P3T1_PNEMU/9-93--------------------------------------------------------------------------------
H1UYT1_COLHI/9-97--------------------------------------------------------------------------------
G9NU11_HYPAI/9-96--------------------------------------------------------------------------------
A8N758_COPC7/11-95--------------------------------------------------------------------------------
R7Z4G4_CONA1/7-97--------------------------------------------------------------------------------
M4B6V9_HYAAE/10-100--------------------------------------------------------------------------------
E3M705_CAERE/15-105--------------------------------------------------------------------------------
R1EVG0_BOTPV/7-89--------------------------------------------------------------------------------
M2NGD5_BAUCO/9-93--------------------------------------------------------------------------------
B9SX99_RICCO/11-95--------------------------------------------------------------------------------
M3K0U0_CANMX/9-103--------------------------------------------------------------------------------
J4KLV9_BEAB2/10-97--------------------------------------------------------------------------------
H9JKN8_BOMMO/16-100--------------------------------------------------------------------------------
H2LNK6_ORYLA/16-97--------------------------------------------------------------------------------
TF2H1_DICDI/19-105--------------------------------------------------------------------------------
D3BDH2_POLPA/19-106--------------------------------------------------------------------------------
E5RZL8_TRISP/21-115--------------------------------------------------------------------------------
D2A3F8_TRICA/16-100--------------------------------------------------------------------------------
F4P5K1_BATDJ/15-102--------------------------------------------------------------------------------
H3E924_PRIPA/15-105--------------------------------------------------------------------------------
J3PCR1_GAGT3/9-99--------------------------------------------------------------------------------
D5GM43_TUBMM/10-95--------------------------------------------------------------------------------
B8BXI5_THAPS/18-109--------------------------------------------------------------------------------
H6CBI6_EXODN/9-99--------------------------------------------------------------------------------
B8LVU2_TALSN/9-96--------------------------------------------------------------------------------
G8BSL5_TETPH/8-105--------------------------------------------------------------------------------
Q6CT84_KLULA/10-108--------------------------------------------------------------------------------
M5ECF4_MALS4/14-105--------------------------------------------------------------------------------
B2B252_PODAN/9-101--------------------------------------------------------------------------------
L8WWX6_THACA/11-94--------------------------------------------------------------------------------
B0D0T4_LACBS/11-92--------------------------------------------------------------------------------
L8G6J1_PSED2/9-97--------------------------------------------------------------------------------
B3RWB8_TRIAD/17-98--------------------------------------------------------------------------------
C1N257_MICPC/13-108--------------------------------------------------------------------------------
Q6BQQ5_DEBHA/9-94--------------------------------------------------------------------------------
A8Q5M5_MALGO/13-104--------------------------------------------------------------------------------
A7RH50_NEMVE/17-97--------------------------------------------------------------------------------
M2RHA4_CERS8/11-94--------------------------------------------------------------------------------
B6IEX8_CAEBR/15-98--------------------------------------------------------------------------------
C5DKS5_LACTC/8-105--------------------------------------------------------------------------------
K1WJC1_MARBU/9-96--------------------------------------------------------------------------------
K0KQD0_WICCF/9-97--------------------------------------------------------------------------------
E5A9P6_LEPMJ/7-93--------------------------------------------------------------------------------
N1J7M0_BLUG1/10-100--------------------------------------------------------------------------------
K1RJ65_CRAGI/16-100--------------------------------------------------------------------------------
E3N9N3_CAERE/15-105--------------------------------------------------------------------------------
M7X2J7_RHOT1/8-96--------------------------------------------------------------------------------
F0XTE6_GROCL/9-97--------------------------------------------------------------------------------
R4XBS4_TAPDE/10-96--------------------------------------------------------------------------------
I1FYH0_AMPQE/20-101--------------------------------------------------------------------------------
C4JS80_UNCRE/11-104--------------------------------------------------------------------------------
R8BY97_TOGMI/10-100--------------------------------------------------------------------------------
F4PG90_DICFS/19-106--------------------------------------------------------------------------------
E4WY57_OIKDI/15-92--------------------------------------------------------------------------------
E9CVT6_COCPS/11-108--------------------------------------------------------------------------------
E9PWY2_MOUSE/23-103--------------------------------------------------------------------------------
G4NAD4_MAGO7/9-98--------------------------------------------------------------------------------
I1RKB1_GIBZE/10-95--------------------------------------------------------------------------------
J9KBA3_ACYPI/15-98--------------------------------------------------------------------------------
K5W1M5_AGABU/12-92--------------------------------------------------------------------------------
Q4WQ61_ASPFU/10-100--------------------------------------------------------------------------------
W1QI78_OGAPD/10-95--------------------------------------------------------------------------------
W4XFR5_STRPU/18-100--------------------------------------------------------------------------------

PF03517

E1GH06_LOALO/57-218--------------------------------------------------------------------------------
LOT5_ASHGO/69-217--------------------------------------------------------------------------------
A2QMX0_ASPNC/82-226--------------------------------------------------------------------------------
A4S3U5_OSTLU/82-224--------------------------------------------------------------------------------
LOT5_PICGU/78-210--------------------------------------------------------------------------------
A6QTC2_AJECN/141-306--------------------------------------------------------------------------------
LOT5_VANPO/82-248--------------------------------------------------------------------------------
A8NTF5_COPC7/63-194--------------------------------------------------------------------------------
A8Y0J2_CAEBR/34-180--------------------------------------------------------------------------------
A9VD70_MONBE/35-180--------------------------------------------------------------------------------
B0WD72_CULQU/34-182--------------------------------------------------------------------------------
B6QED0_PENMQ/87-259--------------------------------------------------------------------------------
B7P9B2_IXOSC/33-159--------------------------------------------------------------------------------
B8BUW5_THAPS/168-320--------------------------------------------------------------------------------
C4WYC8_ACYPI/33-183--------------------------------------------------------------------------------
C5DFH3_LACTC/77-239--------------------------------------------------------------------------------
C5DS18_ZYGRC/74-243--------------------------------------------------------------------------------
C5FIH0_ARTOC/100-255--------------------------------------------------------------------------------
C5M0L7_PERM5/411-532--------------------------------------------------------------------------------
D2VE54_NAEGR/89-219--------------------------------------------------------------------------------
D3AWK5_POLPA/41-182--------------------------------------------------------------------------------
D5GPC9_TUBMM/75-207--------------------------------------------------------------------------------
D6WHX2_TRICA/33-160--------------------------------------------------------------------------------
E2AYH0_CAMFO/33-160--------------------------------------------------------------------------------
E3MRC6_CAERE/33-179--------------------------------------------------------------------------------
E6ZKI1_SPORE/90-225--------------------------------------------------------------------------------
E9CD59_CAPO3/34-165--------------------------------------------------------------------------------
F0XG98_GROCL/95-242--------------------------------------------------------------------------------
F0ZDK9_DICPU/33-167--------------------------------------------------------------------------------
F1QDS7_DANRE/33-166--------------------------------------------------------------------------------
F2UJQ4_SALR5/35-160--------------------------------------------------------------------------------
YIU1_SCHPO/53-192--------------------------------------------------------------------------------
Q4PHI8_USTMA/90-237--------------------------------------------------------------------------------
Q54Q91_DICDI/34-173--------------------------------------------------------------------------------
Q5TW40_ANOGA/34-170--------------------------------------------------------------------------------
Q6C5D1_YARLI/86-206--------------------------------------------------------------------------------
LOT5_KLULA/83-248--------------------------------------------------------------------------------
Q6FWF9_CANGA/65-256--------------------------------------------------------------------------------
Q7RFA5_PLAYO/43-232--------------------------------------------------------------------------------
C5GHM2_AJEDR/150-321--------------------------------------------------------------------------------
E7Q5X8_YEASB/84-242--------------------------------------------------------------------------------
Q5KJY5_CRYNJ/62-200--------------------------------------------------------------------------------

PF14844

F0ZLG9_DICPU/1576-1668--------------------------------------------------------------------------------
A9V098_MONBE/81-174--------------------------------------------------------------------------------
LVSC_DICDI/1712-1818--------------------------------------------------------------------------------
A9SKJ8_PHYPA/1981-2088--------------------------------------------------------------------------------
D8S3X7_SELML/1889-1980--------------------------------------------------------------------------------
D3BT75_POLPA/2605-2696--------------------------------------------------------------------------------
D7LRV7_ARALL/2035-2133--------------------------------------------------------------------------------
F2UGS7_SALR5/2291-2404--------------------------------------------------------------------------------
F6I330_VITVI/2391-2488--------------------------------------------------------------------------------
D0NB84_PHYIT/1700-1817--------------------------------------------------------------------------------
E7EZD1_DANRE/2180-2277--------------------------------------------------------------------------------
Q22HC6_TETTS/2408-2508--------------------------------------------------------------------------------
I1P2W1_ORYGL/1915-2017--------------------------------------------------------------------------------
F1QJA6_DANRE/2081-2178--------------------------------------------------------------------------------
B3RWH0_TRIAD/280-377--------------------------------------------------------------------------------
B4I0S0_DROSE/623-719--------------------------------------------------------------------------------
D2UYK5_NAEGR/2492-2591--------------------------------------------------------------------------------
E4X0F7_OIKDI/1590-1687--------------------------------------------------------------------------------
NBEA_CAEEL/1701-1798--------------------------------------------------------------------------------
LYST_MOUSE/3007-3102--------------------------------------------------------------------------------
U1M966_ASCSU/1739-1835--------------------------------------------------------------------------------
E9GKY9_DAPPU/2072-2169--------------------------------------------------------------------------------
C3Y0L9_BRAFL/2980-3076--------------------------------------------------------------------------------
Q01AN8_OSTTA/2201-2290--------------------------------------------------------------------------------
D3B4G5_POLPA/1067-1165--------------------------------------------------------------------------------
E9CED0_CAPO3/1927-2025--------------------------------------------------------------------------------
A9V898_MONBE/2777-2881--------------------------------------------------------------------------------
C1E8K2_MICSR/45-147--------------------------------------------------------------------------------
D8M509_BLAHO/339-453--------------------------------------------------------------------------------
A2DFN3_TRIVA/1810-1904--------------------------------------------------------------------------------
F0ZTM1_DICPU/1944-2035--------------------------------------------------------------------------------
LVSD_DICDI/2071-2162--------------------------------------------------------------------------------
A4IDE3_LEIIN/3480-3579--------------------------------------------------------------------------------

PF00640

APBA3_RAT/216-354--------------------------------------------------------------FGAKYLGSTQLLSE.RNP
APBB2_HUMAN/419-555--------------------------------------------------------------FAVRSLGWVEMAEEDLAP
SHC1_HUMAN/162-318--------------------------------------------------------------YLVRYMGCVEVLQSMRAL
SHC2_HUMAN/153-308--------------------------------------------------------------YVVRYMGCIEVLRSMRSL
APBA1_HUMAN/461-618--------------------------------------------------------------FAANYLGSTQLLSD.KTP
JIP1_RAT/564-698--------------------------------------------------------------FRVKFLGSVQVPYH....
JIP2_HUMAN/683-814--------------------------------------------------------------FDVQFLGSVEVPCH....
LIN10_CAEEL/607-762--------------------------------------------------------------FRARYLGSTQMLCE.SRG
CAPON_RAT/32-170--------------------------------------------------------------FEAKYVGSLDVPRP....
APBB3_RAT/117-255--------------------------------------------------------------FAVRSLGWVEVPEEDLAP
APBA3_HUMAN/221-359--------------------------------------------------------------FGARYLGSTQLVSE.RNP
APBA2_MOUSE/373-531--------------------------------------------------------------FAANYLGSTQLLSE.RNP
CED6_CAEEL/61-194--------------------------------------------------------------YVARFLGCVETPKA....
SHC3_HUMAN/155-311--------------------------------------------------------------YVVKYLGCIEVLRSMRSL
NUMB_MOUSE/39-172--------------------------------------------------------------FPVKYLGHVEVDESRG..
APBB1_RAT/371-510--------------------------------------------------------------FAVRSLGWVEMTEEELAP
B4HKQ4_DROSE/34-182--------------------------------------------------------------FNVRYTGCVEVKTSMKSL

PF08416

EPS8_MOUSE/64-194-------------------------------------------------------------QYRVEHLTTFVLDRK----
ES8L1_HUMAN/35-165-------------------------------------------------------------QYPVNHLVTFCLGED----
TENS3_HUMAN/1310-1444-------------------------------------------------------------ACNVWYLNSVEMESL----
Q9VHC3_DROME/580-716-------------------------------------------------------------ATNVLWLYSCDTESL----
P92160_CAEEL/272-416-------------------------------------------------------------ACNVVYVGSVDVESL----
F1N4S3_BOVIN/28-148-------------------------------------------------------------QHRVEHLMTCKLGTQ----
F1QMN2_DANRE/51-181-------------------------------------------------------------QYHVEHLTTFVMDRK----
F1RAF6_DANRE/50-170-------------------------------------------------------------QYRVEHLFTCALDGR----
F6PIM5_XENTR/47-173-------------------------------------------------------------QHRVEHLLTCDLDKE----
F6YPU9_XENTR/61-191-------------------------------------------------------------QYHIEHLTTFVMDRK----
F6YU93_MACMU/815-947-------------------------------------------------------------ACSVLYLTSVETESL----
G5E5T1_BOVIN/49-179-------------------------------------------------------------QYHVQHLATFIMDKS----
H3DAX3_TETNG/54-176-------------------------------------------------------------QYRVEHLFTFELDGR----
Q59G71_HUMAN/736-872-------------------------------------------------------------ACNVLFVNSVDMESL----

PF14719

F1SFG1_PIG/69-256-------------------------------------------------------------TYTVLYLGNATTIQA----
C3ZEC0_BRAFL/18-200-------------------------------------------------------------TYSCVYLGNAATLHA----
A2AM80_MOUSE/71-265-------------------------------------------------------------TYTVWYLGNAVTLHA----
Q20652_CAEEL/34-211-------------------------------------------------------------SYNVIYLGNVLTIMA----
B4LZF0_DROVI/288-472-------------------------------------------------------------EYKVSYLGNVLTGWA----
E1FRI2_LOALO/49-231-------------------------------------------------------------TYHVVYLGNVLTIIA----
E5SI18_TRISP/18-200-------------------------------------------------------------TYTVVYLGNVPTSIA----
E9GIB1_DAPPU/14-199-------------------------------------------------------------SFKVVYLGNVLTGWA----
E0VC17_PEDHC/15-198-------------------------------------------------------------TYKVSYLGNVLTGLA----

PF10480

Q5RG21_DANRE/1-198MFRKVKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSG..NAVSDASAEFRVKYVGAIEKLQF----
F7EVP2_MACMU/1-200MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEKLKL----

PF02174

IRS4_MOUSE/232-334--------------------------------------------------------------YKDVWQVVVKPRGL----
DOK2_HUMAN/147-247--------------------------------------------------------------PHKEFAVTMRPTEA----
DOK3_CHICK/145-244--------------------------------------------------------------DLTEFPVLVLRTEA----
A7RF80_NEMVE/161-269--------------------------------------------------------------YQQGFPVTVRFTPS----
IRS1_DROME/122-234--------------------------------------------------------------YDHVWQVVIQKKGI----
IRS1_XENTR/126-228--------------------------------------------------------------FREVWQVSVRPRGL----
Q29P01_DROPS/15-112--------------------------------------------------------------HDNVFRVRVAHLQP----
Q7Q177_ANOGA/14-107--------------------------------------------------------------HSNIFHV....INI----
Q17L29_AEDAE/14-105--------------------------------------------------------------DPNIFYV....INI----
A3KNM7_DANRE/135-232--------------------------------------------------------------QNERFNV...YLMP----
DOK3_HUMAN/213-312--------------------------------------------------------------EVGEFPVVVQRTEA----
A6H792_BOVIN/17-108--------------------------------------------------------------HPTKFKV....TNV----
A7RZ35_NEMVE/132-236--------------------------------------------------------------AGKTFRVQCSGSRA----
DOK4_PONAB/135-232--------------------------------------------------------------QTDRFNV...FLLP----
F1QYZ7_DANRE/148-245--------------------------------------------------------------.VNEFLVTVQRTEA----
F6UJY4_XENTR/131-227--------------------------------------------------------------..SDFRVTVQRTEA----
F6XDD6_XENTR/156-256--------------------------------------------------------------.KEVWQVIMKPKGL----
F6YCQ0_XENTR/195-295--------------------------------------------------------------.KEVWQVNVKPRGL----
F6YKL9_XENTR/136-227--------------------------------------------------------------.TERFNV...FLLP----
H3C9X0_TETNG/163-260--------------------------------------------------------------.VNEFWVIIQRTEA----
H3CKK9_TETNG/161-256--------------------------------------------------------------...DFSVCVRRTEA----
J9P166_CANFA/114-208--------------------------------------------------------------.SERFNV...YLMP----
L5KVB1_PTEAL/194-295--------------------------------------------------------------.REVWQVNLKPKGL----
O54718_MOUSE/160-270--------------------------------------------------------------.QDVWPVTLRSKGL----
Q58DP1_BOVIN/152-253--------------------------------------------------------------.GSQFWVTVQKTEA----
DOK3_MOUSE/159-255--------------------------------------------------------------..TEFPVIVQRTEA----

PF14470

Q73PJ3_TREDE/33-124---------------------------------------------------------------MKDSEHILY--------
Q8XP28_CLOPE/122-213---------------------------------------------------------------LSIDEHIKA--------
D4GR98_HALVD/78-183---------------------------------------------------------------LNENEQPHY--------
D4GR98_HALVD/240-354---------------------------------------------------------------LDPDERVHY--------
C7N8P3_LEPBD/33-124---------------------------------------------------------------ITDNEVVTY--------
D9STE0_CLOC7/154-250---------------------------------------------------------------LNPDEEVLL--------
A0M4L3_GRAFK/28-124---------------------------------------------------------------LTREEKIEY--------
D5BGD3_ZUNPS/37-134---------------------------------------------------------------LTRNENVEY--------
A2BKM8_HYPBU/14-108---------------------------------------------------------------LEPDEAIIK--------
Q5JHI4_THEKO/17-110---------------------------------------------------------------LEPDERVLF--------
Y689_ARCFU/15-109---------------------------------------------------------------LYPGEDVLY--------
C6XZU2_PEDHD/28-124---------------------------------------------------------------LTSNEELIY--------
A0RV76_CENSY/18-109---------------------------------------------------------------LRDGEEILL--------
A5FK72_FLAJ1/29-125---------------------------------------------------------------LMKGEEVGY--------
YOKE_BACSU/50-157---------------------------------------------------------------VGKKEKILH--------
B9E7P9_MACCJ/52-151---------------------------------------------------------------IKNKELIYF--------
B9DJ09_STACT/11-105---------------------------------------------------------------LFPTEQIES--------
E8SGW4_STAPH/11-105---------------------------------------------------------------LFPTEHIET--------
A8LB81_FRASN/29-118---------------------------------------------------------------LWAGELVTD--------
H8XRC1_FLAIG/29-124---------------------------------------------------------------LMSNEEVGY--------
Q81GV4_BACCR/12-108---------------------------------------------------------------LHKEEKILS--------
Q81IW4_BACCR/13-104---------------------------------------------------------------.DDDEKILA--------
Q81QM1_BACAN/12-115---------------------------------------------------------------LNSEEDILS--------
Q97GB3_CLOAB/16-129---------------------------------------------------------------LKKSDSVLY--------
Q9CGT3_LACLA/43-133---------------------------------------------------------------MRENEIISF--------
R5LZ88_9FIRM/210-299---------------------------------------------------------------LFDNEAYEF--------
R5XNA3_9CLOT/8-107---------------------------------------------------------------LKEDENILA--------

PF08000

C7N5J6_SLAHD/4-123--------------------------------------------------------------.FNNSA..FF--------
F2F1Y8_SOLSS/9-133--------------------------------------------------------------ALGLSD..IG--------
D5DEB2_BACMD/2-123--------------------------------------------------------------GILDGL..LG--------
G8LZ44_CLOCD/8-129--------------------------------------------------------------GIFDGL..LG--------
C3AM09_BACMY/2-123--------------------------------------------------------------GLFSGI..FG--------
Q2LS73_SYNAS/3-124--------------------------------------------------------------GLIGGQ..MG--------
R5GQQ5_9BACT/2-123--------------------------------------------------------------GIINNL..FG--------
F0P2W0_WEEVC/2-123--------------------------------------------------------------GLFDKL..LG--------
G8R3B9_OWEHD/2-124--------------------------------------------------------------GLFNKI..LG--------
Q8YA42_LISMO/2-126--------------------------------------------------------------..FDKL..MG--------
R5A390_9CLOT/4-123--------------------------------------------------------------.FKNKT..FF--------
Q5M368_STRT2/2-124--------------------------------------------------------------GIFSGL..LG--------
B2TM32_CLOBB/3-123--------------------------------------------------------------DFNNGA..LF--------
Q4JTR2_CORJK/6-119--------------------------------------------------------------........IA--------
D4K5P2_9FIRM/2-123--------------------------------------------------------------EFRDKP..ME--------
R6FFF9_9FIRM/23-151--------------------------------------------------------------.LLQGG..LN--------
F5XEN8_MICPN/9-122--------------------------------------------------------------........IL--------
E3DRV6_HALPG/2-124--------------------------------------------------------------GLLDGL..MG--------
B0UJV9_METS4/2-122--------------------------------------------------------------GLLDGL..LG--------
K8E6L9_CARML/2-124--------------------------------------------------------------GLFSGL..IN--------
D4ZG58_SHEVD/2-123--------------------------------------------------------------GLLDSL..LG--------
D4KFS3_9FIRM/2-123--------------------------------------------------------------GLFDNL..LG--------
Q8ELK9_OCEIH/2-123--------------------------------------------------------------GLFDGI..MG--------
E4TSG8_MARTH/2-124--------------------------------------------------------------NFFSNF..LN--------
C7RG86_ANAPD/14-128--------------------------------------------------------------........TF--------
F0JKG9_DESDE/2-123--------------------------------------------------------------GFLDGL..MG--------
R7P5Y0_9BACT/2-123--------------------------------------------------------------GIINTI..LG--------
V6K2R3_STRNV/2-123--------------------------------------------------------------GDFMAL..FG--------
I0JT52_HALH3/2-123--------------------------------------------------------------GFFDEL..MG--------
R4SNZ0_AMYOR/10-126--------------------------------------------------------------...KDT..VF--------
F2JJ99_CELLD/13-136--------------------------------------------------------------TLGLSD..IG--------
K9V1A3_9CYAN/10-132--------------------------------------------------------------.LGLGD..IG--------
F4BQI2_CARS1/8-120--------------------------------------------------------------.........I--------
Q3IIM8_PSEHT/2-123--------------------------------------------------------------GLFSGL..MG--------
R7EZS9_9BACI/10-125--------------------------------------------------------------.....SKYFD--------
F2I7Y8_AERUA/8-137--------------------------------------------------------------.LMQGA..LG--------
F4BRS9_CARS1/2-124--------------------------------------------------------------GLIGGL..LG--------
A2U3F1_9FLAO/2-124--------------------------------------------------------------GLFNKI..LG--------
R6FUY7_9CLOT/4-121--------------------------------------------------------------.FNNGE..YV--------
H6NEA0_9BACL/2-123--------------------------------------------------------------GLFDGL..MG--------
Q11IY3_CHESB/2-123--------------------------------------------------------------GILNGL..LG--------
A9AYV8_HERA2/2-123--------------------------------------------------------------GLFDGL..MG--------
A4VWQ3_STRSY/15-137--------------------------------------------------------------GLFSGL..LG--------
X4ZH14_9BACL/3-132--------------------------------------------------------------NLFSGL..LG--------
R5SSA7_9CLOT/11-128--------------------------------------------------------------...SST..FL--------
W8F0N5_9BACT/2-122--------------------------------------------------------------GLLDGL..LG--------
C5B2T2_METEA/2-121--------------------------------------------------------------GLLDGL..LG--------
G4QJ57_GLANF/2-122--------------------------------------------------------------GLLDGL..LG--------
A1APA7_PELPD/2-123--------------------------------------------------------------GLFTGT..TK--------
K0ESH5_9NOCA/2-124--------------------------------------------------------------GLFDNV..LG--------
G2Z1A2_FLABF/2-123--------------------------------------------------------------GIFNAI..LG--------
K4IFG7_PSYTT/2-124--------------------------------------------------------------GLFSSL..LG--------
V5XL94_ENTMU/2-124--------------------------------------------------------------GLFDGL..MG--------
C7MTA4_SACVD/2-123--------------------------------------------------------------GLFDGM..LG--------
F9VIK2_ARTSS/2-123--------------------------------------------------------------GVFSTL..MG--------
Q1GUI3_SPHAL/5-118--------------------------------------------------------------..........--------
N0AXE2_9BACI/2-123--------------------------------------------------------------GILDGL..MG--------
D9SMG5_CLOC7/13-136--------------------------------------------------------------TLGLSD..IG--------
Q8EAU5_SHEON/2-123--------------------------------------------------------------GLLDGL..LG--------
YJQA_BACSU/2-124--------------------------------------------------------------GFIDGL..LG--------
Q24WI9_DESHY/12-133--------------------------------------------------------------GIFSGM..MG--------
B1M0U2_METRJ/2-123--------------------------------------------------------------GLLDGL..LG--------
Q15NS1_PSEA6/2-122--------------------------------------------------------------GLLDAI..MG--------
Q6LHY1_PHOPR/2-122--------------------------------------------------------------GLFDAI..LG--------
E6SCT2_INTC7/3-123--------------------------------------------------------------DFTNGS..VF--------
C7R5K7_JONDD/7-121--------------------------------------------------------------.....A..IT--------
D9R2L2_CLOSW/8-123--------------------------------------------------------------.....T..MM--------
Q6ANG9_DESPS/5-123--------------------------------------------------------------..DKSE..LF--------
C6CSA5_PAESJ/9-133--------------------------------------------------------------LLGLSD..IG--------
G0J438_CYCMS/2-124--------------------------------------------------------------GLFNSL..LG--------
K9ULM0_9CHRO/10-133--------------------------------------------------------------.LGISD..IG--------
R7LCD1_9BACT/2-123--------------------------------------------------------------GLFDSF..MG--------
Q832M1_ENTFA/2-124--------------------------------------------------------------GLFDGL..LG--------
K9ZFA2_ANACC/9-133--------------------------------------------------------------ALGLSD..IG--------
E1VU56_ARTAR/5-123--------------------------------------------------------------..NNSS..VF--------
T0U607_9ENTE/7-134--------------------------------------------------------------.IVQGA..LG--------
D4JZN1_9FIRM/2-124--------------------------------------------------------------EFREKP..MQ--------
L0EIE3_THECK/2-130--------------------------------------------------------------SLFSGL..FG--------
Q9KB40_BACHD/9-133--------------------------------------------------------------ALGISD..IG--------
S5SXY6_9CORY/2-125--------------------------------------------------------------GFFDSM..MG--------
W0EA01_9FIRM/2-123--------------------------------------------------------------GFFDGV..LG--------
F2F2A1_SOLSS/2-123--------------------------------------------------------------GIFDGL..MG--------
I4APS3_FLELS/9-149--------------------------------------------------------------ALGLSD..IG--------
C0ZJB9_BREBN/9-132--------------------------------------------------------------ALGLSN..VG--------
U5L9N0_9BACI/9-133--------------------------------------------------------------VLGISD..IG--------
A1S3D0_SHEAM/2-123--------------------------------------------------------------GFLDAL..MG--------
B1HXL6_LYSSC/11-134--------------------------------------------------------------ALGLSD..IG--------
D3FSX3_BACPE/2-123--------------------------------------------------------------GLLDGL..MG--------
T2KJ86_9FLAO/2-124--------------------------------------------------------------GIFNKI..LG--------
K9RH40_9CYAN/2-123--------------------------------------------------------------GIFSGM..MG--------
Q817P9_BACCR/9-132--------------------------------------------------------------VLGLSD..VG--------
F8HZL1_WEIKK/2-122--------------------------------------------------------------DLINGL..MG--------
R6N893_9CLOT/4-123--------------------------------------------------------------.FNNAS..FM--------
YVBH_BACSU/9-133--------------------------------------------------------------ALGLSD..IG--------
D5EAI3_METMS/3-122--------------------------------------------------------------..LSGI..FG--------
R6YXQ3_9FIRM/6-126--------------------------------------------------------------..NSNS..VF--------
R5AEW1_9CLOT/5-123--------------------------------------------------------------..QNAA..FL--------
C6WGX3_ACTMD/6-123--------------------------------------------------------------...KAS..VF--------
B8I0F4_CLOCE/9-121--------------------------------------------------------------..........--------
C7PDL4_CHIPD/2-124--------------------------------------------------------------GLFSGL..LG--------
R5A5F0_9CLOT/12-140--------------------------------------------------------------..ASGL..MG--------
Q87FW9_VIBPA/22-141--------------------------------------------------------------.FDNSS..VF--------
K3X6U9_PYTUL/10-126--------------------------------------------------------------.TGSAD..IC--------
E1SVQ2_FERBD/2-123--------------------------------------------------------------GLLDGL..MG--------
A3CQI4_STRSV/2-124--------------------------------------------------------------GLFGGL..LG--------
F5Z9A0_ALTSS/2-121--------------------------------------------------------------GLFDTL..LG--------
W0E2C0_MARPU/2-123--------------------------------------------------------------GLLSAI..TG--------
L0G2H8_ECHVK/2-124--------------------------------------------------------------GLFSSL..LG--------
D2SCW6_GEOOG/4-123--------------------------------------------------------------.FSNGS..VF--------
R6KUV2_9BACE/2-121--------------------------------------------------------------ETVQKN..LI--------
X2GTT7_9BACI/2-123--------------------------------------------------------------GLFDGL..MG--------
B1YJX4_EXIS2/9-133--------------------------------------------------------------LTGFSD..IG--------
M1WLQ6_DESPC/2-123--------------------------------------------------------------GFIDKV..LG--------
Q8E0G0_STRA5/2-124--------------------------------------------------------------GIFSGL..MG--------
J7IL01_DESMD/2-123--------------------------------------------------------------GLLSGL..LG--------
F5XZ86_RAMTT/2-123--------------------------------------------------------------GLFDGM..MG--------
R5C3D6_9FIRM/4-123--------------------------------------------------------------.FKNGS..VF--------
K9Z7I1_CYAAP/9-132--------------------------------------------------------------VLGLSD..IG--------
D9SLV7_CLOC7/2-123--------------------------------------------------------------GLLDGL..MG--------
H6RCT5_NOCCG/2-123--------------------------------------------------------------GLMDGI..MG--------
I0GSE3_SELRL/14-136--------------------------------------------------------------SIISGL..MG--------
C6BWQ6_DESAD/2-123--------------------------------------------------------------GILDGL..MG--------
R6MN06_9BACE/2-123--------------------------------------------------------------GIMNAI..FG--------
D9QVV1_ACEAZ/2-124--------------------------------------------------------------GLFSGL..MG--------
I0JI97_HALH3/15-139--------------------------------------------------------------ALGLSD..IG--------
K9XRV0_STAC7/9-132--------------------------------------------------------------TLGLSD..IG--------
H3GP35_PHYRM/9-126--------------------------------------------------------------LTGSAD..IC--------
T0VFI0_9STRE/2-124--------------------------------------------------------------GLLSGL..MG--------
R6NRS3_9FIRM/5-123--------------------------------------------------------------..QNKK..VF--------
X4ZX53_9BACL/2-123--------------------------------------------------------------AFFDGL..LG--------
A5FNF6_FLAJ1/2-124--------------------------------------------------------------GIFSAL..MG--------
A0LZE1_GRAFK/2-124--------------------------------------------------------------SILSSL..LG--------
E6SGF4_THEM7/2-123--------------------------------------------------------------SWIGRM..MG--------

PF03703

A5N1P5_CLOK5/62-141--------------------------------------------------------------------------------
C4XRD2_DESMR/88-163--------------------------------------------------------------------------------
Q2N679_ERYLH/79-158--------------------------------------------------------------------------------
O26822_METTH/90-166--------------------------------------------------------------------------------
A5N1P4_CLOK5/81-157--------------------------------------------------------------------------------
Q8YRN0_NOSS1/39-113--------------------------------------------------------------------------------
A8LQ34_DINSH/96-187--------------------------------------------------------------------------------
C5C9H6_MICLC/78-153--------------------------------------------------------------------------------
Q8CJW8_STRCO/479-556--------------------------------------------------------------------------------
Q8S7W8_ORYSJ/97-171--------------------------------------------------------------------------------
YDBT_BACSU/406-486--------------------------------------------------------------------------------
A0JUF8_ARTS2/86-161--------------------------------------------------------------------------------
Q0S416_RHOSR/85-163--------------------------------------------------------------------------------
Q5KZA4_GEOKA/394-472--------------------------------------------------------------------------------
A4X9A7_SALTO/98-177--------------------------------------------------------------------------------
A1S9Q9_SHEAM/70-149--------------------------------------------------------------------------------
Q5V3H6_HALMA/457-539--------------------------------------------------------------------------------
A4X9A6_SALTO/93-171--------------------------------------------------------------------------------
Q0RP62_FRAAA/86-163--------------------------------------------------------------------------------
A0JR89_ARTS2/421-499--------------------------------------------------------------------------------
A0QQT0_MYCS2/68-149--------------------------------------------------------------------------------
B8LD31_THAPS/35-108--------------------------------------------------------------------------------
A0M124_GRAFK/406-482--------------------------------------------------------------------------------
Q6NJ02_CORDI/358-436--------------------------------------------------------------------------------
Q03UQ0_LEUMM/60-139--------------------------------------------------------------------------------
A8I741_CHLRE/23-98--------------------------------------------------------------------------------
Q0A9I7_ALKEH/434-510--------------------------------------------------------------------------------
Q2S4T2_SALRD/280-363--------------------------------------------------------------------------------
B2J0Q4_NOSP7/39-113--------------------------------------------------------------------------------
Q1AYV8_RUBXD/67-148--------------------------------------------------------------------------------
Q949S6_ARATH/104-178--------------------------------------------------------------------------------
Q10VQ2_TRIEI/39-113--------------------------------------------------------------------------------
Q03T95_LACBA/71-147--------------------------------------------------------------------------------
A5USV1_ROSS1/73-149--------------------------------------------------------------------------------
Q0A9I7_ALKEH/77-156--------------------------------------------------------------------------------
A1WXI2_HALHL/93-184--------------------------------------------------------------------------------
B7KHE2_CYAP7/39-113--------------------------------------------------------------------------------
A5UZJ9_ROSS1/78-155--------------------------------------------------------------------------------
Q3IJZ4_PSEHT/76-156--------------------------------------------------------------------------------
A1SMF8_NOCSJ/73-149--------------------------------------------------------------------------------
Q7U523_SYNPX/40-114--------------------------------------------------------------------------------
Q16DS6_ROSDO/94-185--------------------------------------------------------------------------------
A4X385_SALTO/78-154--------------------------------------------------------------------------------
Q7VB01_PROMA/40-114--------------------------------------------------------------------------------
Q6A731_PROAC/79-153--------------------------------------------------------------------------------
Q3IQW3_NATPD/58-137--------------------------------------------------------------------------------
Q2JF56_FRASC/78-154--------------------------------------------------------------------------------
F2G2I3_ALTMD/454-530--------------------------------------------------------------------------------
Q7V0R9_PROMP/40-114--------------------------------------------------------------------------------
Q2NEQ5_METST/106-182--------------------------------------------------------------------------------
B1YH17_EXIS2/61-141--------------------------------------------------------------------------------
Q5QU90_IDILO/71-150--------------------------------------------------------------------------------
Q086M2_SHEFN/453-529--------------------------------------------------------------------------------
Q8XM54_CLOPE/456-535--------------------------------------------------------------------------------
Q0W0T7_UNCMA/387-467--------------------------------------------------------------------------------
Q3JEQ1_NITOC/43-119--------------------------------------------------------------------------------
Q2JNH7_SYNJB/39-113--------------------------------------------------------------------------------
Q21G74_SACD2/81-160--------------------------------------------------------------------------------
Q8XK94_CLOPE/57-138--------------------------------------------------------------------------------
C1N978_MICPC/163-238--------------------------------------------------------------------------------
Q9KC53_BACHD/397-477--------------------------------------------------------------------------------
A0M123_GRAFK/89-168--------------------------------------------------------------------------------
Q5NX64_AROAE/73-152--------------------------------------------------------------------------------
Q8ELM2_OCEIH/63-143--------------------------------------------------------------------------------
Q6NJ02_CORDI/83-162--------------------------------------------------------------------------------
B7K5U4_CYAP8/39-113--------------------------------------------------------------------------------
Q0S417_RHOSR/271-354--------------------------------------------------------------------------------
Q7UGR8_RHOBA/447-530--------------------------------------------------------------------------------
Q8ELM2_OCEIH/411-490--------------------------------------------------------------------------------
Q1LGU6_RALME/27-104--------------------------------------------------------------------------------
A0PYF4_CLONN/263-346--------------------------------------------------------------------------------
Q0BW05_GRABC/100-175--------------------------------------------------------------------------------
Q7UG90_RHOBA/131-208--------------------------------------------------------------------------------
Q46JN3_PROMT/41-115--------------------------------------------------------------------------------
Q219Q4_RHOPB/92-183--------------------------------------------------------------------------------
C1E7H3_MICSR/155-230--------------------------------------------------------------------------------
Q5WBQ3_BACSK/413-492--------------------------------------------------------------------------------
A8LDS5_FRASN/354-432--------------------------------------------------------------------------------
A5GN11_SYNPW/41-115--------------------------------------------------------------------------------
B4U7M5_HYDS0/110-189--------------------------------------------------------------------------------
Q21G75_SACD2/67-146--------------------------------------------------------------------------------
A6L372_BACV8/68-142--------------------------------------------------------------------------------
B0CDM0_ACAM1/39-113--------------------------------------------------------------------------------
Q18HZ1_HALWD/71-148--------------------------------------------------------------------------------
Q18K27_HALWD/63-142--------------------------------------------------------------------------------
Q9KC53_BACHD/249-335--------------------------------------------------------------------------------
B8HR49_CYAP4/39-113--------------------------------------------------------------------------------
Q2S103_SALRD/46-123--------------------------------------------------------------------------------
Q31MS3_SYNE7/39-113--------------------------------------------------------------------------------
A3CWW6_METMJ/72-152--------------------------------------------------------------------------------
B1XJD3_SYNP2/39-113--------------------------------------------------------------------------------
A5N1P5_CLOK5/245-328--------------------------------------------------------------------------------
B1YH17_EXIS2/235-317--------------------------------------------------------------------------------
A0PYF4_CLONN/58-140--------------------------------------------------------------------------------
A1A2T3_BIFAA/23-98--------------------------------------------------------------------------------
B0RHX1_CLAMS/125-200--------------------------------------------------------------------------------
D5ANR9_RHOCB/96-186--------------------------------------------------------------------------------
I0HUK5_RUBGI/104-193--------------------------------------------------------------------------------
P96883_MYCTU/82-156--------------------------------------------------------------------------------
Q2FWI3_STAA8/69-143--------------------------------------------------------------------------------
Q2FWI4_STAA8/74-150--------------------------------------------------------------------------------
Q81U26_BACAN/238-321--------------------------------------------------------------------------------
Q81U26_BACAN/388-464--------------------------------------------------------------------------------
Q81U26_BACAN/60-138--------------------------------------------------------------------------------
Q83AL8_COXBU/89-163--------------------------------------------------------------------------------
Q8P4G6_XANCP/409-488--------------------------------------------------------------------------------
Q8P4G6_XANCP/70-149--------------------------------------------------------------------------------
Q8XK93_CLOPE/75-147--------------------------------------------------------------------------------
Q8Y8L4_LISMO/403-484--------------------------------------------------------------------------------
Q8Y8L4_LISMO/69-145--------------------------------------------------------------------------------
Q8Y8L5_LISMO/74-149--------------------------------------------------------------------------------
R5K541_9CLOT/18-95--------------------------------------------------------------------------------
R5UDD0_9FIRM/68-144--------------------------------------------------------------------------------
R7DAN2_9FIRM/16-93--------------------------------------------------------------------------------
U5L491_9BACI/392-472--------------------------------------------------------------------------------
U5L4Z8_9BACI/64-143--------------------------------------------------------------------------------

PF08512

M2PB53_CERS8/317-439--------------------------------------------------------------------------------
J9EJK7_WUCBA/478-566--------------------------------------------------------------------------------
U4LMA7_PYROM/238-328--------------------------------------------------------------------------------
B7Q220_IXOSC/339-427--------------------------------------------------------------------------------
F8QGE7_SERL3/271-369--------------------------------------------------------------------------------
B2AEJ4_PODAN/272-366--------------------------------------------------------------------------------
G3AM99_SPAPN/370-458--------------------------------------------------------------------------------
I1S1B4_GIBZE/227-319--------------------------------------------------------------------------------
W4XCL4_STRPU/232-319--------------------------------------------------------------------------------
I2FTX9_USTH4/817-905--------------------------------------------------------------------------------
Q5CXQ9_CRYPI/353-442--------------------------------------------------------------------------------
A8Q169_MALGO/421-512--------------------------------------------------------------------------------
M3HEX8_CANMX/253-350--------------------------------------------------------------------------------
G0S3H8_CHATD/273-370--------------------------------------------------------------------------------
K2QLS5_MACPH/277-370--------------------------------------------------------------------------------
T1IR25_STRMM/196-284--------------------------------------------------------------------------------
M3CY11_SPHMS/241-333--------------------------------------------------------------------------------
POB3_YARLI/386-477--------------------------------------------------------------------------------
M5BPS6_THACB/51-142--------------------------------------------------------------------------------
SPT16_CRYNJ/824-912--------------------------------------------------------------------------------
B3S4B9_TRIAD/341-430--------------------------------------------------------------------------------
A3LUQ9_PICST/284-379--------------------------------------------------------------------------------
K0KFZ5_WICCF/213-299--------------------------------------------------------------------------------
U9TN70_RHIID/375-469--------------------------------------------------------------------------------
F0YFE5_AURAN/365-463--------------------------------------------------------------------------------
E9EZP1_METAR/244-336--------------------------------------------------------------------------------
A4S5S2_OSTLU/804-891--------------------------------------------------------------------------------
G0SHK5_CHATD/370-462--------------------------------------------------------------------------------
K3ZC23_SETIT/339-430--------------------------------------------------------------------------------
A8B8A9_GIAIC/458-554--------------------------------------------------------------------------------
C4XWH5_CLAL4/283-380--------------------------------------------------------------------------------
F6VQ10_CIOIN/343-431--------------------------------------------------------------------------------
A0A023BCN2_GRENI/362-449--------------------------------------------------------------------------------
F4NZP4_BATDJ/343-435--------------------------------------------------------------------------------
A7EHR1_SCLS1/824-912--------------------------------------------------------------------------------
G1XGQ0_ARTOA/385-476--------------------------------------------------------------------------------
A1CDL9_ASPCL/396-488--------------------------------------------------------------------------------
M7XL72_TRIUA/36-124--------------------------------------------------------------------------------
U1GBI2_ENDPU/599-691--------------------------------------------------------------------------------
F4P0B1_BATDJ/806-894--------------------------------------------------------------------------------
M0USZ2_HORVD/62-155--------------------------------------------------------------------------------
D8TSG5_VOLCA/121-241--------------------------------------------------------------------------------
Q23D83_TETTS/262-350--------------------------------------------------------------------------------
G4MV07_MAGO7/823-911--------------------------------------------------------------------------------
T1JNC3_STRMM/337-425--------------------------------------------------------------------------------
D8R056_SELML/347-441--------------------------------------------------------------------------------
I4Y5W1_WALSC/369-460--------------------------------------------------------------------------------
H8ZDZ4_NEMS1/348-435--------------------------------------------------------------------------------
D2VNX5_NAEGR/729-815--------------------------------------------------------------------------------
H3DXW3_PRIPA/172-260--------------------------------------------------------------------------------
C4M6A1_ENTHI/240-330--------------------------------------------------------------------------------
U4LLV9_PYROM/363-455--------------------------------------------------------------------------------
C1EF78_MICSR/358-450--------------------------------------------------------------------------------
H2WAP1_CAEJA/809-897--------------------------------------------------------------------------------
B9IJT6_POPTR/348-439--------------------------------------------------------------------------------
G2X0I7_VERDV/257-350--------------------------------------------------------------------------------
RT106_PHANO/257-343--------------------------------------------------------------------------------
D3AXH6_POLPA/369-464--------------------------------------------------------------------------------
I1C1F7_RHIO9/365-456--------------------------------------------------------------------------------
RT106_PICGU/254-353--------------------------------------------------------------------------------
Q8SW60_ENCCU/652-747--------------------------------------------------------------------------------
A0D1L5_PARTE/273-361--------------------------------------------------------------------------------
G1XQ07_ARTOA/228-318--------------------------------------------------------------------------------
I4YG87_WALSC/824-912--------------------------------------------------------------------------------
C5KH74_PERM5/340-432--------------------------------------------------------------------------------
C1GLV0_PARBD/277-370--------------------------------------------------------------------------------
S9W629_SCHCR/354-445--------------------------------------------------------------------------------
Q8SRJ1_ENCCU/305-392--------------------------------------------------------------------------------
A7AMU7_BABBO/347-436--------------------------------------------------------------------------------
S3CR05_OPHP1/288-382--------------------------------------------------------------------------------
RT106_MAGO7/272-364--------------------------------------------------------------------------------
MU183_SCHPO/225-311--------------------------------------------------------------------------------
POB3_CRYNJ/370-462--------------------------------------------------------------------------------
R7YLM5_CONA1/253-345--------------------------------------------------------------------------------
R7YNS5_CONA1/352-444--------------------------------------------------------------------------------
C4QVU8_PICPG/363-452--------------------------------------------------------------------------------
S7ZBK4_PENO1/258-352--------------------------------------------------------------------------------
U5D0Q6_AMBTC/338-426--------------------------------------------------------------------------------
C5DLM5_LACTC/833-920--------------------------------------------------------------------------------
D7LYR7_ARALL/291-379--------------------------------------------------------------------------------
B6KBU5_TOXGO/365-455--------------------------------------------------------------------------------
D8UAM0_VOLCA/836-924--------------------------------------------------------------------------------
G7E0B9_MIXOS/402-493--------------------------------------------------------------------------------
M2MKJ1_BAUCO/237-329--------------------------------------------------------------------------------
U6HVB5_ECHMU/338-426--------------------------------------------------------------------------------
U4KWY1_PYROM/815-903--------------------------------------------------------------------------------
G5C2X8_HETGA/338-426--------------------------------------------------------------------------------
G0QWE9_ICHMG/261-347--------------------------------------------------------------------------------
H2WQH8_CAEJA/332-422--------------------------------------------------------------------------------
G2YRR9_BOTF4/376-468--------------------------------------------------------------------------------
J9ES64_WUCBA/340-428--------------------------------------------------------------------------------
G4UXS1_NEUT9/267-362--------------------------------------------------------------------------------
E4WR67_OIKDI/342-430--------------------------------------------------------------------------------
B6Q860_PENMQ/278-370--------------------------------------------------------------------------------
M7XH21_RHOT1/396-490--------------------------------------------------------------------------------
C5M9F0_CANTT/251-348--------------------------------------------------------------------------------
POB3_CANAL/362-454--------------------------------------------------------------------------------
S3DEK3_GLAL2/253-351--------------------------------------------------------------------------------
D7FLF8_ECTSI/342-440--------------------------------------------------------------------------------
H6BU47_EXODN/281-384--------------------------------------------------------------------------------
W1QJM3_OGAPD/194-281--------------------------------------------------------------------------------
S2JNH8_MUCC1/207-310--------------------------------------------------------------------------------
M4C0J9_HYAAE/276-361--------------------------------------------------------------------------------
R8B8V8_TOGMI/236-332--------------------------------------------------------------------------------
SPT16_CANGA/831-917--------------------------------------------------------------------------------
K0SUI2_THAOC/380-478--------------------------------------------------------------------------------
A7SV15_NEMVE/818-906--------------------------------------------------------------------------------
D5G911_TUBMM/235-325--------------------------------------------------------------------------------
H3GY61_PHYRM/341-438--------------------------------------------------------------------------------
G4M1N4_SCHMA/483-570--------------------------------------------------------------------------------
Q4N358_THEPA/330-419--------------------------------------------------------------------------------
G7YR77_CLOSI/356-444--------------------------------------------------------------------------------
U5H1N8_USTV1/395-488--------------------------------------------------------------------------------
K0KEJ9_WICCF/814-902--------------------------------------------------------------------------------
RT106_YARLI/219-307--------------------------------------------------------------------------------
E2LU78_MONPE/66-162--------------------------------------------------------------------------------
C4V834_NOSCE/641-727--------------------------------------------------------------------------------
G4TE41_PIRID/824-912--------------------------------------------------------------------------------
J4G3V7_FIBRA/295-403--------------------------------------------------------------------------------
F4R467_MELLP/387-476--------------------------------------------------------------------------------
SSP1B_CAEEL/339-429--------------------------------------------------------------------------------
R4XGU7_TAPDE/241-328--------------------------------------------------------------------------------
F0YK20_AURAN/256-343--------------------------------------------------------------------------------
SPT16_YARLI/813-901--------------------------------------------------------------------------------
S9W122_SCHCR/226-312--------------------------------------------------------------------------------
A7SAG6_NEMVE/330-421--------------------------------------------------------------------------------
T1G514_HELRO/319-407--------------------------------------------------------------------------------
F0ZPA4_DICPU/817-905--------------------------------------------------------------------------------
Q00W77_OSTTA/323-415--------------------------------------------------------------------------------
E5RZ09_TRISP/386-474--------------------------------------------------------------------------------
RT106_KLULA/207-293--------------------------------------------------------------------------------
I1BRC4_RHIO9/40-140--------------------------------------------------------------------------------
C4R4T9_PICPG/193-281--------------------------------------------------------------------------------
A9TBJ4_PHYPA/345-439--------------------------------------------------------------------------------
C0SCH6_PARBP/816-904--------------------------------------------------------------------------------
RT106_DEBHA/280-379--------------------------------------------------------------------------------
K3XFH7_SETIT/348-441--------------------------------------------------------------------------------
C1N716_MICPC/353-449--------------------------------------------------------------------------------
C3YLD4_BRAFL/810-898--------------------------------------------------------------------------------
G0RE12_HYPJQ/823-911--------------------------------------------------------------------------------
S7W7Y4_SPRLO/326-413--------------------------------------------------------------------------------
M7NLM5_PNEMU/802-890--------------------------------------------------------------------------------
Q7RAF9_PLAYO/58-147--------------------------------------------------------------------------------
K7LQJ8_SOYBN/78-174--------------------------------------------------------------------------------
G0MG00_CAEBE/339-429--------------------------------------------------------------------------------
K7MPW8_SOYBN/832-920--------------------------------------------------------------------------------
F8Q6D3_SERL3/668-755--------------------------------------------------------------------------------
B3RJ01_TRIAD/797-885--------------------------------------------------------------------------------
E6ZPS6_SPORE/387-477--------------------------------------------------------------------------------
F6QIX3_CIOIN/814-901--------------------------------------------------------------------------------
C4JJX0_UNCRE/249-342--------------------------------------------------------------------------------
F2U7M9_SALR5/353-444--------------------------------------------------------------------------------
T1K8N9_TETUR/813-901--------------------------------------------------------------------------------
R0KPL4_NOSB1/654-741--------------------------------------------------------------------------------
H2LEM6_ORYLA/340-427--------------------------------------------------------------------------------
E0VB75_PEDHC/777-865--------------------------------------------------------------------------------
G4T8M8_PIRID/353-442--------------------------------------------------------------------------------
J9K6K5_ACYPI/340-427--------------------------------------------------------------------------------
B6AFM0_CRYMR/870-961--------------------------------------------------------------------------------
D8PY95_SCHCM/357-447--------------------------------------------------------------------------------
A7EF87_SCLS1/223-318--------------------------------------------------------------------------------
B4I8T2_DROSE/339-427--------------------------------------------------------------------------------
W5HH08_WHEAT/119-204--------------------------------------------------------------------------------
RT106_LODEL/274-371--------------------------------------------------------------------------------
N1JFF3_BLUG1/384-475--------------------------------------------------------------------------------
W1QIX8_OGAPD/362-454--------------------------------------------------------------------------------
E4XS19_OIKDI/720-808--------------------------------------------------------------------------------
G1XMG7_ARTOA/821-909--------------------------------------------------------------------------------
K5WQC7_PHACS/300-419--------------------------------------------------------------------------------
G8ZLC5_TORDC/211-298--------------------------------------------------------------------------------
A0DSI1_PARTE/256-344--------------------------------------------------------------------------------
G6DL15_DANPL/339-428--------------------------------------------------------------------------------
J9DUA9_EDHAE/329-416--------------------------------------------------------------------------------
H8ZCJ1_NEMS1/752-840--------------------------------------------------------------------------------
C4VA45_NOSCE/302-389--------------------------------------------------------------------------------
M2LTM4_BAUCO/820-908--------------------------------------------------------------------------------
I2H6I5_TETBL/240-326--------------------------------------------------------------------------------
K1W653_MARBU/265-359--------------------------------------------------------------------------------
C4XW15_CLAL4/364-456--------------------------------------------------------------------------------
D8U9V6_VOLCA/358-450--------------------------------------------------------------------------------
F4PX70_DICFS/357-452--------------------------------------------------------------------------------
F6YII2_HORSE/339-427--------------------------------------------------------------------------------
G3JRH7_CORMM/242-333--------------------------------------------------------------------------------
D4AZE5_ARTBC/280-373--------------------------------------------------------------------------------
N1Q7D7_MYCFI/373-464--------------------------------------------------------------------------------
K1VJD1_TRIAC/749-837--------------------------------------------------------------------------------
D3AWW1_POLPA/842-929--------------------------------------------------------------------------------
C4M3K5_ENTHI/531-618--------------------------------------------------------------------------------
G3AUH1_SPAPN/79-169--------------------------------------------------------------------------------
K1Q5H6_CRAGI/340-428--------------------------------------------------------------------------------
M7WKG7_RHOT1/810-898--------------------------------------------------------------------------------
J3PG65_GAGT3/329-421--------------------------------------------------------------------------------
A8NIX9_COPC7/282-390--------------------------------------------------------------------------------
Q4N2N7_THEPA/649-736--------------------------------------------------------------------------------
R4X8W5_TAPDE/804-892--------------------------------------------------------------------------------
C3Z3Y2_BRAFL/338-426--------------------------------------------------------------------------------
A5DBS4_PICGU/384-475--------------------------------------------------------------------------------
B6K3E4_SCHJY/355-446--------------------------------------------------------------------------------
R1H0T9_BOTPV/402-493--------------------------------------------------------------------------------
L8G5Y3_PSED2/260-359--------------------------------------------------------------------------------
G8B5L6_CANPC/284-380--------------------------------------------------------------------------------
RT106_CHAGB/266-364--------------------------------------------------------------------------------
Q4X6Q9_PLACH/235-323--------------------------------------------------------------------------------
C1FEI5_MICSR/824-912--------------------------------------------------------------------------------
X6P659_RETFI/913-1000--------------------------------------------------------------------------------
F8PZZ9_SERL3/358-451--------------------------------------------------------------------------------
D2VV01_NAEGR/362-448--------------------------------------------------------------------------------
G3AWR9_CANTC/371-463--------------------------------------------------------------------------------
RT106_CANAL/245-342--------------------------------------------------------------------------------
POB3_DEBHA/367-460--------------------------------------------------------------------------------
SSRP1_DICDI/379-471--------------------------------------------------------------------------------
D8T4U2_SELML/827-915--------------------------------------------------------------------------------
J3QDH9_PUCT1/325-416--------------------------------------------------------------------------------
W4Z4J5_STRPU/382-470--------------------------------------------------------------------------------
F0V8K2_NEOCL/589-676--------------------------------------------------------------------------------
I1G5P6_AMPQE/808-896--------------------------------------------------------------------------------
B8PLP6_POSPM/283-392--------------------------------------------------------------------------------
K1WT88_MARBU/394-486--------------------------------------------------------------------------------
L0PAF9_PNEJ8/359-450--------------------------------------------------------------------------------
G7DYH1_MIXOS/812-900--------------------------------------------------------------------------------
I1FYM9_AMPQE/334-423--------------------------------------------------------------------------------
M5BW64_THACB/829-916--------------------------------------------------------------------------------
A7ATG3_BABBO/683-768--------------------------------------------------------------------------------
G8Y6R1_PICSO/369-461--------------------------------------------------------------------------------
V5FX85_BYSSN/253-347--------------------------------------------------------------------------------
G8YKW7_PICSO/280-378--------------------------------------------------------------------------------
D8Q1K6_SCHCM/265-361--------------------------------------------------------------------------------
F4RFN8_MELLP/841-929--------------------------------------------------------------------------------
F2UEG8_SALR5/777-865--------------------------------------------------------------------------------
S9W752_SCHCR/814-902--------------------------------------------------------------------------------
K0K6V3_WICCF/357-449--------------------------------------------------------------------------------
E7NL90_YEASO/383-474--------------------------------------------------------------------------------
R0JJB1_SETT2/378-470--------------------------------------------------------------------------------
B0D777_LACBS/275-372--------------------------------------------------------------------------------
D7FPY1_ECTSI/813-906--------------------------------------------------------------------------------

PF07289

Q7PUL7_ANOGA/6-340--------------------------------------------------------------VWEDREVKFD..IPSIYK
A9V1S9_MONBE/13-345--------------------------------------------------------------.WRDREVHFD..IGNKLI
T1EEF4_HELRO/6-339--------------------------------------------------------------LWQDRETRFD..VNPSLL
G6DR32_DANPL/9-341--------------------------------------------------------------VWEDREVLFD..LPFSYL
E9HBN7_DAPPU/3-333--------------------------------------------------------------YWQENEIRFD..VSSSYL
D2VIC7_NAEGR/11-348--------------------------------------------------------------FWQDREIRFDSNIEAGDL
K3X3B3_PYTUL/11-342--------------------------------------------------------------TWQDREIRFD..VSAAAM
E0W305_PEDHC/24-358--------------------------------------------------------------FWEDNEIRFD..VPFTQM
D6W797_TRICA/4-335--------------------------------------------------------------TWEDKEVRFD..IPFTEM
A4H6Y1_LEIBR/25-408--------------------------------------------------------------FWQDREIHFG..VSAAAL
Q231T4_TETTS/5-348--------------------------------------------------------------YFYDREIKFD..LQTKKL
Q17LJ5_AEDAE/6-339--------------------------------------------------------------VWEDREIKFD..ITNICK
Q4GYG4_TRYB2/18-367--------------------------------------------------------------LLLDRTIRFDTSLSELQE
C1EG27_MICSR/13-344--------------------------------------------------------------VWQDREIRFD..VRLKDL
E5RYK1_TRISP/644-958--------------------------------------------------------------IWEDRDVRFD..VDSKQL
E4WWD2_OIKDI/3-335--------------------------------------------------------------LWQDREVRFD..IEPEEV
A8WJB5_CAEBR/9-360--------------------------------------------------------------IWQDREIRFD..VDHKLL
F6T0X5_CIOIN/4-344--------------------------------------------------------------LWEDRDVRFD..LSLQQM
Q4QGM5_LEIMA/25-428--------------------------------------------------------------FWQDREIHFD..AATPVL
B4QVM9_DROSI/19-372--------------------------------------------------------------LWEDKEVKFD..VPQLHK
A8HWI3_CHLRE/14-351--------------------------------------------------------------CWQDREIRFD..CNANDI
Q21626_CAEEL/9-357--------------------------------------------------------------IWQDREIRFD..VDHKLL
Q4E5P7_TRYCC/18-371--------------------------------------------------------------FWFDREFRYNLPDEGLVV
A2FLN7_TRIVA/11-341--------------------------------------------------------------LTTDQVVRLF..QDQSKL
J9K6V4_ACYPI/6-342--------------------------------------------------------------TWEDQEIQFDLSIS.KAL
D8TIQ4_VOLCA/9-343--------------------------------------------------------------CWQDRELRFD..SSLTDI
B3RQQ8_TRIAD/9-342--------------------------------------------------------------LWEDRDIRFD..ISLAQM
T1JH94_STRMM/18-350--------------------------------------------------------------LWQDRDIRFD..VAPSEM
W4Z3R7_STRPU/9-342--------------------------------------------------------------LWEDRDVRFD..INPSQM
E1GAE4_LOALO/12-348--------------------------------------------------------------IWQDRDIRFD..VNPRLL
E3LZ78_CAERE/12-378--------------------------------------------------------------IWQDREIRFD..VDHKLL
K7J1K7_NASVI/1-331--------------------------------------------------------------MWQDNQVKFD..VALSQM
I1FWY5_AMPQE/11-351--------------------------------------------------------------LWQDRDIKFD..SNDKAL
Q3SCX0_PARTE/5-323--------------------------------------------------------------FLYDRCIHFD..IAAAKL
H9KJ67_APIME/1-328--------------------------------------------------------------MWQDNEVRFD..ISYNHM
B7PHC5_IXOSC/11-344--------------------------------------------------------------LWQDRDVRFD..VSNQCS
F0YFS0_AURAN/24-363--------------------------------------------------------------VWQDREIRFD..TPTAHL
BBS5_DANRE/8-340--------------------------------------------------------------LWEDRDVRFD..ITAQQM
C1MWZ6_MICPC/13-351--------------------------------------------------------------VWQDREIRFD..MAVKGL
F4WAX0_ACREC/1-331--------------------------------------------------------------MWQDNQVKFD..VSHSNM
F2TYE0_SALR5/18-356--------------------------------------------------------------.WRDHEVRFD..SIATHM
H9JGR5_BOMMO/9-342--------------------------------------------------------------VWEDREVLFD..LPFAYL
A7RY88_NEMVE/5-337--------------------------------------------------------------LWEDRDVRFD..ITLQQM
D7G173_ECTSI/10-344--------------------------------------------------------------VWQDREVRFD..STPAEM

PF03531

K0K6V3_WICCF/79-302--------------------------------------------------------------DGFDQQDFNQLKNGLQQ.
N1JFF3_BLUG1/79-328--------------------------------------------------------------DGFSQEDYDRLSKIFKNW
G4LWM1_SCHMA/74-282--------------------------------------------------------------DGFGEIEAEKVGSFFKKY
F7E2T1_XENTR/75-284--------------------------------------------------------------DGFRDTEYDKLFDYFKSH
A4SAX2_OSTLU/79-298--------------------------------------------------------------.GMGTEDAKNAAEYAARE
F4NZP4_BATDJ/55-287--------------------------------------------------------------DGFPKDSFEYLSSIANQH
C5DFM8_LACTC/79-313--------------------------------------------------------------DGFSQEDFNLIKNDFKRR
POB3_CANAL/76-307--------------------------------------------------------------DGFDHDDFTQLKQELTRN
C4JJP8_UNCRE/82-330--------------------------------------------------------------DGFQQEDFERSSKAFKLW
U6GM68_EIMAC/87-293--------------------------------------------------------------DGFHKKNYEDIRRHFSEH
D3AXH6_POLPA/88-307--------------------------------------------------------------DGFREQDYDFLKKFISEN
D7FLF8_ECTSI/69-286--------------------------------------------------------------DGFSKAQHADIEKFLSER
H6C9W7_EXODN/70-320--------------------------------------------------------------DGFEEEDYDRAAKAFKIW
POB3_SCHPO/74-299--------------------------------------------------------------DGFSQEDLDDLINVIKQN
E6ZPS6_SPORE/85-331--------------------------------------------------------------DGFVRDDYDRLSSHIRDY
C5FT09_ARTOC/124-375--------------------------------------------------------------DGFEQDDFDRAAKAFKIW
E5RZ09_TRISP/126-331--------------------------------------------------------------....SKDFDRLSAYLKKN
W1P7A3_AMBTC/75-294--------------------------------------------------------------IGFREQDVNNLNSFISNT
G1XGQ0_ARTOA/75-329--------------------------------------------------------------DGFEQTDFDRLKDILKHS
U6IC17_HYMMI/74-283--------------------------------------------------------------DGFGEIEAEKLSSYFKKN
U1G4R9_ENDPU/75-327--------------------------------------------------------------DGFEQEDFDRASKCFRIW
G9NKX3_HYPAI/73-321--------------------------------------------------------------DGFQQEDYERLSKIFKNW
U9TN70_RHIID/75-319--------------------------------------------------------------DGFNKDMFDAVRDLIRTN
B7Q220_IXOSC/74-284--------------------------------------------------------------GGFQDDEQDRLAKFFKHH
A7SAG6_NEMVE/68-275--------------------------------------------------------------DGFKESDFANLSEFLKSF
A8NQK0_COPC7/71-298--------------------------------------------------------------DGFLREEHDKLASLLKNH
T1JNC3_STRMM/74-282--------------------------------------------------------------GGLKETELEKLSKFFEHN
Q5CIB9_CRYHO/71-289--------------------------------------------------------------TGFKTEDYSVIKSHFETY
L8FYL1_PSED2/70-318--------------------------------------------------------------DGFQQDDFDRLTKVFKNW
B6ACD0_CRYMR/80-297--------------------------------------------------------------TGFRSLDFPIIEKHFKTY
C3Z3Y2_BRAFL/73-283--------------------------------------------------------------DGFKESDFDKLSDFINKN
R9AAY5_WALI9/70-309--------------------------------------------------------------DGLVRDDFERLSKTVKEF
R1H0T9_BOTPV/95-344--------------------------------------------------------------DGFQQEDYERLTKVFKMW
D8PY95_SCHCM/72-303--------------------------------------------------------------DGFAREDHDKLATLLRNY
F4PX70_DICFS/82-302--------------------------------------------------------------DGFREPDNETLKQFFKEN
A5DBS4_PICGU/104-330--------------------------------------------------------------DGFAVEDYAQLKQEMQRN
S2JG34_MUCC1/74-308--------------------------------------------------------------DGFKPDDLDELKESVKAF
F8PZZ9_SERL3/71-305--------------------------------------------------------------DGFAREDHDKLAGLMKQH
G3AM99_SPAPN/80-315--------------------------------------------------------------DGFDVDDFAQLKQELARN
W1QIX8_OGAPD/77-307--------------------------------------------------------------DGFDQQDLNGLKNELQRN
G8Y6R1_PICSO/79-314--------------------------------------------------------------DGFDVEDFAKLKQELQRN
Q0IEB2_AEDAE/74-282--------------------------------------------------------------IGFT.GDEQKIADFVKKN
J7RZK8_KAZNA/80-313--------------------------------------------------------------DGFTPEDFNLVKGDFHRR
M2RFF8_COCSN/69-317--------------------------------------------------------------DGFKQEDFDRVAKVFKTW
T1JSI6_TETUR/75-284--------------------------------------------------------------MGFQENDYEKLKKSIDQH
G2YRR9_BOTF4/72-320--------------------------------------------------------------DGFLQDDFERLSKVFKNW
E0VDU0_PEDHC/75-282--------------------------------------------------------------KGFKEAEQNKLANFFLSK
SSRP1_DROME/75-284--------------------------------------------------------------TGFRDSEHEKLGKFIKAA
POB3_ASHGO/79-314--------------------------------------------------------------DGFSQEDFTLLKNDLQRR
F9X858_MYCGM/69-317--------------------------------------------------------------DGFKQDDFETIQKCFKVW
SSP1B_CAEEL/74-285--------------------------------------------------------------GGFLDDDLQKIQSFTSSN
E9H7T5_DAPPU/74-282--------------------------------------------------------------GGFKDSDQDKLAKFFTQT
B9H0D7_POPTR/75-295--------------------------------------------------------------TGFRDQDLSTLTNFFQ.S
U4LLV9_PYROM/73-307--------------------------------------------------------------DGFEQDDFDRAKEAMKAY
R7YNS5_CONA1/46-296--------------------------------------------------------------DGFQQEDFDRVARSFKNY
A3LUL0_PICST/77-318--------------------------------------------------------------DGFDVEDFTKLKQELQRN
F0XPZ4_GROCL/73-313--------------------------------------------------------------DGFQQEDYERLSKIFKNW
A2DGX1_TRIVA/70-274--------------------------------------------------------------..FQIGDKSKLFAALKNQ
C9SUU3_VERA1/73-321--------------------------------------------------------------DGFPQDEFERLSKLFKNW
D2VV01_NAEGR/75-307--------------------------------------------------------------LGFKEADYEQLESQIVQV
POB3_CRYNJ/76-317--------------------------------------------------------------DGFKRDDLDKIKRTLQEY
C4QVU8_PICPG/78-307--------------------------------------------------------------DGFEQQDFQQLKNEIQRT
T1G514_HELRO/58-264--------------------------------------------------------------DGFRESDFEKVSEFIKKN
A0A023BCN2_GRENI/77-301--------------------------------------------------------------SGFREHDFETLQSYFKRH
Q4UAH0_THEAN/101-308--------------------------------------------------------------.......VLDLSKHFEEN
G0MG00_CAEBE/74-285--------------------------------------------------------------GGFKDTDLDKLKQFTDSA
H9K7N5_APIME/74-283--------------------------------------------------------------RGFKEGDQEKIAKFFTQN
B8C388_THAPS/53-273--------------------------------------------------------------DGFPPSDFDRLTEAFQTM
G4T8M8_PIRID/70-292--------------------------------------------------------------EGFRREDQDTLTSLLKQN
F6VQ10_CIOIN/78-286--------------------------------------------------------------DGFKEMEFERLKDFVKNY
K5XVN9_AGABU/72-302--------------------------------------------------------------DGFMREDHDKLASLLKNH
B8MEU9_TALSN/70-323--------------------------------------------------------------DGFDQEDFERLSRAFKVW
E4WR67_OIKDI/77-287--------------------------------------------------------------DGFKDEHLKKLSSYFRNN
D8R056_SELML/75-291--------------------------------------------------------------TGFREQDVSSLNTFITSN
M2R6G6_CERS8/71-304--------------------------------------------------------------DGFVREDHDKLAQLMKQH
SSRP1_ARATH/75-294--------------------------------------------------------------VGFRDQDVPSLSSFFQSS
T0L0V4_COLGC/74-320--------------------------------------------------------------DGFQQEDYERLSKIFKSW
Q0JQ27_ORYSJ/75-293--------------------------------------------------------------IGFREQDVSSLTNFMQKN
G3AWR9_CANTC/79-316--------------------------------------------------------------DGFDSENFAELKQELQRN
G8ZSS5_TORDC/79-316--------------------------------------------------------------DGFSQEDFNLIKNDFHRR
A9TBJ4_PHYPA/71-289--------------------------------------------------------------NGFRESDMANLGSFFTTN
H3GY61_PHYRM/71-284--------------------------------------------------------------TGLKAQDVAQLKSHVESH
B6KBU5_TOXGO/99-311--------------------------------------------------------------DGFHEKNFADLSRHFDAH
R4FNX0_RHOPR/75-283--------------------------------------------------------------TGFKESDLE.IGKYFKSK
Q2H6S0_CHAGB/59-287--------------------------------------------------------------.....EDYERLSKIFKNW
C5L6E2_PERM5/78-286--------------------------------------------------------------DGFQDSNYETVKAFFKKH
A8P7R4_BRUMA/74-285--------------------------------------------------------------GGFAEKDFEDIKKFALDR
A7TMB5_VANPO/79-318--------------------------------------------------------------DGFSEDDFNIIKGDFHRR
D8U9V6_VOLCA/76-298--------------------------------------------------------------LGFRDKDLDALQHYARNA
B3S4B9_TRIAD/76-284--------------------------------------------------------------EGFKEADYDKLADLFSGN
C7Z9V4_NECH7/74-323--------------------------------------------------------------DGFQQEDYDRLSKVFKNW
F2U7M9_SALR5/77-287--------------------------------------------------------------EGFKSNDMNAMIDFFKKH
I1FYM9_AMPQE/69-279--------------------------------------------------------------SGFKESDYGDLRDFFKQN
M7PI11_PNEMU/73-307--------------------------------------------------------------DGFDDEDLDTLRKTIKKY
D8M9Z0_BLAHO/70-287--------------------------------------------------------------DGFKRSDYDALSPFLKSV
H2WQH8_CAEJA/68-276--------------------------------------------------------------GGFKDADYDKIADFAKEN
N1Q7D7_MYCFI/70-318--------------------------------------------------------------DGFKEDDFDTIQKCFKVW
Q8IL56_PLAF7/86-299--------------------------------------------------------------DGFPDRNVNEITQHFQKY
F0YFE5_AURAN/71-306--------------------------------------------------------------DGFARRDQETLGGALKDQ
C1EF78_MICSR/76-304--------------------------------------------------------------KGFRGSDMATVKEAMKAL
G0PNS9_CAEBE/74-285--------------------------------------------------------------GGFKDTDLENIKEFVKTH
X1WJ52_ACYPI/73-283--------------------------------------------------------------SGFNESDQDKIAKYFKNT
K5WMV1_PHACS/78-312--------------------------------------------------------------DGFARDDHDRLAQLLKQH
A7AMU7_BABBO/80-294--------------------------------------------------------------SGFSEKAVDELKQHFDEH
K3ZC23_SETIT/71-284--------------------------------------------------------------FGFRQQDVSNLSNFIQRS
I2GZA7_TETBL/79-321--------------------------------------------------------------DGFSQDDFDLLKGDFHRR
C1N716_MICPC/76-300--------------------------------------------------------------RGFRASDLAGVKELVAEC
V2XNB2_MONRO/74-301--------------------------------------------------------------DGFTREDHDRVAKLLKDH
F4R467_MELLP/83-333--------------------------------------------------------------DGFRADDHDKLANLFKQH
E3JV35_PUCGT/83-325--------------------------------------------------------------DGFRPEDQEKLSNLFKQH
K1Q5H6_CRAGI/75-285--------------------------------------------------------------DGFKEGEFEKLAAFISKY

PF10882

D2RH36_ARCPA/66-169--------------------------------------------------------------------------------
Q892T1_CLOTE/66-167--------------------------------------------------------------------------------
A5N6R3_CLOK5/63-164--------------------------------------------------------------------------------
A9B463_HERA2/77-175--------------------------------------------------------------------------------
D9SW68_CLOC7/63-164--------------------------------------------------------------------------------
Q67L16_SYMTH/48-147--------------------------------------------------------------------------------
D5XC81_THEPJ/68-168--------------------------------------------------------------------------------
C5CH43_KOSOT/70-173--------------------------------------------------------------------------------
F2KQG8_ARCVS/58-157--------------------------------------------------------------------------------
B1I1Z1_DESAP/63-162--------------------------------------------------------------------------------
A3HRM5_9BACT/66-167--------------------------------------------------------------------------------
E8N364_ANATU/72-171--------------------------------------------------------------------------------
A2BJK7_HYPBU/63-163--------------------------------------------------------------------------------
A5I617_CLOBH/64-163--------------------------------------------------------------------------------
A6L350_BACV8/68-162--------------------------------------------------------------------------------
A9WIF8_CHLAA/77-175--------------------------------------------------------------------------------
Y1301_CLOAB/63-163--------------------------------------------------------------------------------
Q8XIV7_CLOPE/64-163--------------------------------------------------------------------------------
U5S0J0_9CLOT/64-164--------------------------------------------------------------------------------

PF06713

L8ATU0_BACIU/60-136--------------------------------------------------------------------------------
A7GTV4_BACCN/61-123--------------------------------------------------------------------------------
A6T2Q0_JANMA/61-134--------------------------------------------------------------------------------
Q5WGJ5_BACSK/65-143--------------------------------------------------------------------------------
Q5WLL6_BACSK/65-138--------------------------------------------------------------------------------
Q6HLV3_BACHK/52-125--------------------------------------------------------------------------------
Q5WBM1_BACSK/61-138--------------------------------------------------------------------------------
D7IH66_9BACE/53-129--------------------------------------------------------------------------------
Q9K9B1_BACHD/42-116--------------------------------------------------------------------------------
A0A015MXD4_BACFG/53-129--------------------------------------------------------------------------------
A6KZD8_BACV8/54-130--------------------------------------------------------------------------------
A5WI48_PSYWF/64-136--------------------------------------------------------------------------------
Q8ELH5_OCEIH/56-129--------------------------------------------------------------------------------
A4BZG7_9FLAO/58-133--------------------------------------------------------------------------------
Q9KEX6_BACHD/65-138--------------------------------------------------------------------------------
Q67SW8_SYMTH/62-135--------------------------------------------------------------------------------
Q633A6_BACCZ/61-123--------------------------------------------------------------------------------
A7UYW5_BACUN/53-129--------------------------------------------------------------------------------
C2SZ95_BACCE/53-128--------------------------------------------------------------------------------
Q5WM07_BACSK/64-139--------------------------------------------------------------------------------
Q8ETD0_OCEIH/64-141--------------------------------------------------------------------------------
A9VJV3_BACWK/52-125--------------------------------------------------------------------------------
Q2BCY1_9BACI/62-139--------------------------------------------------------------------------------
A7AH02_9PORP/54-129--------------------------------------------------------------------------------
A4ASP1_MARSH/60-135--------------------------------------------------------------------------------
A7LYH2_BACO1/53-129--------------------------------------------------------------------------------
A6KZD7_BACV8/56-123--------------------------------------------------------------------------------
A4CQ29_ROBBH/54-128--------------------------------------------------------------------------------
Q4V1T4_BACCZ/53-127--------------------------------------------------------------------------------
A6EQ87_9BACT/59-133--------------------------------------------------------------------------------
A4ANC2_MARSH/53-127--------------------------------------------------------------------------------
A3J6N6_9FLAO/59-136--------------------------------------------------------------------------------
A7GNM9_BACCN/53-127--------------------------------------------------------------------------------
A0A016A011_BACFG/55-123--------------------------------------------------------------------------------
Q5WDR5_BACSK/61-138--------------------------------------------------------------------------------
Q8EQJ6_OCEIH/52-125--------------------------------------------------------------------------------
A6CHZ7_9BACI/57-130--------------------------------------------------------------------------------
Q99IS9_9BACT/61-134--------------------------------------------------------------------------------
A6TN63_ALKMQ/64-137--------------------------------------------------------------------------------
A5ZET0_9BACE/53-129--------------------------------------------------------------------------------
A6LGE4_PARD8/53-128--------------------------------------------------------------------------------
K5DA95_RHOBT/65-137--------------------------------------------------------------------------------
C2SXV9_BACCE/2-75--------------------------------------------------------------------------------
A6CKW3_9BACI/69-152--------------------------------------------------------------------------------
Q8CV26_OCEIH/61-135--------------------------------------------------------------------------------
A3XNY3_LEEBM/58-133--------------------------------------------------------------------------------

PF15405

A7TQH3_VANPO/867-996--------------------------------------------------------------------------------
A8QCG1_MALGO/650-787--------------------------------------------------------------------------------
B6HR54_PENCW/741-867--------------------------------------------------------------------------------
B6K4Z0_SCHJY/799-929--------------------------------------------------------------------------------
B6K7Q5_SCHJY/658-790--------------------------------------------------------------------------------
C5DFA7_LACTC/775-905--------------------------------------------------------------------------------
D5G4S8_TUBMM/733-864--------------------------------------------------------------------------------
D6RNQ8_COPC7/510-650--------------------------------------------------------------------------------
E3KTU1_PUCGT/826-974--------------------------------------------------------------------------------
E4ZWW2_LEPMJ/934-1064--------------------------------------------------------------------------------
F0XUN9_GROCL/777-902--------------------------------------------------------------------------------
F2Z621_KLULA/763-894--------------------------------------------------------------------------------
F9X7Y7_MYCGM/750-877--------------------------------------------------------------------------------
G0V5Q3_NAUCC/849-979--------------------------------------------------------------------------------
G1XBW2_ARTOA/827-954--------------------------------------------------------------------------------
G2WW94_VERDV/764-891--------------------------------------------------------------------------------
G2YJS9_BOTF4/50-174--------------------------------------------------------------------------------
G4NKJ4_MAGO7/790-913--------------------------------------------------------------------------------
G7DY91_MIXOS/924-1056--------------------------------------------------------------------------------
G8BPI3_TETPH/796-928--------------------------------------------------------------------------------
G8ZUV3_TORDC/841-971--------------------------------------------------------------------------------
G9N7F4_HYPVG/769-895--------------------------------------------------------------------------------
H1UV38_COLHI/767-893--------------------------------------------------------------------------------
I1BJ67_RHIO9/768-907--------------------------------------------------------------------------------
I1BQA0_RHIO9/235-373--------------------------------------------------------------------------------
I1C1X6_RHIO9/740-879--------------------------------------------------------------------------------
Q4P7K1_USTMA/348-484--------------------------------------------------------------------------------
Q6CDY6_YARLI/831-954--------------------------------------------------------------------------------
Q752J0_ASHGO/816-948--------------------------------------------------------------------------------
RGF2_SCHPO/670-802--------------------------------------------------------------------------------
RGF1_SCHPO/844-972--------------------------------------------------------------------------------
E7NHW6_YEASO/518-648--------------------------------------------------------------------------------
F8Q550_SERL3/776-912--------------------------------------------------------------------------------
G4U7U0_NEUT9/784-907--------------------------------------------------------------------------------
Q4WUI2_ASPFU/728-851--------------------------------------------------------------------------------
Q5KB00_CRYNJ/694-836--------------------------------------------------------------------------------
W1QFJ3_OGAPD/758-896--------------------------------------------------------------------------------

PF16652

F4Q0K6_DICFS/582-649--------------------------------------------------------------------------------
I1FPV5_AMPQE/1081-1156--------------------------------------------------------------------------------
H3D2Y5_TETNG/477-540--------------------------------------------------------------------------------
F1RB67_DANRE/459-521--------------------------------------------------------------------------------
E7F4U1_DANRE/476-538--------------------------------------------------------------------------------
A2RUX1_DANRE/474-535--------------------------------------------------------------------------------
H2VDT5_TAKRU/287-350--------------------------------------------------------------------------------
M4AJZ7_XIPMA/768-830--------------------------------------------------------------------------------
G1KIR4_ANOCA/1103-1165--------------------------------------------------------------------------------
M4A6K1_XIPMA/1086-1148--------------------------------------------------------------------------------
G3PXN6_GASAC/306-375--------------------------------------------------------------------------------
F6ZCG9_XENTR/229-291--------------------------------------------------------------------------------
I1U3D6_ORYLA/350-412--------------------------------------------------------------------------------
F1NJU1_CHICK/482-544--------------------------------------------------------------------------------
E1B9G8_BOVIN/334-396--------------------------------------------------------------------------------
Q16R60_AEDAE/362-435--------------------------------------------------------------------------------
Q7PMK0_ANOGA/1503-1577--------------------------------------------------------------------------------
B3MD72_DROAN/1772-1839--------------------------------------------------------------------------------
B4MQQ2_DROWI/1788-1856--------------------------------------------------------------------------------
G6CLT4_DANPL/748-815--------------------------------------------------------------------------------
H3E6I2_PRIPA/644-713--------------------------------------------------------------------------------
G0MI70_CAEBE/978-1047--------------------------------------------------------------------------------
F1KQK1_ASCSU/1029-1098--------------------------------------------------------------------------------
J9FEQ9_WUCBA/734-803--------------------------------------------------------------------------------
L7MEV5_9ACAR/1159-1235--------------------------------------------------------------------------------
B7QI72_IXOSC/241-315--------------------------------------------------------------------------------
K1RR99_CRAGI/1042-1116--------------------------------------------------------------------------------
B3SCV3_TRIAD/907-987--------------------------------------------------------------------------------
F1QUN4_DANRE/946-1020--------------------------------------------------------------------------------
H2RNA8_TAKRU/921-999--------------------------------------------------------------------------------
I3KR26_ORENI/954-1032--------------------------------------------------------------------------------
R7VJM8_CAPTE/1319-1392--------------------------------------------------------------------------------
C3XR85_BRAFL/199-274--------------------------------------------------------------------------------
A7SRI8_NEMVE/240-313--------------------------------------------------------------------------------
B0JZC2_XENTR/705-778--------------------------------------------------------------------------------
M3W909_FELCA/644-717--------------------------------------------------------------------------------
F7DVU8_ORNAN/534-606--------------------------------------------------------------------------------
J9JQX8_ACYPI/1076-1146--------------------------------------------------------------------------------
H9K9Y6_APIME/1712-1783--------------------------------------------------------------------------------
E9GNC8_DAPPU/245-319--------------------------------------------------------------------------------
R4WDG5_9HEMI/459-523--------------------------------------------------------------------------------
H3CRZ0_TETNG/625-698--------------------------------------------------------------------------------
M3ZX67_XIPMA/702-775--------------------------------------------------------------------------------
H3AFG5_LATCH/610-683--------------------------------------------------------------------------------
H1A431_TAEGU/397-468--------------------------------------------------------------------------------
Q6XS95_XENLA/999-1072--------------------------------------------------------------------------------
H2TY33_TAKRU/922-995--------------------------------------------------------------------------------
H9GMJ3_ANOCA/960-1033--------------------------------------------------------------------------------
F7E9P4_XENTR/995-1064--------------------------------------------------------------------------------
F6WE69_HORSE/989-1062--------------------------------------------------------------------------------
E7FDV8_DANRE/967-1040--------------------------------------------------------------------------------
L8HIM8_ACACA/86-163--------------------------------------------------------------------------------
G4M1K0_SCHMA/1380-1453--------------------------------------------------------------------------------
E9C6R0_CAPO3/758-815--------------------------------------------------------------------------------
I1FJT4_AMPQE/34-101--------------------------------------------------------------------------------
E9CIT4_CAPO3/1629-1696--------------------------------------------------------------------------------
H6QNV2_PUCGT/1939-2007--------------------------------------------------------------------------------
F4S205_MELLP/1799-1860--------------------------------------------------------------------------------
E5SHC2_TRISP/1437-1506--------------------------------------------------------------------------------
F1KQJ6_ASCSU/1385-1453--------------------------------------------------------------------------------
A8NHP3_BRUMA/115-184--------------------------------------------------------------------------------
E2B7P2_HARSA/286-356--------------------------------------------------------------------------------
K7JHQ7_NASVI/280-349--------------------------------------------------------------------------------
D6WH10_TRICA/455-522--------------------------------------------------------------------------------
N6TRI8_DENPD/1372-1439--------------------------------------------------------------------------------
E9GGN7_DAPPU/1507-1577--------------------------------------------------------------------------------
B7PVP6_IXOSC/339-409--------------------------------------------------------------------------------
K1RGX4_CRAGI/988-1055--------------------------------------------------------------------------------
R7US78_CAPTE/312-382--------------------------------------------------------------------------------
A7RUY7_NEMVE/99-171--------------------------------------------------------------------------------
C3ZLK0_BRAFL/982-1048--------------------------------------------------------------------------------
H2XVQ2_CIOIN/1434-1504--------------------------------------------------------------------------------
G1QVX0_NOMLE/237-307--------------------------------------------------------------------------------
F1R0Z9_DANRE/1475-1545--------------------------------------------------------------------------------
A3KQK0_DANRE/238-307--------------------------------------------------------------------------------
H3DK01_TETNG/1364-1434--------------------------------------------------------------------------------
I3IVP3_ORENI/1445-1515--------------------------------------------------------------------------------
I4YGU5_WALSC/1457-1509--------------------------------------------------------------------------------
G7DWX8_MIXOS/1684-1737--------------------------------------------------------------------------------
M7XIH0_RHOT1/1697-1751--------------------------------------------------------------------------------
G4TEE5_PIRID/1837-1889--------------------------------------------------------------------------------
M5GAJ2_DACSP/1877-1929--------------------------------------------------------------------------------
R7SD96_TREMS/1940-1990--------------------------------------------------------------------------------
E2L4V2_MONPE/64-116--------------------------------------------------------------------------------
J9VV31_CRYNH/1828-1878--------------------------------------------------------------------------------
R7SKN3_DICSQ/1831-1883--------------------------------------------------------------------------------
D8PUQ3_SCHCM/1823-1875--------------------------------------------------------------------------------
M2QQ29_CERS8/915-967--------------------------------------------------------------------------------
K5XIT5_AGABU/1929-1981--------------------------------------------------------------------------------
A8PA90_COPC7/1965-2017--------------------------------------------------------------------------------
B0D2P7_LACBS/1825-1877--------------------------------------------------------------------------------

PF15410

E5RJ29_HUMAN/721-832--------------------------------------------------------------------------------
H2SLA8_TAKRU/516-627--------------------------------------------------------------------------------
B7QFP5_IXOSC/177-288--------------------------------------------------------------------------------
I1BQ29_RHIO9/379-506--------------------------------------------------------------------------------
D4YWC5_CAEEL/387-497--------------------------------------------------------------------------------
E3JSD7_PUCGT/1317-1461--------------------------------------------------------------------------------
YDYB_SCHPO/679-804--------------------------------------------------------------------------------
F6X1S7_XENTR/10-124--------------------------------------------------------------------------------
E9H3M8_DAPPU/491-615--------------------------------------------------------------------------------
G4VKT4_SCHMA/511-627--------------------------------------------------------------------------------
E5SKG2_TRISP/325-435--------------------------------------------------------------------------------
I1CBT7_RHIO9/688-826--------------------------------------------------------------------------------
A8PYL1_BRUMA/369-479--------------------------------------------------------------------------------
E1JIT7_DROME/792-903--------------------------------------------------------------------------------
U1M7X4_ASCSU/467-577--------------------------------------------------------------------------------
W5JQ26_ANODA/1159-1272--------------------------------------------------------------------------------

PF00169

CTRO_MOUSE/1470-1589--------------------------------------------------------------------------------
ARHG6_HUMAN/450-548--------------------------------------------------------------------------------
SPTCB_DROME/2148-2259--------------------------------------------------------------------------------
CA120_YEAST/76-204--------------------------------------------------------------------------------
VAV_RAT/403-504--------------------------------------------------------------------------------
PLCD4_RAT/17-124--------------------------------------------------------------------------------
PLD1_HUMAN/220-328--------------------------------------------------------------------------------
ARHG5_HUMAN/1391-1502--------------------------------------------------------------------------------
Q93569_CAEEL/7-101--------------------------------------------------------------------------------
SOS2_MOUSE/443-545--------------------------------------------------------------------------------
PSD1_HUMAN/757-869--------------------------------------------------------------------------------
YHT1_YEAST/194-304--------------------------------------------------------------------------------
SIP3_YEAST/310-423--------------------------------------------------------------------------------
YOTB_CAEEL/36-131--------------------------------------------------------------------------------
ARHG8_HUMAN/387-501--------------------------------------------------------------------------------
TIAM1_MOUSE/1261-1395--------------------------------------------------------------------------------
DOK1_HUMAN/4-119--------------------------------------------------------------------------------
BMX_HUMAN/5-111--------------------------------------------------------------------------------
CAPS1_MOUSE/520-622--------------------------------------------------------------------------------
PLCG1_HUMAN/33-142--------------------------------------------------------------------------------
PLEK_HUMAN/245-347--------------------------------------------------------------------------------
RDCII_DICDI/354-461--------------------------------------------------------------------------------
OSH2_YEAST/290-386--------------------------------------------------------------------------------
GRB7_MOUSE/229-341--------------------------------------------------------------------------------
TIAM1_MOUSE/434-547--------------------------------------------------------------------------------
SLM1_YEAST/469-581--------------------------------------------------------------------------------
TG325_CAEEL/387-505--------------------------------------------------------------------------------
CYH1_HUMAN/261-377--------------------------------------------------------------------------------
SIF1_DROME/849-955--------------------------------------------------------------------------------
RGA2_SCHPO/720-836--------------------------------------------------------------------------------
APSA_EMENI/1394-1504--------------------------------------------------------------------------------
SH2B1_RAT/247-376--------------------------------------------------------------------------------
Q17777_CAEEL/241-343--------------------------------------------------------------------------------
MIG10_CAEEL/457-566--------------------------------------------------------------------------------
SNT1_CAEEL/228-340--------------------------------------------------------------------------------
GAB1_HUMAN/6-116--------------------------------------------------------------------------------
BUD4_CANAL/1577-1685--------------------------------------------------------------------------------
SKM1_YEAST/4-118--------------------------------------------------------------------------------
SECG_DICDI/785-895--------------------------------------------------------------------------------
VAV2_MOUSE/401-502--------------------------------------------------------------------------------
PLEK_HUMAN/5-101--------------------------------------------------------------------------------
ARHGG_HUMAN/502-620--------------------------------------------------------------------------------
AKT1_DROME/107-211--------------------------------------------------------------------------------
PLCL1_RAT/115-224--------------------------------------------------------------------------------
FGD1_HUMAN/822-921--------------------------------------------------------------------------------
ARHG2_MOUSE/474-572--------------------------------------------------------------------------------
RHG25_HUMAN/47-151--------------------------------------------------------------------------------
FGD1_HUMAN/591-689--------------------------------------------------------------------------------
AKT2_MOUSE/6-108--------------------------------------------------------------------------------
ATG26_YEAST/239-336--------------------------------------------------------------------------------
Q21025_CAEEL/833-940--------------------------------------------------------------------------------
BEM2_YEAST/1832-1948--------------------------------------------------------------------------------
ITK_MOUSE/5-117--------------------------------------------------------------------------------
DOS_DROME/4-113--------------------------------------------------------------------------------
CRAC_DICDI/23-122--------------------------------------------------------------------------------
SIF1_DROME/1672-1793--------------------------------------------------------------------------------
SPTB2_HUMAN/2198-2307--------------------------------------------------------------------------------
TRIO_HUMAN/2158-2271--------------------------------------------------------------------------------
MUG79_SCHPO/1044-1158--------------------------------------------------------------------------------
SHK2_SCHPO/24-125--------------------------------------------------------------------------------
NUM1_YEAST/2574-2683--------------------------------------------------------------------------------
Q18420_CAEEL/249-346--------------------------------------------------------------------------------
ACAP1_HUMAN/266-360--------------------------------------------------------------------------------
ANLN_DROME/1107-1230--------------------------------------------------------------------------------
SEC74_SCHPO/549-677--------------------------------------------------------------------------------
GRP1_CAEEL/262-380--------------------------------------------------------------------------------
UN104_CAEEL/1461-1558--------------------------------------------------------------------------------
KPCD1_HUMAN/423-541--------------------------------------------------------------------------------
RGRF2_MOUSE/23-133--------------------------------------------------------------------------------
ANI2_CAEEL/893-1005--------------------------------------------------------------------------------
SKG3_YEAST/91-221--------------------------------------------------------------------------------
3BP2_MOUSE/27-130--------------------------------------------------------------------------------
RGRF1_RAT/457-582--------------------------------------------------------------------------------
CNT6_SCHPO/527-632--------------------------------------------------------------------------------
BOI2_YEAST/769-887--------------------------------------------------------------------------------
PAC1_CAEEL/612-726--------------------------------------------------------------------------------
YP091_YEAST/135-266--------------------------------------------------------------------------------
TEC_MOUSE/5-111--------------------------------------------------------------------------------
BTK_HUMAN/4-133--------------------------------------------------------------------------------
GPRK1_DROME/558-657--------------------------------------------------------------------------------
YSP1_YEAST/309-421--------------------------------------------------------------------------------
MPRIP_MOUSE/387-482--------------------------------------------------------------------------------
RASA2_RAT/604-704--------------------------------------------------------------------------------
GRB10_HUMAN/291-399--------------------------------------------------------------------------------
VAV_CAEEL/471-598--------------------------------------------------------------------------------
SOS_DROME/481-588--------------------------------------------------------------------------------
YB35_SCHPO/255-349--------------------------------------------------------------------------------
O02134_CAEEL/257-375--------------------------------------------------------------------------------
UN112_CAEEL/406-507--------------------------------------------------------------------------------
TRIO_HUMAN/1480-1591--------------------------------------------------------------------------------
RHG26_CHICK/266-369--------------------------------------------------------------------------------
PHLB1_RAT/722-824--------------------------------------------------------------------------------
ABR_HUMAN/302-459--------------------------------------------------------------------------------
RGRF1_RAT/23-129--------------------------------------------------------------------------------
SNTB1_HUMAN/323-433--------------------------------------------------------------------------------
AFAP1_CHICK/154-249--------------------------------------------------------------------------------
OPY1_YEAST/216-318--------------------------------------------------------------------------------
KIF1A_MOUSE/1581-1678--------------------------------------------------------------------------------
ARHG7_HUMAN/480-578--------------------------------------------------------------------------------
BUD4_YEAST/1303-1413--------------------------------------------------------------------------------
DYN1_RAT/520-625--------------------------------------------------------------------------------
Q20151_CAEEL/20-135--------------------------------------------------------------------------------
SNTA1_RABIT/294-401--------------------------------------------------------------------------------
BEM3_YEAST/635-741--------------------------------------------------------------------------------
RGPS1_HUMAN/432-543--------------------------------------------------------------------------------
AKT1_CAEEL/16-118--------------------------------------------------------------------------------
AKP13_HUMAN/2232-2333--------------------------------------------------------------------------------
F4JNE2_ARATH/803-908--------------------------------------------------------------------------------
O88768_RAT/254-355--------------------------------------------------------------------------------
Q57YQ0_TRYB2/332-428--------------------------------------------------------------------------------
Q7KV69_DROME/3748-3851--------------------------------------------------------------------------------
Q8MSU1_DROME/95-195--------------------------------------------------------------------------------

PF15409

B6JVE7_SCHJY/144-232--------------------------------------------------------------------------------
E3RG70_PYRTT/221-309--------------------------------------------------------------------------------
H1VVI1_COLHI/216-304--------------------------------------------------------------------------------
C8VHJ7_EMENI/110-198--------------------------------------------------------------------------------
Q6C4Y2_YARLI/155-243--------------------------------------------------------------------------------
G3B6N0_CANTC/156-243--------------------------------------------------------------------------------
A3LTM2_PICST/192-279--------------------------------------------------------------------------------
G8YKE6_PICSO/214-301--------------------------------------------------------------------------------
F2UGB6_SALR5/1490-1577--------------------------------------------------------------------------------
C5GMH2_AJEDR/215-302--------------------------------------------------------------------------------
G8BIT9_CANPC/202-289--------------------------------------------------------------------------------

PF15413

E9C7L7_CAPO3/130-226--------------------------------------------------------------------------------
C4Y4Q1_CLAL4/136-269--------------------------------------------------------------------------------
D7KQC6_ARALL/95-227--------------------------------------------------------------------------------
C6HG43_AJECH/87-193--------------------------------------------------------------------------------
E5T4G3_TRISP/39-138--------------------------------------------------------------------------------
A0CUJ8_PARTE/105-200--------------------------------------------------------------------------------
A7SI59_NEMVE/523-628--------------------------------------------------------------------------------

PF15406

B6K769_SCHJY/110-235--------------------------------------------------------------------------------
G2X9M4_VERDV/99-204--------------------------------------------------------------------------------
E3Q3I3_COLGM/92-197--------------------------------------------------------------------------------
G4MXJ0_MAGO7/107-216--------------------------------------------------------------------------------
G2PZQ3_THIHA/101-208--------------------------------------------------------------------------------
G4UAB8_NEUT9/95-202--------------------------------------------------------------------------------
B2A9W4_PODAN/92-199--------------------------------------------------------------------------------
F9G078_FUSOF/114-219--------------------------------------------------------------------------------
H0EZ07_GLAL7/83-191--------------------------------------------------------------------------------
G0SHV9_CHATD/90-197--------------------------------------------------------------------------------
F0XAK4_GROCL/91-200--------------------------------------------------------------------------------
H6BUU9_EXODN/90-198--------------------------------------------------------------------------------

PF14593

Q7PUX5_ANOGA/445-547--------------------------------------------------------------------------------
D6WGV3_TRICA/369-471--------------------------------------------------------------------------------
E2A088_CAMFO/460-562--------------------------------------------------------------------------------
PDPK1_MOUSE/449-551--------------------------------------------------------------------------------
A8XME2_CAEBR/317-419--------------------------------------------------------------------------------
F0ZQF1_DICPU/137-240--------------------------------------------------------------------------------
Q172S2_AEDAE/402-506--------------------------------------------------------------------------------
E3MA10_CAERE/460-562--------------------------------------------------------------------------------
A8X5P7_CAEBR/474-576--------------------------------------------------------------------------------
D2VK59_NAEGR/353-456--------------------------------------------------------------------------------
B5DR97_DROPS/703-805--------------------------------------------------------------------------------
D8QMJ5_SELML/388-489--------------------------------------------------------------------------------
E9CBD6_CAPO3/483-586--------------------------------------------------------------------------------
C4QMA7_SCHMA/364-466--------------------------------------------------------------------------------
F0ZSM2_DICPU/404-506--------------------------------------------------------------------------------
B0X1B0_CULQU/404-508--------------------------------------------------------------------------------
E5SYD2_TRISP/403-505--------------------------------------------------------------------------------
E4XZ21_OIKDI/382-502--------------------------------------------------------------------------------
A2DAR5_TRIVA/371-472--------------------------------------------------------------------------------
F0ZMQ8_DICPU/111-220--------------------------------------------------------------------------------
D3BJW1_POLPA/401-501--------------------------------------------------------------------------------
E9H687_DAPPU/410-512--------------------------------------------------------------------------------
D8M3A3_BLAHO/75-180--------------------------------------------------------------------------------
F2U695_SALR5/410-513--------------------------------------------------------------------------------
A8PPP4_BRUMA/451-551--------------------------------------------------------------------------------
I1NTT9_ORYGL/392-497--------------------------------------------------------------------------------
W5J907_ANODA/470-570--------------------------------------------------------------------------------

PF15411

L8FXT1_PSED2/322-458--------------------------------------------------------------------------------
U4LT07_PYROM/417-540--------------------------------------------------------------------------------
L8GCG2_PSED2/446-567--------------------------------------------------------------------------------
G8B9T7_CANPC/472-606--------------------------------------------------------------------------------
S8E8S9_FOMPI/218-342--------------------------------------------------------------------------------
C0S734_PARBP/64-174--------------------------------------------------------------------------------
E7FHG6_ASHGO/465-600--------------------------------------------------------------------------------
C5DFZ5_LACTC/451-585--------------------------------------------------------------------------------
Q5B2R3_EMENI/457-581--------------------------------------------------------------------------------
A1CE88_ASPCL/310-419--------------------------------------------------------------------------------
Q6CBW7_YARLI/468-578--------------------------------------------------------------------------------
Q5KFX7_CRYNJ/909-1028--------------------------------------------------------------------------------
C5DV96_ZYGRC/480-617--------------------------------------------------------------------------------
K0KM79_WICCF/509-632--------------------------------------------------------------------------------
J0HE23_COCIM/382-505--------------------------------------------------------------------------------
B6QI46_PENMQ/316-424--------------------------------------------------------------------------------
G7XEK3_ASPKW/313-424--------------------------------------------------------------------------------
J3QBA5_PUCT1/361-480--------------------------------------------------------------------------------
B6JVU8_SCHJY/392-503--------------------------------------------------------------------------------
I1BLT9_RHIO9/201-314--------------------------------------------------------------------------------
E6ZVA8_SPORE/482-616--------------------------------------------------------------------------------
A8PVU8_MALGO/415-566--------------------------------------------------------------------------------
M1VVE6_CLAP2/435-562--------------------------------------------------------------------------------
C4XY43_CLAL4/465-600--------------------------------------------------------------------------------
S2KBJ9_MUCC1/386-503--------------------------------------------------------------------------------
G4T894_PIRID/458-613--------------------------------------------------------------------------------
E3K951_PUCGT/463-582--------------------------------------------------------------------------------
M3J399_CANMX/484-622--------------------------------------------------------------------------------
U9SS96_RHIID/417-534--------------------------------------------------------------------------------
H6C2C5_EXODN/429-537--------------------------------------------------------------------------------
M2N2Q4_BAUCO/388-510--------------------------------------------------------------------------------
W1QFU0_OGAPD/431-554--------------------------------------------------------------------------------
Q6CTG1_KLULA/462-594--------------------------------------------------------------------------------
R7Z2B7_CONA1/307-419--------------------------------------------------------------------------------
M7X9M7_RHOT1/492-610--------------------------------------------------------------------------------
F2SVI5_TRIRC/339-454--------------------------------------------------------------------------------
R0IDL4_SETT2/326-435--------------------------------------------------------------------------------
SCD1_SCHPO/428-541--------------------------------------------------------------------------------
B0CTT2_LACBS/383-504--------------------------------------------------------------------------------
I1S1B1_GIBZE/432-552--------------------------------------------------------------------------------
M2NHU0_BAUCO/429-542--------------------------------------------------------------------------------
S3D7J5_GLAL2/462-592--------------------------------------------------------------------------------
Q2GPG0_CHAGB/419-538--------------------------------------------------------------------------------
A5E275_LODEL/534-703--------------------------------------------------------------------------------
A5DJC8_PICGU/473-589--------------------------------------------------------------------------------
D5GGD7_TUBMM/421-541--------------------------------------------------------------------------------
G8XZ82_PICSO/475-610--------------------------------------------------------------------------------
I2GVT9_TETBL/484-621--------------------------------------------------------------------------------
N1JBG8_BLUG1/461-585--------------------------------------------------------------------------------
G1XAU9_ARTOA/439-555--------------------------------------------------------------------------------
G7E2X4_MIXOS/392-510--------------------------------------------------------------------------------
B0D191_LACBS/477-620--------------------------------------------------------------------------------
B4R7P5_DROSI/265-372--------------------------------------------------------------------------------
S7ZA81_PENO1/323-431--------------------------------------------------------------------------------
S7ZSU9_PENO1/383-506--------------------------------------------------------------------------------
Q7PLZ7_ANOGA/418-525--------------------------------------------------------------------------------
N1JM33_BLUG1/404-516--------------------------------------------------------------------------------
R4XCX7_TAPDE/388-502--------------------------------------------------------------------------------
G9NQW5_HYPAI/397-517--------------------------------------------------------------------------------
Q0U2Z5_PHANO/430-542--------------------------------------------------------------------------------
H6BPC6_EXODN/387-506--------------------------------------------------------------------------------
F0X7S3_GROCL/411-531--------------------------------------------------------------------------------
G3J9K1_CORMM/455-571--------------------------------------------------------------------------------
B2VWD7_PYRTR/472-592--------------------------------------------------------------------------------
S9W2N8_SCHCR/425-538--------------------------------------------------------------------------------
Q4P6E0_USTMA/492-614--------------------------------------------------------------------------------
K5UKM2_PHACS/138-258--------------------------------------------------------------------------------
D5G6T9_TUBMM/297-409--------------------------------------------------------------------------------
C4QYR2_PICPG/477-615--------------------------------------------------------------------------------
E9CRC3_COCPS/316-427--------------------------------------------------------------------------------
G4TBK8_PIRID/436-574--------------------------------------------------------------------------------
M7TPR1_BOTF1/430-561--------------------------------------------------------------------------------
M3C0H4_SPHMS/505-618--------------------------------------------------------------------------------
D8Q9F8_SCHCM/416-560--------------------------------------------------------------------------------
U5H7X6_USTV1/405-528--------------------------------------------------------------------------------
D6RLF0_COPC7/420-561--------------------------------------------------------------------------------
M2RFB3_CERS8/410-543--------------------------------------------------------------------------------
G3ANH9_SPAPN/475-609--------------------------------------------------------------------------------
D8Q1A2_SCHCM/270-391--------------------------------------------------------------------------------
I1BWV5_RHIO9/177-288--------------------------------------------------------------------------------
R9AUY5_WALI9/1302-1440--------------------------------------------------------------------------------
M7SFW8_EUTLA/395-516--------------------------------------------------------------------------------
F9X5J1_MYCGM/456-563--------------------------------------------------------------------------------
J3PFZ1_GAGT3/436-555--------------------------------------------------------------------------------
D8Q823_SCHCM/499-642--------------------------------------------------------------------------------
V2XX15_MONRO/414-554--------------------------------------------------------------------------------
R1EWD6_BOTPV/334-449--------------------------------------------------------------------------------
F4RFQ9_MELLP/829-937--------------------------------------------------------------------------------
Q0CQU8_ASPTN/384-507--------------------------------------------------------------------------------
M7X2J5_RHOT1/436-549--------------------------------------------------------------------------------
E3K331_PUCGT/477-609--------------------------------------------------------------------------------
B8N7H3_ASPFN/313-422--------------------------------------------------------------------------------
G4TIK6_PIRID/427-548--------------------------------------------------------------------------------
S2JJT5_MUCC1/389-502--------------------------------------------------------------------------------
Q59YK6_CANAL/488-627--------------------------------------------------------------------------------
C4JQ35_UNCRE/311-422--------------------------------------------------------------------------------
K5UWD4_PHACS/357-490--------------------------------------------------------------------------------
G1X4D9_ARTOA/385-499--------------------------------------------------------------------------------
K1X859_MARBU/542-671--------------------------------------------------------------------------------
V2XVI9_MONRO/375-500--------------------------------------------------------------------------------
G7E3N8_MIXOS/651-756--------------------------------------------------------------------------------
R7YYY5_CONA1/430-547--------------------------------------------------------------------------------
C5MGV9_CANTT/489-625--------------------------------------------------------------------------------
C5FRQ7_ARTOC/318-432--------------------------------------------------------------------------------
U1GBI6_ENDPU/442-552--------------------------------------------------------------------------------
I4YHQ5_WALSC/334-473--------------------------------------------------------------------------------
G9A084_TORDC/483-619--------------------------------------------------------------------------------
L8X1U6_THACA/215-352--------------------------------------------------------------------------------
A3LZC0_PICST/478-611--------------------------------------------------------------------------------
Q4WNB0_ASPFU/340-448--------------------------------------------------------------------------------
A6QW04_AJECN/372-506--------------------------------------------------------------------------------
V5F1S4_PSEBG/497-617--------------------------------------------------------------------------------
N1PRD2_MYCP1/450-560--------------------------------------------------------------------------------
I2FVD8_USTH4/497-618--------------------------------------------------------------------------------
T5A7N1_OPHSC/118-233--------------------------------------------------------------------------------
K5XKC0_AGABU/416-562--------------------------------------------------------------------------------
Q0CRE8_ASPTN/313-423--------------------------------------------------------------------------------
S8AFW7_DACHA/364-476--------------------------------------------------------------------------------
A8N8V8_COPC7/387-508--------------------------------------------------------------------------------
F9FY02_FUSOF/674-792--------------------------------------------------------------------------------
U1GPE5_ENDPU/390-513--------------------------------------------------------------------------------
M7PCK0_PNEMU/420-534--------------------------------------------------------------------------------
Q5KB43_CRYNJ/514-650--------------------------------------------------------------------------------
Q6BPP7_DEBHA/481-615--------------------------------------------------------------------------------
G3BAJ1_CANTC/418-554--------------------------------------------------------------------------------
A7EK75_SCLS1/461-587--------------------------------------------------------------------------------
F2PSL1_TRIEC/256-378--------------------------------------------------------------------------------
J4G1P6_FIBRA/406-539--------------------------------------------------------------------------------
V5G094_BYSSN/505-615--------------------------------------------------------------------------------
I1C104_RHIO9/376-487--------------------------------------------------------------------------------
I1C1Q1_RHIO9/364-476--------------------------------------------------------------------------------
K1VGG6_TRIAC/2195-2311--------------------------------------------------------------------------------
K1VJL7_TRIAC/512-645--------------------------------------------------------------------------------
G4UNC3_NEUT9/434-548--------------------------------------------------------------------------------
K9FWT5_PEND2/333-440--------------------------------------------------------------------------------
F8Q3T8_SERL3/370-493--------------------------------------------------------------------------------
M3AK59_MYCFI/360-473--------------------------------------------------------------------------------
U4LNN6_PYROM/533-643--------------------------------------------------------------------------------
S2JSL7_MUCC1/375-485--------------------------------------------------------------------------------
U5HFN6_USTV1/451-567--------------------------------------------------------------------------------
F4PBV1_BATDJ/347-455--------------------------------------------------------------------------------
N4U9U3_FUSC1/553-669--------------------------------------------------------------------------------
L2FUK4_COLGN/432-552--------------------------------------------------------------------------------

PF15404

A7TM50_VANPO/1059-1235--------------------------------------------------------------------------------
W1Q8K3_OGAPD/779-971--------------------------------------------------------------------------------
Q74ZU3_ASHGO/998-1187--------------------------------------------------------------------------------
SPO71_YEAST/1032-1228--------------------------------------------------------------------------------
E6ZQ69_SPORE/1863-2064--------------------------------------------------------------------------------
A5DM32_PICGU/798-966--------------------------------------------------------------------------------
E5A6C0_LEPMJ/941-1113--------------------------------------------------------------------------------
C4XYT4_CLAL4/366-533--------------------------------------------------------------------------------
C5DN47_LACTC/1032-1239--------------------------------------------------------------------------------
G3AEW4_SPAPN/678-854--------------------------------------------------------------------------------
K2SB20_MACPH/554-726--------------------------------------------------------------------------------
Q6BI79_DEBHA/853-1032--------------------------------------------------------------------------------
C5MDI2_CANTT/674-843--------------------------------------------------------------------------------
G0WGW0_NAUDC/1002-1189--------------------------------------------------------------------------------
C6HN26_AJECH/774-941--------------------------------------------------------------------------------
F9XLM8_MYCGM/682-862--------------------------------------------------------------------------------
A3GEX7_PICST/684-865--------------------------------------------------------------------------------
G0V9Z1_NAUCC/1010-1197--------------------------------------------------------------------------------
C5DSP7_ZYGRC/1057-1243--------------------------------------------------------------------------------
J7RPQ9_KAZNA/1010-1198--------------------------------------------------------------------------------
I2H637_TETBL/1344-1532--------------------------------------------------------------------------------
G8JS70_ERECY/1003-1198--------------------------------------------------------------------------------
C1GFY0_PARBD/994-1162--------------------------------------------------------------------------------
H2AR29_KAZAF/997-1185--------------------------------------------------------------------------------
Q5B8I2_EMENI/860-1039--------------------------------------------------------------------------------
R7YP31_CONA1/928-1101--------------------------------------------------------------------------------
H6CBI5_EXODN/881-1078--------------------------------------------------------------------------------
G8BMZ3_TETPH/890-1075--------------------------------------------------------------------------------
G8ZX42_TORDC/989-1169--------------------------------------------------------------------------------
I2FT70_USTH4/1877-2075--------------------------------------------------------------------------------
K0KGT7_WICCF/952-1124--------------------------------------------------------------------------------
C4QYG2_PICPG/900-1077--------------------------------------------------------------------------------
S6EKT4_ZYGB2/1054-1241--------------------------------------------------------------------------------
G4TI65_PIRID/969-1141--------------------------------------------------------------------------------
Q59RJ1_CANAL/654-826--------------------------------------------------------------------------------
G8YNP7_PICSO/857-1036--------------------------------------------------------------------------------

PF16453

I3KJC1_ORENI/919-1056--------------------------------------------------------------------------------
G4VHF8_SCHMA/805-958--------------------------------------------------------------------------------
T1IEB3_RHOPR/597-731--------------------------------------------------------------------------------
W5KJD3_ASTMX/719-855--------------------------------------------------------------------------------
E4XUI6_OIKDI/553-682--------------------------------------------------------------------------------
B3RIN4_TRIAD/498-638--------------------------------------------------------------------------------
G7YBM9_CLOSI/933-1089--------------------------------------------------------------------------------
F7CUJ9_MACMU/755-888--------------------------------------------------------------------------------
A7SN35_NEMVE/238-373--------------------------------------------------------------------------------
T1J4F0_STRMM/849-983--------------------------------------------------------------------------------
T1EEU4_HELRO/262-396--------------------------------------------------------------------------------
H0ZQZ2_TAEGU/623-760--------------------------------------------------------------------------------
G0P5R6_CAEBE/296-431--------------------------------------------------------------------------------
B5DPT2_DROPS/972-1106--------------------------------------------------------------------------------
U1LWW7_ASCSU/486-618--------------------------------------------------------------------------------
H0X983_OTOGA/745-880--------------------------------------------------------------------------------
H2ZJJ7_CIOSA/136-270--------------------------------------------------------------------------------
E9H1A2_DAPPU/210-344--------------------------------------------------------------------------------
H0Y0X9_OTOGA/718-858--------------------------------------------------------------------------------
A8QG19_BRUMA/431-563--------------------------------------------------------------------------------
G5BAI1_HETGA/849-978--------------------------------------------------------------------------------
M3ZNX4_XIPMA/848-985--------------------------------------------------------------------------------
B7PGL9_IXOSC/498-632--------------------------------------------------------------------------------
F6QVV0_MONDO/912-1046--------------------------------------------------------------------------------
T1KGE2_TETUR/524-650--------------------------------------------------------------------------------
W4XI21_STRPU/232-361--------------------------------------------------------------------------------
H3E9J4_PRIPA/334-474--------------------------------------------------------------------------------
K1RB92_CRAGI/149-283--------------------------------------------------------------------------------

PF08458

D7MNV5_ARALL/293-395--------------------------------------------------------------------------------
M0RLK3_MUSAM/290-394--------------------------------------------------------------------------------
F4J0Y8_ARATH/263-368--------------------------------------------------------------------------------
W1P3J2_AMBTC/338-444--------------------------------------------------------------------------------
I1IC90_BRADI/270-381--------------------------------------------------------------------------------
B9IKK1_POPTR/328-431--------------------------------------------------------------------------------
M4E4U9_BRARP/346-452--------------------------------------------------------------------------------
W1PTL4_AMBTC/149-254--------------------------------------------------------------------------------
I1QW38_ORYGL/91-190--------------------------------------------------------------------------------
W1NU10_AMBTC/323-428--------------------------------------------------------------------------------
M8A701_TRIUA/248-349--------------------------------------------------------------------------------
D7MCD2_ARALL/309-414--------------------------------------------------------------------------------
B9SFG0_RICCO/365-471--------------------------------------------------------------------------------
W5AJN2_WHEAT/35-140--------------------------------------------------------------------------------
J3N518_ORYBR/323-423--------------------------------------------------------------------------------
M1BPD2_SOLTU/369-475--------------------------------------------------------------------------------
Q9LKC2_ARATH/341-447--------------------------------------------------------------------------------
M0SV78_MUSAM/342-448--------------------------------------------------------------------------------
M4DV70_BRARP/294-395--------------------------------------------------------------------------------
K7VKA4_MAIZE/319-424--------------------------------------------------------------------------------
F6HYN8_VITVI/262-363--------------------------------------------------------------------------------
Q6H686_ORYSJ/268-383--------------------------------------------------------------------------------
D7TE14_VITVI/362-468--------------------------------------------------------------------------------
B9RS23_RICCO/302-407--------------------------------------------------------------------------------
I1K0R2_SOYBN/272-376--------------------------------------------------------------------------------
K7LWY0_SOYBN/274-374--------------------------------------------------------------------------------
D8RGF1_SELML/288-392--------------------------------------------------------------------------------
B9SXD6_RICCO/265-367--------------------------------------------------------------------------------
M0RMU8_MUSAM/263-363--------------------------------------------------------------------------------
D8SWC9_SELML/319-425--------------------------------------------------------------------------------
K4CLR2_SOLLC/308-410--------------------------------------------------------------------------------
K7KIW3_SOYBN/237-340--------------------------------------------------------------------------------
I1PMP1_ORYGL/278-376--------------------------------------------------------------------------------
K7TQI6_MAIZE/313-412--------------------------------------------------------------------------------
W5EUW3_WHEAT/51-154--------------------------------------------------------------------------------
I1QW40_ORYGL/167-265--------------------------------------------------------------------------------
M1A0U2_SOLTU/269-372--------------------------------------------------------------------------------
Q683C3_ARATH/224-330--------------------------------------------------------------------------------
C5WRE5_SORBI/262-366--------------------------------------------------------------------------------
I1QVX3_ORYGL/260-364--------------------------------------------------------------------------------
M0RPD8_MUSAM/283-380--------------------------------------------------------------------------------
B9MUQ4_POPTR/263-367--------------------------------------------------------------------------------
B9HUR4_POPTR/371-477--------------------------------------------------------------------------------
K7LH35_SOYBN/217-323--------------------------------------------------------------------------------
B9T6W9_RICCO/245-345--------------------------------------------------------------------------------
B9IM62_POPTR/279-379--------------------------------------------------------------------------------
D7M9P3_ARALL/9-113--------------------------------------------------------------------------------
C5XJN3_SORBI/304-414--------------------------------------------------------------------------------
I1IZA0_BRADI/284-384--------------------------------------------------------------------------------
A9T2K8_PHYPA/290-395--------------------------------------------------------------------------------
W1PB96_AMBTC/286-390--------------------------------------------------------------------------------
K7UXW2_MAIZE/301-411--------------------------------------------------------------------------------
Q5U1F1_ARATH/283-387--------------------------------------------------------------------------------
W5AUL7_WHEAT/72-173--------------------------------------------------------------------------------
M0TPF7_MUSAM/219-319--------------------------------------------------------------------------------
C5WS39_SORBI/227-333--------------------------------------------------------------------------------
W5G7U5_WHEAT/33-145--------------------------------------------------------------------------------

PF09380

Q7QB86_ANOGA/230-322--------------------------------------------------------------------------------
FARP2_MOUSE/238-328--------------------------------------------------------------------------------
FRPD2_HUMAN/557-646--------------------------------------------------------------------------------
E41L5_MOUSE/239-331--------------------------------------------------------------------------------
O17905_CAEEL/223-313--------------------------------------------------------------------------------
FRM4A_HUMAN/225-326--------------------------------------------------------------------------------
PTN3_HUMAN/226-316--------------------------------------------------------------------------------
A4QNY2_DANRE/770-859--------------------------------------------------------------------------------
MERH_DROME/220-309--------------------------------------------------------------------------------
Q16F39_AEDAE/217-307--------------------------------------------------------------------------------
Q9VKY7_DROME/209-301--------------------------------------------------------------------------------
Q17GE0_AEDAE/263-353--------------------------------------------------------------------------------
A2AUK8_MOUSE/292-382--------------------------------------------------------------------------------
A7SRN5_NEMVE/219-309--------------------------------------------------------------------------------
Q8I093_CAEEL/223-359--------------------------------------------------------------------------------
Q7PMF4_ANOGA/228-311--------------------------------------------------------------------------------
Q2M1E6_DROME/268-358--------------------------------------------------------------------------------
Q8JG61_DANRE/197-287--------------------------------------------------------------------------------
Q1MTL1_DANRE/226-316--------------------------------------------------------------------------------
A7RWH0_NEMVE/210-299--------------------------------------------------------------------------------
Q7PRJ8_ANOGA/219-309--------------------------------------------------------------------------------
A8X9K5_CAEBR/230-319--------------------------------------------------------------------------------
A7SJJ3_NEMVE/179-269--------------------------------------------------------------------------------
A7T1E3_NEMVE/204-296--------------------------------------------------------------------------------
A7SBA4_NEMVE/205-308--------------------------------------------------------------------------------
Q5LK46_CAEEL/220-307--------------------------------------------------------------------------------
A7S031_NEMVE/180-270--------------------------------------------------------------------------------
Q16TI3_AEDAE/200-283--------------------------------------------------------------------------------
Q16YM3_AEDAE/262-348--------------------------------------------------------------------------------
FRMD3_HUMAN/229-316--------------------------------------------------------------------------------
A7RUW8_NEMVE/238-328--------------------------------------------------------------------------------
FRMD7_HUMAN/196-286--------------------------------------------------------------------------------
MERL_HUMAN/226-315--------------------------------------------------------------------------------
A8Y3W1_CAEBR/270-367--------------------------------------------------------------------------------
B8JJL5_DANRE/42-128--------------------------------------------------------------------------------
E1BKT4_BOVIN/789-876--------------------------------------------------------------------------------
E9Q0S8_MOUSE/226-313--------------------------------------------------------------------------------
F6YGI4_CIOIN/233-323--------------------------------------------------------------------------------
F7CAC9_XENTR/210-299--------------------------------------------------------------------------------
FARP1_MOUSE/234-323--------------------------------------------------------------------------------
H3CCC0_TETNG/514-599--------------------------------------------------------------------------------
H3CPI3_TETNG/280-380--------------------------------------------------------------------------------
H3CYW0_TETNG/210-299--------------------------------------------------------------------------------
H3D2P3_TETNG/215-308--------------------------------------------------------------------------------
H3DGP3_TETNG/244-328--------------------------------------------------------------------------------
H3DIN7_TETNG/226-306--------------------------------------------------------------------------------
I3N7A6_SPETR/13-96--------------------------------------------------------------------------------
M4AFA5_XIPMA/6-94--------------------------------------------------------------------------------
Q05768_ECHMU/212-301--------------------------------------------------------------------------------
PTN21_MOUSE/226-309--------------------------------------------------------------------------------

PF10756

A1T6Y6_MYCVP/40-111--------------------------------------------------------------------------------
A0QUX5_MYCS2/56-127--------------------------------------------------------------------------------
Q0S2H6_RHOSR/133-204--------------------------------------------------------------------------------
A4FMQ8_SACEN/47-118--------------------------------------------------------------------------------
Q5YRV9_NOCFA/80-151--------------------------------------------------------------------------------
A4X496_SALTO/52-123--------------------------------------------------------------------------------
Q8NQZ8_CORGL/37-108--------------------------------------------------------------------------------
Q8FPX5_COREF/69-140--------------------------------------------------------------------------------
Q6NHN5_CORDI/53-124--------------------------------------------------------------------------------
Q4JUN4_CORJK/53-125--------------------------------------------------------------------------------
Q2IEC1_ANADE/109-180--------------------------------------------------------------------------------
A0QWV2_MYCS2/76-146--------------------------------------------------------------------------------
Q741E9_MYCPA/73-143--------------------------------------------------------------------------------
Q9CCP2_MYCLE/74-144--------------------------------------------------------------------------------
A1T8K3_MYCVP/70-140--------------------------------------------------------------------------------
Q0S0K0_RHOSR/72-142--------------------------------------------------------------------------------
Q5YTP5_NOCFA/86-156--------------------------------------------------------------------------------
A4FBK6_SACEN/71-141--------------------------------------------------------------------------------
Q8NQ54_CORGL/114-184--------------------------------------------------------------------------------
Q6NH30_CORDI/107-177--------------------------------------------------------------------------------
Q4JVI7_CORJK/71-141--------------------------------------------------------------------------------
A4X643_SALTO/103-173--------------------------------------------------------------------------------
Q47QZ7_THEFY/72-143--------------------------------------------------------------------------------
Q827L6_STRAW/68-139--------------------------------------------------------------------------------
A1SJH2_NOCSJ/82-152--------------------------------------------------------------------------------
A6WC99_KINRD/77-147--------------------------------------------------------------------------------
Q9CDE8_MYCLE/58-136--------------------------------------------------------------------------------
Q744S0_MYCPA/58-136--------------------------------------------------------------------------------
A1T119_MYCVP/58-136--------------------------------------------------------------------------------
Q5Z3S4_NOCFA/64-148--------------------------------------------------------------------------------
Q0SAE3_RHOSR/62-146--------------------------------------------------------------------------------
A4F5R5_SACEN/60-137--------------------------------------------------------------------------------
A4XDA1_SALTO/68-146--------------------------------------------------------------------------------
A8LCF4_FRASN/69-148--------------------------------------------------------------------------------
Q0RB02_FRAAA/82-161--------------------------------------------------------------------------------
Q9X8Z2_STRCO/64-149--------------------------------------------------------------------------------
Q8TW66_METKA/65-149--------------------------------------------------------------------------------
Q6ADX4_LEIXX/63-147--------------------------------------------------------------------------------
A0JYT3_ARTS2/61-144--------------------------------------------------------------------------------
Q47LS7_THEFY/56-142--------------------------------------------------------------------------------
Q82I13_STRAW/80-156--------------------------------------------------------------------------------
B0RFT7_CLAMS/59-140--------------------------------------------------------------------------------
B2HI57_MYCMM/58-135--------------------------------------------------------------------------------
B2HIG3_MYCMM/52-122--------------------------------------------------------------------------------
Y1417_MYCTU/72-141--------------------------------------------------------------------------------
Y010_MYCTU/58-135--------------------------------------------------------------------------------

PF00638

RANG_HUMAN/37-161--------------------------------------------------------------------------------
RBP2_HUMAN/2321-2442--------------------------------------------------------------------------------
YRB2_YEAST/204-327--------------------------------------------------------------------------------
NUP2_YEAST/598-718--------------------------------------------------------------------------------
RBP2_HUMAN/2024-2145--------------------------------------------------------------------------------
YRB1_YEAST/75-197--------------------------------------------------------------------------------
RBP2_HUMAN/2922-3043--------------------------------------------------------------------------------
RBP2_HUMAN/1183-1304--------------------------------------------------------------------------------

PF00568

LAS17_YEAST/13-124--------------------------------------------------------------------------------
Q9VAT0_DROME/31-140--------------------------------------------------------------------------------
O96607_DROME/1-107--------------------------------------------------------------------------------
WASL_RAT/28-135--------------------------------------------------------------------------------
VASP_HUMAN/1-110--------------------------------------------------------------------------------
HOME3_RAT/3-110--------------------------------------------------------------------------------
ENAH_MOUSE/1-108--------------------------------------------------------------------------------
WASP_HUMAN/36-145--------------------------------------------------------------------------------

PF06058

I4YGX0_WALSC/6-122--------------------------------------------------------------------------------
U6IUB4_HYMMI/4-119--------------------------------------------------------------------------------
M7P3V1_PNEMU/8-120--------------------------------------------------------------------------------
H1V3S0_COLHI/54-178--------------------------------------------------------------------------------
H2WG39_CAEJA/11-127--------------------------------------------------------------------------------
K0T1R6_THAOC/10-135--------------------------------------------------------------------------------
G7DZX0_MIXOS/485-600--------------------------------------------------------------------------------
B7G0L8_PHATC/10-124--------------------------------------------------------------------------------
K1RLV6_CRAGI/4-119--------------------------------------------------------------------------------
Q5CQ73_CRYPI/16-136--------------------------------------------------------------------------------
E3KCY6_PUCGT/4-124--------------------------------------------------------------------------------
Q00YW6_OSTTA/22-138--------------------------------------------------------------------------------
D3AZC1_POLPA/8-123--------------------------------------------------------------------------------
C5LA18_PERM5/11-142--------------------------------------------------------------------------------
F4P0I1_BATDJ/9-123--------------------------------------------------------------------------------
J3NZ48_GAGT3/56-175--------------------------------------------------------------------------------
A2DA02_TRIVA/16-133--------------------------------------------------------------------------------
F0V826_NEOCL/23-153--------------------------------------------------------------------------------
I1GL53_BRADI/114-230--------------------------------------------------------------------------------
I3EEQ1_NEMP3/9-124--------------------------------------------------------------------------------
D8RZ35_SELML/9-130--------------------------------------------------------------------------------
E4XC40_OIKDI/8-126--------------------------------------------------------------------------------
C5X2N4_SORBI/23-139--------------------------------------------------------------------------------
M7XHX0_RHOT1/38-154--------------------------------------------------------------------------------
R8BPG1_TOGMI/63-194--------------------------------------------------------------------------------
M2TEG9_COCSN/39-153--------------------------------------------------------------------------------
A0E4X8_PARTE/3-121--------------------------------------------------------------------------------
T1KEM3_TETUR/10-125--------------------------------------------------------------------------------
T1FY06_HELRO/9-134--------------------------------------------------------------------------------
G2YCV2_BOTF4/42-168--------------------------------------------------------------------------------
B6AAA0_CRYMR/30-163--------------------------------------------------------------------------------
K4AAP8_SETIT/35-151--------------------------------------------------------------------------------
F0ZJ48_DICPU/8-124--------------------------------------------------------------------------------
DCP1_ARATH/16-132--------------------------------------------------------------------------------
W5NIT2_LEPOC/19-133--------------------------------------------------------------------------------
T1HJB8_RHOPR/7-122--------------------------------------------------------------------------------
A8ITI1_CHLRE/8-118--------------------------------------------------------------------------------
F6WP26_CIOIN/10-126--------------------------------------------------------------------------------
A7APD0_BABBO/28-146--------------------------------------------------------------------------------
E5SY77_TRISP/4-116--------------------------------------------------------------------------------
Q8IJ85_PLAF7/295-416--------------------------------------------------------------------------------
M5C8H0_THACB/6-120--------------------------------------------------------------------------------
G0SH67_CHATD/20-150--------------------------------------------------------------------------------
M1WE34_CLAP2/44-168--------------------------------------------------------------------------------
M1AHB5_SOLTU/16-132--------------------------------------------------------------------------------
B0WEB0_CULQU/6-122--------------------------------------------------------------------------------
H3GFP6_PHYRM/15-137--------------------------------------------------------------------------------
D8TZD6_VOLCA/13-124--------------------------------------------------------------------------------
Q4U8T6_THEAN/27-148--------------------------------------------------------------------------------
K0KQA9_WICCF/30-164--------------------------------------------------------------------------------
N4UUY7_COLOR/53-178--------------------------------------------------------------------------------
F4S8K2_MELLP/4-127--------------------------------------------------------------------------------
L2GQ63_VITCO/22-141--------------------------------------------------------------------------------
J9E9N6_WUCBA/20-136--------------------------------------------------------------------------------
U6I2H7_ECHMU/4-119--------------------------------------------------------------------------------
I2G041_USTH4/8-117--------------------------------------------------------------------------------
U5H2N5_USTV1/11-127--------------------------------------------------------------------------------
L2GS13_VAVCU/7-118--------------------------------------------------------------------------------
G7Y9B7_CLOSI/250-364--------------------------------------------------------------------------------
H9JX56_BOMMO/7-120--------------------------------------------------------------------------------
A9RKT5_PHYPA/17-132--------------------------------------------------------------------------------
G4V8P0_SCHMA/4-121--------------------------------------------------------------------------------
E9FTR2_DAPPU/8-124--------------------------------------------------------------------------------
Q54KM1_DICDI/6-122--------------------------------------------------------------------------------
DCP1_SCHPO/8-123--------------------------------------------------------------------------------
W5N9S2_LEPOC/8-124--------------------------------------------------------------------------------
A9TRE6_PHYPA/17-133--------------------------------------------------------------------------------
Q9N363_CAEEL/12-128--------------------------------------------------------------------------------
C1N0Y3_MICPC/14-126--------------------------------------------------------------------------------
Q8SU45_ENCCU/6-121--------------------------------------------------------------------------------
C4LZ86_ENTHI/19-136--------------------------------------------------------------------------------
B8C1C7_THAPS/9-129--------------------------------------------------------------------------------
S2JSW1_MUCC1/6-118--------------------------------------------------------------------------------
J9K8Y4_ACYPI/7-123--------------------------------------------------------------------------------
U1NK85_ASCSU/13-126--------------------------------------------------------------------------------
M7SPD0_EUTLA/5-131--------------------------------------------------------------------------------
K7E8I5_ORNAN/46-162--------------------------------------------------------------------------------
C1FJ80_MICSR/13-127--------------------------------------------------------------------------------
T1EQJ1_HELRO/2-118--------------------------------------------------------------------------------
W5DQ23_WHEAT/26-142--------------------------------------------------------------------------------
D2VTY8_NAEGR/42-154--------------------------------------------------------------------------------
DCP1A_MOUSE/28-144--------------------------------------------------------------------------------
S9W4V6_SCHCR/8-120--------------------------------------------------------------------------------
M5E581_MALS4/7-124--------------------------------------------------------------------------------
E2BEK1_HARSA/6-122--------------------------------------------------------------------------------
D6X0J0_TRICA/7-122--------------------------------------------------------------------------------
B4MRP3_DROWI/6-122--------------------------------------------------------------------------------
C3YN74_BRAFL/6-122--------------------------------------------------------------------------------
M0SUM7_MUSAM/16-132--------------------------------------------------------------------------------

PF07933

J3NS94_GAGT3/46-217--------------------------------------------------------------------------------
A9TKE1_PHYPA/27-186--------------------------------------------------------------------------------
V4Z972_TOXGO/63-220--------------------------------------------------------------------------------
R7YGT9_CONA1/17-208--------------------------------------------------------------------------------
B8CDI7_THAPS/48-214--------------------------------------------------------------------------------
B3RZA3_TRIAD/4-160--------------------------------------------------------------------------------
U4LEE2_PYROM/5-164--------------------------------------------------------------------------------
D5GM90_TUBMM/4-176--------------------------------------------------------------------------------
B0CSR4_LACBS/7-165--------------------------------------------------------------------------------
G4N575_MAGO7/17-189--------------------------------------------------------------------------------
H0ZSD6_TAEGU/6-163--------------------------------------------------------------------------------
G1WZK6_ARTOA/6-197--------------------------------------------------------------------------------
I1EXS1_AMPQE/5-160--------------------------------------------------------------------------------
H3GBN1_PHYRM/10-186--------------------------------------------------------------------------------
F4RRV5_MELLP/8-177--------------------------------------------------------------------------------
T1I3S8_RHOPR/4-159--------------------------------------------------------------------------------
E3KK50_PUCGT/10-180--------------------------------------------------------------------------------
D0NAX8_PHYIT/6-160--------------------------------------------------------------------------------
B8BZP8_THAPS/17-203--------------------------------------------------------------------------------
C4M7C6_ENTHI/5-159--------------------------------------------------------------------------------
B7FUE2_PHATC/14-170--------------------------------------------------------------------------------
M7TSV8_EUTLA/17-196--------------------------------------------------------------------------------
K5UYW7_PHACS/9-170--------------------------------------------------------------------------------
M5E4Y9_MALS4/3-162--------------------------------------------------------------------------------
E4XX70_OIKDI/3-155--------------------------------------------------------------------------------
M2M4Z6_BAUCO/19-192--------------------------------------------------------------------------------
R1E743_BOTPV/16-210--------------------------------------------------------------------------------
E3QI84_COLGM/17-211--------------------------------------------------------------------------------
K1REF2_CRAGI/4-161--------------------------------------------------------------------------------
E9BXK3_CAPO3/3-162--------------------------------------------------------------------------------
A2EYL1_TRIVA/13-170--------------------------------------------------------------------------------
C5FJI7_ARTOC/14-217--------------------------------------------------------------------------------
F2UF95_SALR5/6-158--------------------------------------------------------------------------------
M5BJY1_THACB/6-167--------------------------------------------------------------------------------
G0RTU4_HYPJQ/17-183--------------------------------------------------------------------------------
D8LLJ9_ECTSI/11-173--------------------------------------------------------------------------------
R8BQ43_TOGMI/17-191--------------------------------------------------------------------------------
T1JKH1_STRMM/4-159--------------------------------------------------------------------------------
Q5KP23_CRYNJ/8-165--------------------------------------------------------------------------------
C9SUP5_VERA1/18-200--------------------------------------------------------------------------------
U7PYJ6_SPOS1/17-206--------------------------------------------------------------------------------
E1Z4K2_CHLVA/31-205--------------------------------------------------------------------------------
K2S272_MACPH/17-200--------------------------------------------------------------------------------
D8M8J1_BLAHO/6-151--------------------------------------------------------------------------------
G0S443_CHATD/21-207--------------------------------------------------------------------------------
W7WZB3_TETTS/6-151--------------------------------------------------------------------------------
D8LGE9_ECTSI/55-233--------------------------------------------------------------------------------
N1QGL9_SPHMS/17-199--------------------------------------------------------------------------------
V2XMV7_MONRO/9-173--------------------------------------------------------------------------------
M1WFF3_CLAP2/17-209--------------------------------------------------------------------------------
A7ESN8_SCLS1/17-192--------------------------------------------------------------------------------
D8RE88_SELML/14-170--------------------------------------------------------------------------------
U6IAW8_HYMMI/6-172--------------------------------------------------------------------------------
G3JU05_CORMM/17-193--------------------------------------------------------------------------------
K3X1F0_PYTUL/6-162--------------------------------------------------------------------------------
T1KZ98_TETUR/6-163--------------------------------------------------------------------------------
F0XFH0_GROCL/18-211--------------------------------------------------------------------------------
E4URP0_ARTGP/15-207--------------------------------------------------------------------------------
Q4P2B5_USTMA/4-180--------------------------------------------------------------------------------
U5FXY2_POPTR/19-179--------------------------------------------------------------------------------
U6HIL6_ECHMU/6-170--------------------------------------------------------------------------------
M0U9S4_MUSAM/18-180--------------------------------------------------------------------------------
E9EXV9_METAR/17-186--------------------------------------------------------------------------------
G2Q5R9_THIHA/20-227--------------------------------------------------------------------------------
M9M7V1_PSEA3/4-180--------------------------------------------------------------------------------
E9IZ98_SOLIN/3-158--------------------------------------------------------------------------------
F9XJ39_MYCGM/17-183--------------------------------------------------------------------------------
G7DY82_MIXOS/4-167--------------------------------------------------------------------------------
B8LTE1_TALSN/26-203--------------------------------------------------------------------------------
M2UB51_COCH5/16-202--------------------------------------------------------------------------------
Q7QF64_ANOGA/6-161--------------------------------------------------------------------------------
A7SIZ0_NEMVE/6-164--------------------------------------------------------------------------------
D0MQQ9_PHYIT/10-187--------------------------------------------------------------------------------
G2QYW0_THITE/20-241--------------------------------------------------------------------------------
M7XI76_RHOT1/4-179--------------------------------------------------------------------------------
N1J6Q3_BLUG1/17-189--------------------------------------------------------------------------------
W5L8W2_ASTMX/7-166--------------------------------------------------------------------------------
F0Y367_AURAN/15-181--------------------------------------------------------------------------------
M2YLK4_MYCFI/17-190--------------------------------------------------------------------------------
J9K5B3_ACYPI/4-159--------------------------------------------------------------------------------
C5GJB5_AJEDR/18-243--------------------------------------------------------------------------------
C0SB09_PARBP/18-236--------------------------------------------------------------------------------
G9MXD8_HYPVG/17-184--------------------------------------------------------------------------------
F7BVE6_MONDO/7-163--------------------------------------------------------------------------------
K5XGN4_AGABU/7-168--------------------------------------------------------------------------------
K1X9F4_MARBU/17-188--------------------------------------------------------------------------------
I1RNR3_GIBZE/17-183--------------------------------------------------------------------------------
D8S3Z0_SELML/19-178--------------------------------------------------------------------------------
S3DAW2_GLAL2/17-190--------------------------------------------------------------------------------
H3G0S5_PRIPA/4-152--------------------------------------------------------------------------------
J4IAW5_FIBRA/9-170--------------------------------------------------------------------------------
D4B3K7_ARTBC/15-225--------------------------------------------------------------------------------
T1FZF4_HELRO/5-166--------------------------------------------------------------------------------
D8PT94_SCHCM/8-167--------------------------------------------------------------------------------
A9TJQ4_PHYPA/5-167--------------------------------------------------------------------------------
U9STJ1_RHIID/5-161--------------------------------------------------------------------------------
S3CTF6_OPHP1/17-203--------------------------------------------------------------------------------
Q9N489_CAEEL/4-158--------------------------------------------------------------------------------
S2K9W2_MUCC1/5-162--------------------------------------------------------------------------------
N1PHQ0_MYCP1/17-184--------------------------------------------------------------------------------
K3WH06_PYTUL/15-205--------------------------------------------------------------------------------
G4V5L5_SCHMA/3-160--------------------------------------------------------------------------------
E9D275_COCPS/18-247--------------------------------------------------------------------------------
B7QCT5_IXOSC/4-160--------------------------------------------------------------------------------
Q6BG09_PARTE/3-157--------------------------------------------------------------------------------
J4WGT4_BEAB2/17-207--------------------------------------------------------------------------------
E4ZRT1_LEPMJ/16-197--------------------------------------------------------------------------------
E1FS06_LOALO/5-160--------------------------------------------------------------------------------
R5A3D0_TAPDE/5-161--------------------------------------------------------------------------------
F2PSB4_TRIEC/15-224--------------------------------------------------------------------------------
A6QU18_AJECN/18-250--------------------------------------------------------------------------------
Q0UID2_PHANO/16-176--------------------------------------------------------------------------------
C4M0K9_ENTHI/6-152--------------------------------------------------------------------------------
C4JRU2_UNCRE/18-241--------------------------------------------------------------------------------
G3P8M2_GASAC/9-166--------------------------------------------------------------------------------
C3XPI1_BRAFL/4-160--------------------------------------------------------------------------------
Q2GZY9_CHAGB/20-238--------------------------------------------------------------------------------
Q54U74_DICDI/5-157--------------------------------------------------------------------------------
W5KMI5_ASTMX/7-164--------------------------------------------------------------------------------
G7YV25_CLOSI/3-160--------------------------------------------------------------------------------
B2WG42_PYRTR/16-198--------------------------------------------------------------------------------
V5FWH7_BYSSN/18-204--------------------------------------------------------------------------------
F7GRX0_CALJA/6-161--------------------------------------------------------------------------------
H2XRE1_CIOIN/8-161--------------------------------------------------------------------------------
G6DKG0_DANPL/4-157--------------------------------------------------------------------------------
H2ZRB7_CIOSA/5-158--------------------------------------------------------------------------------
B4M1N5_DROVI/3-158--------------------------------------------------------------------------------
K0S700_THAOC/262-424--------------------------------------------------------------------------------
B7FRS4_PHATC/6-155--------------------------------------------------------------------------------
U5HFP6_USTV1/5-178--------------------------------------------------------------------------------
M4DFK4_BRARP/12-175--------------------------------------------------------------------------------
L5LPE8_MYODS/6-163--------------------------------------------------------------------------------
N4VI33_COLOR/17-213--------------------------------------------------------------------------------
F7VRW3_SORMK/18-194--------------------------------------------------------------------------------
S8AM96_DACHA/6-190--------------------------------------------------------------------------------
F8Q7V8_SERL3/8-169--------------------------------------------------------------------------------
A8BII4_GIAIC/3-157--------------------------------------------------------------------------------

PF12814

A8NC45_COPC7/1477-1596--------------------------------------------------------------------------------
A8Q694_MALGO/495-613--------------------------------------------------------------------------------
B2VUN2_PYRTR/943-1083--------------------------------------------------------------------------------
B6JVF8_SCHJY/810-930--------------------------------------------------------------------------------
B8M115_TALSN/905-1052--------------------------------------------------------------------------------
C0SAF8_PARBP/1004-1151--------------------------------------------------------------------------------
C1H210_PARBA/1232-1352--------------------------------------------------------------------------------
C5DMW2_LACTC/3405-3524--------------------------------------------------------------------------------
C5DY62_ZYGRC/2362-2478--------------------------------------------------------------------------------
C5FWA2_ARTOC/1261-1380--------------------------------------------------------------------------------
C5MCT5_CANTT/3605-3725--------------------------------------------------------------------------------
Q0TVR4_PHANO/1388-1507--------------------------------------------------------------------------------
Q2TZB5_ASPOR/919-1066--------------------------------------------------------------------------------
Q4P966_USTMA/1901-2021--------------------------------------------------------------------------------
Q4Q999_LEIMA/446-556--------------------------------------------------------------------------------
Q4YWB8_PLABA/90-206--------------------------------------------------------------------------------
Q5KMI7_CRYNJ/1724-1843--------------------------------------------------------------------------------
Q6CF84_YARLI/3022-3141--------------------------------------------------------------------------------
Q6FVK1_CANGA/1920-2038--------------------------------------------------------------------------------
MCP5_SCHPO/840-959--------------------------------------------------------------------------------
Q1K7R2_NEUCR/971-1102--------------------------------------------------------------------------------

PF16457

F2U545_SALR5/1386-1502--------------------------------------------------------------------------------
Q8IA75_CAEEL/74-191--------------------------------------------------------------------------------
H3C055_TETNG/9-126--------------------------------------------------------------------------------
G1MWI1_MELGA/27-143--------------------------------------------------------------------------------
G3NV89_GASAC/27-143--------------------------------------------------------------------------------
G1N5L5_MELGA/27-143--------------------------------------------------------------------------------
H2QM57_PANTR/9-125--------------------------------------------------------------------------------
F4NYW2_BATDJ/668-811--------------------------------------------------------------------------------
E4YI96_OIKDI/579-706--------------------------------------------------------------------------------
H2VI16_CAEJA/135-252--------------------------------------------------------------------------------
CED12_CAEBR/550-685--------------------------------------------------------------------------------
F1KWU1_ASCSU/567-696--------------------------------------------------------------------------------
D6W9U3_TRICA/165-281--------------------------------------------------------------------------------
F2TZR8_SALR5/544-669--------------------------------------------------------------------------------
B3RVM3_TRIAD/557-675--------------------------------------------------------------------------------
I1FTR2_AMPQE/570-688--------------------------------------------------------------------------------
B7Q0D1_IXOSC/536-660--------------------------------------------------------------------------------
E9C1Y2_CAPO3/536-660--------------------------------------------------------------------------------
C3ZV75_BRAFL/544-670--------------------------------------------------------------------------------
A7SLG8_NEMVE/536-660--------------------------------------------------------------------------------
C3YD81_BRAFL/369-491--------------------------------------------------------------------------------
G1KZV5_AILME/550-676--------------------------------------------------------------------------------
F7DYL0_HORSE/554-680--------------------------------------------------------------------------------
F6RLT2_XENTR/535-658--------------------------------------------------------------------------------
G1SYE9_RABIT/567-695--------------------------------------------------------------------------------
H3CTT0_TETNG/532-657--------------------------------------------------------------------------------
G1MUA8_MELGA/508-634--------------------------------------------------------------------------------
H2YA57_CIOSA/189-312--------------------------------------------------------------------------------
B7Q7M8_IXOSC/553-677--------------------------------------------------------------------------------
Q29N75_DROPS/548-672--------------------------------------------------------------------------------
B0WB15_CULQU/539-663--------------------------------------------------------------------------------
E9H9Z7_DAPPU/559-683--------------------------------------------------------------------------------
H9JLX2_BOMMO/556-681--------------------------------------------------------------------------------
D6WDN2_TRICA/534-656--------------------------------------------------------------------------------
E0VNX9_PEDHC/550-675--------------------------------------------------------------------------------
I1C1Z8_RHIO9/470-634--------------------------------------------------------------------------------
I1BJB6_RHIO9/153-333--------------------------------------------------------------------------------
G2Y444_BOTF4/505-670--------------------------------------------------------------------------------
G9P7T1_HYPAI/502-650--------------------------------------------------------------------------------
C7YQF4_NECH7/504-660--------------------------------------------------------------------------------
H1UW70_COLHI/501-660--------------------------------------------------------------------------------
G3JKD9_CORMM/498-655--------------------------------------------------------------------------------
E9DTQ0_METAQ/504-655--------------------------------------------------------------------------------
Q0C7D9_ASPTN/458-611--------------------------------------------------------------------------------
D5GMC6_TUBMM/478-630--------------------------------------------------------------------------------
Q5KFV3_CRYNJ/676-815--------------------------------------------------------------------------------
G7DXA4_MIXOS/1138-1273--------------------------------------------------------------------------------
Q4P5W9_USTMA/603-759--------------------------------------------------------------------------------
G4TUD7_PIRID/590-737--------------------------------------------------------------------------------
E2LF39_MONPE/31-172--------------------------------------------------------------------------------
B0CU21_LACBS/584-724--------------------------------------------------------------------------------
Q6CEB9_YARLI/515-645--------------------------------------------------------------------------------
F2QVJ2_PICP7/437-572--------------------------------------------------------------------------------
Q6BTL6_DEBHA/441-583--------------------------------------------------------------------------------
G3AUY9_SPAPN/448-610--------------------------------------------------------------------------------
C4Y9G4_CLAL4/452-596--------------------------------------------------------------------------------
G8Y676_PICSO/354-499--------------------------------------------------------------------------------
A5DKW2_PICGU/355-500--------------------------------------------------------------------------------
H8XAE8_CANO9/448-592--------------------------------------------------------------------------------
A3LSN2_PICST/356-478--------------------------------------------------------------------------------
G3BBH7_CANTC/358-490--------------------------------------------------------------------------------

PF11605

VPS36_DROME/2-94--------------------------------------------------------------------------------
Q4QDE7_LEIMA/5-95--------------------------------------------------------------------------------
Q5TPR5_ANOGA/2-94--------------------------------------------------------------------------------
Q5AHK1_CANAL/13-100--------------------------------------------------------------------------------
Q19519_CAEEL/2-89--------------------------------------------------------------------------------
Q6CAN8_YARLI/6-95--------------------------------------------------------------------------------
A5DUJ7_LODEL/11-99--------------------------------------------------------------------------------
Q6CWP4_KLULA/12-100--------------------------------------------------------------------------------
A3LUC0_PICST/11-98--------------------------------------------------------------------------------
A5DGQ5_PICGU/60-147--------------------------------------------------------------------------------
Q4PA51_USTMA/9-97--------------------------------------------------------------------------------
Q6BSQ4_DEBHA/12-99--------------------------------------------------------------------------------
VPS36_DICDI/8-94--------------------------------------------------------------------------------
Q6FPE3_CANGA/8-96--------------------------------------------------------------------------------
VPS36_SCHPO/6-94--------------------------------------------------------------------------------
VPS36_ARATH/18-111--------------------------------------------------------------------------------
Q757C1_ASHGO/15-103--------------------------------------------------------------------------------
A7TGC6_VANPO/8-96--------------------------------------------------------------------------------
Q4DRE4_TRYCC/5-94--------------------------------------------------------------------------------
A4HA31_LEIBR/5-95--------------------------------------------------------------------------------
E7KS64_YEASL/8-95--------------------------------------------------------------------------------

PF02893

Q9VU19_DROME/13-82--------------------------------------------------------------------------------
MTMR2_MOUSE/71-139--------------------------------------------------------------------------------
TBCD8_MOUSE/285-353--------------------------------------------------------------------------------
UGT52_DICDI/881-948--------------------------------------------------------------------------------
FAN_HUMAN/176-247--------------------------------------------------------------------------------
GRAM4_HUMAN/445-523--------------------------------------------------------------------------------
GRM1B_HUMAN/96-163--------------------------------------------------------------------------------
MTMR5_HUMAN/882-968--------------------------------------------------------------------------------
Q9VP46_DROME/136-203--------------------------------------------------------------------------------
Q9VP46_DROME/282-350--------------------------------------------------------------------------------
GYP2_SCHPO/20-85--------------------------------------------------------------------------------
Q9TXP3_CAEEL/783-872--------------------------------------------------------------------------------
YL072_YEAST/164-231--------------------------------------------------------------------------------
GYP2_YEAST/29-116--------------------------------------------------------------------------------
YFE2_YEAST/198-265--------------------------------------------------------------------------------
ATG26_YEAST/570-636--------------------------------------------------------------------------------
MTM1_HUMAN/29-97--------------------------------------------------------------------------------
ATG26_PICPG/586-652--------------------------------------------------------------------------------
YGZ7_SCHPO/197-264--------------------------------------------------------------------------------
Q18966_CAEEL/9-83--------------------------------------------------------------------------------
Q9VGH9_DROME/922-1002--------------------------------------------------------------------------------
YHO0_YEAST/548-617--------------------------------------------------------------------------------
YSP2_YEAST/647-716--------------------------------------------------------------------------------
GEML1_ARATH/138-215--------------------------------------------------------------------------------
WBP2_MOUSE/1-84--------------------------------------------------------------------------------
ATG26_CANAL/816-880--------------------------------------------------------------------------------
Q9VMI9_DROME/40-113--------------------------------------------------------------------------------
C2GR1_ARATH/688-754--------------------------------------------------------------------------------
I3NB22_SPETR/106-171--------------------------------------------------------------------------------
M0YCJ0_HORVD/230-306--------------------------------------------------------------------------------

PF08567

C0S578_PARBP/9-110--------------------------------------------------------------------------------
B4J482_DROGR/16-100--------------------------------------------------------------------------------
F4WXP5_ACREC/16-100--------------------------------------------------------------------------------
H2AUR0_KAZAF/8-105--------------------------------------------------------------------------------
M7TY82_BOTF1/10-100--------------------------------------------------------------------------------
B7Q4R8_IXOSC/16-102--------------------------------------------------------------------------------
G4VRZ6_SCHMA/16-100--------------------------------------------------------------------------------
G2QQE2_THIHA/9-102--------------------------------------------------------------------------------
H3HDA4_PHYRM/10-97--------------------------------------------------------------------------------
D8LFT0_ECTSI/21-108--------------------------------------------------------------------------------
I2GVF1_TETBL/8-94--------------------------------------------------------------------------------
E9G9U7_DAPPU/17-101--------------------------------------------------------------------------------
C4R8T2_PICPG/9-97--------------------------------------------------------------------------------
H2Z5J2_CIOSA/14-97--------------------------------------------------------------------------------
G8ZV89_TORDC/8-105--------------------------------------------------------------------------------
E1FYN0_LOALO/14-103--------------------------------------------------------------------------------
E3KFN3_PUCGT/17-117--------------------------------------------------------------------------------
F8PUT6_SERL3/11-94--------------------------------------------------------------------------------
G2XIN7_VERDV/9-97--------------------------------------------------------------------------------
G0RZ08_CHATD/9-102--------------------------------------------------------------------------------
C5FUC5_ARTOC/9-103--------------------------------------------------------------------------------
C5DU63_ZYGRC/8-105--------------------------------------------------------------------------------
TFB1_SCHPO/10-95--------------------------------------------------------------------------------
G4URS9_NEUT9/12-102--------------------------------------------------------------------------------
B6HTW4_PENCW/8-100--------------------------------------------------------------------------------
Q6FNK7_CANGA/8-105--------------------------------------------------------------------------------
G7E2C5_MIXOS/16-105--------------------------------------------------------------------------------
M3AKW8_MYCFI/9-93--------------------------------------------------------------------------------
C3Y693_BRAFL/15-100--------------------------------------------------------------------------------
M2V0J7_COCH5/7-93--------------------------------------------------------------------------------
J7R257_KAZNA/8-105--------------------------------------------------------------------------------
E9EZ62_METAR/9-99--------------------------------------------------------------------------------
N1PQD5_MYCP1/9-92--------------------------------------------------------------------------------
F9X734_MYCGM/9-93--------------------------------------------------------------------------------
N1QHE7_SPHMS/9-93--------------------------------------------------------------------------------
H2W045_CAEJA/16-106--------------------------------------------------------------------------------
Q0CQX7_ASPTN/9-105--------------------------------------------------------------------------------
M9MEQ8_PSEA3/15-106--------------------------------------------------------------------------------
G8JRE4_ERECY/8-105--------------------------------------------------------------------------------
M7P3T1_PNEMU/9-93--------------------------------------------------------------------------------
H1UYT1_COLHI/9-97--------------------------------------------------------------------------------
G9NU11_HYPAI/9-96--------------------------------------------------------------------------------
A8N758_COPC7/11-95--------------------------------------------------------------------------------
R7Z4G4_CONA1/7-97--------------------------------------------------------------------------------
M4B6V9_HYAAE/10-100--------------------------------------------------------------------------------
E3M705_CAERE/15-105--------------------------------------------------------------------------------
R1EVG0_BOTPV/7-89--------------------------------------------------------------------------------
M2NGD5_BAUCO/9-93--------------------------------------------------------------------------------
B9SX99_RICCO/11-95--------------------------------------------------------------------------------
M3K0U0_CANMX/9-103--------------------------------------------------------------------------------
J4KLV9_BEAB2/10-97--------------------------------------------------------------------------------
H9JKN8_BOMMO/16-100--------------------------------------------------------------------------------
H2LNK6_ORYLA/16-97--------------------------------------------------------------------------------
TF2H1_DICDI/19-105--------------------------------------------------------------------------------
D3BDH2_POLPA/19-106--------------------------------------------------------------------------------
E5RZL8_TRISP/21-115--------------------------------------------------------------------------------
D2A3F8_TRICA/16-100--------------------------------------------------------------------------------
F4P5K1_BATDJ/15-102--------------------------------------------------------------------------------
H3E924_PRIPA/15-105--------------------------------------------------------------------------------
J3PCR1_GAGT3/9-99--------------------------------------------------------------------------------
D5GM43_TUBMM/10-95--------------------------------------------------------------------------------
B8BXI5_THAPS/18-109--------------------------------------------------------------------------------
H6CBI6_EXODN/9-99--------------------------------------------------------------------------------
B8LVU2_TALSN/9-96--------------------------------------------------------------------------------
G8BSL5_TETPH/8-105--------------------------------------------------------------------------------
Q6CT84_KLULA/10-108--------------------------------------------------------------------------------
M5ECF4_MALS4/14-105--------------------------------------------------------------------------------
B2B252_PODAN/9-101--------------------------------------------------------------------------------
L8WWX6_THACA/11-94--------------------------------------------------------------------------------
B0D0T4_LACBS/11-92--------------------------------------------------------------------------------
L8G6J1_PSED2/9-97--------------------------------------------------------------------------------
B3RWB8_TRIAD/17-98--------------------------------------------------------------------------------
C1N257_MICPC/13-108--------------------------------------------------------------------------------
Q6BQQ5_DEBHA/9-94--------------------------------------------------------------------------------
A8Q5M5_MALGO/13-104--------------------------------------------------------------------------------
A7RH50_NEMVE/17-97--------------------------------------------------------------------------------
M2RHA4_CERS8/11-94--------------------------------------------------------------------------------
B6IEX8_CAEBR/15-98--------------------------------------------------------------------------------
C5DKS5_LACTC/8-105--------------------------------------------------------------------------------
K1WJC1_MARBU/9-96--------------------------------------------------------------------------------
K0KQD0_WICCF/9-97--------------------------------------------------------------------------------
E5A9P6_LEPMJ/7-93--------------------------------------------------------------------------------
N1J7M0_BLUG1/10-100--------------------------------------------------------------------------------
K1RJ65_CRAGI/16-100--------------------------------------------------------------------------------
E3N9N3_CAERE/15-105--------------------------------------------------------------------------------
M7X2J7_RHOT1/8-96--------------------------------------------------------------------------------
F0XTE6_GROCL/9-97--------------------------------------------------------------------------------
R4XBS4_TAPDE/10-96--------------------------------------------------------------------------------
I1FYH0_AMPQE/20-101--------------------------------------------------------------------------------
C4JS80_UNCRE/11-104--------------------------------------------------------------------------------
R8BY97_TOGMI/10-100--------------------------------------------------------------------------------
F4PG90_DICFS/19-106--------------------------------------------------------------------------------
E4WY57_OIKDI/15-92--------------------------------------------------------------------------------
E9CVT6_COCPS/11-108--------------------------------------------------------------------------------
E9PWY2_MOUSE/23-103--------------------------------------------------------------------------------
G4NAD4_MAGO7/9-98--------------------------------------------------------------------------------
I1RKB1_GIBZE/10-95--------------------------------------------------------------------------------
J9KBA3_ACYPI/15-98--------------------------------------------------------------------------------
K5W1M5_AGABU/12-92--------------------------------------------------------------------------------
Q4WQ61_ASPFU/10-100--------------------------------------------------------------------------------
W1QI78_OGAPD/10-95--------------------------------------------------------------------------------
W4XFR5_STRPU/18-100--------------------------------------------------------------------------------

PF03517

E1GH06_LOALO/57-218--------------------------------------------------------------------------------
LOT5_ASHGO/69-217--------------------------------------------------------------------------------
A2QMX0_ASPNC/82-226--------------------------------------------------------------------------------
A4S3U5_OSTLU/82-224--------------------------------------------------------------------------------
LOT5_PICGU/78-210--------------------------------------------------------------------------------
A6QTC2_AJECN/141-306--------------------------------------------------------------------------------
LOT5_VANPO/82-248--------------------------------------------------------------------------------
A8NTF5_COPC7/63-194--------------------------------------------------------------------------------
A8Y0J2_CAEBR/34-180--------------------------------------------------------------------------------
A9VD70_MONBE/35-180--------------------------------------------------------------------------------
B0WD72_CULQU/34-182--------------------------------------------------------------------------------
B6QED0_PENMQ/87-259--------------------------------------------------------------------------------
B7P9B2_IXOSC/33-159--------------------------------------------------------------------------------
B8BUW5_THAPS/168-320--------------------------------------------------------------------------------
C4WYC8_ACYPI/33-183--------------------------------------------------------------------------------
C5DFH3_LACTC/77-239--------------------------------------------------------------------------------
C5DS18_ZYGRC/74-243--------------------------------------------------------------------------------
C5FIH0_ARTOC/100-255--------------------------------------------------------------------------------
C5M0L7_PERM5/411-532--------------------------------------------------------------------------------
D2VE54_NAEGR/89-219--------------------------------------------------------------------------------
D3AWK5_POLPA/41-182--------------------------------------------------------------------------------
D5GPC9_TUBMM/75-207--------------------------------------------------------------------------------
D6WHX2_TRICA/33-160--------------------------------------------------------------------------------
E2AYH0_CAMFO/33-160--------------------------------------------------------------------------------
E3MRC6_CAERE/33-179--------------------------------------------------------------------------------
E6ZKI1_SPORE/90-225--------------------------------------------------------------------------------
E9CD59_CAPO3/34-165--------------------------------------------------------------------------------
F0XG98_GROCL/95-242--------------------------------------------------------------------------------
F0ZDK9_DICPU/33-167--------------------------------------------------------------------------------
F1QDS7_DANRE/33-166--------------------------------------------------------------------------------
F2UJQ4_SALR5/35-160--------------------------------------------------------------------------------
YIU1_SCHPO/53-192--------------------------------------------------------------------------------
Q4PHI8_USTMA/90-237--------------------------------------------------------------------------------
Q54Q91_DICDI/34-173--------------------------------------------------------------------------------
Q5TW40_ANOGA/34-170--------------------------------------------------------------------------------
Q6C5D1_YARLI/86-206--------------------------------------------------------------------------------
LOT5_KLULA/83-248--------------------------------------------------------------------------------
Q6FWF9_CANGA/65-256--------------------------------------------------------------------------------
Q7RFA5_PLAYO/43-232--------------------------------------------------------------------------------
C5GHM2_AJEDR/150-321--------------------------------------------------------------------------------
E7Q5X8_YEASB/84-242--------------------------------------------------------------------------------
Q5KJY5_CRYNJ/62-200--------------------------------------------------------------------------------

PF14844

F0ZLG9_DICPU/1576-1668--------------------------------------------------------------------------------
A9V098_MONBE/81-174--------------------------------------------------------------------------------
LVSC_DICDI/1712-1818--------------------------------------------------------------------------------
A9SKJ8_PHYPA/1981-2088--------------------------------------------------------------------------------
D8S3X7_SELML/1889-1980--------------------------------------------------------------------------------
D3BT75_POLPA/2605-2696--------------------------------------------------------------------------------
D7LRV7_ARALL/2035-2133--------------------------------------------------------------------------------
F2UGS7_SALR5/2291-2404--------------------------------------------------------------------------------
F6I330_VITVI/2391-2488--------------------------------------------------------------------------------
D0NB84_PHYIT/1700-1817--------------------------------------------------------------------------------
E7EZD1_DANRE/2180-2277--------------------------------------------------------------------------------
Q22HC6_TETTS/2408-2508--------------------------------------------------------------------------------
I1P2W1_ORYGL/1915-2017--------------------------------------------------------------------------------
F1QJA6_DANRE/2081-2178--------------------------------------------------------------------------------
B3RWH0_TRIAD/280-377--------------------------------------------------------------------------------
B4I0S0_DROSE/623-719--------------------------------------------------------------------------------
D2UYK5_NAEGR/2492-2591--------------------------------------------------------------------------------
E4X0F7_OIKDI/1590-1687--------------------------------------------------------------------------------
NBEA_CAEEL/1701-1798--------------------------------------------------------------------------------
LYST_MOUSE/3007-3102--------------------------------------------------------------------------------
U1M966_ASCSU/1739-1835--------------------------------------------------------------------------------
E9GKY9_DAPPU/2072-2169--------------------------------------------------------------------------------
C3Y0L9_BRAFL/2980-3076--------------------------------------------------------------------------------
Q01AN8_OSTTA/2201-2290--------------------------------------------------------------------------------
D3B4G5_POLPA/1067-1165--------------------------------------------------------------------------------
E9CED0_CAPO3/1927-2025--------------------------------------------------------------------------------
A9V898_MONBE/2777-2881--------------------------------------------------------------------------------
C1E8K2_MICSR/45-147--------------------------------------------------------------------------------
D8M509_BLAHO/339-453--------------------------------------------------------------------------------
A2DFN3_TRIVA/1810-1904--------------------------------------------------------------------------------
F0ZTM1_DICPU/1944-2035--------------------------------------------------------------------------------
LVSD_DICDI/2071-2162--------------------------------------------------------------------------------
A4IDE3_LEIIN/3480-3579--------------------------------------------------------------------------------

PF00640

APBA3_RAT/216-354PPST-RMGQAQEAMDRVKAP..........................EGET-Q----------------------------
APBB2_HUMAN/419-555GKS.-.SVAVNNCIRQLSYC.................KNDIRDT..VGIW-G----------------------------
SHC1_HUMAN/162-318DFNT-RTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGR..SNLK-F----------------------------
SHC2_HUMAN/153-308DFNT-RTQVTREAINRLHEAVPGVRGS.WKKKAPNKALASVLGK..SNLR-F----------------------------
APBA1_HUMAN/461-618SKNV-RMMQAQEAVSRIKMA...............QKLAKSRKKAPEGES-Q----------------------------
JIP1_RAT/564-698....-....KGNDVLCAAMQ................KIATTRRL..TVHF-N----------------------------
JIP2_HUMAN/683-814....-....QGNGILCAAMQ................KIATARKL..TVHL-R----------------------------
LIN10_CAEEL/607-762SKAA-RMAQAQEAVARVKAP..........................EGDV-Q----------------------------
CAPON_RAT/32-170..NS-RVEIVA.AMRRIRYEFK............AKNIKKKKVS..IMVS-V----------------------------
APBB3_RAT/117-255GKS.-.SIAVNNCIQQLAQA.................RNRSQPH..DGAW-G----------------------------
APBA3_HUMAN/221-359PTST-RMAQAREAMDRVKAP..........................DGET-Q----------------------------
APBA2_MOUSE/373-531SKNI-RMMQAQEAVSRVKRMQK............AAKIKKKANS..EGDA-Q----------------------------
CED6_CAEEL/61-194..N.-GSDVAREAIHAIRFQ...............RDLKRSEQT..R.ET-A----------------------------
SHC3_HUMAN/155-311DFST-RTQITREAISRVCEAVPGAKGAFKKRKPPSKMLSSILGK..SNLQ-F----------------------------
NUMB_MOUSE/39-172....-.MHICEDAVKRLKAE.................RKFFKGF..FGKT-G----------------------------
APBB1_RAT/371-510GRS.-.SVAVNNCIRQLSYH................KNNLHDPM..SGGW-G----------------------------
B4HKQ4_DROSE/34-182DFET-RTQLARECINRVCEAAGLKS......AGKRRLTNFISDR..PSMQ-H----------------------------

PF08416

EPS8_MOUSE/64-194---D-AMITVEDGIRKLKLL--------------------------DAKG-K----------------------------
ES8L1_HUMAN/35-165---D-GVHTVEDASRKLAVM--------------------------DSQG-R----------------------------
TENS3_HUMAN/1310-1444---T-GHQAIQK..ALSITL--------------------------VQEP-P----------------------------
Q9VHC3_DROME/580-716---T-GNEAIRK..AIRQMY--------------------------GQQP-L----------------------------
P92160_CAEEL/272-416---T-GNECVKRSIATCSQR--------------------------AING-D----------------------------
F1N4S3_BOVIN/28-148---R-.IQEPKDALQKLQEM--------------------------DAQG-R----------------------------
F1QMN2_DANRE/51-181---E-AMLTIEDGIRKLRLL--------------------------DAKG-K----------------------------
F1RAF6_DANRE/50-170---E-.VSSIDDCVNRLKIL--------------------------DSKG-K----------------------------
F6PIM5_XENTR/47-173---.-.LRNVEDCLKHLSFL--------------------------EAQG-R----------------------------
F6YPU9_XENTR/61-191---D-GVLTVDDGIRKLKLL--------------------------DAKG-K----------------------------
F6YU93_MACMU/815-947---T-GPQAVAR..ASSAAL--------------------------SCSP-R----------------------------
G5E5T1_BOVIN/49-179---E-AITSVEDAIRKLVQL--------------------------SSKE-K----------------------------
H3DAX3_TETNG/54-176---Q-.LRNVSDCVEQLQLL--------------------------EEMG-R----------------------------
Q59G71_HUMAN/736-872---T-GPQAISK..ATSETL--------------------------AADP-T----------------------------

PF14719

F1SFG1_PIG/69-256---R.GDGCTDLAVGKIWSK--------------------------SEAG.R----------------------------
C3ZEC0_BRAFL/18-200---K.GEGSTDNAVKTIWTK--------------------------SNKG.K----------------------------
A2AM80_MOUSE/71-265---K.GDGCTDDAVGRIWAR--------------------------CGPG.G----------------------------
Q20652_CAEEL/34-211---R.GENCYEKPLSLIWKA--------------------------YCSRAR----------------------------
B4LZF0_DROVI/288-472---KAGEGCVEKQLNTLWRN--------------------------YTQHTK----------------------------
E1FRI2_LOALO/49-231---K.GEECLAKPLSLIWRT--------------------------YCNR.Q----------------------------
E5SI18_TRISP/18-200---R.GEGCVDRPLGVIWRS--------------------------YCER.K----------------------------
E9GIB1_DAPPU/14-199---K.GEGCLDKPLATLWKN--------------------------YCQS.S----------------------------
E0VC17_PEDHC/15-198---K.GEGCIEKPLNTLWKN--------------------------YNESLK----------------------------

PF10480

Q5RG21_DANRE/1-198---D-MSKTLQEPLDLINYI--------------------DAAQQDGKLPFV----------------------------
F7EVP2_MACMU/1-200---S-EGKGLEGPLDLINYI--------------------DVAQQDGKLPFV----------------------------

PF02174

IRS4_MOUSE/232-334----------------------------------------------GHRK-E----------------------------
DOK2_HUMAN/147-247----------------------------------------------SERC-H----------------------------
DOK3_CHICK/145-244----------------------------------------------AARC-E----------------------------
A7RF80_NEMVE/161-269----------------------------------------------AEKN-Q----------------------------
IRS1_DROME/122-234----------------------------------------------SEKV-G----------------------------
IRS1_XENTR/126-228----------------------------------------------GQTR-N----------------------------
Q29P01_DROPS/15-112----------------------------------------------SPGT-P----------------------------
Q7Q177_ANOGA/14-107----------------------------------------------DNDG-T----------------------------
Q17L29_AEDAE/14-105----------------------------------------------DDDG-T----------------------------
A3KNM7_DANRE/135-232----------------------------------------------TPNL-D----------------------------
DOK3_HUMAN/213-312----------------------------------------------ATRC-Q----------------------------
A6H792_BOVIN/17-108----------------------------------------------DDEG-V----------------------------
A7RZ35_NEMVE/132-236----------------------------------------------MQRI-G----------------------------
DOK4_PONAB/135-232----------------------------------------------CPNL-D----------------------------
F1QYZ7_DANRE/148-245----------------------------------------------SERC-G----------------------------
F6UJY4_XENTR/131-227----------------------------------------------AERC-S----------------------------
F6XDD6_XENTR/156-256----------------------------------------------GQLK-N----------------------------
F6YCQ0_XENTR/195-295----------------------------------------------GQAK-N----------------------------
F6YKL9_XENTR/136-227----------------------------------------------SSNL-D----------------------------
H3C9X0_TETNG/163-260----------------------------------------------SERC-G----------------------------
H3CKK9_TETNG/161-256----------------------------------------------SERC-R----------------------------
J9P166_CANFA/114-208----------------------------------------------SPNL-D----------------------------
L5KVB1_PTEAL/194-295----------------------------------------------GQSK-N----------------------------
O54718_MOUSE/160-270----------------------------------------------GRAQ-G----------------------------
Q58DP1_BOVIN/152-253----------------------------------------------AERC-G----------------------------
DOK3_MOUSE/159-255----------------------------------------------TSRC-Q----------------------------

PF14470

Q73PJ3_TREDE/33-124------LT-..SG...LMD.--------------------------...........-----------------------
Q8XP28_CLOPE/122-213------MT-..SG...LTD.--------------------------...........-----------------------
D4GR98_HALVD/78-183------YF-..AN...NSKG--------------------------QIRDGD.....-----------------------
D4GR98_HALVD/240-354------LT-..RG...QTVD--------------------------VEGSGAGSSWW-----------------------
C7N8P3_LEPBD/33-124------AT-..SG...YYE.--------------------------...........-----------------------
D9STE0_CLOC7/154-250------CF-..CG...LNNF--------------------------VS.........-----------------------
A0M4L3_GRAFK/28-124------IA-..VQKKPAVN.--------------------------...........-----------------------
D5BGD3_ZUNPS/37-134------VA-..VQKKPAVN.--------------------------...........-----------------------
A2BKM8_HYPBU/14-108------AV-..KQ...QRIA--------------------------...........-----------------------
Q5JHI4_THEKO/17-110------AI-..KK...KIS.--------------------------...........-----------------------
Y689_ARCFU/15-109------SV-KKKL...YTE.--------------------------...........-----------------------
C6XZU2_PEDHD/28-124------MA-..VQKKPAVN.--------------------------...........-----------------------
A0RV76_CENSY/18-109------TV-..TQ...SKA.--------------------------...........-----------------------
A5FK72_FLAJ1/29-125------IA-..VQ...K.KP--------------------------A..........-----------------------
YOKE_BACSU/50-157------MT-..SA...DPK.--------------------------...........-----------------------
B9E7P9_MACCJ/52-151------AS-..YS...QIN.--------------------------...........-----------------------
B9DJ09_STACT/11-105------SV-..LG...KMAY--------------------------PMN........-----------------------
E8SGW4_STAPH/11-105------SV-..LG...IMPY--------------------------QMK........-----------------------
A8LB81_FRASN/29-118------MA-..RG...SRG.--------------------------...........-----------------------
H8XRC1_FLAIG/29-124------IA-..VQ...K.KP--------------------------A..........-----------------------
Q81GV4_BACCR/12-108------TL-..KC...SLTG--------------------------YMI........-----------------------
Q81IW4_BACCR/13-104------FV-..VG...IFEK--------------------------DN.........-----------------------
Q81QM1_BACAN/12-115------TL-..YC...VINF--------------------------G..........-----------------------
Q97GB3_CLOAB/16-129------YC-..YG...IINA--------------------------KIGS.......-----------------------
Q9CGT3_LACLA/43-133------AT-..SG...FVD.--------------------------...........-----------------------
R5LZ88_9FIRM/210-299------VF-..GG...VLNL--------------------------D..........-----------------------
R5XNA3_9CLOT/8-107------SL-..KC...NLKS--------------------------FID........-----------------------

PF08000

C7N5J6_SLAHD/4-123------KM---SRID.PKKI--------------------------VGDVQP..LMV-----------------------
F2F1Y8_SOLSS/9-133------VV---ISRQDFDKT--------------------------DADDFI..FNE-----------------------
D5DEB2_BACMD/2-123------NA---SEAD.IRGT--------------------------EKDLQN..ILI-----------------------
G8LZ44_CLOCD/8-129------NS---RELN.AEDV--------------------------EQDMDR..LLT-----------------------
C3AM09_BACMY/2-123------NA---SDTS.TENV--------------------------ERDLQK..IML-----------------------
Q2LS73_SYNAS/3-124------LL---SMQELVDNI--------------------------RKEYAP..LLV-----------------------
R5GQQ5_9BACT/2-123------NA---TSID.LDTI--------------------------RKEYDA..ILY-----------------------
F0P2W0_WEEVC/2-123------NA---GTVT.PEKL--------------------------YSDYQA..ILI-----------------------
G8R3B9_OWEHD/2-124------NA---SAVD.SSKL--------------------------QEKYSR..LLM-----------------------
Q8YA42_LISMO/2-126------KA---AIVT.....--------------------------ESSYGIERFLD-----------------------
R5A390_9CLOT/4-123------KL---KAID.NKEG--------------------------EKIVSD..ILI-----------------------
Q5M368_STRT2/2-124------NA---SKKD.NDKV--------------------------ERQLEN..ILI-----------------------
B2TM32_CLOBB/3-123------KL---KKTS.NDDI--------------------------SKQIEP..LLI-----------------------
Q4JTR2_CORJK/6-119------EW---MFIE.EVPI--------------------------PEDVMA..LLV-----------------------
D4K5P2_9FIRM/2-123------NL---MRLQ.EKDI--------------------------CKNVNA..LLL-----------------------
R6FFF9_9FIRM/23-151------NY---SEVS.AEQL--------------------------MQEYGM..YLM-----------------------
F5XEN8_MICPN/9-122------NW---TLQA.EIPI--------------------------PKDAGE..LLI-----------------------
E3DRV6_HALPG/2-124------NA---SEMN.EVQL--------------------------EEELKE..VII-----------------------
B0UJV9_METS4/2-122------HG---SDAA.PADV--------------------------ARELDG..MLV-----------------------
K8E6L9_CARML/2-124------NA---SDAN.INDV--------------------------RKKLAD..VLL-----------------------
D4ZG58_SHEVD/2-123------NA---SEVN.LEEL--------------------------ADELGP..ILA-----------------------
D4KFS3_9FIRM/2-123------NA---SKAN.LDDI--------------------------RQDYAK..LLA-----------------------
Q8ELK9_OCEIH/2-123------NA---SEVD.NGKI--------------------------EEEFQQ..VLA-----------------------
E4TSG8_MARTH/2-124------NS---GVLE.NSKI--------------------------KEDYGH..FFL-----------------------
C7RG86_ANAPD/14-128------NL---KEIN.IENV--------------------------RKEVIN..FLL-----------------------
F0JKG9_DESDE/2-123------NA---TEVS.LSDV--------------------------QDELAP..ILG-----------------------
R7P5Y0_9BACT/2-123------NA---SEMN.EQEL--------------------------QRTFGP..LLC-----------------------
V6K2R3_STRNV/2-123------NA---HTIN.PATA--------------------------QQDYAR..LLG-----------------------
I0JT52_HALH3/2-123------NA---SEAN.IEKL--------------------------EEQLDD..ILV-----------------------
R4SNZ0_AMYOR/10-126------KL---TPCK.PKDI--------------------------APTVQP..III-----------------------
F2JJ99_CELLD/13-136------KI---ISPQDFDKV--------------------------DGDDFI..LQE-----------------------
K9V1A3_9CYAN/10-132------SV---IQPRDFDKV--------------------------DADDYL..FHE-----------------------
F4BQI2_CARS1/8-120------NW---TFSE.KCAI--------------------------PSDIND..RLV-----------------------
Q3IIM8_PSEHT/2-123------NA---SEVD.DADL--------------------------EKVLLN..TLI-----------------------
R7EZS9_9BACI/10-125------FK---YQIE.PKDL--------------------------PDYAKE..YVS-----------------------
F2I7Y8_AERUA/8-137------NF---SQKD.QQEL--------------------------TEEYGD..FLF-----------------------
F4BRS9_CARS1/2-124------NA---GNIS.ENEA--------------------------RKKLVG..VIL-----------------------
A2U3F1_9FLAO/2-124------NA---SEVS.SEKL--------------------------TEKYGR..LLV-----------------------
R6FUY7_9CLOT/4-121------KL---RQIN.NKDG--------------------------LNATAD..FLI-----------------------
H6NEA0_9BACL/2-123------NA---SEVP.AAEA--------------------------HKEFGT..LLT-----------------------
Q11IY3_CHESB/2-123------HG---SEVD.ASKL--------------------------AQRLDG..VLI-----------------------
A9AYV8_HERA2/2-123------NA---SEVD.PQAA--------------------------QRDFAQ..LLA-----------------------
A4VWQ3_STRSY/15-137------NA---SQMD.NDKI--------------------------EQELEH..VLL-----------------------
X4ZH14_9BACL/3-132------NY---SEVS.VSEL--------------------------TGQYGA..YLM-----------------------
R5SSA7_9CLOT/11-128------SL---KEIE.LDEV--------------------------RSEVQG..LMV-----------------------
W8F0N5_9BACT/2-122------NA---SETD.AQDM--------------------------QLELQQ..LLS-----------------------
C5B2T2_METEA/2-121------HG---SDLS.ADEV--------------------------DRQLAG..VLA-----------------------
G4QJ57_GLANF/2-122------NA---SKID.VSSV--------------------------TEELAP..ILS-----------------------
A1APA7_PELPD/2-123------AG---GSAE.IKKY--------------------------NTEYRQ..LLI-----------------------
K0ESH5_9NOCA/2-124------NA---GRAD.SLQA--------------------------QKEYGF..LLV-----------------------
G2Z1A2_FLABF/2-123------NA---SEVD.IEKI--------------------------NKEFEP..ILI-----------------------
K4IFG7_PSYTT/2-124------NA---GAVD.KEQL--------------------------AKEYEQ..LLT-----------------------
V5XL94_ENTMU/2-124------NA---TQKD.TTNI--------------------------TREVQE..ILI-----------------------
C7MTA4_SACVD/2-123------NA---SSIE.PRAA--------------------------MREFGR..LLA-----------------------
F9VIK2_ARTSS/2-123------NA---SNSD.PNKL--------------------------QEKVSD..ILF-----------------------
Q1GUI3_SPHAL/5-118------SA---GDLD.VSRA--------------------------QAEFQP..WLI-----------------------
N0AXE2_9BACI/2-123------NV---SEVD.VKEV--------------------------EKDLEL..IIA-----------------------
D9SMG5_CLOC7/13-136------KI---IAPSDFDKV--------------------------DGDDYI..MHE-----------------------
Q8EAU5_SHEON/2-123------NA---SEVN.LQEL--------------------------AEELRP..IMG-----------------------
YJQA_BACSU/2-124------NA---STLS.TAAV--------------------------QEELAH..ILL-----------------------
Q24WI9_DESHY/12-133------NA---SEID.TKEI--------------------------ESEVGP..LLY-----------------------
B1M0U2_METRJ/2-123------HG---SAVD.AASL--------------------------ERRLAG..ILI-----------------------
Q15NS1_PSEA6/2-122------NA---SEID.VSDV--------------------------SEELAP..IIG-----------------------
Q6LHY1_PHOPR/2-122------NA---GEMS.IADA--------------------------TEELST..ILG-----------------------
E6SCT2_INTC7/3-123------KL---SPAN.PQEI--------------------------GPQVAE..LLV-----------------------
C7R5K7_JONDD/7-121------EW---IFVQ.EVPI--------------------------PNDVAG..LLA-----------------------
D9R2L2_CLOSW/8-123------TW---TFSS.KCPI--------------------------PNDVQG..MLI-----------------------
Q6ANG9_DESPS/5-123------KL---KPID.NSKA--------------------------LEAISL..FLI-----------------------
C6CSA5_PAESJ/9-133------SV---IRPENYDKV--------------------------DSDDYV..MHE-----------------------
G0J438_CYCMS/2-124------NA---GVVD.KDTL--------------------------LKDFGK..ILI-----------------------
K9ULM0_9CHRO/10-133------II---VSPADYDKV--------------------------AADDYV..FHE-----------------------
R7LCD1_9BACT/2-123------NA---SKIN.KEEL--------------------------AREFSP..MLA-----------------------
Q832M1_ENTFA/2-124------NA---TQNN.NETA--------------------------EKELRD..VLI-----------------------
K9ZFA2_ANACC/9-133------AV---IKPEDYNKV--------------------------DSDDYV..IHE-----------------------
E1VU56_ARTAR/5-123------KL---GPWD.LSQV--------------------------APEIVP..MMV-----------------------
T0U607_9ENTE/7-134------NY---SEKS.PEQL--------------------------NNEYGP..YLF-----------------------
D4JZN1_9FIRM/2-124------NL---IRIK.EKEI--------------------------CKNVQA..LLL-----------------------
L0EIE3_THECK/2-130------NY---TEVS.PREL--------------------------QQQYGA..YLM-----------------------
Q9KB40_BACHD/9-133------KI---IRPEDFDKT--------------------------ESDDYV..LHE-----------------------
S5SXY6_9CORY/2-125------NA---GNMD.PQDV--------------------------VNKLAEDRVLI-----------------------
W0EA01_9FIRM/2-123------NA---SEVN.IGEI--------------------------KTEYDK..IIG-----------------------
F2F2A1_SOLSS/2-123------NA---SELK.AEDV--------------------------QKEMEE..IIT-----------------------
I4APS3_FLELS/9-149------KI---IPPKDYDKV--------------------------ESDDYI..LHE-----------------------
C0ZJB9_BREBN/9-132------IV---VKPADYDKV--------------------------DADDYI..MHE-----------------------
U5L9N0_9BACI/9-133------SV---ISPADYDKV--------------------------DADDYV..MHE-----------------------
A1S3D0_SHEAM/2-123------NA---SEVD.LGKL--------------------------AAELSP..ILG-----------------------
B1HXL6_LYSSC/11-134------VV---VQREDYDKT--------------------------DADDFI..LHE-----------------------
D3FSX3_BACPE/2-123------NA---SEIN.LAEV--------------------------EKELEV..ILI-----------------------
T2KJ86_9FLAO/2-124------NA---SEIS.AEHL--------------------------NEKYGR..LLI-----------------------
K9RH40_9CYAN/2-123------NA---SEVN.PEKL--------------------------ERELAS..LMI-----------------------
Q817P9_BACCR/9-132------SV---ITPKDYDKV--------------------------DADDYV..MHE-----------------------
F8HZL1_WEIKK/2-122------NA---SEVS.IKSV--------------------------RSEIAP..LLI-----------------------
R6N893_9CLOT/4-123------KL---KPVP.NSDF--------------------------EAMVAP..LFV-----------------------
YVBH_BACSU/9-133------KI---IEPQDYDKT--------------------------DADDYV..MHE-----------------------
D5EAI3_METMS/3-122------NA---GVVE.PDKL--------------------------ESDYGQ..FMC-----------------------
R6YXQ3_9FIRM/6-126------NL---KPIN.VEEV--------------------------RKEVDG..LLI-----------------------
R5AEW1_9CLOT/5-123------NL---RPVP.LSEA--------------------------ENALAP..LLL-----------------------
C6WGX3_ACTMD/6-123------KL---APCA.PEDI--------------------------APQVSP..IMV-----------------------
B8I0F4_CLOCE/9-121------VW---TLVS.ECPI--------------------------PDDVID..LMV-----------------------
C7PDL4_CHIPD/2-124------NA---GAVD.QAQL--------------------------VKDYGK..LLT-----------------------
R5A5F0_9CLOT/12-140------NL---SEVS.VESL--------------------------TQEYGM..YLM-----------------------
Q87FW9_VIBPA/22-141------KL---KPID.VSKV--------------------------RDDFHK..FLI-----------------------
K3X6U9_PYTUL/10-126------HV---V..KDVASC--------------------------LAAA....YLL-----------------------
E1SVQ2_FERBD/2-123------NA---TEVN.AAEL--------------------------QDELAP..ILA-----------------------
A3CQI4_STRSV/2-124------NA---SQKD.IEKT--------------------------ERQLED..ILT-----------------------
F5Z9A0_ALTSS/2-121------NA---SETS.AEAV--------------------------NEELSP..ILA-----------------------
W0E2C0_MARPU/2-123------NA---ASRD.AEAV--------------------------GEELAP..ILA-----------------------
L0G2H8_ECHVK/2-124------NA---GVVE.PEKL--------------------------QADFGQ..LLI-----------------------
D2SCW6_GEOOG/4-123------KL---NPAS.PQEL--------------------------GPEVGP..LLV-----------------------
R6KUV2_9BACE/2-121------SL---EPVA.LDDG--------------------------KELFGN..FIL-----------------------
X2GTT7_9BACI/2-123------NA---SEVN.LDKL--------------------------QEEMKE..ILI-----------------------
B1YJX4_EXIS2/9-133------QV---IHPDDFDKA--------------------------AADDYV..LHE-----------------------
M1WLQ6_DESPC/2-123------NA---SEMN.ISDM--------------------------QNDFDP..ILA-----------------------
Q8E0G0_STRA5/2-124------NA---SQMD.TDKV--------------------------ENQLSD..ILI-----------------------
J7IL01_DESMD/2-123------NA---SEVD.AQAI--------------------------EKELEM..ILM-----------------------
F5XZ86_RAMTT/2-123------NA---SKVD.PAKI--------------------------QREFAQ..ILA-----------------------
R5C3D6_9FIRM/4-123------KL---KRTG.KFNN--------------------------EKVIAP..LFV-----------------------
K9Z7I1_CYAAP/9-132------QV---ISPKDYDKV--------------------------ASDDYV..LHE-----------------------
D9SLV7_CLOC7/2-123------NA---SEVN.VQEV--------------------------QKEYAN..VLA-----------------------
H6RCT5_NOCCG/2-123------NA---GRID.PGQA--------------------------QQEYAK..LLG-----------------------
I0GSE3_SELRL/14-136------NA---AKTD.IDEV--------------------------KKDYGK..LLG-----------------------
C6BWQ6_DESAD/2-123------NA---SEID.IDDV--------------------------QEELSP..ILG-----------------------
R6MN06_9BACE/2-123------NV---SEMD.IASL--------------------------QKEFGA..LLC-----------------------
D9QVV1_ACEAZ/2-124------NA---SEMD.MEKL--------------------------EKELAE..ILI-----------------------
I0JI97_HALH3/15-139------KI---INKEDFDKT--------------------------QSDDFV..LTE-----------------------
K9XRV0_STAC7/9-132------KI---ISPTDYDKV--------------------------DADDYL..FHE-----------------------
H3GP35_PHYRM/9-126------NT---A..KDVTKL--------------------------HATS....YLL-----------------------
T0VFI0_9STRE/2-124------NA---SQKN.VDKV--------------------------ERDLED..ILV-----------------------
R6NRS3_9FIRM/5-123------KL---SKGK.DKNI--------------------------PKEVFD..LLI-----------------------
X4ZX53_9BACL/2-123------NA---SQVD.LQTA--------------------------RKEYGQ..ILA-----------------------
A5FNF6_FLAJ1/2-124------NA---GTVS.QEDL--------------------------LKKYGQ..LLT-----------------------
A0LZE1_GRAFK/2-124------NA---GAIE.KDKL--------------------------QEKYGK..LLI-----------------------
E6SGF4_THEM7/2-123------HA---GEAD.LKRV--------------------------QQEYAP..LLT-----------------------

PF03703

A5N1P5_CLOK5/62-141--------------------------------------------------------------------------------
C4XRD2_DESMR/88-163--------------------------------------------------------------------------------
Q2N679_ERYLH/79-158--------------------------------------------------------------------------------
O26822_METTH/90-166--------------------------------------------------------------------------------
A5N1P4_CLOK5/81-157--------------------------------------------------------------------------------
Q8YRN0_NOSS1/39-113--------------------------------------------------------------------------------
A8LQ34_DINSH/96-187--------------------------------------------------------------------------------
C5C9H6_MICLC/78-153--------------------------------------------------------------------------------
Q8CJW8_STRCO/479-556--------------------------------------------------------------------------------
Q8S7W8_ORYSJ/97-171--------------------------------------------------------------------------------
YDBT_BACSU/406-486--------------------------------------------------------------------------------
A0JUF8_ARTS2/86-161--------------------------------------------------------------------------------
Q0S416_RHOSR/85-163--------------------------------------------------------------------------------
Q5KZA4_GEOKA/394-472--------------------------------------------------------------------------------
A4X9A7_SALTO/98-177--------------------------------------------------------------------------------
A1S9Q9_SHEAM/70-149--------------------------------------------------------------------------------
Q5V3H6_HALMA/457-539--------------------------------------------------------------------------------
A4X9A6_SALTO/93-171--------------------------------------------------------------------------------
Q0RP62_FRAAA/86-163--------------------------------------------------------------------------------
A0JR89_ARTS2/421-499--------------------------------------------------------------------------------
A0QQT0_MYCS2/68-149--------------------------------------------------------------------------------
B8LD31_THAPS/35-108--------------------------------------------------------------------------------
A0M124_GRAFK/406-482--------------------------------------------------------------------------------
Q6NJ02_CORDI/358-436--------------------------------------------------------------------------------
Q03UQ0_LEUMM/60-139--------------------------------------------------------------------------------
A8I741_CHLRE/23-98--------------------------------------------------------------------------------
Q0A9I7_ALKEH/434-510--------------------------------------------------------------------------------
Q2S4T2_SALRD/280-363--------------------------------------------------------------------------------
B2J0Q4_NOSP7/39-113--------------------------------------------------------------------------------
Q1AYV8_RUBXD/67-148--------------------------------------------------------------------------------
Q949S6_ARATH/104-178--------------------------------------------------------------------------------
Q10VQ2_TRIEI/39-113--------------------------------------------------------------------------------
Q03T95_LACBA/71-147--------------------------------------------------------------------------------
A5USV1_ROSS1/73-149--------------------------------------------------------------------------------
Q0A9I7_ALKEH/77-156--------------------------------------------------------------------------------
A1WXI2_HALHL/93-184--------------------------------------------------------------------------------
B7KHE2_CYAP7/39-113--------------------------------------------------------------------------------
A5UZJ9_ROSS1/78-155--------------------------------------------------------------------------------
Q3IJZ4_PSEHT/76-156--------------------------------------------------------------------------------
A1SMF8_NOCSJ/73-149--------------------------------------------------------------------------------
Q7U523_SYNPX/40-114--------------------------------------------------------------------------------
Q16DS6_ROSDO/94-185--------------------------------------------------------------------------------
A4X385_SALTO/78-154--------------------------------------------------------------------------------
Q7VB01_PROMA/40-114--------------------------------------------------------------------------------
Q6A731_PROAC/79-153--------------------------------------------------------------------------------
Q3IQW3_NATPD/58-137--------------------------------------------------------------------------------
Q2JF56_FRASC/78-154--------------------------------------------------------------------------------
F2G2I3_ALTMD/454-530--------------------------------------------------------------------------------
Q7V0R9_PROMP/40-114--------------------------------------------------------------------------------
Q2NEQ5_METST/106-182--------------------------------------------------------------------------------
B1YH17_EXIS2/61-141--------------------------------------------------------------------------------
Q5QU90_IDILO/71-150--------------------------------------------------------------------------------
Q086M2_SHEFN/453-529--------------------------------------------------------------------------------
Q8XM54_CLOPE/456-535--------------------------------------------------------------------------------
Q0W0T7_UNCMA/387-467--------------------------------------------------------------------------------
Q3JEQ1_NITOC/43-119--------------------------------------------------------------------------------
Q2JNH7_SYNJB/39-113--------------------------------------------------------------------------------
Q21G74_SACD2/81-160--------------------------------------------------------------------------------
Q8XK94_CLOPE/57-138--------------------------------------------------------------------------------
C1N978_MICPC/163-238--------------------------------------------------------------------------------
Q9KC53_BACHD/397-477--------------------------------------------------------------------------------
A0M123_GRAFK/89-168--------------------------------------------------------------------------------
Q5NX64_AROAE/73-152--------------------------------------------------------------------------------
Q8ELM2_OCEIH/63-143--------------------------------------------------------------------------------
Q6NJ02_CORDI/83-162--------------------------------------------------------------------------------
B7K5U4_CYAP8/39-113--------------------------------------------------------------------------------
Q0S417_RHOSR/271-354--------------------------------------------------------------------------------
Q7UGR8_RHOBA/447-530--------------------------------------------------------------------------------
Q8ELM2_OCEIH/411-490--------------------------------------------------------------------------------
Q1LGU6_RALME/27-104--------------------------------------------------------------------------------
A0PYF4_CLONN/263-346--------------------------------------------------------------------------------
Q0BW05_GRABC/100-175--------------------------------------------------------------------------------
Q7UG90_RHOBA/131-208--------------------------------------------------------------------------------
Q46JN3_PROMT/41-115--------------------------------------------------------------------------------
Q219Q4_RHOPB/92-183--------------------------------------------------------------------------------
C1E7H3_MICSR/155-230--------------------------------------------------------------------------------
Q5WBQ3_BACSK/413-492--------------------------------------------------------------------------------
A8LDS5_FRASN/354-432--------------------------------------------------------------------------------
A5GN11_SYNPW/41-115--------------------------------------------------------------------------------
B4U7M5_HYDS0/110-189--------------------------------------------------------------------------------
Q21G75_SACD2/67-146--------------------------------------------------------------------------------
A6L372_BACV8/68-142--------------------------------------------------------------------------------
B0CDM0_ACAM1/39-113--------------------------------------------------------------------------------
Q18HZ1_HALWD/71-148--------------------------------------------------------------------------------
Q18K27_HALWD/63-142--------------------------------------------------------------------------------
Q9KC53_BACHD/249-335--------------------------------------------------------------------------------
B8HR49_CYAP4/39-113--------------------------------------------------------------------------------
Q2S103_SALRD/46-123--------------------------------------------------------------------------------
Q31MS3_SYNE7/39-113--------------------------------------------------------------------------------
A3CWW6_METMJ/72-152--------------------------------------------------------------------------------
B1XJD3_SYNP2/39-113--------------------------------------------------------------------------------
A5N1P5_CLOK5/245-328--------------------------------------------------------------------------------
B1YH17_EXIS2/235-317--------------------------------------------------------------------------------
A0PYF4_CLONN/58-140--------------------------------------------------------------------------------
A1A2T3_BIFAA/23-98--------------------------------------------------------------------------------
B0RHX1_CLAMS/125-200--------------------------------------------------------------------------------
D5ANR9_RHOCB/96-186--------------------------------------------------------------------------------
I0HUK5_RUBGI/104-193--------------------------------------------------------------------------------
P96883_MYCTU/82-156--------------------------------------------------------------------------------
Q2FWI3_STAA8/69-143--------------------------------------------------------------------------------
Q2FWI4_STAA8/74-150--------------------------------------------------------------------------------
Q81U26_BACAN/238-321--------------------------------------------------------------------------------
Q81U26_BACAN/388-464--------------------------------------------------------------------------------
Q81U26_BACAN/60-138--------------------------------------------------------------------------------
Q83AL8_COXBU/89-163--------------------------------------------------------------------------------
Q8P4G6_XANCP/409-488--------------------------------------------------------------------------------
Q8P4G6_XANCP/70-149--------------------------------------------------------------------------------
Q8XK93_CLOPE/75-147--------------------------------------------------------------------------------
Q8Y8L4_LISMO/403-484--------------------------------------------------------------------------------
Q8Y8L4_LISMO/69-145--------------------------------------------------------------------------------
Q8Y8L5_LISMO/74-149--------------------------------------------------------------------------------
R5K541_9CLOT/18-95--------------------------------------------------------------------------------
R5UDD0_9FIRM/68-144--------------------------------------------------------------------------------
R7DAN2_9FIRM/16-93--------------------------------------------------------------------------------
U5L491_9BACI/392-472--------------------------------------------------------------------------------
U5L4Z8_9BACI/64-143--------------------------------------------------------------------------------

PF08512

M2PB53_CERS8/317-439--------------------------------------------------------------------------------
J9EJK7_WUCBA/478-566--------------------------------------------------------------------------------
U4LMA7_PYROM/238-328--------------------------------------------------------------------------------
B7Q220_IXOSC/339-427--------------------------------------------------------------------------------
F8QGE7_SERL3/271-369--------------------------------------------------------------------------------
B2AEJ4_PODAN/272-366--------------------------------------------------------------------------------
G3AM99_SPAPN/370-458--------------------------------------------------------------------------------
I1S1B4_GIBZE/227-319--------------------------------------------------------------------------------
W4XCL4_STRPU/232-319--------------------------------------------------------------------------------
I2FTX9_USTH4/817-905--------------------------------------------------------------------------------
Q5CXQ9_CRYPI/353-442--------------------------------------------------------------------------------
A8Q169_MALGO/421-512--------------------------------------------------------------------------------
M3HEX8_CANMX/253-350--------------------------------------------------------------------------------
G0S3H8_CHATD/273-370--------------------------------------------------------------------------------
K2QLS5_MACPH/277-370--------------------------------------------------------------------------------
T1IR25_STRMM/196-284--------------------------------------------------------------------------------
M3CY11_SPHMS/241-333--------------------------------------------------------------------------------
POB3_YARLI/386-477--------------------------------------------------------------------------------
M5BPS6_THACB/51-142--------------------------------------------------------------------------------
SPT16_CRYNJ/824-912--------------------------------------------------------------------------------
B3S4B9_TRIAD/341-430--------------------------------------------------------------------------------
A3LUQ9_PICST/284-379--------------------------------------------------------------------------------
K0KFZ5_WICCF/213-299--------------------------------------------------------------------------------
U9TN70_RHIID/375-469--------------------------------------------------------------------------------
F0YFE5_AURAN/365-463--------------------------------------------------------------------------------
E9EZP1_METAR/244-336--------------------------------------------------------------------------------
A4S5S2_OSTLU/804-891--------------------------------------------------------------------------------
G0SHK5_CHATD/370-462--------------------------------------------------------------------------------
K3ZC23_SETIT/339-430--------------------------------------------------------------------------------
A8B8A9_GIAIC/458-554--------------------------------------------------------------------------------
C4XWH5_CLAL4/283-380--------------------------------------------------------------------------------
F6VQ10_CIOIN/343-431--------------------------------------------------------------------------------
A0A023BCN2_GRENI/362-449--------------------------------------------------------------------------------
F4NZP4_BATDJ/343-435--------------------------------------------------------------------------------
A7EHR1_SCLS1/824-912--------------------------------------------------------------------------------
G1XGQ0_ARTOA/385-476--------------------------------------------------------------------------------
A1CDL9_ASPCL/396-488--------------------------------------------------------------------------------
M7XL72_TRIUA/36-124--------------------------------------------------------------------------------
U1GBI2_ENDPU/599-691--------------------------------------------------------------------------------
F4P0B1_BATDJ/806-894--------------------------------------------------------------------------------
M0USZ2_HORVD/62-155--------------------------------------------------------------------------------
D8TSG5_VOLCA/121-241--------------------------------------------------------------------------------
Q23D83_TETTS/262-350--------------------------------------------------------------------------------
G4MV07_MAGO7/823-911--------------------------------------------------------------------------------
T1JNC3_STRMM/337-425--------------------------------------------------------------------------------
D8R056_SELML/347-441--------------------------------------------------------------------------------
I4Y5W1_WALSC/369-460--------------------------------------------------------------------------------
H8ZDZ4_NEMS1/348-435--------------------------------------------------------------------------------
D2VNX5_NAEGR/729-815--------------------------------------------------------------------------------
H3DXW3_PRIPA/172-260--------------------------------------------------------------------------------
C4M6A1_ENTHI/240-330--------------------------------------------------------------------------------
U4LLV9_PYROM/363-455--------------------------------------------------------------------------------
C1EF78_MICSR/358-450--------------------------------------------------------------------------------
H2WAP1_CAEJA/809-897--------------------------------------------------------------------------------
B9IJT6_POPTR/348-439--------------------------------------------------------------------------------
G2X0I7_VERDV/257-350--------------------------------------------------------------------------------
RT106_PHANO/257-343--------------------------------------------------------------------------------
D3AXH6_POLPA/369-464--------------------------------------------------------------------------------
I1C1F7_RHIO9/365-456--------------------------------------------------------------------------------
RT106_PICGU/254-353--------------------------------------------------------------------------------
Q8SW60_ENCCU/652-747--------------------------------------------------------------------------------
A0D1L5_PARTE/273-361--------------------------------------------------------------------------------
G1XQ07_ARTOA/228-318--------------------------------------------------------------------------------
I4YG87_WALSC/824-912--------------------------------------------------------------------------------
C5KH74_PERM5/340-432--------------------------------------------------------------------------------
C1GLV0_PARBD/277-370--------------------------------------------------------------------------------
S9W629_SCHCR/354-445--------------------------------------------------------------------------------
Q8SRJ1_ENCCU/305-392--------------------------------------------------------------------------------
A7AMU7_BABBO/347-436--------------------------------------------------------------------------------
S3CR05_OPHP1/288-382--------------------------------------------------------------------------------
RT106_MAGO7/272-364--------------------------------------------------------------------------------
MU183_SCHPO/225-311--------------------------------------------------------------------------------
POB3_CRYNJ/370-462--------------------------------------------------------------------------------
R7YLM5_CONA1/253-345--------------------------------------------------------------------------------
R7YNS5_CONA1/352-444--------------------------------------------------------------------------------
C4QVU8_PICPG/363-452--------------------------------------------------------------------------------
S7ZBK4_PENO1/258-352--------------------------------------------------------------------------------
U5D0Q6_AMBTC/338-426--------------------------------------------------------------------------------
C5DLM5_LACTC/833-920--------------------------------------------------------------------------------
D7LYR7_ARALL/291-379--------------------------------------------------------------------------------
B6KBU5_TOXGO/365-455--------------------------------------------------------------------------------
D8UAM0_VOLCA/836-924--------------------------------------------------------------------------------
G7E0B9_MIXOS/402-493--------------------------------------------------------------------------------
M2MKJ1_BAUCO/237-329--------------------------------------------------------------------------------
U6HVB5_ECHMU/338-426--------------------------------------------------------------------------------
U4KWY1_PYROM/815-903--------------------------------------------------------------------------------
G5C2X8_HETGA/338-426--------------------------------------------------------------------------------
G0QWE9_ICHMG/261-347--------------------------------------------------------------------------------
H2WQH8_CAEJA/332-422--------------------------------------------------------------------------------
G2YRR9_BOTF4/376-468--------------------------------------------------------------------------------
J9ES64_WUCBA/340-428--------------------------------------------------------------------------------
G4UXS1_NEUT9/267-362--------------------------------------------------------------------------------
E4WR67_OIKDI/342-430--------------------------------------------------------------------------------
B6Q860_PENMQ/278-370--------------------------------------------------------------------------------
M7XH21_RHOT1/396-490--------------------------------------------------------------------------------
C5M9F0_CANTT/251-348--------------------------------------------------------------------------------
POB3_CANAL/362-454--------------------------------------------------------------------------------
S3DEK3_GLAL2/253-351--------------------------------------------------------------------------------
D7FLF8_ECTSI/342-440--------------------------------------------------------------------------------
H6BU47_EXODN/281-384--------------------------------------------------------------------------------
W1QJM3_OGAPD/194-281--------------------------------------------------------------------------------
S2JNH8_MUCC1/207-310--------------------------------------------------------------------------------
M4C0J9_HYAAE/276-361--------------------------------------------------------------------------------
R8B8V8_TOGMI/236-332--------------------------------------------------------------------------------
SPT16_CANGA/831-917--------------------------------------------------------------------------------
K0SUI2_THAOC/380-478--------------------------------------------------------------------------------
A7SV15_NEMVE/818-906--------------------------------------------------------------------------------
D5G911_TUBMM/235-325--------------------------------------------------------------------------------
H3GY61_PHYRM/341-438--------------------------------------------------------------------------------
G4M1N4_SCHMA/483-570--------------------------------------------------------------------------------
Q4N358_THEPA/330-419--------------------------------------------------------------------------------
G7YR77_CLOSI/356-444--------------------------------------------------------------------------------
U5H1N8_USTV1/395-488--------------------------------------------------------------------------------
K0KEJ9_WICCF/814-902--------------------------------------------------------------------------------
RT106_YARLI/219-307--------------------------------------------------------------------------------
E2LU78_MONPE/66-162--------------------------------------------------------------------------------
C4V834_NOSCE/641-727--------------------------------------------------------------------------------
G4TE41_PIRID/824-912--------------------------------------------------------------------------------
J4G3V7_FIBRA/295-403--------------------------------------------------------------------------------
F4R467_MELLP/387-476--------------------------------------------------------------------------------
SSP1B_CAEEL/339-429--------------------------------------------------------------------------------
R4XGU7_TAPDE/241-328--------------------------------------------------------------------------------
F0YK20_AURAN/256-343--------------------------------------------------------------------------------
SPT16_YARLI/813-901--------------------------------------------------------------------------------
S9W122_SCHCR/226-312--------------------------------------------------------------------------------
A7SAG6_NEMVE/330-421--------------------------------------------------------------------------------
T1G514_HELRO/319-407--------------------------------------------------------------------------------
F0ZPA4_DICPU/817-905--------------------------------------------------------------------------------
Q00W77_OSTTA/323-415--------------------------------------------------------------------------------
E5RZ09_TRISP/386-474--------------------------------------------------------------------------------
RT106_KLULA/207-293--------------------------------------------------------------------------------
I1BRC4_RHIO9/40-140--------------------------------------------------------------------------------
C4R4T9_PICPG/193-281--------------------------------------------------------------------------------
A9TBJ4_PHYPA/345-439--------------------------------------------------------------------------------
C0SCH6_PARBP/816-904--------------------------------------------------------------------------------
RT106_DEBHA/280-379--------------------------------------------------------------------------------
K3XFH7_SETIT/348-441--------------------------------------------------------------------------------
C1N716_MICPC/353-449--------------------------------------------------------------------------------
C3YLD4_BRAFL/810-898--------------------------------------------------------------------------------
G0RE12_HYPJQ/823-911--------------------------------------------------------------------------------
S7W7Y4_SPRLO/326-413--------------------------------------------------------------------------------
M7NLM5_PNEMU/802-890--------------------------------------------------------------------------------
Q7RAF9_PLAYO/58-147--------------------------------------------------------------------------------
K7LQJ8_SOYBN/78-174--------------------------------------------------------------------------------
G0MG00_CAEBE/339-429--------------------------------------------------------------------------------
K7MPW8_SOYBN/832-920--------------------------------------------------------------------------------
F8Q6D3_SERL3/668-755--------------------------------------------------------------------------------
B3RJ01_TRIAD/797-885--------------------------------------------------------------------------------
E6ZPS6_SPORE/387-477--------------------------------------------------------------------------------
F6QIX3_CIOIN/814-901--------------------------------------------------------------------------------
C4JJX0_UNCRE/249-342--------------------------------------------------------------------------------
F2U7M9_SALR5/353-444--------------------------------------------------------------------------------
T1K8N9_TETUR/813-901--------------------------------------------------------------------------------
R0KPL4_NOSB1/654-741--------------------------------------------------------------------------------
H2LEM6_ORYLA/340-427--------------------------------------------------------------------------------
E0VB75_PEDHC/777-865--------------------------------------------------------------------------------
G4T8M8_PIRID/353-442--------------------------------------------------------------------------------
J9K6K5_ACYPI/340-427--------------------------------------------------------------------------------
B6AFM0_CRYMR/870-961--------------------------------------------------------------------------------
D8PY95_SCHCM/357-447--------------------------------------------------------------------------------
A7EF87_SCLS1/223-318--------------------------------------------------------------------------------
B4I8T2_DROSE/339-427--------------------------------------------------------------------------------
W5HH08_WHEAT/119-204--------------------------------------------------------------------------------
RT106_LODEL/274-371--------------------------------------------------------------------------------
N1JFF3_BLUG1/384-475--------------------------------------------------------------------------------
W1QIX8_OGAPD/362-454--------------------------------------------------------------------------------
E4XS19_OIKDI/720-808--------------------------------------------------------------------------------
G1XMG7_ARTOA/821-909--------------------------------------------------------------------------------
K5WQC7_PHACS/300-419--------------------------------------------------------------------------------
G8ZLC5_TORDC/211-298--------------------------------------------------------------------------------
A0DSI1_PARTE/256-344--------------------------------------------------------------------------------
G6DL15_DANPL/339-428--------------------------------------------------------------------------------
J9DUA9_EDHAE/329-416--------------------------------------------------------------------------------
H8ZCJ1_NEMS1/752-840--------------------------------------------------------------------------------
C4VA45_NOSCE/302-389--------------------------------------------------------------------------------
M2LTM4_BAUCO/820-908--------------------------------------------------------------------------------
I2H6I5_TETBL/240-326--------------------------------------------------------------------------------
K1W653_MARBU/265-359--------------------------------------------------------------------------------
C4XW15_CLAL4/364-456--------------------------------------------------------------------------------
D8U9V6_VOLCA/358-450--------------------------------------------------------------------------------
F4PX70_DICFS/357-452--------------------------------------------------------------------------------
F6YII2_HORSE/339-427--------------------------------------------------------------------------------
G3JRH7_CORMM/242-333--------------------------------------------------------------------------------
D4AZE5_ARTBC/280-373--------------------------------------------------------------------------------
N1Q7D7_MYCFI/373-464--------------------------------------------------------------------------------
K1VJD1_TRIAC/749-837--------------------------------------------------------------------------------
D3AWW1_POLPA/842-929--------------------------------------------------------------------------------
C4M3K5_ENTHI/531-618--------------------------------------------------------------------------------
G3AUH1_SPAPN/79-169--------------------------------------------------------------------------------
K1Q5H6_CRAGI/340-428--------------------------------------------------------------------------------
M7WKG7_RHOT1/810-898--------------------------------------------------------------------------------
J3PG65_GAGT3/329-421--------------------------------------------------------------------------------
A8NIX9_COPC7/282-390--------------------------------------------------------------------------------
Q4N2N7_THEPA/649-736--------------------------------------------------------------------------------
R4X8W5_TAPDE/804-892--------------------------------------------------------------------------------
C3Z3Y2_BRAFL/338-426--------------------------------------------------------------------------------
A5DBS4_PICGU/384-475--------------------------------------------------------------------------------
B6K3E4_SCHJY/355-446--------------------------------------------------------------------------------
R1H0T9_BOTPV/402-493--------------------------------------------------------------------------------
L8G5Y3_PSED2/260-359--------------------------------------------------------------------------------
G8B5L6_CANPC/284-380--------------------------------------------------------------------------------
RT106_CHAGB/266-364--------------------------------------------------------------------------------
Q4X6Q9_PLACH/235-323--------------------------------------------------------------------------------
C1FEI5_MICSR/824-912--------------------------------------------------------------------------------
X6P659_RETFI/913-1000--------------------------------------------------------------------------------
F8PZZ9_SERL3/358-451--------------------------------------------------------------------------------
D2VV01_NAEGR/362-448--------------------------------------------------------------------------------
G3AWR9_CANTC/371-463--------------------------------------------------------------------------------
RT106_CANAL/245-342--------------------------------------------------------------------------------
POB3_DEBHA/367-460--------------------------------------------------------------------------------
SSRP1_DICDI/379-471--------------------------------------------------------------------------------
D8T4U2_SELML/827-915--------------------------------------------------------------------------------
J3QDH9_PUCT1/325-416--------------------------------------------------------------------------------
W4Z4J5_STRPU/382-470--------------------------------------------------------------------------------
F0V8K2_NEOCL/589-676--------------------------------------------------------------------------------
I1G5P6_AMPQE/808-896--------------------------------------------------------------------------------
B8PLP6_POSPM/283-392--------------------------------------------------------------------------------
K1WT88_MARBU/394-486--------------------------------------------------------------------------------
L0PAF9_PNEJ8/359-450--------------------------------------------------------------------------------
G7DYH1_MIXOS/812-900--------------------------------------------------------------------------------
I1FYM9_AMPQE/334-423--------------------------------------------------------------------------------
M5BW64_THACB/829-916--------------------------------------------------------------------------------
A7ATG3_BABBO/683-768--------------------------------------------------------------------------------
G8Y6R1_PICSO/369-461--------------------------------------------------------------------------------
V5FX85_BYSSN/253-347--------------------------------------------------------------------------------
G8YKW7_PICSO/280-378--------------------------------------------------------------------------------
D8Q1K6_SCHCM/265-361--------------------------------------------------------------------------------
F4RFN8_MELLP/841-929--------------------------------------------------------------------------------
F2UEG8_SALR5/777-865--------------------------------------------------------------------------------
S9W752_SCHCR/814-902--------------------------------------------------------------------------------
K0K6V3_WICCF/357-449--------------------------------------------------------------------------------
E7NL90_YEASO/383-474--------------------------------------------------------------------------------
R0JJB1_SETT2/378-470--------------------------------------------------------------------------------
B0D777_LACBS/275-372--------------------------------------------------------------------------------
D7FPY1_ECTSI/813-906--------------------------------------------------------------------------------

PF07289

Q7PUL7_ANOGA/6-340TIRSG.EV-VLDVLDSVEDT--------------------------KGNSGDCGRILVTNLRLIWYSVTSHRFSLSVGFS
A9V1S9_MONBE/13-345ALTRG.EF-VIDHLDQVEDT--------------------------KGNNGISGTLTVTNLRLIWTNKKRSNINLSIGLR
T1EEF4_HELRO/6-339NLVRG.EK-VILELNAVEDS--------------------------KGNTGVLGSAILSNLRFIWHSQKFPKVNISLGHN
G6DR32_DANPL/9-341KLRTG.EK-VFDRIEPIEDT--------------------------KGNSGMKGRLVVTNLRIIWHSLTSPRINLTVGLN
E9HBN7_DAPPU/3-333ATVTG.ES-VLERVEPVEDT--------------------------KANSGEAGCLIMTNLRLLWFSNKTAKLNLTIGYN
D2VIC7_NAEGR/11-348SLKKG.EF-EIDVLDNVEDT--------------------------KGNNGEKGKCIVTNLRMIWICTRNPKINLSIGYN
K3X3B3_PYTUL/11-342ELRKG.EV-LIDSINSVEDT--------------------------KGNNGERGSLEITNLRLLWASHKSVRTNLSIGYI
E0W305_PEDHC/24-358KLRTA.EK-LIDKLDSVEDT--------------------------KGNGGDKGRLIVTNLRILWHSLSSPRVSLSIGLN
D6W797_TRICA/4-335RLKTG.EK-IIDRLENIEDT--------------------------KGNGGDRGRLIVTNIRVLWHSVTSPRVNLSIGFN
A4H6Y1_LEIBR/25-408KLRENTEH-IYAAFNHVEDK--------------------------KGNEGHSGTLLVTNLRLIWSSARRQAVNISIGYY
Q231T4_TETTS/5-348SPCSG.EF-EMSSQNYIEDF--------------------------KGNADCDGVLVLTNLRLIWYQNDDKRINLSIGLD
Q17LJ5_AEDAE/6-339TIRSG.EQ-PLEILDSIEDT--------------------------KGNLGDRGRLLVTNLRIIWYSVTSNRFSLSIGFS
Q4GYG4_TRYB2/18-367QTSRG.ER-ILMRLSPVEDT--------------------------KGNSGKEGVLYVTNLRFMWHSSHRVRNNLSVGYY
C1EG27_MICSR/13-344NLRKG.EF-EIDHLQGVEDT--------------------------KGNTGDKGELVVTNLRTIWVSSKRRNINLSIGYG
E5RYK1_TRISP/644-958KLRNG.EF-IVDKSHGIEDT--------------------------KGNRGQK......................AIGFN
E4WWD2_OIKDI/3-335KERPG.EE-FLAIFNPVEDT--------------------------KGNNGMRGILKISNLRVVWITPRTNSLNLSIGLK
A8WJB5_CAEBR/9-360RMING.EV-QIAKVENVEDT--------------------------KGNNGDKGVIRVTNLRLIWYAMSMPRINITIGWN
F6T0X5_CIOIN/4-344NMRPG.EF-VIQTFNSVEDT--------------------------KGNNGDNGKLLVTNLRIMWHSHTLPRVNLSIGFG
Q4QGM5_LEIMA/25-428KLRENTEH-VYATFDNVEDT--------------------------KGNNGCPGTLLVTNLRLIWRCKQRPNVNLSIGYY
B4QVM9_DROSI/19-372NLRSG.ER-VLDYIYHIEDS--------------------------KGNPGDTGRLMVTNLRIIWHSLVHKKYNLSIGYA
A8HWI3_CHLRE/14-351NLRQG.EE-LITLMDSVEDT--------------------------KGNNGDLGELRVSNLRLCWVNKKNRRTNICIGHN
Q21626_CAEEL/9-357RLING.EI-QVAKIEHVEDT--------------------------KGNNGDRGTMRVTNLRLIWHAASMPRINITIGWN
Q4E5P7_TRYCC/18-371QTARG.EV-LLSKLSPVEDT--------------------------KGNNGEEGVLYVTNLRCIWQSKVNPHKNLSVGYY
A2FLN7_TRIVA/11-341KAIPG.ES-NVAVLSRVEDM--------------------------KAHPGQFGQGHVTNIRFIWYIQNTPTINASIGYN
J9K6V4_ACYPI/6-342KMRNG.EK-IIDRLEFIEDT--------------------------KGNSGDKGVLVITNLRAIWHSMTIARISLSIGYN
D8TIQ4_VOLCA/9-343NPRQG.EE-VLSVLESVEDT--------------------------KGNNGDLGELVITTLRLMWISKKNRRTNISVGHS
B3RQQ8_TRIAD/9-342RMRPG.EM-LIDRLDSIEDT--------------------------KGNNGERGRLLITNLRILWHSQAMPRVNLSVGYN
T1JH94_STRMM/18-350KLRLG.EK-LLDTIDSVEDT--------------------------KGNSGDRGKLLVTNLRLMWHSHSMSRVNLSIGWN
W4Z3R7_STRPU/9-342NMRPG.ES-IIDKLDSIEDT--------------------------KGNNGDRGRLLVTNLRVIWHSTSLPRVNLSVGLN
E1GAE4_LOALO/12-348HLIAG.EN-LVDRIDDVEDT--------------------------KGNCGDKGVLRITNLRLTWHAIAIPRINLSLGYN
E3LZ78_CAERE/12-378RMAKG.EF-AVAKVEHVEDT--------------------------KGNNGDKGIMKVTNLRLIWYAMNMPRINISIGWN
K7J1K7_NASVI/1-331EMRLG.EH-LIDKLEMVEDT--------------------------KGNAGDRGRLLITNLRLMWHSISYPRINLSIGFN
I1FWY5_AMPQE/11-351APRPG.ET-VISKFEAVEDT--------------------------KGNNGASGKLTVTNLRIIWRSTAKPSVNLSIGLM
Q3SCX0_PARTE/5-323NMQKG.EK-TLFLWKDVEDI--------------------------KGNPDQLGSLVISNTRILWWSERNNSVNLSIGLG
H9KJ67_APIME/1-328QLRLG.EF-NVDKLDLIEDT--------------------------KGNAGDNGRLIVTNLRIIWHSLLLPKINLSIGYN
B7PHC5_IXOSC/11-344DARR..YI-LRAHTNEVMTV--------------------------LSLHTCTGTLYVTNLRIIWQSNARSRVNLSVGFN
F0YFS0_AURAN/24-363QNRKG.EA-VIDSINSVEDT--------------------------KGNNGERGSLVVTNLRIMWISHKNSRTNLSIGFN
BBS5_DANRE/8-340KTRPG.EA-LIDCLDSIEDT--------------------------KGNNGDRGRLLVTNLRIIWHSLALPRVNLSVGYN
C1MWZ6_MICPC/13-351ALRKG.EF-EIDHLEGVEDT--------------------------KGNNGERGTLVVTNLRVIWFSKRSRRTNLSIGYN
F4WAX0_ACREC/1-331QLRPG.EL-TVDKLDMIEDT--------------------------KGNAGDLGRLIVTNLRIIWHSLSLPRINLSIGYN
F2TYE0_SALR5/18-356QPGPG.EV-IIDSLSNVEDT--------------------------QGNNGVRGKLVVTNLRIMWHAIKKPSVNLSIGLF
H9JGR5_BOMMO/9-342KLRPG.EK-IFDRIEPIEDT--------------------------KGNSGVKGRMVVTSLRIIWHSLASPRINMSIGLN
A7RY88_NEMVE/5-337QLRAG.EV-MIDKLDSVEDT--------------------------KGNNGDRGRLLVTNLRLIWHSQSMPRVNLSVGFS
D7G173_ECTSI/10-344QCRKG.EV-VIDSINSVEDT--------------------------KGNNGERGSLVVTNLRVLWISHKISRVNLSIGFS

PF03531

K0K6V3_WICCF/79-302F....NIQ.LDHREHSLRGW--------------------------NWGNTD----------------------------
N1JFF3_BLUG1/79-328Y....STN.LQHKEHALCGW--------------------------NWGKGE----------------------------
G4LWM1_SCHMA/74-282F....DVE.IVKRELCYKGY--------------------------NWGDVD----------------------------
F7E2T1_XENTR/75-284F....RVE.LVEKDLCVKGW--------------------------NWGSVR----------------------------
A4SAX2_OSTLU/79-298L....GCA.SGETKMNVNGR--------------------------NWGDVA----------------------------
F4NZP4_BATDJ/55-287Y....NVP.LEVVDTSLRGY--------------------------NWGEPN----------------------------
C5DFM8_LACTC/79-313F....NVQ.VEQREHSMRGW--------------------------NWGKAD----------------------------
POB3_CANAL/76-307F....HIN.LEHREHSLRGW--------------------------NWGKTD----------------------------
C4JJP8_UNCRE/82-330Y....GVN.LENREHALRGW--------------------------NWGKAD----------------------------
U6GM68_EIMAC/87-293F....KLN.LHSKNIAHLGW--------------------------HWGDVS----------------------------
D3AXH6_POLPA/88-307Y....KIE.LAVKELSTKGS--------------------------NFGIAK----------------------------
D7FLF8_ECTSI/69-286.....DVS.LSNESPNPGGG--------------------------NYGDIE----------------------------
H6C9W7_EXODN/70-320Y....GIN.LEHKEHALRGW--------------------------NWGKAE----------------------------
POB3_SCHPO/74-299F....DMG.IEQKEFSIKGW--------------------------NWGEAN----------------------------
E6ZPS6_SPORE/85-331F....NKS.LETKEVSTRGW--------------------------NWGQAK----------------------------
C5FT09_ARTOC/124-375Y....GVN.LTNREHALRGW--------------------------NWGKAE----------------------------
E5RZ09_TRISP/126-331W....NME.LKNIEPCITGT--------------------------NQATAN----------------------------
W1P7A3_AMBTC/75-294L....GIT.PQEKQLSVSGR--------------------------NFGEIE----------------------------
G1XGQ0_ARTOA/75-329Y....NAV.LENREHSLKGW--------------------------NWGKAE----------------------------
U6IC17_HYMMI/74-283F....NMD.VEKREISYKGF--------------------------NWGDVV----------------------------
U1G4R9_ENDPU/75-327Y....GVN.LENREHALRGW--------------------------NWGKAE----------------------------
G9NKX3_HYPAI/73-321Y....STA.LESKEHALRGW--------------------------NWGKAE----------------------------
U9TN70_RHIID/75-319Y....KLQ.LETKDLSVRGW--------------------------NWGKTE----------------------------
B7Q220_IXOSC/74-284F....EMP.LGTRDLCLKGW--------------------------NWGTAR----------------------------
A7SAG6_NEMVE/68-275F....GVK.LEEMELSVKGW--------------------------NWGTAT----------------------------
A8NQK0_COPC7/71-298F....GIT.LETQEVSFRGW--------------------------NWGVAD----------------------------
T1JNC3_STRMM/74-282Y....ELQ.LREKDFSVRGW--------------------------NWGTAK----------------------------
Q5CIB9_CRYHO/71-289Y....GIN.LETKELNTKGI--------------------------NWGDLT----------------------------
L8FYL1_PSED2/70-318Y....STN.LETKEHALRGW--------------------------NWGKAE----------------------------
B6ACD0_CRYMR/80-297Y....NII.IKEFSVNTQGS--------------------------NWGNAI----------------------------
C3Z3Y2_BRAFL/73-283Y....KMR.LEEKELSVKGW--------------------------NWGTAK----------------------------
R9AAY5_WALI9/70-309Y....GVS.IETREISFKGW--------------------------NWGKTE----------------------------
R1H0T9_BOTPV/95-344Y....TIN.LESKEHALRGY--------------------------NWGKAE----------------------------
D8PY95_SCHCM/72-303F....SVA.IETKEITFKGW--------------------------NWGDTD----------------------------
F4PX70_DICFS/82-302Y....DIE.LDNIELSTRGV--------------------------NFSMVK----------------------------
A5DBS4_PICGU/104-330F....SLN.LEHREHSLRGW--------------------------NWGKSD----------------------------
S2JG34_MUCC1/74-308Y....KLP.VEVKEVSVKGW--------------------------NWGKTE----------------------------
F8PZZ9_SERL3/71-305F....GVT.LEVRDVSFKGW--------------------------NWGVTD----------------------------
G3AM99_SPAPN/80-315F....SVT.LEHKEHSLRGW--------------------------NWGKTD----------------------------
W1QIX8_OGAPD/77-307F....SVQ.LEVREHSLRGW--------------------------NWGKTQ----------------------------
G8Y6R1_PICSO/79-314F....HLT.LEHKEHSLRGW--------------------------NWGKTD----------------------------
Q0IEB2_AEDAE/74-282Y....KLD.MLEKELSMRGW--------------------------NWGTVH----------------------------
J7RZK8_KAZNA/80-313F....NIQ.LEHKEHSLRGW--------------------------NWGKTD----------------------------
M2RFF8_COCSN/69-317Y....GIS.LDNREHALRGW--------------------------NWGKAD----------------------------
T1JSI6_TETUR/75-284L....DLD.LSPKELCLKGW--------------------------NWGTAN----------------------------
G2YRR9_BOTF4/72-320Y....STN.LEHKEHALRGW--------------------------NWGKGE----------------------------
E0VDU0_PEDHC/75-282Y....KKE.MNEKELSLKGW--------------------------NWGTAK----------------------------
SSRP1_DROME/75-284Y....SQE.MVEKEMCVKGW--------------------------NWGTAR----------------------------
POB3_ASHGO/79-314F....NVQ.LEHKDHSLRGW--------------------------NWGTTD----------------------------
F9X858_MYCGM/69-317Y....GVP.FEQKEHALRGW--------------------------NWGKNE----------------------------
SSP1B_CAEEL/74-285W....SKS.INQSNLFINGW--------------------------NYGQAD----------------------------
E9H7T5_DAPPU/74-282Y....KKD.MLEKELSVKGW--------------------------NWGRAE----------------------------
B9H0D7_POPTR/75-295H....GIT.PEEKQLSVSGR--------------------------NWGEVD----------------------------
U4LLV9_PYROM/73-307Y....KVN.LEHREHALKGW--------------------------NWGKAE----------------------------
R7YNS5_CONA1/46-296Y....SIN.VESKEHALRGW--------------------------NWGKAE----------------------------
A3LUL0_PICST/77-318F....SLN.LEHKEHSLRGW--------------------------NWGKND----------------------------
F0XPZ4_GROCL/73-313Y....SHN.LENKEHSVRGW--------------------------NWGKAE----------------------------
A2DGX1_TRIVA/70-274L....DVE.ANEEDLSISGL--------------------------NEGVFF----------------------------
C9SUU3_VERA1/73-321Y....STT.LENKEHALRGW--------------------------NWGKAE----------------------------
D2VV01_NAEGR/75-307QVES.DIP.FNKVETCMKGV--------------------------NWGKPV----------------------------
POB3_CRYNJ/76-317F....NIT.LETRDTSLKGW--------------------------NWGEAQ----------------------------
C4QVU8_PICPG/78-307F....NVN.LEHKEHSLRGW--------------------------NWGKTQ----------------------------
T1G514_HELRO/58-264Y....DLK.LEKKDSALKGW--------------------------NWGNAK----------------------------
A0A023BCN2_GRENI/77-301W....QIPMLADIKLGCKGW--------------------------HWGEWS----------------------------
Q4UAH0_THEAN/101-308Y....KMS.CDKDEVSCTGW--------------------------HWGTYE----------------------------
G0MG00_CAEBE/74-285W....SQS.IEPSPLFIKGW--------------------------SYGQAE----------------------------
H9K7N5_APIME/74-283Y....KKD.MLEKELSLKGW--------------------------NWGTAR----------------------------
B8C388_THAPS/53-273Y....GIT.LKRHSMSSAGA--------------------------SWGNTD----------------------------
G4T8M8_PIRID/70-292F....DIN.LEVRELSWRGW--------------------------NWGSTD----------------------------
F6VQ10_CIOIN/78-286Y....KID.LEHQELSGKGW--------------------------NWGTTD----------------------------
K5XVN9_AGABU/72-302F....GIT.LETREVSFKGW--------------------------NWGVTD----------------------------
B8MEU9_TALSN/70-323Y....GVA.IEQREHAIRGW--------------------------NWGKAE----------------------------
E4WR67_OIKDI/77-287P....DKE.IKQEDLSIKGW--------------------------NWGKAE----------------------------
D8R056_SELML/75-291I....GVT.PQDKPLAVSGR--------------------------NWGEAE----------------------------
M2R6G6_CERS8/71-304F....SIA.LETKEVSVKGW--------------------------NWGVTD----------------------------
SSRP1_ARATH/75-294Y....GKT.PDEKQLSVSGR--------------------------NWGEVD----------------------------
T0L0V4_COLGC/74-320Y....STN.LENKEHSLRGW--------------------------NWGKAD----------------------------
Q0JQ27_ORYSJ/75-293M....GLS.PDEKQLSVSGQ--------------------------NWGGID----------------------------
G3AWR9_CANTC/79-316F....QMS.LEHKEHSLRGW--------------------------NWGKTD----------------------------
G8ZSS5_TORDC/79-316F....NVQ.IELKEHSLRGW--------------------------NWGKAD----------------------------
A9TBJ4_PHYPA/71-289M....GIT.SEEKPLAISGR--------------------------NWGDVT----------------------------
H3GY61_PHYRM/71-284F....DRE.LEQEKVAASGG--------------------------NWGDMK----------------------------
B6KBU5_TOXGO/99-311F....KVK.LQRGQQAYRGW--------------------------HWGDVK----------------------------
R4FNX0_RHOPR/75-283Y....SQE.LNEKELSVRGW--------------------------NWGTAK----------------------------
Q2H6S0_CHAGB/59-287Y....SAT.LENKEHSLRGW--------------------------NWGKAE----------------------------
C5L6E2_PERM5/78-286Y....GLD.LKKDKVSTRGW--------------------------CWGESS----------------------------
A8P7R4_BRUMA/74-285W....SID.VDQVEQCIKGW--------------------------NYGRAE----------------------------
A7TMB5_VANPO/79-318F....SIQ.VEHKEHSLRGW--------------------------NWGKAD----------------------------
D8U9V6_VOLCA/76-298LDHPEGIS...EEALSTSGH--------------------------NWGAVQ----------------------------
B3S4B9_TRIAD/76-284Y....NIQ.LEEKELSVKGF--------------------------NWGNHS----------------------------
C7Z9V4_NECH7/74-323Y....STV.LENKEHALRGW--------------------------NWGKAE----------------------------
F2U7M9_SALR5/77-287Y....DLD.IKIVELSLKGN--------------------------NSGSAR----------------------------
I1FYM9_AMPQE/69-279F....GKD.LKQVELCVKGW--------------------------NWGEPV----------------------------
M7PI11_PNEMU/73-307F....NIT.LEQREHSLKGW--------------------------NWGKTE----------------------------
D8M9Z0_BLAHO/70-287F....KID.LKDDVLGSDGV--------------------------NWGTID----------------------------
H2WQH8_CAEJA/68-276W....SQS.VEKTDLVIKGW--------------------------NYGDID----------------------------
N1Q7D7_MYCFI/70-318Y....GVP.FEHKEHALRGW--------------------------NWGKNE----------------------------
Q8IL56_PLAF7/86-299F....NIR.LNNRKIATKGW--------------------------NWGEFK----------------------------
F0YFE5_AURAN/71-306.....GVA.LSDVEFCSSGV--------------------------NRGKHS----------------------------
C1EF78_MICSR/76-304Y....DVD.VVKRDMQVIGR--------------------------NWGQIE----------------------------
G0PNS9_CAEBE/74-285W....QME.IHNTELFIKGW--------------------------NYGQAN----------------------------
X1WJ52_ACYPI/73-283Y....RLD.MLEKELAIKGW--------------------------NWGSTK----------------------------
K5WMV1_PHACS/78-312F....SIV.LETKEASVKGW--------------------------NWGMTD----------------------------
A7AMU7_BABBO/80-294F....KIS.PEVGSVAHTGW--------------------------HWGVYG----------------------------
K3ZC23_SETIT/71-284T....GIS.PEEKQLSISGH--------------------------NWGGVE----------------------------
I2GZA7_TETBL/79-321F....DVQ.LEHKEHSLRGW--------------------------NWGKTD----------------------------
C1N716_MICPC/76-300Y....AKK.LTKREAQTNGR--------------------------NWGEVD----------------------------
V2XNB2_MONRO/74-301F....SVT.LETRETSLKGW--------------------------NWGVTD----------------------------
F4R467_MELLP/83-333F....HVT.LETKDMSLRGW--------------------------NWGKAD----------------------------
E3JV35_PUCGT/83-325F....HVT.LETKDLSLRGW--------------------------NWGKMD----------------------------
K1Q5H6_CRAGI/75-285Y....MVS.LEKKDLSVKGW--------------------------NWGIAH----------------------------

PF10882

D2RH36_ARCPA/66-169-------------------------------------TSI----------------------------------------
Q892T1_CLOTE/66-167-------------------------------------VNY----------------------------------------
A5N6R3_CLOK5/63-164-------------------------------------LKY----------------------------------------
A9B463_HERA2/77-175-------------------------------------LHY----------------------------------------
D9SW68_CLOC7/63-164-------------------------------------MEY----------------------------------------
Q67L16_SYMTH/48-147-------------------------------------MRY----------------------------------------
D5XC81_THEPJ/68-168-------------------------------------LEY----------------------------------------
C5CH43_KOSOT/70-173-------------------------------------MKY----------------------------------------
F2KQG8_ARCVS/58-157-------------------------------------KEV----------------------------------------
B1I1Z1_DESAP/63-162-------------------------------------RGF----------------------------------------
A3HRM5_9BACT/66-167-------------------------------------RRY----------------------------------------
E8N364_ANATU/72-171-------------------------------------GQY----------------------------------------
A2BJK7_HYPBU/63-163-------------------------------------VRA----------------------------------------
A5I617_CLOBH/64-163-------------------------------------.DY----------------------------------------
A6L350_BACV8/68-162-------------------------------------..I----------------------------------------
A9WIF8_CHLAA/77-175-------------------------------------LRY----------------------------------------
Y1301_CLOAB/63-163-------------------------------------LKY----------------------------------------
Q8XIV7_CLOPE/64-163-------------------------------------.VY----------------------------------------
U5S0J0_9CLOT/64-164-------------------------------------LKY----------------------------------------

PF06713

L8ATU0_BACIU/60-136-------------------------------------LKY----------------------------------------
A7GTV4_BACCN/61-123-------------------------------------KKH----------------------------------------
A6T2Q0_JANMA/61-134-------------------------------------TRY----------------------------------------
Q5WGJ5_BACSK/65-143-------------------------------------IKF----------------------------------------
Q5WLL6_BACSK/65-138-------------------------------------TGY----------------------------------------
Q6HLV3_BACHK/52-125-------------------------------------TKY----------------------------------------
Q5WBM1_BACSK/61-138-------------------------------------MYY----------------------------------------
D7IH66_9BACE/53-129-------------------------------------TVY----------------------------------------
Q9K9B1_BACHD/42-116-------------------------------------TYD----------------------------------------
A0A015MXD4_BACFG/53-129-------------------------------------TVY----------------------------------------
A6KZD8_BACV8/54-130-------------------------------------STY----------------------------------------
A5WI48_PSYWF/64-136-------------------------------------IKY----------------------------------------
Q8ELH5_OCEIH/56-129-------------------------------------TRY----------------------------------------
A4BZG7_9FLAO/58-133-------------------------------------TSY----------------------------------------
Q9KEX6_BACHD/65-138-------------------------------------TGY----------------------------------------
Q67SW8_SYMTH/62-135-------------------------------------TGY----------------------------------------
Q633A6_BACCZ/61-123-------------------------------------KKH----------------------------------------
A7UYW5_BACUN/53-129-------------------------------------TTY----------------------------------------
C2SZ95_BACCE/53-128-------------------------------------SHY----------------------------------------
Q5WM07_BACSK/64-139-------------------------------------TKY----------------------------------------
Q8ETD0_OCEIH/64-141-------------------------------------LCY----------------------------------------
A9VJV3_BACWK/52-125-------------------------------------TKY----------------------------------------
Q2BCY1_9BACI/62-139-------------------------------------VKY----------------------------------------
A7AH02_9PORP/54-129-------------------------------------TWY----------------------------------------
A4ASP1_MARSH/60-135-------------------------------------TNY----------------------------------------
A7LYH2_BACO1/53-129-------------------------------------TTY----------------------------------------
A6KZD7_BACV8/56-123-------------------------------------TIY----------------------------------------
A4CQ29_ROBBH/54-128-------------------------------------IRY----------------------------------------
Q4V1T4_BACCZ/53-127-------------------------------------STY----------------------------------------
A6EQ87_9BACT/59-133-------------------------------------TRY----------------------------------------
A4ANC2_MARSH/53-127-------------------------------------TYY----------------------------------------
A3J6N6_9FLAO/59-136-------------------------------------TFY----------------------------------------
A7GNM9_BACCN/53-127-------------------------------------STY----------------------------------------
A0A016A011_BACFG/55-123-------------------------------------CKY----------------------------------------
Q5WDR5_BACSK/61-138-------------------------------------ITY----------------------------------------
Q8EQJ6_OCEIH/52-125-------------------------------------TGY----------------------------------------
A6CHZ7_9BACI/57-130-------------------------------------TCY----------------------------------------
Q99IS9_9BACT/61-134-------------------------------------TRY----------------------------------------
A6TN63_ALKMQ/64-137-------------------------------------TNY----------------------------------------
A5ZET0_9BACE/53-129-------------------------------------TAY----------------------------------------
A6LGE4_PARD8/53-128-------------------------------------TYY----------------------------------------
K5DA95_RHOBT/65-137-------------------------------------CRY----------------------------------------
C2SXV9_BACCE/2-75-------------------------------------AKY----------------------------------------
A6CKW3_9BACI/69-152-------------------------------------TYY----------------------------------------
Q8CV26_OCEIH/61-135-------------------------------------TGY----------------------------------------
A3XNY3_LEEBM/58-133-------------------------------------TSY----------------------------------------

PF15405

A7TQH3_VANPO/867-996--------------------------------------------------------------------------------
A8QCG1_MALGO/650-787--------------------------------------------------------------------------------
B6HR54_PENCW/741-867--------------------------------------------------------------------------------
B6K4Z0_SCHJY/799-929--------------------------------------------------------------------------------
B6K7Q5_SCHJY/658-790--------------------------------------------------------------------------------
C5DFA7_LACTC/775-905--------------------------------------------------------------------------------
D5G4S8_TUBMM/733-864--------------------------------------------------------------------------------
D6RNQ8_COPC7/510-650--------------------------------------------------------------------------------
E3KTU1_PUCGT/826-974--------------------------------------------------------------------------------
E4ZWW2_LEPMJ/934-1064--------------------------------------------------------------------------------
F0XUN9_GROCL/777-902--------------------------------------------------------------------------------
F2Z621_KLULA/763-894--------------------------------------------------------------------------------
F9X7Y7_MYCGM/750-877--------------------------------------------------------------------------------
G0V5Q3_NAUCC/849-979--------------------------------------------------------------------------------
G1XBW2_ARTOA/827-954--------------------------------------------------------------------------------
G2WW94_VERDV/764-891--------------------------------------------------------------------------------
G2YJS9_BOTF4/50-174--------------------------------------------------------------------------------
G4NKJ4_MAGO7/790-913--------------------------------------------------------------------------------
G7DY91_MIXOS/924-1056--------------------------------------------------------------------------------
G8BPI3_TETPH/796-928--------------------------------------------------------------------------------
G8ZUV3_TORDC/841-971--------------------------------------------------------------------------------
G9N7F4_HYPVG/769-895--------------------------------------------------------------------------------
H1UV38_COLHI/767-893--------------------------------------------------------------------------------
I1BJ67_RHIO9/768-907--------------------------------------------------------------------------------
I1BQA0_RHIO9/235-373--------------------------------------------------------------------------------
I1C1X6_RHIO9/740-879--------------------------------------------------------------------------------
Q4P7K1_USTMA/348-484--------------------------------------------------------------------------------
Q6CDY6_YARLI/831-954--------------------------------------------------------------------------------
Q752J0_ASHGO/816-948--------------------------------------------------------------------------------
RGF2_SCHPO/670-802--------------------------------------------------------------------------------
RGF1_SCHPO/844-972--------------------------------------------------------------------------------
E7NHW6_YEASO/518-648--------------------------------------------------------------------------------
F8Q550_SERL3/776-912--------------------------------------------------------------------------------
G4U7U0_NEUT9/784-907--------------------------------------------------------------------------------
Q4WUI2_ASPFU/728-851--------------------------------------------------------------------------------
Q5KB00_CRYNJ/694-836--------------------------------------------------------------------------------
W1QFJ3_OGAPD/758-896--------------------------------------------------------------------------------

PF16652

F4Q0K6_DICFS/582-649-------------------------------------VQN----------------------------------------
I1FPV5_AMPQE/1081-1156-------------------------------------AEG----------------------------------------
H3D2Y5_TETNG/477-540-------------------------------------LLR----------------------------------------
F1RB67_DANRE/459-521-------------------------------------VRG----------------------------------------
E7F4U1_DANRE/476-538-------------------------------------LLR----------------------------------------
A2RUX1_DANRE/474-535-------------------------------------LLR----------------------------------------
H2VDT5_TAKRU/287-350-------------------------------------MGP----------------------------------------
M4AJZ7_XIPMA/768-830-------------------------------------MMG----------------------------------------
G1KIR4_ANOCA/1103-1165-------------------------------------KKQ----------------------------------------
M4A6K1_XIPMA/1086-1148-------------------------------------TKH----------------------------------------
G3PXN6_GASAC/306-375-------------------------------------QGN----------------------------------------
F6ZCG9_XENTR/229-291-------------------------------------ILR----------------------------------------
I1U3D6_ORYLA/350-412-------------------------------------MGR----------------------------------------
F1NJU1_CHICK/482-544-------------------------------------MGQ----------------------------------------
E1B9G8_BOVIN/334-396-------------------------------------MLQ----------------------------------------
Q16R60_AEDAE/362-435-------------------------------------LTV----------------------------------------
Q7PMK0_ANOGA/1503-1577-------------------------------------LTV----------------------------------------
B3MD72_DROAN/1772-1839-------------------------------------LTQ----------------------------------------
B4MQQ2_DROWI/1788-1856-------------------------------------LTQ----------------------------------------
G6CLT4_DANPL/748-815-------------------------------------LPQ----------------------------------------
H3E6I2_PRIPA/644-713-------------------------------------LTK----------------------------------------
G0MI70_CAEBE/978-1047-------------------------------------LTK----------------------------------------
F1KQK1_ASCSU/1029-1098-------------------------------------LTN----------------------------------------
J9FEQ9_WUCBA/734-803-------------------------------------LTH----------------------------------------
L7MEV5_9ACAR/1159-1235-------------------------------------LKR----------------------------------------
B7QI72_IXOSC/241-315-------------------------------------LRQ----------------------------------------
K1RR99_CRAGI/1042-1116-------------------------------------LTK----------------------------------------
B3SCV3_TRIAD/907-987-------------------------------------LTH----------------------------------------
F1QUN4_DANRE/946-1020-------------------------------------LTT----------------------------------------
H2RNA8_TAKRU/921-999-------------------------------------LST----------------------------------------
I3KR26_ORENI/954-1032-------------------------------------LTT----------------------------------------
R7VJM8_CAPTE/1319-1392-------------------------------------LNH----------------------------------------
C3XR85_BRAFL/199-274-------------------------------------LPS----------------------------------------
A7SRI8_NEMVE/240-313-------------------------------------FSK----------------------------------------
B0JZC2_XENTR/705-778-------------------------------------ISK----------------------------------------
M3W909_FELCA/644-717-------------------------------------ITR----------------------------------------
F7DVU8_ORNAN/534-606-------------------------------------ITQ----------------------------------------
J9JQX8_ACYPI/1076-1146-------------------------------------VTK----------------------------------------
H9K9Y6_APIME/1712-1783-------------------------------------ITK----------------------------------------
E9GNC8_DAPPU/245-319-------------------------------------LTK----------------------------------------
R4WDG5_9HEMI/459-523-------------------------------------LTK----------------------------------------
H3CRZ0_TETNG/625-698-------------------------------------LTQ----------------------------------------
M3ZX67_XIPMA/702-775-------------------------------------LTQ----------------------------------------
H3AFG5_LATCH/610-683-------------------------------------LTT----------------------------------------
H1A431_TAEGU/397-468-------------------------------------LTS----------------------------------------
Q6XS95_XENLA/999-1072-------------------------------------LTK----------------------------------------
H2TY33_TAKRU/922-995-------------------------------------LTK----------------------------------------
H9GMJ3_ANOCA/960-1033-------------------------------------LRS----------------------------------------
F7E9P4_XENTR/995-1064-------------------------------------LTT----------------------------------------
F6WE69_HORSE/989-1062-------------------------------------LTK----------------------------------------
E7FDV8_DANRE/967-1040-------------------------------------LTK----------------------------------------
L8HIM8_ACACA/86-163-------------------------------------MKG----------------------------------------
G4M1K0_SCHMA/1380-1453-------------------------------------HER----------------------------------------
E9C6R0_CAPO3/758-815-------------------------------------AND----------------------------------------
I1FJT4_AMPQE/34-101-------------------------------------MGS----------------------------------------
E9CIT4_CAPO3/1629-1696-------------------------------------LGP----------------------------------------
H6QNV2_PUCGT/1939-2007-------------------------------------VGR----------------------------------------
F4S205_MELLP/1799-1860-------------------------------------VGR----------------------------------------
E5SHC2_TRISP/1437-1506-------------------------------------LGP----------------------------------------
F1KQJ6_ASCSU/1385-1453-------------------------------------VGP----------------------------------------
A8NHP3_BRUMA/115-184-------------------------------------VGP----------------------------------------
E2B7P2_HARSA/286-356-------------------------------------LGP----------------------------------------
K7JHQ7_NASVI/280-349-------------------------------------LGP----------------------------------------
D6WH10_TRICA/455-522-------------------------------------LGP----------------------------------------
N6TRI8_DENPD/1372-1439-------------------------------------LGP----------------------------------------
E9GGN7_DAPPU/1507-1577-------------------------------------LGP----------------------------------------
B7PVP6_IXOSC/339-409-------------------------------------LGS----------------------------------------
K1RGX4_CRAGI/988-1055-------------------------------------LGP----------------------------------------
R7US78_CAPTE/312-382-------------------------------------LGP----------------------------------------
A7RUY7_NEMVE/99-171-------------------------------------LGP----------------------------------------
C3ZLK0_BRAFL/982-1048-------------------------------------LGP----------------------------------------
H2XVQ2_CIOIN/1434-1504-------------------------------------LDQ----------------------------------------
G1QVX0_NOMLE/237-307-------------------------------------LGP----------------------------------------
F1R0Z9_DANRE/1475-1545-------------------------------------LGP----------------------------------------
A3KQK0_DANRE/238-307-------------------------------------LGP----------------------------------------
H3DK01_TETNG/1364-1434-------------------------------------LGP----------------------------------------
I3IVP3_ORENI/1445-1515-------------------------------------LGP----------------------------------------
I4YGU5_WALSC/1457-1509-------------------------------------TRS----------------------------------------
G7DWX8_MIXOS/1684-1737-------------------------------------QGP----------------------------------------
M7XIH0_RHOT1/1697-1751-------------------------------------LGP----------------------------------------
G4TEE5_PIRID/1837-1889-------------------------------------MGQ----------------------------------------
M5GAJ2_DACSP/1877-1929-------------------------------------MGH----------------------------------------
R7SD96_TREMS/1940-1990-------------------------------------LGP----------------------------------------
E2L4V2_MONPE/64-116-------------------------------------MGS----------------------------------------
J9VV31_CRYNH/1828-1878-------------------------------------LGP----------------------------------------
R7SKN3_DICSQ/1831-1883-------------------------------------MGQ----------------------------------------
D8PUQ3_SCHCM/1823-1875-------------------------------------MGT----------------------------------------
M2QQ29_CERS8/915-967-------------------------------------MGP----------------------------------------
K5XIT5_AGABU/1929-1981-------------------------------------MGP----------------------------------------
A8PA90_COPC7/1965-2017-------------------------------------MGA----------------------------------------
B0D2P7_LACBS/1825-1877-------------------------------------MGG----------------------------------------

PF15410

E5RJ29_HUMAN/721-832------------------------------------YKSG--F--LARKIHAD-------M--DGKKT--PRGKR-----
H2SLA8_TAKRU/516-627------------------------------------YKSG--F--LVRKVHAD-------P--DGKRT--PRGKR-----
B7QFP5_IXOSC/177-288------------------------------------YKKG--Y--VMRKCCLD-------P--GGKRT--PLGKR-----
I1BQ29_RHIO9/379-506------------------------------------CKEG--V--VTRKHLLE-------N--ASQKA--..KHR-----
D4YWC5_CAEEL/387-497------------------------------------YYSG--F--LMRKYVRE-------T--DGGKT--PFGRR-----
E3JSD7_PUCGT/1317-1461------------------------------------AKEG--I--LQRKQYWE-------S--KGKRH--..KDR-----
YDYB_SCHPO/679-804------------------------------------VHPY--I--KQGILKFQ-------S--KESHK--FRKKE-----
F6X1S7_XENTR/10-124------------------------------------IYSL--W--CKNHLLIC-------I--FILTA--PWGKR-----
E9H3M8_DAPPU/491-615------------------------------------FKKG--Y--IMRKCCME-------P--NGKRT--PLGKR-----
G4VKT4_SCHMA/511-627------------------------------------AQSS--I--VTSINSTN-------T--MTSSF--STSNP-----
E5SKG2_TRISP/325-435------------------------------------YKKG--W--VMRKCVVD-------K--GGKKV--PFGRR-----
I1CBT7_RHIO9/688-826------------------------------------YKEG--I--VIRKHLLE-------N--ASQKA--..KHR-----
A8PYL1_BRUMA/369-479------------------------------------YKAG--W--VVRKYLFD-------R--DGKRT--PFGRR-----
E1JIT7_DROME/792-903------------------------------------YKKG--Y--VMRKCCYD-------S--SFKKT--PFGKR-----
U1M7X4_ASCSU/467-577------------------------------------YKAG--W--VMRKCVYD-------R--DGSRT--PFGRR-----
W5JQ26_ANODA/1159-1272------------------------------------YKKG--Y--VYRKWCFE-------D--NRKKI--PFGRR-----

PF00169

CTRO_MOUSE/1470-1589--------------------------------L---HLEG--W..MKVPRNNK-------R--GQQ..--..........
ARHG6_HUMAN/450-548--------------------------------V---IFMS--Q..VM.....V-------Q--YGACE--..........
SPTCB_DROME/2148-2259--------------------------------E---GHEG--Y..VT.....R-------K--HEWDS--TTKK......
CA120_YEAST/76-204--------------------------------R---YHEG--VFLIL.....Q-------D--LNNNG--THA.......
VAV_RAT/403-504--------------------------------P---KIDG--E..LK.....I-------T--SVERR--..........
PLCD4_RAT/17-124--------------------------------L---MQKG--T..MM.....R-------K--VRTK.--..........
PLD1_HUMAN/220-328--------------------------------K---GIEG--M..IM.....K-------R--SGGHR--IPGLNCC...
ARHG5_HUMAN/1391-1502--------------------------------L---VKSG--ELTAL.....E-------F--SASPG--LRR.......
Q93569_CAEEL/7-101--------------------------------L---PTNG--V..MK.....K-------W--TNYVN--..........
SOS2_MOUSE/443-545--------------------------------F---IMEG--P..LT.....R-------I--G....--..........
PSD1_HUMAN/757-869--------------------------------V---YKHG--A..LV.....R-------K--VHADP--DCRKT.....
YHT1_YEAST/194-304--------------------------------R---IHSD--L..VH.....R-------S--DQSQ.--..........
SIP3_YEAST/310-423--------------------------------P---EKSG--W..LY.....M-------K--TQVGK--PT........
YOTB_CAEEL/36-131--------------------------------L---VGEG--V..LV.....K-------M--CRK..--..........
ARHG8_HUMAN/387-501--------------------------------L---LCHG--E..LR.....S-------K--S....--..........
TIAM1_MOUSE/1261-1395--------------------------------D---LSMG--D..LLLHTSVI-------W--LNPPA--SL........
DOK1_HUMAN/4-119--------------------------------A---VMEG--PLFLQ.....S-------Q--RFGTK--..........
BMX_HUMAN/5-111--------------------------------S---ILEE--L..LL.....K-------R--SQQKK--KMS.......
CAPS1_MOUSE/520-622--------------------------------M---KHSG--Y..LW.....T-------I--GKNVW--K.........
PLCG1_HUMAN/33-142--------------------------------T---VMTL--F..YS.....K-------K--SQ...--..........
PLEK_HUMAN/245-347--------------------------------I---IKQG--C..LL.....K-------Q--GHRRK--..........
RDCII_DICDI/354-461--------------------------------I---VKEG--W..LK.....R-------K--SISSS--NQ........
OSH2_YEAST/290-386--------------------------------P---TYKG--F..LK.....K-------W--TNFAH--..........
GRB7_MOUSE/229-341--------------------------------P---EIQG--F..LQ.....L-------R--GSGRG--SG........
TIAM1_MOUSE/434-547--------------------------------V---RKAG--ALAVKNFLVHK-------K--NKKVE--SAT.......
SLM1_YEAST/469-581--------------------------------E---IKSG--F..LE.....R-------R--SKFLK--..........
TG325_CAEEL/387-505--------------------------------T---IRCG--D..LE.....R-------S--ENDEP--AEKVV.....
CYH1_HUMAN/261-377--------------------------------P---DREG--W..LL.....K-------L--GGGRV--K.........
SIF1_DROME/849-955--------------------------------L---SVKK--W..LL.....R-------K--KHQIE--LAR.......
RGA2_SCHPO/720-836--------------------------------A---QKEG--V..LL.....K-------Y--IENS.--..........
APSA_EMENI/1394-1504--------------------------------T---MIGE--F..LW.....K-------Y--TRRAV--SGE.......
SH2B1_RAT/247-376--------------------------------I---QREE--L..LSFMGAEE-------A--APDPA--GVGRGGGAAG
Q17777_CAEEL/241-343--------------------------------P---ILEG--VLSVQ.....H-------V--EEGV.--..........
MIG10_CAEEL/457-566--------------------------------P---EMEG--F..LY.....L-------K--SDGRK--..........
SNT1_CAEEL/228-340--------------------------------V---RHMG--W..IA.....E-------Q--VSENG--I.........
GAB1_HUMAN/6-116--------------------------------V---VCSG--W..LR.....K-------S--PPEKK--LK........
BUD4_CANAL/1577-1685--------------------------------N---YFEG--Y..LH.....Q-------E--GGDCP--..........
SKM1_YEAST/4-118--------------------------------V---KKEG--W..IS.....Y-------K--VDGLF--S.........
SECG_DICDI/785-895--------------------------------V---EKKG--W..LT.....K-------Q--GGRIK--..........
VAV2_MOUSE/401-502--------------------------------P---KIDG--E..LK.....V-------R--SIVNH--..........
PLEK_HUMAN/5-101--------------------------------R---IREG--Y..LV.....K-------K--GSVFN--..........
ARHGG_HUMAN/502-620--------------------------------L---LKRG--ELFLV.....E-------E--TGLFR--K.........
AKT1_DROME/107-211--------------------------------V---VKEG--W..LM.....K-------R--GEHIK--..........
PLCL1_RAT/115-224--------------------------------F---MQAG--C..EL.....K-------K--VRPNS--R.........
FGD1_HUMAN/822-921--------------------------------S---VICS--FLHYM.....E-------K--GGK..--..........
ARHG2_MOUSE/474-572--------------------------------L---IHEG--C..LL......-------W--KTATG--..........
RHG25_HUMAN/47-151--------------------------------P---IKMG--W..LK.....K-------Q--RSIVK--..........
FGD1_HUMAN/591-689--------------------------------L---IKEG--H..IL.....K-------L--SAKNG--..........
AKT2_MOUSE/6-108--------------------------------V---IKEG--W..LH.....K-------R--GEYIK--..........
ATG26_YEAST/239-336--------------------------------V---KMSG--N..LN.....I-------R--TKLIR--..........
Q21025_CAEEL/833-940--------------------------------G---RMNG--WLRVY.....R-------D--DMTGS--..........
BEM2_YEAST/1832-1948--------------------------------K---KIGG--F..FR.....R-------P--FSIGG--F.........
ITK_MOUSE/5-117--------------------------------I---LLEE--Q..LI.....K-------K--SQQKR--RTS.......
DOS_DROME/4-113--------------------------------T---FYEG--W..LI.....K-------S--PPTKR--IW........
CRAC_DICDI/23-122--------------------------------V---SYSS--I..MK.....K-------A--GGNGK--..........
SIF1_DROME/1672-1793--------------------------------L---NISD--F..LG.....K-------I--KKGL.--..........
SPTB2_HUMAN/2198-2307--------------------------------A---QMEG--F..LN.....R-------K--HEWEA--HNKK......
TRIO_HUMAN/2158-2271--------------------------------I---VAQG--K..LL.....L-------Q--DTFLV--TDQDA.....
MUG79_SCHPO/1044-1158--------------------------------W---HRRG--MISYKKMVLSK-------N--NRWVA--G.........
SHK2_SCHPO/24-125--------------------------------I---IRSG--WVMLK.....E-------D--KMKYL--..........
NUM1_YEAST/2574-2683--------------------------------T---VIGE--Y..LF.....K-------Y--YPRLG--PFG.......
Q18420_CAEEL/249-346--------------------------------M---EKSG--Y..WT.....Q-------L--TDSRI--K.........
ACAP1_HUMAN/266-360--------------------------------L---VMEG--H..LF.....K-------R--ASNAF--K.........
ANLN_DROME/1107-1230--------------------------------V---EYKG--FLTMF.....E-------D--ISGFG--..........
SEC74_SCHPO/549-677--------------------------------V---FKLG--I..LI.....Q-------N--EKVRK--DR........
GRP1_CAEEL/262-380--------------------------------A---EREG--W..LF.....K-------Q--SSNPL--FSG.......
UN104_CAEEL/1461-1558--------------------------------V---SKKG--YMNFL.....E-------E--KTQ..--..........
KPCD1_HUMAN/423-541--------------------------------V---MKEG--W..MV.....H-------Y--TSKD.--..........
RGRF2_MOUSE/23-133--------------------------------G---TKRG--F..LS.....K-------K--AAEAS--..........
ANI2_CAEEL/893-1005--------------------------------V---EYRG--FLYLF.....D-------E--RSPNG--E.........
SKG3_YEAST/91-221--------------------------------R---YHYG--IFLIL.....H-------D--LKTDG--TPA.......
3BP2_MOUSE/27-130--------------------------------V---AKAG--Y..LH.....K-------K--GGTQL--QL........
RGRF1_RAT/457-582--------------------------------F---VRQG--S..LIQVPMSE-------K--GKINK--GRLGS.....
CNT6_SCHPO/527-632--------------------------------I---FKEG--L..LLVFGATE-------L--GTDLA--MVS.......
BOI2_YEAST/769-887--------------------------------A---DFSG--W..MS.....K-------K--GSGAM--S.........
PAC1_CAEEL/612-726--------------------------------V---ARQT--W..VK.....H-------Q--EIALG--KSG.......
YP091_YEAST/135-266--------------------------------V---LRHG--NLFLY.....K-------D--DSQNA--NLVHAIS...
TEC_MOUSE/5-111--------------------------------T---ILEE--I..LI.....K-------R--SQQKK--KTS.......
BTK_HUMAN/4-133--------------------------------V---ILES--I..FL.....K-------R--SQQKK--KTS.......
GPRK1_DROME/558-657--------------------------------C---ILHG--Y..IK.....K-------L--GGSFA--S.........
YSP1_YEAST/309-421--------------------------------K---GLSG--WLYMK.....T-------T--VGHDP--KR........
MPRIP_MOUSE/387-482--------------------------------N---FKKG--W..LT.....K-------Q--YEDG.--..........
RASA2_RAT/604-704--------------------------------H---LKEG--E..MY.....K-------R--AQGRT--RIG.......
GRB10_HUMAN/291-399--------------------------------P---EIQG--F..LH.....V-------K--ELGKK--..........
VAV_CAEEL/471-598--------------------------------V---NLDG--EVKMA.....E-------S--TLTQA--G.........
SOS_DROME/481-588--------------------------------F---IRED--S..LS.....K-------L--GSGKR--..........
YB35_SCHPO/255-349--------------------------------Q---HMSG--Y..LK.....K-------W--TNYKS--..........
O02134_CAEEL/257-375--------------------------------L---KSLG--LLRLQ.....T-------E--CDVFT--YNRKK.....
UN112_CAEEL/406-507--------------------------------A---DYLK--Y..MK.....P-------K--KLAAF--K.........
TRIO_HUMAN/1480-1591--------------------------------I---ESQG--E..LILQESFQ-------V--WDPKT--LI........
RHG26_CHICK/266-369--------------------------------Y---TMEG--Y..LY.....V-------Q--EKRHF--G.........
PHLB1_RAT/722-824--------------------------------K---VCRG--Y..LI.....K-------M--GGKIK--..........
ABR_HUMAN/302-459--------------------------------L---VKDG--FLVEVSESSRK-------L--RHVFL--FTDVLLCAKL
RGRF1_RAT/23-129--------------------------------G---TRKG--Y..LS.....K-------R--SSDNP--..........
SNTB1_HUMAN/323-433--------------------------------I---RHLG--W..LA.....E-------K--VPGES--K.........
AFAP1_CHICK/154-249--------------------------------A---KICA--F..LL.....R-------K--KRFG.--..........
OPY1_YEAST/216-318--------------------------------Q---VCSG--I..LY.....T-------K--VKKKK--LFN.......
KIF1A_MOUSE/1581-1678--------------------------------V---SKKG--Y..LH.....F-------L--EPHTA--..........
ARHG7_HUMAN/480-578--------------------------------V---TYMS--Q..VL.....I-------Q--CAGSE--..........
BUD4_YEAST/1303-1413--------------------------------I---YKEG--Y..LL.....Q-------D--GGDLK--G.........
DYN1_RAT/520-625--------------------------------V---IRKG--WLTIN.....N-------I--GIMKG--..........
Q20151_CAEEL/20-135--------------------------------R---LKDG--E..IL.....K-------Y--TSGIF--S.........
SNTA1_RABIT/294-401--------------------------------I---KQIG--W..LT.....E-------Q--LPSG.--..........
BEM3_YEAST/635-741--------------------------------N---VKDG--SLLLR.....R-------P--KTLTG--N.........
RGPS1_HUMAN/432-543--------------------------------P---TMEG--P..LR.....R-------K--TLLKE--GRKP......
AKT1_CAEEL/16-118--------------------------------V---VIEG--W..LH.....K-------K--GEHIR--..........
AKP13_HUMAN/2232-2333--------------------------------L---VRDG--SVFLK.....N-------A--AG...--..........
F4JNE2_ARATH/803-908--------------------------------.---.FEG--WLSIL.....S-------W--KGREA--..........
O88768_RAT/254-355--------------------------------.---LKEG--Y..ME.....K-------T--GPKQT--E.........
Q57YQ0_TRYB2/332-428--------------------------------V---THRG--H..VN.....K-------L--GGGNG--K.........
Q7KV69_DROME/3748-3851--------------------------------V---EIQG--S..LE.....R-------K--HGLQS--GGKK......
Q8MSU1_DROME/95-195--------------------------------.---.KYG--Q..LQ.....R-------I--VPKRL--FF........

PF15409

B6JVE7_SCHJY/144-232---------------------------------------G--I--LL-----K-------K--RRKKA--Q---------
E3RG70_PYRTT/221-309---------------------------------------G--V--LQ-----K-------K--RRKRN--Q---------
H1VVI1_COLHI/216-304---------------------------------------G--I--LH-----K-------R--RRKKG--Q---------
C8VHJ7_EMENI/110-198---------------------------------------G--L--LL-----K-------R--RRKRH--Q---------
Q6C4Y2_YARLI/155-243---------------------------------------G--I--LL-----K-------K--RRKKL--Q---------
G3B6N0_CANTC/156-243---------------------------------------G--V--LL-----K-------K--RRKKL--Q---------
A3LTM2_PICST/192-279---------------------------------------S--I--LL-----K-------K--RRKKL--Q---------
G8YKE6_PICSO/214-301---------------------------------------S--V--LL-----K-------K--RRKVL--Q---------
F2UGB6_SALR5/1490-1577---------------------------------------G--W--FV-----K-------K--AHKRG--K---------
C5GMH2_AJEDR/215-302---------------------------------------G--I--LQ-----K-------R--RRKRH--Q---------
G8BIT9_CANPC/202-289---------------------------------------S--I--ML-----K-------K--RRKKL--Q---------

PF15413

E9C7L7_CAPO3/130-226-------------------------------------IHG..W--LN-----K-------L--GAK..--..GLVK----
C4Y4Q1_CLAL4/136-269-------------------------------------SKP..V--IK-----S-------S--GSK..--......----
D7KQC6_ARALL/95-227-------------------------------------VAGIMY--KW-----V-------N--YGK..--......----
C6HG43_AJECH/87-193-------------------------------------KEG..Y--VR-----C-------K--EDK..--...FLA----
E5T4G3_TRISP/39-138-------------------------------------MKG..Y--VW-----H-------Q--RKR..--.....D----
A0CUJ8_PARTE/105-200-------------------------------------IEG..F--LM-----K-------K--SPH..--......----
A7SI59_NEMVE/523-628-------------------------------------KCG..Y--LE-----M-------K--LPRKQ--RKVTHK----

PF15406

B6K769_SCHJY/110-235--------------------------------N---YYYRKRF--YGSLTETDKTATESNP--SNGDE--EGEGVEEPKE
G2X9M4_VERDV/99-204--------------------------------N---FIYSKQF--FWFGT.DA...VE..P--STLSH--YRRS.....E
E3Q3I3_COLGM/92-197--------------------------------N---FIYSKEF--FWFGN.DA...VE..S--KSLSS--YLKS.....E
G4MXJ0_MAGO7/107-216--------------------------------N---FIYTKRF--FWFGT.DA...VE..P--KNLAS--FLKS.....E
G2PZQ3_THIHA/101-208--------------------------------N---FLYTKQL--FWFGS.......E..P--VDLKS--IASF...KAD
G4UAB8_NEUT9/95-202--------------------------------N---LLFSKKF--FWFGN.EA...VD..L--KSISS--FKAD......
B2A9W4_PODAN/92-199--------------------------------N---FLYTKTL--FWFGS.......E..P--VNVKE--IASF...KAE
F9G078_FUSOF/114-219--------------------------------N---LIPSKEF--FFFGT.EA...VE..P--KALSH--YLKS.....E
H0EZ07_GLAL7/83-191--------------------------------S---FIFQKKF--FWFGT.DA...VE..T--KALSS--YLRG..EK..
G0SHV9_CHATD/90-197--------------------------------N---FLYNKQF--FWFGT.DA...VD..L--KAISS--FKAD......
F0XAK4_GROCL/91-200--------------------------------K---FLYTKKF--FWFGN.DA...LS..A--KDLAA--YVKS......
H6BUU9_EXODN/90-198--------------------------------K---FFFTKHY--FWLSDEPL...TS..E--SLASF--LRSE......

PF14593

Q7PUX5_ANOGA/445-547--------------------------------S---LWQP--FAD...GDEIL-------K--YGIIY--KR..K-----
D6WGV3_TRICA/369-471--------------------------------S---VYHE--LVE...GNLIL-------K--QGIVE--KR..K-----
E2A088_CAMFO/460-562--------------------------------N---QWDT--FVE...GNLIL-------K--QGFVN--KR..K-----
PDPK1_MOUSE/449-551--------------------------------N---PWHQ--FVE...NNLIL-------K--MGPVD--KR..K-----
A8XME2_CAEBR/317-419--------------------------------N---DYHQ--LLD...GYLVL-------K--QGILH--KK..R-----
F0ZQF1_DICPU/137-240--------------------------------Q---QWNS--FLLP.NDEIIL-------A--CSLTL--KR..S-----
Q172S2_AEDAE/402-506--------------------------------D---MWHS--FAE...GELIL-------K--KGFVN--KR..K-----
E3MA10_CAERE/460-562--------------------------------N---PFHI--FTG...NMLIL-------K--QGYLE--KK..R-----
A8X5P7_CAEBR/474-576--------------------------------N---EWRV--YTP...QNLIL-------K--YGYLN--KK..R-----
D2VK59_NAEGR/353-456--------------------------------E---KYSL--FLLK..NESVV-------Y--TRKVV--KR..R-----
B5DR97_DROPS/703-805--------------------------------D---KWHV--FAD...GEVIL-------K--KGFVN--KR..K-----
D8QMJ5_SELML/388-489--------------------------------E---PWQK--FLFE..GETIL-------A--SSRVR--KF..R-----
E9CBD6_CAPO3/483-586--------------------------------S---QWHR--FVQV..DELII-------K--TGIIH--KR..K-----
C4QMA7_SCHMA/364-466--------------------------------N---PFNR--FVR...GRLIL-------K--QGILF--KR..R-----
F0ZSM2_DICPU/404-506--------------------------------K---KWSN--LINK..DETIV-------C--QGLVW--KR..K-----
B0X1B0_CULQU/404-508--------------------------------D---IWHP--FTN...DELII-------K--RGFVN--KR..K-----
E5SYD2_TRISP/403-505--------------------------------N---IYDQ--FVE...GNLII-------K--SGYLE--KR..K-----
E4XZ21_OIKDI/382-502--------------------------------N---RWAT--FVDD..DELII-------K--LGYMY--KK..R-----
A2DAR5_TRIVA/371-472--------------------------------S---HMEQ--FLLS..GEHII-------Y--EGDIQ--KR..V-----
F0ZMQ8_DICPU/111-220--------------------------------N---RSRA--FTSPELPKPSL-------L--QGYLK--KQGEK-----
D3BJW1_POLPA/401-501--------------------------------I---VWNR--FLLP.NNEIIL-------A--IATLE--KK..T-----
E9H687_DAPPU/410-512--------------------------------P---QWHN--LVD...KKLIL-------K--QGLID--KR..K-----
D8M3A3_BLAHO/75-180--------------------------------E---AIER--VLGE..GERCR-------Y--ASIVV--HV..H-----
F2U695_SALR5/410-513--------------------------------S---PWHS--FLNE..GELII-------K--TGLVD--KR..R-----
A8PPP4_BRUMA/451-551--------------------------------.---KYHR--FVE...GNLII-------K--SGLLD--KK..K-----
I1NTT9_ORYGL/392-497--------------------------------S---RWQD--FLEP..GESVV-------L--ISKLK--KI..N-----
W5J907_ANODA/470-570--------------------------------.---MWEP--FAE...GEKIL-------K--LGYVH--KR..K-----

PF15411

L8FXT1_PSED2/322-458--------------------------------S---RFGK-----LRLYGTIR-------V--GKD..--....KV----
U4LT07_PYROM/417-540--------------------------------E---HFGE-----LLLHGQFS-------V--IKGDQ--K...GD----
L8GCG2_PSED2/446-567--------------------------------N---QFGD-----LLLHGVFT-------V--ITGK.--....SD----
G8B9T7_CANPC/472-606--------------------------------K---DQGE-----LLYHGIVG-------V--RD...--....AD----
S8E8S9_FOMPI/218-342--------------------------------S---GLGP-----LQMYDLLS-------V--RR...--....DA----
C0S734_PARBP/64-174--------------------------------Q---RFGK-----LKLHGVVR-------V--GKD..--....RA----
E7FHG6_ASHGO/465-600--------------------------------A---KFGE-----LLYFDKVN-------I--STSNS--....NE----
C5DFZ5_LACTC/451-585--------------------------------A---KFGE-----LLYFDKVA-------I--STGNG--....NE----
Q5B2R3_EMENI/457-581--------------------------------Q---RFGK-----LRLHGHMR-------V--GKD..--....RE----
A1CE88_ASPCL/310-419--------------------------------A---RFGK-----LRLHGHMR-------V--GKD..--....RE----
Q6CBW7_YARLI/468-578--------------------------------E---DFGD-----LLYMDHLT-------I--AK...--....ES----
Q5KFX7_CRYNJ/909-1028--------------------------------D---SLGQ-----LRLFDILT-------V--RK...--....GS----
C5DV96_ZYGRC/480-617--------------------------------A---KFGE-----LLYFDKVF-------I--STSNS--....SE----
K0KM79_WICCF/509-632--------------------------------N---SFGE-----LLFFDKVI-------V--KDNSK--....TS----
J0HE23_COCIM/382-505--------------------------------E---AFGE-----LLRFGTFI-------V--IKGDA--G...KD----
B6QI46_PENMQ/316-424--------------------------------Q---RFGK-----LLLHGSLN-------V--GKD..--....RE----
G7XEK3_ASPKW/313-424--------------------------------N---RFGK-----LRLHGHMS-------V--GKD..--....RT----
J3QBA5_PUCT1/361-480--------------------------------K---DFGV-----LQKYDQLY-------V--EK...--....EA----
B6JVU8_SCHJY/392-503--------------------------------K---HFGS-----LLVWEIVP-------V--AK...--....GD----
I1BLT9_RHIO9/201-314--------------------------------D---GFGS-----LLLHDKLS-------L--FQC..--....GI----
E6ZVA8_SPORE/482-616--------------------------------K---TFGL-----LLLSDVFM-------V--AK...--....SD----
A8PVU8_MALGO/415-566--------------------------------R---TFGS-----LLLSDTFV-------V--SK...--....GD----
M1VVE6_CLAP2/435-562--------------------------------E---TFGK-----LMMHGQHI-------V--ITAK.--....ND----
C4XY43_CLAL4/465-600--------------------------------.---EQGE-----LLYHSVVS-------V--KD...--....GD----
S2KBJ9_MUCC1/386-503--------------------------------D---VYGN-----LMLQDKLI-------I--STNAT--....ES----
G4T894_PIRID/458-613--------------------------------D---KTGP-----LLLDEVFG-------I--SGD..--....KR----
E3K951_PUCGT/463-582--------------------------------K---DFGL-----LKKYDQIH-------V--EK...--....EA----
M3J399_CANMX/484-622--------------------------------D---AQGE-----LLFHGHVG-------V--KD...--....AD----
U9SS96_RHIID/417-534--------------------------------S---QFGN-----LLLEDVFI-------M--SK...--....ED----
H6C2C5_EXODN/429-537--------------------------------Q---RFGN-----LRLHGVIR-------V--GKD..--....RH----
M2N2Q4_BAUCO/388-510--------------------------------S---GFGE-----LLLYGTFT-------V--LKSEN--LASGKD----
W1QFU0_OGAPD/431-554--------------------------------.---.AGE-----LLYANQVT-------V--KDLLT--DG..HS----
Q6CTG1_KLULA/462-594--------------------------------A---KFGE-----LLYFDRIS-------I--STSNS--....NE----
R7Z2B7_CONA1/307-419--------------------------------S---QFGK-----LRLHGNVR-------V--GKD..--....RQ----
M7X9M7_RHOT1/492-610--------------------------------N---SFGD-----LLLQETFV-------V--IK...--....SD----
F2SVI5_TRIRC/339-454--------------------------------S---RFGK-----LNLHGTIR-------V--GKD..--....KN----
R0IDL4_SETT2/326-435--------------------------------S---RFGK-----LRLHAHIR-------V--GKD..--....RQ----
SCD1_SCHPO/428-541--------------------------------Q---YFGQ-----LLVWDVVN-------V--CK...--....AD----
B0CTT2_LACBS/383-504--------------------------------S---DLGP-----LQMYDLLS-------V--RR...--....DS----
I1S1B1_GIBZE/432-552--------------------------------E---QFGK-----LLLHGVYG-------V--ITGK.--....TD----
M2NHU0_BAUCO/429-542--------------------------------S---RFGR-----LLLHGVVR-------V--GKD..--....KQ----
S3D7J5_GLAL2/462-592--------------------------------N---RFGK-----LRLYGTIR-------V--GKD..--....RQ----
Q2GPG0_CHAGB/419-538--------------------------------D---HFGD-----LLMHGVYT-------V--VTGK.--....GD----
A5E275_LODEL/534-703--------------------------------.---DQGE-----LLHHGVVG-------I--KD...--....SE----
A5DJC8_PICGU/473-589--------------------------------K---EMGE-----LLHHGIIG-------V--KVK..--....DE----
D5GGD7_TUBMM/421-541--------------------------------E---HFGE-----LLLHGQFS-------V--IKGDP--K...GD----
G8XZ82_PICSO/475-610--------------------------------K---DQGE-----LLYHSAVG-------V--RD...--....SD----
I2GVT9_TETBL/484-621--------------------------------S---KFGE-----LLYFDKVQ-------I--STSNT--....SE----
N1JBG8_BLUG1/461-585--------------------------------D---QFGD-----LLLHGYFP-------V--LTGK.--....SD----
G1XAU9_ARTOA/439-555--------------------------------D---HFGD-----LLLYGQFT-------V--IKGDA--K...GD----
G7E2X4_MIXOS/392-510--------------------------------S---TFGN-----LLLEDTFM-------V--IK...--....NE----
B0D191_LACBS/477-620--------------------------------E---NFGE-----LLLDDIFV-------V--TK...--....SD----
B4R7P5_DROSI/265-372--------------------------------.---QYGR-----LLLDGELH-------I--KAHE.--....DQ----
S7ZA81_PENO1/323-431--------------------------------S---RFGK-----LRLHGQMR-------V--GKD..--....RE----
S7ZSU9_PENO1/383-506--------------------------------E---AFGD-----LLRFGTFA-------V--VKGDS--G...KD----
Q7PLZ7_ANOGA/418-525--------------------------------E---QYGR-----LLLDGDLN-------I--KAHE.--....DQ----
N1JM33_BLUG1/404-516--------------------------------S---RFGK-----LRLHGKIR-------V--GKD..--....KI----
R4XCX7_TAPDE/388-502--------------------------------A---SFGS-----LLLEDTFQ-------V--TK...--....GE----
G9NQW5_HYPAI/397-517--------------------------------E---SFGK-----LLLHGVYG-------V--ITGK.--....SE----
Q0U2Z5_PHANO/430-542--------------------------------S---RFGK-----LRLHGHIR-------V--GKD..--....RQ----
H6BPC6_EXODN/387-506--------------------------------A---ALGE-----LLLHGTFN-------I--VKDGS--L...RS----
F0X7S3_GROCL/411-531--------------------------------E---HFGK-----LLLHGVHT-------V--VTGK.--....SD----
G3J9K1_CORMM/455-571--------------------------------E---RFGQ-----LRLYGTLH-------V--GKD..--....KK----
B2VWD7_PYRTR/472-592--------------------------------E---GFGD-----LLLHGQYT-------V--LKGES--MSS.KN----
S9W2N8_SCHCR/425-538--------------------------------.---FFGQ-----LLLWDVVS-------V--SK...--....AD----
Q4P6E0_USTMA/492-614--------------------------------E---HFGP-----LALHDLLN-------I--RQ...--....DS----
K5UKM2_PHACS/138-258--------------------------------Q---GLGP-----LQMYDLLA-------V--RR...--....DA----
D5G6T9_TUBMM/297-409--------------------------------.---RFGK-----LRLHGTIK-------V--GKD..--....CQ----
C4QYR2_PICPG/477-615--------------------------------S---TFGD-----LLFHSNLT-------V--ID...--....SD----
E9CRC3_COCPS/316-427--------------------------------D---RFGK-----LRLHGRLK-------V--GKD..--....RR----
G4TBK8_PIRID/436-574--------------------------------S---NFGE-----LLLDDVFM-------V--TK...--....SG----
M7TPR1_BOTF1/430-561--------------------------------N---RFGK-----LRLYGTIR-------V--GKD..--....RQ----
M3C0H4_SPHMS/505-618--------------------------------D---RFGE-----LLLHGVMS-------V--GKD..--....RQ----
D8Q9F8_SCHCM/416-560--------------------------------E---NFGR-----LLLDDVFT-------V--TK...--....SD----
U5H7X6_USTV1/405-528--------------------------------N---SFGE-----LLLMEPFV-------V--IK...--....ND----
D6RLF0_COPC7/420-561--------------------------------E---NFGE-----LLLEDVFV-------V--TK...--....SD----
M2RFB3_CERS8/410-543--------------------------------S---NFGA-----LLLDDVFS-------V--TK...--....SE----
G3ANH9_SPAPN/475-609--------------------------------S---DQGE-----LLHYGKVG-------V--KD...--....GE----
D8Q1A2_SCHCM/270-391--------------------------------S---DLGP-----LQMYDLLT-------V--RR...--....DN----
I1BWV5_RHIO9/177-288--------------------------------D---KYGQ-----LLLHDKLT-------L--QKAD.--....SE----
R9AUY5_WALI9/1302-1440--------------------------------S---SFGN-----LLIEDMFN-------V--NK...--....NH----
M7SFW8_EUTLA/395-516--------------------------------E---QFGR-----LLQHGVYT-------V--ITGR.--....SD----
F9X5J1_MYCGM/456-563--------------------------------D---RFGK-----LLLHGLVS-------V--GKD..--....RN----
J3PFZ1_GAGT3/436-555--------------------------------T---QFGS-----LLLHGVHT-------V--LTGK.--....TE----
D8Q823_SCHCM/499-642--------------------------------E---KFGR-----LLIADQLV-------V--TR...--....EG----
V2XX15_MONRO/414-554--------------------------------E---NFGQ-----LLLDDIFV-------V--TK...--....SD----
R1EWD6_BOTPV/334-449--------------------------------S---RFGK-----LRLHGHVR-------V--GKD..--....RQ----
F4RFQ9_MELLP/829-937--------------------------------T---DFGS-----LKLHDRIQ-------V--RK...--....QS----
Q0CQU8_ASPTN/384-507--------------------------------E---SFGE-----LLRFGTFT-------V--IKGDN--G...KD----
M7X2J5_RHOT1/436-549--------------------------------E---EFGQ-----LRLYDTVN-------V--RK...--....DA----
E3K331_PUCGT/477-609--------------------------------.---TFGQ-----LVLEDTFT-------V--VK...--....NE----
B8N7H3_ASPFN/313-422--------------------------------Q---RFGK-----LRLHGQMR-------V--GKD..--....RE----
G4TIK6_PIRID/427-548--------------------------------.---GLGP-----LQMFDILS-------V--RR...--....DV----
S2JJT5_MUCC1/389-502--------------------------------D---SFGS-----LLLHDKLV-------M--QQP..--....DE----
Q59YK6_CANAL/488-627--------------------------------D---AQGE-----LLFHGQVG-------V--KD...--....AE----
C4JQ35_UNCRE/311-422--------------------------------D---RFGK-----LKLHGKLK-------V--GKD..--....RR----
K5UWD4_PHACS/357-490--------------------------------S---NFGT-----LLLDDIFT-------V--TK...--....SD----
G1X4D9_ARTOA/385-499--------------------------------S---RFGK-----LRLFGTIK-------V--GKD..--....CQ----
K1X859_MARBU/542-671--------------------------------S---RFGK-----LRLYGTIR-------V--GKD..--....KK----
V2XVI9_MONRO/375-500--------------------------------H---TLGL-----FVREEELL-------V--RK...--....HD----
G7E3N8_MIXOS/651-756--------------------------------.---ELGP-----LRLYEPIE-------V--RK...--....EG----
R7YYY5_CONA1/430-547--------------------------------E---GFGD-----LLLHGTFT-------V--LKGDT--....KD----
C5MGV9_CANTT/489-625--------------------------------D---AQGE-----LLFHGTVG-------V--KD...--....SD----
C5FRQ7_ARTOC/318-432--------------------------------S---RFGK-----LNLHGTIR-------V--GKD..--....RT----
U1GBI6_ENDPU/442-552--------------------------------S---RFGK-----LRLHGTIH-------V--GKD..--....RQ----
I4YHQ5_WALSC/334-473--------------------------------G---SFGN-----LVIEDMFN-------V--NK...--....NQ----
G9A084_TORDC/483-619--------------------------------A---KFGE-