Sequence alignment for CL0267

PF00861

F7YKM5_VIBA7/1-117MDKKASRIRRA-----------TRARRKIAELGAT...RLVVHRTPRHVYAQVIASNGSEVIAAASTVEKAI-R-E..LV
RL18_HAEIN/1-117MDKKSARIRRA-----------ARARHMMREQGVT...RLVIHRTPRHIYAQVIAPNGSEVLAAASTVEKAI-R-E..QV
R4I0E9_9ENTR/1-117MDKKSARIRRA-----------TRARRKLKELGAT...RLVVHRTPRHMYAQVIAPNGSKVLVAASTLEKAI-T-E..QL
RL18_BACSU/5-120TSKNAARLKRH-----------ARVRAKLS..GTAERPRLNVFRSNKHIYAQIIDDVNGVTLASASTLDKDL-N-....V
RL18_GEOKA/5-120VDRNAVRKKRH-----------ARIRKKIF..GTAERPRLSVFRSNKHIYAQIIDDTKSSTIVSASTLDKEF-G-....L
RL18_MYCMS/3-116FTKAEARKRRH-----------FRVRQKVV..GTAERPRLNVFKSNTNFYAQIIDDTKGVTLVSASTLKMDL-K-.....
RL18_AQUAE/5-124KTRREKRLRRH-----------KRIRKKVF..GTPERPRLCVYRSLKHFYAQIIDDTIGHTLVSASTLDPEF-E-KITGK
RL18_SYNY3/3-120STRKSATQRRH-----------RRLRRHLS..GTSERPRLAVFRSNDHIYAQVIDDVAQHTLAAASTLDPDL-K-K..SL
RL18_SYNE7/3-120VSRRESTRRRH-----------RRVRRTIV..GTPARPRLSVFRSNNHIYAQVIDDAAGHTLAAASSLDPDL-R-Q..SL
RL18_MYCPN/2-116KTRTEQRRLRH-----------KRIVKKIRATNHDNRVVLMVIKSLNHISVQAWDFSQNIVLASSSSLALKL-K-.....
RL18_BORBU/5-119KEAEQRKLRRK-----------KRIKDKIG.RGVASRPRITVFKSNRYFYAQVIDDSKGHTIASISTIEKSL-N-.....
RL18_HELPY/8-119YKKKALRDRRK-----------LRIKSKLL..GDALRPRVSVFRSNRYFYAQAIDDVKQSTITHIDGRKMGF-K-.....
RL18_CHLTR/6-123YKKTSGKARRA-----------LRVRKALK..GCSLKPRLSVVKTNKHVYVQLIDDVEGKTLASISTLAKVA-K-T..SG
RL18_STRCO/12-127AYKRAAIKRRH-----------IRIRKNLS..GTAERPRLVVTRSNRHIVAQVIDDIKGHTLASASTLDTSI-R-....G
RL18_MYCTU/7-122ATRRISRLRRH-----------TRLRKKLS..GTAERPRLVVHRSARHIHVQLVNDLNGTTVAAASSIEADV-R-....G
C5CC47_MICLC/9-124KGKFNARTRRH-----------LRVRKRIS..GTTVRPRLVVNRSARHMFVQVVDDTQSRTIAYASTMEADV-R-....A

PF17144

A0A010RHR7_9PEZI/27-192SRFQTKYKRRRSGKTDYYAR..KRLITQAKNKYGAPKYRLVVRFTNRDIIMQIVTSELTGDKVFVAAYAHEL.P.AYGIT
U9TL92_RHIID/14-176KRYQVKYRRRREGKTDYYAR..KRLVVQAKNKYNSPKYRLVVRFTNTDVIVQIIYAKLDGDFVLTAAYSHEL.K.KYGIK
A0A016TA30_9BILA/14-175KRYQVKLKRRRQGKTDYYAR..KRLTVQDKNKYNTPKYRLIVRFTNKDVIAQIAYSKIEGDVIVASAYSHEL.P.AFGIK
A0A022RZY9_ERYGU/14-175KRFQVKFKRRREGKTDYRAR..IRMINQDKNKYNTPKYRFVVRFTNKDIICQIVSATITGDHVLAAAYAHEL.P.HFGLD
A0A023B1A6_GRENI/14-176SRFQVKYRRRREGRTDYQAR..RNMIRQELCKYNTPKYRFVVRFTNRKVICQIVYATVCGDKVIACADSTEL.A.RYGMP
A0A023EQ43_AEDAL/14-176KRYQVRFRRRREGKTDYYAR..KRLIFQDKNKYNTPKYRLIVRLSNRDITCQIAYARIEGDRIVCAAYSHEL.P.RYGVK
A0A023FJK3_9ACAR/14-176KRFQVKFKRRREGKTDYYAR..RRLVVQDKNKYNSPKYRMIVRITNRDIICQIAYARIEGDVIVCAAYAHEL.P.RYGVK
E7KIW9_YEASA/14-176SRFQTPFRRRREGKTDYYQR..KRLVTQHKAKYNTPKYRLVVRFTNKDIICQIISSTITGDVVLAAAYSHEL.P.RYGIT
A0A024GN61_9STRA/14-185KRYQVKYRRRREGKTDYRAR..KRLITQDKNKYNSPKYRLVVRITNTKVICQIAYAEIDGDKILAEATSTEL.P.RYGLK
A0A024W0F1_PLAFA/14-178KRYQVKYRRRREGKTDYRAR..KALILQDKNKYNAQKLRFVVRKTNSQVICQIACAHIEGDKILAEAKSKEL.I.RYGIP
A0A058ZDQ8_9EUKA/14-176KRFQTQYRRRRDGKTDYYAR..QRLVNQDKNKYASPKYRFVVRITNNDIIAQFIYSKIEGDYVVSSAYAHEL.K.NFGIT
A0A059EMQ9_9MICR/13-174SRFQTKLRRRREGKTDYKHR..SAMIRQDANKQGAVKNRIVVRITNKKIICQVVKAYVVGDRTIVSADSTEL.K.KYGIN
A0A059LQQ5_9CHLO/14-176SRYQVKYRRRREGKTDYRAR..LRLVTQDKNKYNTPKYRMVVRFTNKDIVCQLAYSTLAGDVVVASAYSHEL.P.KYGLT
A0BUQ3_PARTE/14-171KRFQTKFRRRREGKTDYYAR..SRLIVQDKDKYNSPKYRFVVRHTNTKIICQVIYATLKGDKVVAAAESTEL.K.RFGLT
A2DNM5_TRIVA/13-170SRFQTKFRRRREAKTDYVQR..TQLIQQDKTKYGAAKYRLVARITNTKVIAQIVVAELTGDKTVCQALSTEL.P.KYGIK
A4HMK9_LEIBR/14-182KRFQVKYRRRREGKTDYHAR..RQMVLQDKTKFGSPKYRLVVRTTNKDIIAQIVQAKIAGDEVLMAAYAHEL.P.AFGIE
A4S796_OSTLU/21-183SRFQVKFARRRAGKTDYYAR..QRLITQDKNKYNSPKYRFVVRFTNRDVICQVVYATLAGDVCIASAYSHEL.P.KYGMK
A7APX9_BABBO/14-176KRFQVKYRRRREGKTDYYCR..RRMVLQDKNKYASPKYRFVVRFTNKRIICQIISATIVGDKVHASADSTEL.K.HYGVN
A7RMX8_NEMVE/14-176KRFQVKFKRRREGKTDYYAR..KRLITQDKNKYNTPKYRFVVRITNKDIICQIAYAKLDGDRVLASAYAHEL.P.NFGVK
A7TZ37_LEPSM/14-176KRYQVKFRRRREGRTDYYAR..KRLVVQDKNKYNTPKYRMIVRFTNKDICCQIAYARIDGDRIVEAAYAHEL.P.RYGVK
A8E608_XENLA/14-180KRFQVKYRRRREGKTDYYAR..KRLVAQSKNKYNTPKYRLVVRFTNKDVIAQVAYAKIEGDQIIAAAYSHEL.P.RYGIK
A8HP55_CHLRE/14-176SRFQVKYRRRREGKTDYRAR..LRLVKQDKNKYNTPKYRLVVRFTNRDITCQIVRSTIKGDIVEAAAYAHEL.P.DYGLE
A8NXM3_COPC7/14-178SRFQVKFRRRREGKTDYYAR..KRLVTQAKNKYNAPKYRLVVRLTNKDIIVQVVYARIQGDFILTQAHSREL.P.RYGIK
A8UEW1_AREMA/18-180KRFQVKFKRRREGRTDYYAR..KRLVIQEKNKYNTPKYRMIVRFTNKDVTCQIAYAKIEGDVIVSAAYAHEL.P.SYGVK
A9BKN0_HEMAN/14-166SRFQLKWRRRREGKTDYYSR..KRLITQDKRKYNSPKYRMVVRITKKNIICQFTQSLLEGDRVLMAGYSNKIGK.QLEFF
A9S013_PHYPA/14-175KRFQVKYKRRRAGKTDYRAR..IRLTTQDKNKYNTPKYRYVVRFTNKDIVAQITYATLAGDIVLTSAYAHEL.P.RYGLK
A9UDR2_9BILA/14-176KRFQVKFRRRREGKTDYYAR..RRLVVQEKNKYNTPKYRMIVRFTNKDVICQVAYARIEGDVIVCAAYSHEL.P.RYGLK
A9UT63_MONBE/7-169KRFQVKYRRRREGKTDYYAR..TRLVRQEKNKYNTPKYRLIVRRTTSDVVAQIAYSRLEGDYIMAAAYSHEL.P.QFGFK
B0EFW2_ENTDS/14-177KKYQTQFRRRREGKTDYYAR..RKMIFQDKDKFKTPKYRVVVRITNKTVIAQIAYSEIIGDKILCAAYSHEL.P.RYGVK
B3RNF8_TRIAD/14-176KRFQVKYKRRREGKTDYFAR..KRLCTQDKNKYNSPKYRMVVRLTNKDVICQIACAKLEGDEIFCAAYSHEL.P.RYGIK
B5YLN7_THAPS/14-185KRYQVKFRRRREGRTDYRQR..KRLCCQAKNKYQSPKYRFVVRFSNKQVICQIAYTLIDGDRILTSASSNEL.P.RYGLK
B6AAM9_CRYMR/14-176SRYQVKPRRRREGKTDYQAR..RAMITQDKTKYNSPKYRLVVRSTNRRVICQIISSTIEGDRVLCQADSTEL.V.HYGVP
B6K5U0_SCHJY/13-175SRYQTKYRRRREGKTDYYAR..KRLISQAKNKYNAPKYRLVVRISNRFVTCQIVSSKVNGDYVLASAHSSEL.P.RYGIK
B6SQF0_MAIZE/14-178SRFQVKARRRREGKTDYYAR..KRLVAQAKNKYNSPKYRLVVRFTNKQIIVQIVYAKLQGDFVFCAASSSEL.P.RYGVK
B7XI44_ENTBH/12-173KNFKVKLRRRREGKTDYKHR..INMLRQDMYKFGSVKSRLVVRITNTKIICSIQKAYADGDRVVAYADSTEL.K.KFGIH
B9PV52_TOXGO/14-175KRYQVKYRRRRQGKTDYAAR..RALVLQDRNKYNAHKHRLVVRLTNKRIICQVVYSTIEGDRVLATAESTEL.P.RYGVK
C0L2Z7_PECGU/15-176SRYQVKFKRRREGKTDYFAR..KRLICQDKNKYNTPKYRLIVRFTNKDIITQIAYARIAGDFIICSAYAHEL.P.RYGLK
C1LUA3_SCHJA/14-176KRFQVKFKRRREGKTDYYAR..KRLIWQDKNKYNTPKYRLVVRFTNKDIICQIIYARIDGDRVLCSAYAHEL.P.RYGVK
C4V9T8_NOSCE/20-181SRFQVKRRRRRECKTNYRHR..INLIKQDYNKQGALKFRLVVRRTNTKVICQITRSYIDGDRVFAFADSTEL.K.NYGVD
C5KB00_PERM5/14-178KRYQTKYRRRREGKTDYFQR..RRMVKQDKNKYNTPKYRLVVRITNTKVICQVIYATITGDRVLAAAESTEL.K.NYGIP
V6TYE8_GIAIN/14-184KRFQVQFRRRREGKTDYQAR..KALIIQDKNKYATPRYRFVVRRTNKDIICQVTAAELTKDRVVCAAYSHEL.P.RYGIP
D2VLC1_NAEGR/14-176KRYQVKFRRRREGKTDYRAR..QKLITQDKTKYNTPKYRFVVRVTNKDIVCQIVAPKLKGDEVICAAYSHEL.T.RFGIP
D3BER0_POLPA/14-176KRYQVQFRRRREGKTDYQQR..HRLITQDKNKYNSPKYRLVARFTNTKVIAQVIYSKIVGDFVLASAYSTEL.P.RYGVS
D5G4X7_TUBMM/87-252SRYQTKYRRRREGKTDYYAR..KRLITQAKNKYNAPKYRLVVRFTNRDIITQIIYSEIAGDKVFCSAYAHEL.P.RYGIK
D8R9P8_SELML/14-176KRYQVKYRRRREGKTDYRAR..VRLTNQDKNKYNTPKYRFVVRFSNKDIVAQIAYATIAGDVIMAAAYAHEL.P.RYGLK
E0S7L1_ENCIT/12-173KNFQVKRRRRREGKTDYKHR..TNMIRQDSNSYGSVKHRLVVRITKSRVICQITGAYMDGDRVMVYADSSEL.K.KYGIN
E1ZT19_CHLVA/14-176SRYQVKYKRRRAGKTDYRAR..LRMCTQDKNKYNTPKYRLVVRFTNRTVVCQVAYATMAGDKVICAAYSSEL.P.RYGLK
E4XMZ8_OIKDI/24-186KRYQPKFKRRREGKTDYFAR..KRLCVQDKNKYNTPKYRLVVRVTNKDIIAQIAYARLQGDVIVTSAYAHEL.P.RYGVS
E5S3L8_TRISP/74-236KRYQVKFRRRRQGKTDYHAR..RYLVVQDKNKYNTPKYRLIVRITNKDIVAQIAYAKIGGDVVVTAAYSHEL.P.KYGIK
E6R224_CRYGW/14-177SRYQVKPRRRREGKTDYQAR..RGLVSQAKNKYASPKYRLVVRITNKQVICQIVYAKLQGDVVFAHATSKEL.P.RYGIK
E6ZPA5_SPORE/14-177SRYQVKYRRRREGRTDYYAR..KRLVSQAKNKYNAPKYRLVVRFSNRYVTCQIVHAKIVGDFVLTQASSKEL.P.RYGVK
A0A0D2U8A3_CAPO3/14-175KRYQVQFRRRRQGKTDYYAR..KRLITQDKNKYNSPKYRLVVRFSNRDIVAQIASAKIEGDVILAAAYAHEL.P.RYGVK
F0XY43_AURAN/14-185KRYQVKYKRRREGKTDYRAR..KRLITQDKNKYNTPKYRLVVRFSNKYVTCAVHSSELVGDKCIATATSKEL.G.RYGLK
F1RLP2_PIG/21-182KKKKKKKKKKKKKKKKKKKKKKKTSGHHDKGKYHAPKHRMLVHGTKRDIICQT......GDQIICAAQAHKL.P.KYGVK
F2HIH8_9CRYP/14-164SRFQVKWKRRRKGKTDYYSR..KKMISKDKRKHNFHKYRVVVRFSKHNIVCQFINSKFEGDHILNSVYSSKL.K.KMGIY
F2PXL6_TRIEC/14-170SRFQTKFKRRRQGKTDYYAR..KRLITQAKNKYNSPKYRLVVRFTNRDIITQIVTAEISGDKVLACAYSHEL.K.RYGIK
F2UEH8_SALR5/40-203KRYQVKYRRRRTGQTDYFAR..RKLIQQDKNKYNTPKFRLVVRRTNRDVIAQVAYSRLEGDYVVAAAYSHEL.K.QFGIK
R0M6F5_NOSB1/10-171SRKQLKRRRRREAKTNYKHR..INLIRQDCNKQSAVKFRLVVRRSNKKVVCQITRAYVEGDRVFAYADSSEL.E.KYGVN
F4NUR8_BATDJ/14-176KRYQTKYRRRREGKTDYYAR..KRLVTQAKNKYNSPKHRLVVRITGKDIVCQIVYSKIQGDVVMAAAYSHEL.P.KYGIK
F6PJ58_MACMU/14-166ERYRVKFRRRQEGKTDFCAR..KCLEIQDKNKYNTPKYRMIVCVT......KIAYARIEGDMIVCASYS......KYGVK
F6Y3M5_CALJA/21-182KGYQVKFRRRREGKTDYYAQ..KRLVTQDKNKYNTPKYRMIVHVTNRDIICQIAYARIEGNMIISAVYAHEP.P.KYGVK
F7C4N5_MACMU/14-174KRYQVKFRRRREGKTDYYAR..KRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHEL.P.KYGVK
F7HBE1_CALJA/19-171RDT....KNKQTKKTDYYAW..KRLVIQDKNKYNTPKCRMIVCVTNRDIICKIAYAHIEGDMVVCATYAHT..D.CQGVN
F7HVK0_CALJA/20-181KRYQVKVRRQQEGKMDYYTQ..KRLVIQDKNKYNTPKYRMIVHVTNRDIISQIAYALLEVDMIACAAYAHKP.P.KYGVN
F7ILB7_CALJA/22-180KRYQVKFRR.QEGKT.YYAW..KRLVIQDKNKDNTPKYRMTVRVTEIAFV..RCFCPYGGEMIVCATHAHKL.S.KHSMK
G0QVW1_ICHMG/28-190KRFQTKYRRRREGVTDYYAR..KRLIIQDKDKYNTPKYRLVARCTNRRVIAQIIYATIRGDRVLCSADSFEL.R.RFGLK
G1LB10_AILME/19-179KRHWVKSGR.GQSKTNNYAW..KCWVIKDQSKSSTPKHRMIVRVTNRDITCQTAYARREGDTTVCAAHAHAL.P.KYGVK
G1Q087_MYOLU/21-182KRYQVKCRKQREGKIDYYAQ..KRMVIQGKNTYNTPKYRMIVCVSNKNSICQIPYARIEGDKIVCVAYAHG..P.KYGVQ
G1Q8N7_MYOLU/15-166VAFR.AFKKKREGKTDYYAQ..KHLVIQDKN.....KYRMIVRVTNRDI.CHIAYVCIEGDMIVCATYAHEL.P.KYGVK
G3TSV6_LOXAF/14-173KRYQVKFRRGGEGKTDYYSQ..KCLVIQDKNKYNVPKYK.IVHVNNRDTICQIAYAPVEGNMILRAVYAHEF.P.TSGVK
G5B9L4_HETGA/14-171KRYQGKFR.....KTDYYVQ..KCLVIQGKSKYNTPKYRMIVLLTNRDIICQIAHVHTEAGMMVCAANAHEL.P.KYGVK
G7DXW6_MIXOS/14-176SRYQVKYRRRREGKTDYRAR..KRLISQAKNKYNSPKYRLVVRFTNKDIICQVVHAKIVGDIVLAAAYSHEL.P.RYGIK
G8FUG2_9MYCE/14-176KRFQVQFRRRRECKTDYQQR..QRLITQDKNKYNSPKYRLVARFTNKDIIAQVIYSKIVGDFVLAAAYAHEL.P.RYGVK
H0W8V5_CAVPO/20-181KRYQVKFRR.QEGKTDCYAE..KCLVIQDKNKYNTPKHKMILCITNRDTIFQITYAHIKGDLIVCVAYVHEL.P.KYSVK
H0XJH6_OTOGA/21-179KRHQVKFK....SKTDYYTR..KLLVIQDKNKYNTPKYRMIVCVTNRDIMCQTASAHIEGDITVCIAYASEL.P.KCSVK
H8Z9C6_NEMS1/14-176KRMRLPLRRRREGKTDYQQR..HNLIRHNKANYGEVKSRFVVRITNTKVICQIVQAYTIGDKVICAADSTEL.K.KYGIT
H9B928_EIMTE/14-176KRFQVKYRRRREGKTDYAAR..RRLILQDKNKYNAPKYRFVVRVTNSRVLCQVMYATLQGDRLVCSADSQEL.T.RYGIK
I3LS96_PIG/19-177KRHQVKFRR.QEGKTDYYAQ..KQLVIQDKNKYNTLKYRMTVCVTNRDRMCQIAYTHIEGD.IVCVAFAHEL...KYGVK
I4YAA1_WALMC/195-358SRYQVKYRRRREGKTDFYAR..KRLVTQAKNKYNAPKYRLVVRFTNKDIICQIVSSKIQGDVVLTHARAREL.P.KYGIK
I7I857_BABMI/14-182KRFQVKYRRRREGKTDYYAR..KRLVQQDKNKYSSPKYRLVVRATSTRIICQIVSSTIIGDKIHASADSSEL.K.HFGIQ
J7G8P4_9CRYP/14-165SRFQVKWRRRREGKTDYYSR..KRMICQDKRKYTSPKYRMVVRKTKKNIICQFIQPKIEGDHVLSVVYSKNL.K.DFGIP
J9DSB3_EDHAE/39-201SRFQVKKRRRREGKTDYKQR..RKLLTQDNTRYGVYKSRLVVRFTNTKVICAVVRPTYSGDNILCYADSTEL.K.KYGIN
J9ID52_9SPIT/14-178SRYQVKFRRRREGKTDYYAR..RRLVQQDKNKYDSKKYRLVVRRTNRRVITQIIFATIKGDRVLCQADSFEL.K.KFGLE
K8Z8X1_9STRA/14-187KRYQTKFRRRREGKTDYRAR..KRMVAQDKNKYNTPKYRLVVRFTNRYCIAQIVYATIDGDKVLAAANSKEL.A.RYGLK
L1I3R0_GUITH/14-187KRYQTKRRRRREGKTDYRAR..KRLITQDKNKFNTPKYRMIVRTSNRYVYCQIAWATTKGDRILAAACSKEL.PLKYGLP
L2GKV0_VITCO/12-173RNFQTKRRRRREGKTDYQHR..TNLLRQDCTQHNNVKSRLVVRITNTKVICAIVKAFIDGDRVVAYADSTEL.R.NYGVN
L2GR30_VAVCU/12-173HRFQTKKRRRRENKTDYTHR..RNMLRPNLKNYGAVKSRLVVRRTNKKIICQIVKAYADGDRIVVEATSDEL.R.QYGLC
L8GRC7_ACACA/14-177KRYQVKYRRRREGKTDYQAR..NKMIIQAKNKYNTPKYRLVVRVTNKDIICQIAYAKIKGDMIMTAAYSHEL.P.RYGLK
L9K2D7_TUPCH/14-176KRYQVKFIRQQEGKTDYYAR..KRLMIQDKNKYNTPKYRMIVLVTNRDVICRIAYVCIEGDVTVCATYTHEP.P.EHGVK
M1V7H2_CYAME/14-175KRFQVKPRRRREGKTDYHAR..RALIIVDKTKYNTPKYRLVVRITNSDVICQIVTARVEGDKVIAAAYAHEL.P.RYGIK
M1XMR4_9METZ/14-176KRFQVKYRRRREGKTDYYAR..KRLCVQDKNKYNTPKYRLVVRFTNKDIVTQVAYARLQGDIILSSAYSHEL.P.RYGIQ
M2Y2S8_GALSU/14-175KRFQVKPRRRREGKTDYRAR..LKLITQDLRKYSSPKYRLVVRFTNRDIVCQFVYARLEGDHILSAAYAHEL.P.RYGIK
M5GC33_DACSP/14-178SRYQVKYRRRREGKTDYYAR..KRLIAQAKNKYNAPKYRLVVRFTNKNIIVQIAYARLQGDFILCAAQSREL.P.KFGIE
RL5_DUNSA/14-176SRYQVKYRRRRQGKTDYRAR..LRLVRQDKNKYNTHKYRLVVRFSNKNVTCQIVYSTIQGDVVMAAAYSKEL.P.NYGLK
RL5_SUBDO/14-176KRYQVKFRRRREGKTDYRAR..KRLVVQDKNKYNTPKYRIVIRFTNTDIICQIIYAKIEGDKVLVSAYAHEL.P.RYGVK
Q9AVW3_GUITH/14-162SRFKLKKRRRRIGKTDYKKR..MKLIRQDKKKFENKKKRIIIRFSKRNLSLQMVNSNVDGDFILLSSYLKNL.S.KLEYK
R1D1T8_EMIHU/14-175QRYQVKYRRRREGKTDYLAR..KRLVVQDKNKYGSPKYRLVVRCTNKDVICQIMHSKIVGDVCLCAAYSHEL.P.KYGIE
R4XAZ7_TAPDE/14-176SRFQTKYRRRREGKTDYYAR..KRLISQAKNKYNAPKYRLVVRFAKKDITCQIVYSKIEGDVVFAAAYAHEL.P.KYGIK
R7QK75_CHOCR/14-175KRYQTKWRRRREGKTDYQAR..RRLVTQDKRKYNSPRYRLVVRFTNKDIICQVVAARIQGDEILTSAYAHEL.P.RYGIK
S7XIG7_SPRLO/20-180QRFQTKKRRRRLCKTNYRRR..TKLIKLDQKNVGEDKSRLVVRITNSKVICQVVKSHLGGDMVVAQATSAEL.K.EFGLK
T1K073_TETUR/14-176KRYQVKFRRRREGKTDYYAR..KRLIWQDKNKYNTPKYRMIVRITNKDIICQIAYSKIEGDYVVCSAYSHEL.P.KFGVK
A0A087W1E5_ECHMU/14-175KRFQVKFRRRREGKTDYYAR..KRLIWQDKNKYNTPKYRFVVRFTNKDIVCQIIYACMDGDRVVATAYSHEL.P.RYGVK
V4CLT1_LOTGI/14-176KRYQVKFRRRREGKTDYYAR..KRLIFQEKCKYNTPKYRLIVRFSNKDITCQVAYAKIEGDVVICSAYSHEL.P.RYGLK
V6LLC9_9EUKA/14-174KRFQVQFRRRRDGLTDYQQR..RALTIQDKDKYAAPKYRLVVRRSNKFVTCQIISAHLGGDKIHCAAYSHEL.P.EYGLK
W2S457_9EURO/14-179SRFQTKYKRRRAGKTDYYAR..KRLISQAKNKYNAPKYRLVVRFTNRDIICQLVTAELTGDKVHAAAYAREL.K.RYGIE

PF00411

RS11_HALMA/10-127------------------------GIAHVHASFNNTIITITDQTGAETLAKSSGGTVVKQNRDEASPYAAMQ--------
RR11_MAIZE/36-142------------------------GIIHVQASFNNTIITVTDPQGRVVFWSSAGTCGFKSSR.KASPYAGQR--------
RS11_SULAC/10-128------------------------GNARIYASQNNTIITITDITGAEIISKASGGMVVKADREKPSPYAAML--------
RS141_MAIZE/27-145------------------------GVAHIFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML--------
RS11_GEOKA/19-128------------------------GIAHIRSTFNNTIVTITDVHGNAIAWASAGSLGFKGSR.KSTPFAAQM--------
RR11_PHYPA/20-129------------------------GVIHIQASFNNTIVTVTDIRGQVVFWSSAGACGFKGAK.KSTPFAAQT--------
W0L7X1_9ENTR/19-128------------------------GVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSR.KSTPFAAQV--------

PF03464

ERF1_CAEEL/153-285-KFGFIIMDGNGCLFGTLQG--NTREVLHKFTVDLPKKHGRGGQSAVRFARLRNEKRHNYVRKVAENSVEQF--------
PELO_HUMAN/136-268-DVAAVVMQEGLAHICLVTP--SMTLTRAKVEVNIPRKRK.GNCSQH......DRALERFYEQVVQAIQRH.--------
PELO_METTH/136-256-KAIILVMEDDVAELGLIRQ--YGVEYRGPITGHIPGKRI...QQRD.....RGKLRREFYESIVESLQKY.--------
DOM34_YEAST/141-274-DTAAVVLQEGIAHVCLVTS--SSTILKQKIEYSMPKKKRT..TDVLKF....DEKTEKFYKAIYSAMKKD.--------
RF1_AERPE/142-276-AIGIIIVERDQATIGLLKG--ARLEVLKELEGFVPGKHKMGGQSQRRYERIIEQMVDEFFKKVGEEASNLL--------
O96203_PLAF7/141-273-KFGFIIVDGNGALFGTIQG--NTREVIRRFTVDLPKKHGRGGQSALRFARLRLEKRHNYVRKVAEVATSVF--------
RF1_HALSA/147-278-LYGLIVLDRRESNVGWLKG--KRVQPVKSAESLVPGKQRKGGQSAQRFARLRLEAIDNFYQEVAGMADDLF--------
RF1_METTH/141-271-TYGLAVLDRKEATIATLKG--KRIDILKTLTSGVPGKHKAGGQSQRRFDRLIDLAAHEFLKRIGEHMNEAF--------
PEL1_ARATH/136-268-DLAVVLMQEGLAQIFLVGR--SVTSSRARIETSIPRKHGP...AIAGYE........SALKKFFENVLQAF--------
PELO_DROME/136-268-DVAAVVMQEGLAHVCLITA--SMTLVRSKIEVSIPRKRK.GSVQQH......EKGLAKFYEQVMQSILRH.--------
PELO_CAEEL/136-268-DVAAVVLHEGLANVCLITP--AMTLTRAKIDMTIPRKR.KGFTSQH..........EKGLEKFYEAVSTAF--------
DOM34_SCHPO/136-268-EIGAVVLDEGLANICLITD--YMTILRQRIDQVIPRKR.RGDSSAYQ......KGLDKFYDSVFQSINSE.--------
ERF1_SCHPO/142-274-RFGFIVMDGHQTLYGVVSG--SAREVLQRFTVDLPKKHGRGGQSALRFARLRDEKRHNYVRKVAEGAVQHF--------
RF1_ARCFU/136-267-LYGLIVLDRREATVGLLKG--KRIEVLDWDTSMVPGKHRQGGQSSVRFERLREIAIHEFYKKVGEMASEAL--------
RF1_SULSO/138-272-VYGLIIVERDEATIGLLKG--ARIEILEEIEGFVPGKHMMGGQSQRRIDRIIDEMYHNFLKEVGEKVNAYF--------
RF1_METJA/141-274-AYGVILVDRNEATIALVKG--RNINILKKLTSGVPGKFKAGGQSARRLERLIDLAAHEFLQRVGQKANEQF--------
B2AWT5_PODAN/146-276-KFGFIVMDGNGALFGTLSG--NTRDIVHKFSVDLPKKHGRGGQSALRFARLREEKRHNYVRKVAELAVQNF--------
I7MKI5_TETTS/145-275-.FGFIVMDGQGALYANLQG--NTKTVLNKFSVELPKKHGRGGQSSVRFARLRVEKRHNYLRKVCEVATQTF--------
Q386S9_TRYB2/146-277-KFGFIVVDGSGTTYATLCG--SVKEKLSSFTVELPKKHGRGGQSKNRFARIRMERRHNYLRKVAEGATQLF--------
RF1_THEKO/140-272-.YGLITVEKNEATIGLLRG--KRIEVIDELTSNVPGKTRAGGQSARRYERIREQETHEFMKRIGEHANKAF--------
RF1_THEAC/144-273-.YGLIVIDRKEATVGFLNG--TRIEVVDNVQSQVPSKHHQGGQSSRRFERLIEIAANEFFKKVGEIANNAF--------

PF00861

F7YKM5_VIBA7/1-117--KNTGNVDAAKAV-------GKAIAER-----ALEKG-------VSAVAFDRS-------------------GF-----
RL18_HAEIN/1-117--KYTGNKDAAAAV-------GKAVAER-----ALAKG-------VQAVAFDRS-------------------GF-----
R4I0E9_9ENTR/1-117--KYSGNKNAAAAV-------GKTLAKR-----ALEKG-------IAKVSFDRS-------------------GF-----
RL18_BACSU/5-120--ESTGDTSAATKV-------GELVAKR-----AAEKG-------ISDVVFDRG-------------------GY-----
RL18_GEOKA/5-120--DSTNNIEAAKKV-------GELVAKR-----ALEKG-------IKKVVFDRG-------------------GY-----
RL18_MYCMS/3-116--.SKSNTLAAQKV-------AEEIAKK-----ALAAN-------ITQVVFDRN-------------------GY-----
RL18_AQUAE/5-124--RGGKSIKDAEVV-------AEIIARR-----ALEKG-------IKKVVFDRG-------------------GF-----
RL18_SYNY3/3-120--SSTATQEASAEV-------GKLVAQR-----AIAKG-------INQVVFDRG-------------------GK-----
RL18_SYNE7/3-120--TSGGNQQASAAV-------GKLIAER-----AQAKG-------VTTVVFDRG-------------------GN-----
RL18_MYCPN/2-116--..NGNKDNAKLV-------GQDIADK-----LVKLK-------LTNVVFDTG-------------------GS-----
RL18_BORBU/5-119--.LGKNIDDVKKL-------GEVLAKR-----LKEKN-------INNLIFDRN-------------------GY-----
RL18_HELPY/8-119--...NTQEDAKKL-------GALFAEE-----LKKAG-------IERAVYDRN-------------------GY-----
RL18_CHLTR/6-123--LTRKNQDNAKAL-------GIKIAEL-----GKGLQ-------VDRVVFDRG-------------------AH-----
RL18_STRCO/12-127--GEADKSAQAKQV-------GALVAER-----AKAAG-------VEAVVFDRG-------------------GN-----
RL18_MYCTU/7-122--VPGDKKARSVRV-------GQLIAER-----AKAAG-------IDTVVFDRG-------------------GY-----
C5CC47_MICLC/9-124--LEGDKTAKAKRV-------GELVAER-----AKAAG-------IEAAVFDRG-------------------GN-----

PF17144

A0A010RHR7_9PEZI/27-192..HGLTNWAAAYAT.......GLLIARRA....LSKLG.......LDKTFTGVE.........E.....AD..GE.....
U9TL92_RHIID/14-176..IGLTNWAATYAT.......GLLAARRV....LTKLG.......LADKYLGIT.........E.....PD..GK.....
A0A016TA30_9BILA/14-175..VGLTNYAAGYAT.......GLLLARRH....LKNLK.......LDQTFKGQE.........D.....VN..GE.....
A0A022RZY9_ERYGU/14-175..VGLSNYAAAYCT.......GLLLSRRV....LKKLE.......MDEEYEGNV.........E.....AT..GE.....
A0A023B1A6_GRENI/14-176..VGLTNYAAAYAT.......GLLCARRV....LQSLK.......LNEVCVGQT.........Q.....AD..GK.....
A0A023EQ43_AEDAL/14-176..VGLTNYAAAYCT.......GLLVARRI....LQKLR.......LDTLYTGCT.........D.....VT..GE.....
A0A023FJK3_9ACAR/14-176..LGLTNYPAAYCT.......GLLLARRM....LQKFK.......LDQVYKGVE.........E.....AT..GE.....
E7KIW9_YEASA/14-176..HGLTNWAAAYAT.......GLLIARRT....LQKLG.......LDETYKGVE.........E.....VE..GE.....
A0A024GN61_9STRA/14-185..VGFKNYSAAYAT.......GLLLGRRV....LQTLG.......LDEKYEGNTEVDAEVVKTE.....VN..GR.....
A0A024W0F1_PLAFA/14-178..VGLKNYAAAYAT.......GLLCARRF....LKSLN.......LDTQFLGVE.........K.....VT..GE.....
A0A058ZDQ8_9EUKA/14-176..VGLTNYAAAYAV.......GLLAARRL....LTKLN.......LASIYEGTT.........E.....VD..GE.....
A0A059EMQ9_9MICR/13-174..FGLTNYSAAYAT.......GLLLARRM....LAKQN.......LAEEFPA.K.........E.....AD..GE.....
A0A059LQQ5_9CHLO/14-176..VGLTNYAAAYAT.......GLLLARRV....LSKYN.......LAKAYAGNT.........E.....DV..GE.....
A0BUQ3_PARTE/14-171..SGLTNYAAAYAT.......GLLLARRT....LKTLK.......MDKFYEGNK.........T.....ID..GN.....
A2DNM5_TRIVA/13-170..LGLSNYPAAYAT.......GLLVARRF....LTQMK.......LADVFK..T.........E.....IT..EE.....
A4HMK9_LEIBR/14-182..HGLTNYAAAYAT.......GLLLARRT....LAKLG.......IADKFQGAK.........E.....AD..GS.....
A4S796_OSTLU/21-183..AGLTNYAATYAT.......GLLCARRL....LTKYG.......LADAYEGKT.........E.....DL..GE.....
A7APX9_BABBO/14-176..VGLTNYAAAYCT.......GLLLARRL....LTQLK.......LDNQFVGKE.........Q.....AD..GT.....
A7RMX8_NEMVE/14-176..VGLTNYAAAYCT.......GLLLARRL....LTMLN.......LHEIYTGTD.........D.....VN..GD.....
A7TZ37_LEPSM/14-176..VGLTNYAAAYCT.......GLLLARRV....LNKFK.......LDSIYEGQT.........K.....VD..GE.....
A8E608_XENLA/14-180..VGLTNYAACYAT.......GLLVARRL....LTKLG.......LADQYEGNT.........EAAAPGED..GG.....
A8HP55_CHLRE/14-176..CGLTNYAACYCV.......GLLVARRI....LTKFG.......LDKHYPGQT.........E.....PD..GE.....
A8NXM3_COPC7/14-178..HGLTNWAAAYAT.......GLLAARRA....LTKLG.......LADKYEGVT.........E.....PD..GT.....
A8UEW1_AREMA/18-180..VGLTNYAAAYCT.......GLLLARRT....LAKFG.......LDGIYAGNS.........D.....VN..GD.....
A9BKN0_HEMAN/14-166..CGPTAFHIAYFC.......GVYLANRI....LFKK................E.........N.....KN..SE.....
A9S013_PHYPA/14-175..GGLTNYAAAYCT.......GLLLARRH....LKNFE.......LDQEYVGNE.........T.....AT..GE.....
A9UDR2_9BILA/14-176..VGLTNYAAAYCT.......GLLLARRL....LKKYK.......LDGIYSGQE.........E.....ID..GN.....
A9UT63_MONBE/7-169..VGLTNWSACYAT.......GLLVARRL....LTKLN.......LADTYKGVE.........E.....PN..GE.....
B0EFW2_ENTDS/14-177..LGLTNYAAAYCT.......GLLLARRL....LQKLG.......MDKQFVGVS.........D.....AAKLGE.....
B3RNF8_TRIAD/14-176..VGLTNYAACYCT.......GLLLARRV....LTKLN.......LADKYVGVE.........E.....PD..GE.....
B5YLN7_THAPS/14-185..VGLKNYAASYCT.......GLLCARRL....LQKVG.......LDDVYEGND.........E.....ID..GNVVKT.
B6AAM9_CRYMR/14-176..VGFSNFSAAYCT.......GLLCARRV....LKKLS.......MDTIFSGVG.........E.....IT..GD.....
B6K5U0_SCHJY/13-175..WGLANWTAAYAT.......GLLVARRA....LIKLG.......LDKKYEGVV.........E.....PE..GE.....
B6SQF0_MAIZE/14-178..HGLTNWTSAYAT.......GLLCARRA....LKKLG.......LDEKYEGIT.........E.....PD..GE.....
B7XI44_ENTBH/12-173..FGLTNYFAAYAT.......GLLLGRRA....LAANG.......MDKEYSVN..........E.....DI..GE.....
B9PV52_TOXGO/14-175..IGLTNYAAAYCT.......GLLLARRV....LKQLG.......MSETFEGV..........E.....AT..GE.....
C0L2Z7_PECGU/15-176..VGLTNYSAAYCT.......GLLMARRV....LKKLN.......LDQVYEVNT.........E.....VQ...E.....
C1LUA3_SCHJA/14-176..VGLTNYAAAYCT.......GLLCARRV....LKQLG.......LDGLYAGAE.........K.....VD..GQ.....
C4V9T8_NOSCE/20-181..FGLKNHFAFYAT.......GFLAGRRA....LAKLK.......MDDLYKAK..........K.....TD..GT.....
C5KB00_PERM5/14-178..VGLKNYSAAYAT.......GLLVARRT....LKKLG.......LDSTFEGQK.........E.....ID..GE.....
V6TYE8_GIAIN/14-184..VGLTNYAAAYAT.......GLLCGRRL....LEKLSVGVKENALAKLYPGLD.........K.....AT..GE.....
D2VLC1_NAEGR/14-176..VGHTNYASAYAT.......GLLLARRL....LKKVG.......LDTRYAGIT.........E.....TD..GS.....
D3BER0_POLPA/14-176..VGLSNYAAAYAT.......GLLLARRL....LTQLK.......LNDLYKGQE.........K.....IT..GD.....
D5G4X7_TUBMM/87-252..HGLTNWAAAYAT.......GLLLARRT....LTKLG.......LDEHFEGVA.........T.....PD..GA.....
D8R9P8_SELML/14-176..VGLTNYAAAYCT.......GLLLARRL....LTKMG.......MADIYEGNT.........D.....VN..GE.....
E0S7L1_ENCIT/12-173..FGLTNYSAAYAT.......GFLIGRRA....LTALS.......LDGVY.GPK.........E.....ID..GT.....
E1ZT19_CHLVA/14-176..VGLTNYAAAYCT.......GLLVARRM....LNKLG.......LDKHYEGNT.........E.....DV..GE.....
E4XMZ8_OIKDI/24-186..VGLTNYSAAYAT.......GLLIGRRV....LQKFG.......LDSMYEGQI.........E.....VD..GD.....
E5S3L8_TRISP/74-236..LGLTNYAAAYCT.......GLLLARRH....LKKLK.......LDRIYKGVD.........D.....VT..GE.....
E6R224_CRYGW/14-177..HGLTNWTACYAT.......GLLVARRA....LTKLG.......LADKYEGVV.........E.....PT..GE.....
E6ZPA5_SPORE/14-177..TGLANWTAAYAT.......GLLVARRA....LKILG.......LDEKYEGVT.........E.....PD..GE.....
A0A0D2U8A3_CAPO3/14-175..LGLTNYAAAYAT.......GLLLARRL....LTKVG.......LADAYKGVE.........K.....AT..GE.....
F0XY43_AURAN/14-185..VGLKNFAAAYCT.......GLLVARRL....LAKVG.......LDELYEGNT.........D.....PE..GEVVKT.
F1RLP2_PIG/21-182..FGRRSYAAACWA.......GLLLARRLLRRLLRRLG.......VDRIYEGQD.........E.....VT...D.....
F2HIH8_9CRYP/14-164..IGLTNFSCAYIS.......GLLLSKNI....LQKNC.......LNGSYCL.....................NA.....
F2PXL6_TRIEC/14-170..NGLTNWSAAYAT.......WSPACPPH....PEEAR.......SQMVSSPVT..........................
F2UEH8_SALR5/40-203..VGLTNYAACYAT.......GLLLARRL....LTKYN.......LADRYTGVE.........E.....AT..GD.....
R0M6F5_NOSB1/10-171..FGLKNHFAFYAT.......GFLVARRA....LEKLE.......MDELYKP.K.........S.....TN..GE.....
F4NUR8_BATDJ/14-176..HGLTNWAAAYAT.......GLLIARRV....LTKLN.......LDSKYEGCV.........E.....PD..GE.....
F6PJ58_MACMU/14-166..VGLTNYALACWI.......DLLLAHWL....LNRFG.......KDKIYESKV.........E.....VT..GN.....
F6Y3M5_CALJA/21-182..VGLTNYPVVYCT.......GLLLA.RL....LSRFG.......MDKIYEGQV.........E.....VT..GL.....
F7C4N5_MACMU/14-174..VGLTNYAAAYCT.......GLLLARRY....INLY.........LKIYNKND.........L.....LN..YA.....
F7HBE1_CALJA/19-171..IGLTNYAAAYCT.......GLL.........LNRLG.......MDKIYEGQV.........E.....VT..GD.....
F7HVK0_CALJA/20-181..AGLTHSAAVYCT.......GLLLACSL....LSMFG.......MDEIYEGQV.........E.....VT..GD.....
F7ILB7_CALJA/22-180..AGLTGDAAAHGT.......GLLLARRL....LNRFG.......TDKIYEGQV.........E.....VT..GD.....
G0QVW1_ICHMG/28-190..TGLASYASAYAT.......GLLIARRL....LKQVG.......LDTMYEGQA.........Q.....VN..GE.....
G1LB10_AILME/19-179..AGLTNYAAAYYT.......GLLLAHRL....LRIFG.......VDGIYEGQA.........E.....VT..GG.....
G1Q087_MYOLU/21-182..VGLTSYAAAHCT.......GLLLARRL....LNRFG.......TDKVNEGQV.........E.....VT..ED.....
G1Q8N7_MYOLU/15-166..AGLTSYAAAYYT.......GLLLACRL....LNRVG.......LGKIYEGQV.........E.....VT..GH.....
G3TSV6_LOXAF/14-173..VGLTNYVAAYCT.......DLLLACRL....LNRLS.......VDKIYDGQV.........Q.....VT..RD.....
G5B9L4_HETGA/14-171..VGLTNYTVACCT.......GLLLAHGL....LNRFG.......MDKIDKGQV.........E.....VT..GR.....
G7DXW6_MIXOS/14-176..HGLTNWAAAYAT.......GLLVARRA....LTKLG.......LADKYEGVT.........E.....PD..GT.....
G8FUG2_9MYCE/14-176..VGLTNYASAYAT.......GLLLARRL....LQKLK.......LDATYKGQE.........K.....VD..GK.....
H0W8V5_CAVPO/20-181..VGLINYAVSYCT.......GLLLAHWL....LSRFG.......MYKICEGQA.........E.....VT..RD.....
H0XJH6_OTOGA/21-179..VGPMNYAAVYCT.......GLLLARRL....LNTFG.......VDKVYEGQV.........E.....VT..GD.....
H8Z9C6_NEMS1/14-176..FGLKNYSAAYAT.......GFLCARKM....LTKLG.......LAGEYTGKE.........E.....ID..GE.....
H9B928_EIMTE/14-176..VGLTNYSAAYAT.......GLLLARRL....LKQKG.......LADEFKGLE.........K.....PS..GE.....
I3LS96_PIG/19-177..VGLTNYAAAYCT.......GLLLARRL....LIRFG.......VDKIYEGQV.........E.....GT..GD.....
I4YAA1_WALMC/195-358..HGLTSWSAAYAV.......GLLVARRA....LTKLG.......LADKYEGDA.........E.....AT..GE.....
I7I857_BABMI/14-182..TGLTNYAAAYCTVCLHLIQGLLVARRI....LLKLG.......LDSQFA.AT.........E.....AT..GE.....
J7G8P4_9CRYP/14-165..LSYTSFPSSYLS.......GLLLGKTI....SKN...........KFLQLKK.........K.....IK..NE.....
J9DSB3_EDHAE/39-201..FGLTNSSAAYLT.......GFLLGQRV....LEKFS.......MKECGFGNN.........E.....EL..GD.....
J9ID52_9SPIT/14-178..AGLTNYAAAYAT.......GLLLARRL....LTDLG.......MADMYKGVE.........S.....AD..GE.....
K8Z8X1_9STRA/14-187..VGLKNYAAAYCT.......GLLIARRL....LNKLG.......LDEAYEGVD.........E.....PD..GEIATTK
L1I3R0_GUITH/14-187GAVGLKNWTACYAT.......GFLLARRV....LKKLN.......LDELYKGQE.........E.....VS..GE.....
L2GKV0_VITCO/12-173..FGLTNHFAAYAT.......GFLCGRRA....LQSNG.......LDRIYQPNT.........Q.....I...GE.....
L2GR30_VAVCU/12-173..VGLTNYSAAYAT.......GLLVARKA....LIKME.......LNDLYAA.K.........K.....AD..GK.....
L8GRC7_ACACA/14-177..TGLTNYAACYAT.......GLLLARRH....LTKLN.......LAEKYQGKT.........E.....VT..GE.....
L9K2D7_TUPCH/14-176..GGLTNDAAVYYT.......GLLQAHRL....PNRFG.......MDKIYEGQV.........E.....VT..GD.....
M1V7H2_CYAME/14-175..VGLTNFAAAYAT.......GLLVARRT....LTILG.......LADAYQGKV.........E.....AD..GE.....
M1XMR4_9METZ/14-176..VGLTNYAAAYCT.......GLLLARRV....LTKLD.......LAKHYDGQT.........E.....VD..GD.....
M2Y2S8_GALSU/14-175..VGLTNFAAAYAT.......GLLLARRT....LKKLN.......LDEVYVGKE.........S.....VD..GE.....
M5GC33_DACSP/14-178..HGLTNWTAAYAT.......GLLCARRA....LTKLG.......LADKYEGQV.........E.....PT..GE.....
RL5_DUNSA/14-176..VGLTNYSAAYCV.......GLLVARRI....LTKLN.......LADTYKGQE.........E.....PD..GE.....
RL5_SUBDO/14-176..VGLTNYAAAYCT.......GLLLARRL....LTNLG.......LADKYAGQT.........D.....ID..GE.....
Q9AVW3_GUITH/14-162..NLTNNYPFSYLL.......GYYFGKDL....IEKVK.......QSETYNK............................
R1D1T8_EMIHU/14-175..VGLTNYAAAYAT.......GLLCARRL....LQKLG.......LDEQYEGND.........D.....PD..GE.....
R4XAZ7_TAPDE/14-176..HGLTNWSAAYAT.......GLLVARRA....LKKLG.......LDETYTGVE.........E.....AD..GE.....
R7QK75_CHOCR/14-175..HGLTNFAAAYCV.......GLLCARRH....LSKLG.......LDELYKGVE.........E.....VS..GE.....
S7XIG7_SPRLO/20-180..VGFTNYSAAYAT.......GLLCARKI....LRMEK.......LDNIYKPKF.........C.....T....D.....
T1K073_TETUR/14-176..VGLTNYAAAYCT.......GLLLARRM....LKKFR.......LDSIYAGSE.........E.....VT..GE.....
A0A087W1E5_ECHMU/14-175..IGLTNYSAAYCT.......GLLLARRV....LKKLK.......LDGLYQGQT.........E.....VN..GE.....
V4CLT1_LOTGI/14-176..VGLTNYAAAYCT.......GLLLTRRL....LQKYK.......LDGIYKGQE.........A.....PD..GE.....
V6LLC9_9EUKA/14-174..AGLNNYAACYAT.......GLLCARRM....LAKIQ.......MADLYKGNT.........D.....VS...K.....
W2S457_9EURO/14-179..NGLTNWSAGYAV.......GLLLARRV....LKKFE.......LDEDFTGVE.........E.....PD..GE.....

PF00411

RS11_HALMA/10-127--MAEVVAEKALDR-------GVEGVDVR----VRGPG-------GNLQTSPGP-------------------GA-----
RR11_MAIZE/36-142--TAVDAIRTV...-------GLQRAEVM----VKG..-------......AGS-------------------GR-----
RS11_SULAC/10-128--AANKAANDAFDK-------GISAIHIK----VRAQG-------GYGSKTPGP-------------------GA-----
RS141_MAIZE/27-145--AAQDVAQRCKEL-------GITALHIK----LRATG-------GNKTKTPGP-------------------GA-----
RS11_GEOKA/19-128--AAEAAAKASMEH-------GMKTVEVN----VKG..-------......PGA-------------------GR-----
RR11_PHYPA/20-129--AAENAIRVLIDQ-------GMKQAEVM----ISG..-------......PGP-------------------GR-----
W0L7X1_9ENTR/19-128--AAERCADAVKEY-------GIKNLEVM----VKG..-------......PGP-------------------GR-----

PF03464

ERF1_CAEEL/153-285--I.KNDKVTVAGL--------ILAGSAD----FKTEL-------GQSDMFDQR-------------------LQ-----
PELO_HUMAN/136-268--...IHFDVVKCI--------LVASPGF----VREQF-------CDYLFQQAV-------------------KT-----
PELO_METTH/136-256--......GDLETI--------IIAGPGF----YKSDF-------YDYLMERYP-------------------EI-----
DOM34_YEAST/141-274--...LNFDKLKTI--------ILCSPGF----YAKIL-------MDKIFQYAE-------------------EE-----
RF1_AERPE/142-276--VPLAEKGVLKGV--------IVAGPGL----AKQEF-------VEGNYLDYR-------------------LK-----
O96203_PLAF7/141-273--ITN.DKVNVTGI--------VLAGSAD----FKNDL-------LNSDMFDQR-------------------LF-----
RF1_HALSA/147-278--V.P.KRHEIDGI--------LVGGPSP----TKDEF-------LDGDYLHHE-------------------LQ-----
RF1_METTH/141-271--L...QIDDLKGI--------ILGGPGH----TKEEF-------LNGDYLHHE-------------------LK-----
PEL1_ARATH/136-268--VKHVDFSVVRCA--------VVASPGF----TKDQF-------HRHLLLEAE-------------------RR-----
PELO_DROME/136-268--...VNFDVVKCV--------LIASPGF----VRDQF-------YDYMFQQAV-------------------KM-----
PELO_CAEEL/136-268--MRHVNLQVVKCV--------IVASRGF----VKDAF-------MQHLIAHAD-------------------AN-----
DOM34_SCHPO/136-268--...FDFDKLKVV--------ILASPGF----VARGL-------YDYIFSMAV-------------------KL-----
ERF1_SCHPO/142-274--I.TDDKPNVAGI--------VLAGSAD----FKTEL-------GQSDLFDQR-------------------LQ-----
RF1_ARCFU/136-267--LPY..KDKLIGI--------LIGGPSP----TKEEF-------YEGEYLHHE-------------------LQ-----
RF1_SULSO/138-272--MPFVQNGKMKGV--------LLGGPGY----AKEDF-------YKEDYVDYR-------------------IK-----
RF1_METJA/141-274--LPLLQEKKLRGI--------LVGGPGH----TKNEF-------VEGDYLHHE-------------------LK-----
B2AWT5_PODAN/146-276--I.TNDKVNVMGI--------VLAGSAD----FKNDL-------NASDMFDQR-------------------LA-----
I7MKI5_TETTS/145-275--I.SQDKINVQGL--------VLAGSGD----FKNEL-------STTQMFDPR-------------------LA-----
Q386S9_TRYB2/146-277--I.TNDRPNIVGL--------VLAGSAE----FKEVL-------YQSDLFDPR-------------------LK-----
RF1_THEKO/140-272--LPLLEKGELRGI--------IIGGPGP----TKEEF-------VEGDYLHHE-------------------LR-----
RF1_THEAC/144-273--M..PKIKDIRAI--------FLGGPGA----TKEYF-------FEKDYLRNE-------------------VK-----

PF00861

F7YKM5_VIBA7/1-117------QYHG--------------------------------------------------RVAALAESAREAGL-KF---
RL18_HAEIN/1-117------KYHG--------------------------------------------------RVQTLADAAREAGL-QF---
R4I0E9_9ENTR/1-117------QYHG--------------------------------------------------RVQALADAARKAGL-QF---
RL18_BACSU/5-120------LYHG--------------------------------------------------RVKALADAAREAGL-KF---
RL18_GEOKA/5-120------LYHG--------------------------------------------------RVKALADAAREAGL-EF---
RL18_MYCMS/3-116------LYHG--------------------------------------------------KIKAFAETARENGL-KF---
RL18_AQUAE/5-124------KYHG--------------------------------------------------KIKAFADKCREMGL-EF---
RL18_SYNY3/3-120------LYHG--------------------------------------------------RVKALAEAAREAGL-NF---
RL18_SYNE7/3-120------LYHG--------------------------------------------------RVKALAEAAREAGL-EF---
RL18_MYCPN/2-116------KYHG--------------------------------------------------RIAALAEAARERGL-NF---
RL18_BORBU/5-119------KYHG--------------------------------------------------LIASFATSLREFGI-NI---
RL18_HELPY/8-119------LYHG--------------------------------------------------VVAAFAESLRENGI-AL---
RL18_CHLTR/6-123------KYHG--------------------------------------------------VVAMVADGAREGGL-QF---
RL18_STRCO/12-127------QYAG--------------------------------------------------RIAALADAAREAGL-KF---
RL18_MYCTU/7-122------TYGG--------------------------------------------------RIAALADAARENGL-SF---
C5CC47_MICLC/9-124------KYHG--------------------------------------------------RVAAVADGAREGGL-QL---

PF17144

A0A010RHR7_9PEZI/27-192......FTLT..EA..AETDD...G........ERR......PFKANLDVG-LHRTSTGARVFGAMKGASDGGI.LVPHS
U9TL92_RHIID/14-176......VAPI..EE..L...E...D........APR......PFKAFLDVG-LKRTSTGSKVFAALKGASDGGI.FIPHG
A0A016TA30_9BILA/14-175......FYTV..EE..E...D...G.........RS......PFKAVLDVG-LARTTTGCKVFAVMKGVADGGI.EVPHS
A0A022RZY9_ERYGU/14-175......DYSV..EP..A...E............TRR......PFRALLDVG-LIKTTTGNRVFGALKGALDGGL.DIPHS
A0A023B1A6_GRENI/14-176......EYHI..ED..E...D...T........ERS......AFKCVLDIG-LVRTTTGNRVFGALKGAVDGGL.YIPHS
A0A023EQ43_AEDAL/14-176......EYLV..EP..V...D...D........GPG......AFRCYLDVG-LARTTTGARVFGAMKGAVDGGL.NIPHS
A0A023FJK3_9ACAR/14-176......DYCV..DS..E...D...G........QPG......AFRCYLDVG-LARTTTGARIFGCLKGAVDGGM.DIPHS
E7KIW9_YEASA/14-176......YELT..EA..V...E...D........GPR......PFKVFLDIG-LQRTTTGARVFGALKGASDGGL.YVPHS
A0A024GN61_9STRA/14-185......TYYV..NE..V...A...D........DGR......PFRCYLDVG-LRTTTTGNRVFGALKGAIDAGL.DIPHS
A0A024W0F1_PLAFA/14-178......IENN..ED..K...E...DE......EGRK......PIKAFLDVG-ITRTTTGNRVFAALKGACDGGL.NIPHG
A0A058ZDQ8_9EUKA/14-176......VYNV..EE..I...D...G........QPR......PFRAYLDTG-LARTTTGARIFGVMKGAVDGGV.AIPHS
A0A059EMQ9_9MICR/13-174......YSVV..EC..N...E...E........GKK......PLTCYLDIG-LNRSTKGARVFAAMKGCSDGGL.RVPHS
A0A059LQQ5_9CHLO/14-176......DYNV..EE..I...E...G........EKR......PFVALLDTG-LKRTSTGSKVFAALKGALDGGL.DVPHS
A0BUQ3_PARTE/14-171......LKT...............Q........RER......PFFAVLDIG-LVRSTLGNRVFAALKGAADGGI.HIPHN
A2DNM5_TRIVA/13-170......YLND..EE...................NRR......PFKVILDVG-LARTTTGAKVFAVMKGAVDGGL.FIPHN
A4HMK9_LEIBR/14-182......YSAV..RT..K...K...D........DQGDDEARFPFKAILDVG-LARTTTGARVFGVLKGAVDGGI.SVPHR
A4S796_OSTLU/21-183......DYHV..EQ..G...D...E........EAR......PFKCFLDTG-LVRTSTGARVFAALKGAVDGGL.DIPHN
A7APX9_BABBO/14-176......SFHI..EE..E...D...H........DRR......PFKALLDVG-IKIVTTGNKVFGALKGACDGGL.HIPHS
A7RMX8_NEMVE/14-176......EYNV..ES..V...D...G........SPG......AFRCFLDVG-LARTSTGARVFGALKGAVDGGL.EIPHS
A7TZ37_LEPSM/14-176......HFMV..ED..E...E...G........KPG......AFRACLDTG-LARTSTGAKVFGAMKGAADGGL.DVPHS
A8E608_XENLA/14-180......LYHV..EA......E...G........DSR......PFRCFLDVG-LVRTTTGAKVFAVMKGAVDGGL.DIPHN
A8HP55_CHLRE/14-176......DYNI..EP..V...E...E........GPR......PFFCLLDTG-LKRTSTGSKVFGCLKGALDGGL.DIPHN
A8NXM3_COPC7/14-178......LQIT..EA..LD.DD...D........APR......PFKAFLDVG-LRRTSTGARVFGAMKGASDGGI.YIPHS
A8UEW1_AREMA/18-180......EYLV..ES..I...D...G........QPG......AFRCFLDVG-LARTSTGARVFGALQGAVDGGL.DIPHS
A9BKN0_HEMAN/14-166......TPNV..RK..K...Y...A..........K......SIFAILDIG-LTRATTGHRVFAAMKGALDGGI.TIPYN
A9S013_PHYPA/14-175......DYNV..EE..G...E...G........K.R......PFRALLDVG-LVRTTTGNRVFGALKGALDGGL.DVPHS
A9UDR2_9BILA/14-176......EYNV..EA..L...D...D........QPG......PFRAFLDVG-LVRTTTGARVFGAMKGAADGGI.DIPHS
A9UT63_MONBE/7-169......DYFV..EE..A...E...D........KPR......PFRCYLDVG-LAPTTTGSRVFGVMKGAVDGGL.AIPHN
B0EFW2_ENTDS/14-177......DYTP..EE..V...E............ERR......PFKCILDVG-LARTTTGSKVFAVLKGMCDGGV.YVPHS
B3RNF8_TRIAD/14-176......DFEV..EE..P...D...E........GAR......AFRCFLDVG-LARTTTGARIFGTLKGAVDGGL.NIPHQ
B5YLN7_THAPS/14-185.QVGKSTYYV..DE..V...D...E........DKR......PFRALLDVG-CKTTTTGCRIFGALKGAADGGL.DIPHS
B6AAM9_CRYMR/14-176......DYHV..EE..D...A...E........ERR......PFKCILDVG-LARTTCGNRVFAAMKGAADGGI.YIPHS
B6K5U0_SCHJY/13-175......FELT..EA..I...E...D........GPR......PFKVFLDVG-LKRTSTGARVFGAMKGASDGGL.YVPHS
B6SQF0_MAIZE/14-178......MTIT..EA..LE.GD...D........EPR......PFKVFLDVG-LKRTTTGNRIFGALKGASDGGL.YVPHN
B7XI44_ENTBH/12-173......YKIT..ED..A...S...D........ERR......AYKVFLDIG-LARATKGARVFAAMKGASDAGL.YIPHS
B9PV52_TOXGO/14-175......EYHI..EE..N...F...G........ERR......PFKVLLDVG-IVRTTVGNRVFGAMKGAADGGL.HVPHG
C0L2Z7_PECGU/15-176......EYHV..EP..K...D...G........ESD......PLKVYLDVG-LSRTSTGTKLFSVLKGASDGGL.NIPHG
C1LUA3_SCHJA/14-176......EYHV..ES..V...G...G........NKS......PFRCHLDVG-LARTSSGANIFGALKGAVDGGL.DIPYS
C4V9T8_NOSCE/20-181......YTIT..ED..I...D...E........ERR......ALKVFLDIG-LSRSTKGGNTFIAMKGCSDAGV.FIPHS
C5KB00_PERM5/14-178......EYYVADEE..Y...E...G........EKR......PFKCVLDVG-LVRTTVGARVFGAMKGAADGGL.DIPHN
V6TYE8_GIAIN/14-184......EYHP..DE..N..EN...E........EVH......AFKAFLDIG-LARASTGARVFAAMKGAVDAGL.NIPHS
D2VLC1_NAEGR/14-176......VFLV..EQ..A...E...D........APR......PFKAFLDVG-LVRTTTGNRVFGALKGACDGGL.YIPHS
D3BER0_POLPA/14-176......DFLV..KP..V...D...D........KPR......PFKAFLDVG-LARTTTGNKVFAVLKGACDGGM.YIPHK
D5G4X7_TUBMM/87-252......FQLT..ED..A...DVEGE........SRR......PFKAYLDVG-LKKTTTGARVFGAMKGASDGGL.YIPHS
D8R9P8_SELML/14-176......DYNV..ET..L...D...E........NRR......PFRALLDVG-LVRTTTGNRVFGALKGALDGGL.DIPHS
E0S7L1_ENCIT/12-173......YSIT..ED..V...D...G........ERK......APKVFLDIG-LARSTKGAKVFGAMKGASDAGL.NIPHS
E1ZT19_CHLVA/14-176......DYNV..EA..E...D...D........APR......PFQCILDAG-LKRTSTGSKVFAALKGALDGGL.DIPHN
E4XMZ8_OIKDI/24-186......EFYE..EA..D...A...A........EKA......SFRCYLDTG-LARTSTGARIFGVLKGCADAGI.DIPHS
E5S3L8_TRISP/74-236......DYNV..ES..E...E...G........KPG......AFRCFLDVG-LARTTTGARIFGIMKGALDGGL.DIPHS
E6R224_CRYGW/14-177......LQLT..EA..L..GD...D........EPR......PFKCYLDVG-LRRTSTGARVFGAMKGASDGGI.FIPHS
E6ZPA5_SPORE/14-177......MSEV..EP..L..GD...D........EPR......PFKCFLDVG-LKRTSTGSRVFGALKGASDGGI.FIPHS
A0A0D2U8A3_CAPO3/14-175......EYHV..EE......E...G........EKR......PFQAFLDVG-LARTSTGARLFGVLKGAVDGGL.NVPHS
F0XY43_AURAN/14-185.EVGKKEYYV..EE..L...D...D........DKR......PFKCILDVG-IQTTTTGNRVFGALKGATDGGL.DIPHN
F1RLP2_PIG/21-182......EHDV..EG..I...T...G........QPG......AFPCYLEAK-VARTPAGKQVLGVPRAAVHGGL.PAHHS
F2HIH8_9CRYP/14-164......KYVI..KK..I...........................RTCLDIG-LTRATRGHKVFSCMKGIIDGGI.EIPHK
F2PXL6_TRIEC/14-170.......EAA..ET..D...E...G........TRR......PFKAVLDVG-LHRTSTGARVFAAMKGASDGGI.FVPHS
F2UEH8_SALR5/40-203......DYNV..EK.GV...Q...S........GPR......PFRAFLDVG-LAPTTTGARVFAVMKGAVDGGL.AVPHN
R0M6F5_NOSB1/10-171......INKT..ED..I...E...G........ERR......ALKVFLDIG-LSRATKGANCFIAMKGASDAGI.FIPHS
F4NUR8_BATDJ/14-176......YYKI..EP..M...E...D........GPR......PFRAFLDIG-LRRTTTGSRIFGALKGAVDGGL.AIPYS
F6PJ58_MACMU/14-166......EHNV..ES..I...D...G........QPG......AFICYLNAG-LARNTTGNKVFGALKGVFDGGL.SVPHS
F6Y3M5_CALJA/21-182......EYDV..ER..I...D...D........QPG......AFTCYLDAG-LSRTTTGNNTFGALKGAVDGGL.SIPHS
F7C4N5_MACMU/14-174......KRWI..LEFDK...E...F........EEK......AYERFLNLQ-LRNKIVGH..FGKLSRLICSSI.GLMFS
F7HBE1_CALJA/19-171......EYNV..ES..I...D...G........QPG......AFTCYFNVG-LARTTTGNKVFGTLKGAVDGVS.SIPHS
F7HVK0_CALJA/20-181......EYNV..ES..T...G...G........RPG.......ALCYLDVG-LAKTTAGNKVFGALKGAVGGGF.FVPHG
F7ILB7_CALJA/22-180......EHSA..EG..T...D...G........QPG......AFTC.LDAG-LARTTTGNKVFGTLKGAVDGGLLSLTVP
G0QVW1_ICHMG/28-190......YFNV..DE..N...K...K........EKR......PFKAILDSG-LVRTSTGNRVFGVLKGACDGGI.NVPHQ
G1LB10_AILME/19-179......EYDV..DS..I...G...QPS....AFACR......PFTCCLDAE-LARTATGNS.F....GAVGGGL.SIPHG
G1Q087_MYOLU/21-182......EYNV..ES..T...D...S........QPG......AFTCYLVAG-FARTTTGSKAFGVLKGAVDRVL.STLHS
G1Q8N7_MYOLU/15-166......EYNV..ES..I...D...G........QPG......AFTCYLDAG-LARTTTGNKVF....GAVGGGL.SISHS
G3TSV6_LOXAF/14-173......EHNV..EK......D...G........QPG......VFTCYLDAG-LARTTHRNNILRAVK.ALDGDL.FIPHN
G5B9L4_HETGA/14-171......KYNV..GS..I...G...G........QPG......AFTCYLDVG-LARTTTGNKVFGAPEAAVDGGL.PIPHS
G7DXW6_MIXOS/14-176......MTET..QH..I...E...G........GPR......PFKCYLDAG-LKRTSTGSRVFGALKGASDGGI.FIPHN
G8FUG2_9MYCE/14-176......IFNI..SP..V...A...D........KSK......PFRANLDVG-LTRTSTGNKVFAVLKGAVDGGI.AVQHR
H0W8V5_CAVPO/20-181......EYTV..ES..I...D...G........KLS......VFTCYLGTG-LARTTIGNKVFGALKGVVGGGL.SVPHS
H0XJH6_OTOGA/21-179......EHNV..ET..I...G...G........QPG......AFICFLDAG-LARTTTSNKVLGALKGTVDGGL.SVPHS
H8Z9C6_NEMS1/14-176......EYLE..SD..N...E...E........GPS......AFRCYLDLG-LARSSKGAKVFAAMKGACDGGL.HIPHS
H9B928_EIMTE/14-176......EYHI..EE..V...S...E........ERR......PFKCVLDVG-IVATTVGNRVFGAMKGACDGGL.HIPHS
I3LS96_PIG/19-177......EYHV..ES..T...D...G........QPG......ACTCYLDAG-LASTTTGNKVLGALKGAVDS.L.SIPHS
I4YAA1_WALMC/195-358......YSLT..EP..L..GD...D........EPR......PFKVFLDVG-LKRTSTGSRVFGALKGASDGGL.YVPHS
I7I857_BABMI/14-182......DYHI..EE..Q...D...C........ERR......PFKALLDVG-ITITTTGNRVFGAMKGACDGGL.HIPHS
J7G8P4_9CRYP/14-165......KPF.........................LK......PIYAILDIG-LGRTTTGHKIFAAMKGAIDGGI.AIPHK
J9DSB3_EDHAE/39-201......YFVQ..EE..N...D...D........GVK......PFECFLDIG-LKRATNGAKVFLAMKGASDAGV.RVPHS
J9ID52_9SPIT/14-178......FFDV..TE..KG.VN...D........NRR......PFKALLDVG-LVRTTTGNRVFGALKGAVDGGV.YVPHN
K8Z8X1_9STRA/14-187DETNGRTYYV..PE..L...N...D........EKK......PFRAILDVG-IQTTTTGNRIFGVLKGASDGGL.DIPQS
L1I3R0_GUITH/14-187......DYTV..KS..N...N...EGKKDKKSKDPE......PFRVCLDVG-LQTTSTGARIFGALKGALDGGL.DIPHS
L2GKV0_VITCO/12-173......YSIT..ED..K...D...D........EHK......AYKVYLDIG-LARASRGANVFIAMKGASDAGL.QIPHS
L2GR30_VAVCU/12-173......IEEQ..ED..V...E...D........ERR......AYQVFLDIG-LGRSTRGSRYFAAMKGASDGGL.KIPHS
L8GRC7_ACACA/14-177......DWSYNLDE..I.......E........GPK......PFKATLDSG-LARTSTGAKLFASLKGACDGGL.DIPHS
L9K2D7_TUPCH/14-176......EYNV..ES..I...D...G........QPG......AFACYLDAG-LARTTSGSKVFGALKGAVDGGL.SILHS
M1V7H2_CYAME/14-175......LYQV..EP..V.......G........ETR......PFRAVLDVG-LVRTTTGHRVFAAMKGAVDGGI.DIPHS
M1XMR4_9METZ/14-176......EYAV..DD..V...A...G........APS......AFRCFLDIG-LARTTTGARIFGALKGAVDGGL.NIPHN
M2Y2S8_GALSU/14-175......FFEV..EP..Q.......G........ERR......PFRAFLDVG-LIRTTTGNKVFAAMKGAVDGGV.DIPHN
M5GC33_DACSP/14-178......LALV..EG..LD.DE...D........APR......PFKCYLDAG-LKRTSTGSRIFGAMKGAADGGL.FIPHS
RL5_DUNSA/14-176......DYNV..EP..V...E...D........GPK......PFYCLLDTG-LKRTSTGSKVFAAMKGALDGGL.DIPHN
RL5_SUBDO/14-176......DFNV..EH..M...G...D........GPR......PFRAFLDVG-LTRTTTGNRVFAAMKGAVDGGI.DIPHS
Q9AVW3_GUITH/14-162............K...........N........YSS......KITAIIDIG-LKRATIGNKSFASMKGSVDSGI.NIPHN
R1D1T8_EMIHU/14-175......HFLV..EH..E...D............GPR......PFTCVLDVG-LIRTTTGAKVFGALKGAVDGGL.NIPHS
R4XAZ7_TAPDE/14-176......HTVT..EA..V...D...D........APR......PFKVFLDVG-LKRTSTGSRIFGALKGASDGGL.FIPHS
R7QK75_CHOCR/14-175......MYEI..EE..D.......D........EKR......PFTALLDIG-LTRTTTGKKVFATMKGAVDGGM.NIPHN
S7XIG7_SPRLO/20-180......VDVV..ED..I...E...G........EKN......AYRCYLDIG-LSRNSKGAKVFAAMKGASDGGI.KIPYS
T1K073_TETUR/14-176......MFNV..ED..I...D...G........KPG......AFRAFLDVG-LARTSTGSRIFGAMKGAVDGGI.DIPHS
A0A087W1E5_ECHMU/14-175......NYLV..ES..K...E............KRG......AFKCFLDVG-LRRTSSGANIFGALKGAVDGGL.NIPHS
V4CLT1_LOTGI/14-176......AYHV..EK..V...P...D........KPG......AFRAILDIG-LSRSSTGAKVFGVMKGAADGGL.DIPHS
V6LLC9_9EUKA/14-174......IVPV..ED..K.......D........ERS......AFRCFLDIG-LSRTTTGANVFAALKGAVDGGL.NIPYS
W2S457_9EURO/14-179......FTLT..EA..AGEGD...D........ERR......PFKAFLDVG-LHRTSTGARIFGVMKGASDGGL.YIPHN

PF00411

RS11_HALMA/10-127------------QA----------------------------TIRALARAG-LEIGRIEDVTPTPHDGTRAPKN----S.
RR11_MAIZE/36-142------------DA----------------------------ALRAIAKSG-VRLSCIRDVTPMPHNGCRPPKK----RR
RS11_SULAC/10-128------------QP----------------------------AIRALARAG-FIIGRIEDVTPLPHDTIRRPGG----RR
RS141_MAIZE/27-145------------QS----------------------------ALRALARSG-MKIGRIEDVTPVPTDSTRRKGG----RR
RS11_GEOKA/19-128------------EA----------------------------AIRALQAAG-LEITAIKDVTPIPHNGCRPPKR----RR
RR11_PHYPA/20-129------------DT----------------------------ALRAIRRSG-VILNFVRDVTPMPHNGCRPPKK----RR
W0L7X1_9ENTR/19-128------------ES----------------------------TIRALNAAG-FRITNITDVTPIPHNGCRPPKK----RR

PF03464

ERF1_CAEEL/153-285------A...--------------------------------.....KMIK.TVDIAYGGE-NGFNQAIEL..AADTLAS
PELO_HUMAN/136-268------DNKL--------------------------------LLENRSKFL.QVHASSGHK-YSLKEALCDPTVASRLSD
PELO_METTH/136-256------A...--------------------------------.....KKAV.LENTGTGGR-AGISEVLRKGTVERVSSE
DOM34_YEAST/141-274------HNKK--------------------------------ILDNKGMFF.IAHCSTGYL-QGINEVLKNPLYASKLQD
RF1_AERPE/142-276------....--------------------------------....KILAPELVDVAYQGL-QGLKEAVMK..AEKVVEA
O96203_PLAF7/141-273------A...--------------------------------.....KVIK.IVDISYGGD-NGFNQAIEL..SSEALQN
RF1_HALSA/147-278------D...--------------------------------.....KVLG.KFDVSYTDE-SGLSDLVDA..GQAALAE
RF1_METTH/141-271------K...--------------------------------.....KVIT.TVDTSYTGE-FGIREVIDK..SMDVLSE
PEL1_ARATH/136-268------QLRP--------------------------------IIENKSRII.LVHTNSGYR-HSLGEVLHAPNVMNMIKD
PELO_DROME/136-268------DYKL--------------------------------LLDNKSKFM.LVHASSGFK-HSLREILQDPAVLAKMSD
PELO_CAEEL/136-268------GKKF--------------------------------TTEQRAKFM.LTHSSSGFK-HALKEVLETPQVALRLAD
DOM34_SCHPO/136-268------DLKQ--------------------------------IVKSKNKFV.ILHSSTGHI-HSLNEILKDPAVESKLAD
ERF1_SCHPO/142-274------S...--------------------------------.....RIIK.TVDVSYGGD-AGFNQAIEL..AADTLSN
RF1_ARCFU/136-267------K...--------------------------------.....KVLG.LFDVGYTDE-SGLYELVEK..AKDVLQE
RF1_SULSO/138-272------N...--------------------------------.....LILQPLIDVSDQGE-VGLREMIMK..AEDLLKN
RF1_METJA/141-274------K...--------------------------------.....IVLD.TFDLCYTEE-FGIRELLEK..AAPLLKD
B2AWT5_PODAN/146-276------T...--------------------------------.....KVIK.VVDVSYGGE-NGFNQAIEL..ASETL..
I7MKI5_TETTS/145-275------C...--------------------------------.....KIIK.IVDVSYGGE-NGLNQAIEL..AQESLT.
Q386S9_TRYB2/146-277------A...--------------------------------.....IVVK.VVDVAHPGD-VGLNQAIDL..AADALS.
RF1_THEKO/140-272------K...--------------------------------.....KVIG.VVDISYHGE-YGLRELVEK..ASDILKD
RF1_THEAC/144-273------E...--------------------------------.....KIKD.LFDVGYTDE-SGLRELVEK..ASESIK.

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window