Sequence alignment for CL0267

PF00411

RS11_HALMA/10-127------------GIAHVHASFNNTIITITDQTGAETLAKSSGGTVV-KQNRDEASPYAAMQMAEVVAEKALDRGVEGVDV
RR11_MAIZE/36-142------------GIIHVQASFNNTIITVTDPQGRVVFWSSAGTCGF-KSSR.KASPYAGQRTAVDAIRTV...GLQRAEV
RS11_SULAC/10-128------------GNARIYASQNNTIITITDITGAEIISKASGGMVV-KADREKPSPYAAMLAANKAANDAFDKGISAIHI
RS141_MAIZE/27-145------------GVAHIFASFNDTFIHVTDLSGRETLVRITGGMKV-KADRDESSPYAAMLAAQDVAQRCKELGITALHI
RS11_GEOKA/19-128------------GIAHIRSTFNNTIVTITDVHGNAIAWASAGSLGF-KGSR.KSTPFAAQMAAEAAAKASMEHGMKTVEV
RR11_PHYPA/20-129------------GVIHIQASFNNTIVTVTDIRGQVVFWSSAGACGF-KGAK.KSTPFAAQTAAENAIRVLIDQGMKQAEV
W0L7X1_SERFO/19-128------------GVAHIHASFNNTIVTITDRQGNALGWATAGGSGF-RGSR.KSTPFAAQVAAERCADAVKEYGIKNLEV

PF00861

RL5_YEAST/26-173------------GKTDYYQRKRLVT--------QHKAKYNTPKYRL-VVRFTNKDIICQIISSTITGDVVLAAAYSHELP
RL18_HALMA/10-130------------PMRRRREARTDYH--------QRLRLLKSGKPRL-VARKSNKHVRAQLVTLGPNGDDTLASAHSSDLA
RL18_MYCPN/5-116------------TEQRRLRHKRIVK--------KIRATNHDNRVVL-MVIKSLNHISVQAWDFSQNIVLASSSSLALKLK
RL18_BORBU/7-119------------AEQRKLRRKKRIK--------DKIGRGVASRPRI-TVFKSNRYFYAQVIDDSKGHTIASISTI...EK
RL51_ORYSJ/27-173------------GKTDYRARIRLTN--------QDKNKYNTPKYRF-VVRFTNKDITAQIVYATIAGDIVMAAAYSHELP
RL18_HAEIN/1-117------------MDKKSARIRRAAR--------ARHMMREQGVTRL-VIHRTPRHIYAQVIAPNGSEVLAAASTVEKAIR
RL18_SYNY3/4-120------------TRKSATQRRHRRL--------RRHLSGTSERPRL-AVFRSNDHIYAQVIDDVAQHTLAAASTLDPDLK
RL18_ARCFU/12-132------------PLRRRREGKTNYR--------KRLKLLLSRKPRL-VVRITNRRVIAQIVEYAPEGDRVVVGVDSAMLR
RL18_SULAC/10-131------------KFRRRREGKTDYY--------TRYTYVINNAIRF-VPRLTNKYVIVSVSKFDQKGDIMIAYAHSIELV
RL18_HELPY/9-119------------KKKALRDRRKLRI--------KSKLLGDALRPRV-SVFRSNRYFYAQAIDDVKQSTITHID.....GR
RL5_CAEEL/26-172------------GKTDYYARKRLTV--------QDKNKYNTPKYRL-IVRITNKDVVAQLAYSKIEGDVVVASAYSHELP
RL18_METTH/10-130------------AFRRRREGKTDYR--------ARYKMVETGKSRL-VVRITTYHVIAQIINVGMNGDETLVSAHSKQLQ
RL5A_SCHPO/26-173------------GKTDYYARKRLIA--------QAKNKYNAPKYRL-VVRFSNRFVTCQIVSSRVNGDYVLAHAHSSELP
RL18_STRCO/13-127------------YKRAAIKRRHIRI--------RKNLSGTAERPRL-VVTRSNRHIVAQVIDDIKGHTLASASTLDTSIR
RL18_BACSU/6-120------------SKNAARLKRHARV--------RAKLSGTAERPRL-NVFRSNKHIYAQIIDDVNGVTLASASTLDKDLN
RL18_METJA/10-130------------KFRRRREAKTDYR--------KRLKLLLSRKPRL-VARRTLNHCIAQIVLYDEKGDKTVVSAHSRELI
RL18_AQUAE/6-124------------TRREKRLRRHKRI--------RKKVFGTPERPRL-CVYRSLKHFYAQIIDDTIGHTLVSASTLDPEFE
RL18_CHLTR/7-123------------KKTSGKARRALRV--------RKALKGCSLKPRL-SVVKTNKHVYVQLIDDVEGKTLASISTLAKVAK
C5CC47_MICLC/11-124------------.KFNARTRRHLRV--------RKRISGTTVRPRL-VVNRSARHMFVQVVDDTQSRTIAYASTMEADVR
F7DSA5_XENTR/26-173------------GKTDYYARKRLVI--------QDKNKYNTPKYRM-IVRVTNRDIICQIAYARIEGDMIVCAAYAHELT
F7YKM5_VIBA7/2-117------------.DKKASRIRRATR--------ARRKIAELGATRL-VVHRTPRHVYAQVIASNGSEVIAAASTVEKAIR
RL18_MYCTU/9-122------------.RRISRLRRHTRL--------RKKLSGTAERPRL-VVHRSARHIHVQLVNDLNGTTVAAASSIEADVR
RL18_SYNE7/5-120------------.RRESTRRRHRRV--------RRTIVGTPARPRL-SVFRSNNHIYAQVIDDAAGHTLAAASSLDPDLR
RL18_GEOKA/8-120------------..NAVRKKRHARI--------RKKIFGTAERPRL-SVFRSNKHIYAQIIDDTKSSTIVSASTLDKEFG
RL18_METMP/11-130------------.FRRRREGKTDFR--------QRLGLLLSGKPRL-VARKSLNNVTAQLMAYDEKGDVVLVSAHSKELV
RL18_MYCMS/5-116------------.KAEARKRRHFRV--------RQKVVGTAERPRL-NVFKSNTNFYAQIIDDTKGVTLVSASTLKMDLK
R4I0E9_9ENTR/2-117------------.DKKSARIRRATR--------ARRKLKELGATRL-VVHRTPRHMYAQVIAPNGSKVLVAASTLEKAIT

PF03464

ERF1_CAEEL/153-285KFGFIIMDGNGCLFGTLQGNTREVLHKFTVDLPKKHGRGGQSAVRFARLRNEKRHNYVRKVAENSVEQFI.....KNDKV
PELO_HUMAN/136-268DVAAVVMQEGLAHICLVTPSMTLTRAKVEVNIPRKRK.GNCSQH......DRALERFYEQVVQAIQRH........IHFD
PELO_METTH/136-256KAIILVMEDDVAELGLIRQYGVEYRGPITGHIPGKRI...QQRD.....RGKLRREFYESIVESLQKY...........G
DOM34_YEAST/141-274DTAAVVLQEGIAHVCLVTSSSTILKQKIEYSMPKKKRT..TDVLKF....DEKTEKFYKAIYSAMKKD........LNFD
RF1_AERPE/142-276AIGIIIVERDQATIGLLKGARLEVLKELEGFVPGKHKMGGQSQRRYERIIEQMVDEFFKKVGEEASNLLVP....LAEKG
O96203_PLAF7/141-273KFGFIIVDGNGALFGTIQGNTREVIRRFTVDLPKKHGRGGQSALRFARLRLEKRHNYVRKVAEVATSVFIT....N.DKV
RF1_HALSA/147-278LYGLIVLDRRESNVGWLKGKRVQPVKSAESLVPGKQRKGGQSAQRFARLRLEAIDNFYQEVAGMADDLFV.....P.KRH
RF1_METTH/141-271TYGLAVLDRKEATIATLKGKRIDILKTLTSGVPGKHKAGGQSQRRFDRLIDLAAHEFLKRIGEHMNEAFL.......QID
PEL1_ARATH/136-268DLAVVLMQEGLAQIFLVGRSVTSSRARIETSIPRKHGP...AIAGYE........SALKKFFENVLQAFVK....HVDFS
PELO_DROME/136-268DVAAVVMQEGLAHVCLITASMTLVRSKIEVSIPRKRK.GSVQQH......EKGLAKFYEQVMQSILRH........VNFD
YNU6_CAEEL/136-268DVAAVVLHEGLANVCLITPAMTLTRAKIDMTIPRKR.KGFTSQH..........EKGLEKFYEAVSTAFMR....HVNLQ
DOM34_SCHPO/136-268EIGAVVLDEGLANICLITDYMTILRQRIDQVIPRKR.RGDSSAYQ......KGLDKFYDSVFQSINSE........FDFD
ERF1_SCHPO/142-274RFGFIVMDGHQTLYGVVSGSAREVLQRFTVDLPKKHGRGGQSALRFARLRDEKRHNYVRKVAEGAVQHFI.....TDDKP
RF1_ARCFU/136-267LYGLIVLDRREATVGLLKGKRIEVLDWDTSMVPGKHRQGGQSSVRFERLREIAIHEFYKKVGEMASEALLP....Y..KD
RF1_SULSO/138-272VYGLIIVERDEATIGLLKGARIEILEEIEGFVPGKHMMGGQSQRRIDRIIDEMYHNFLKEVGEKVNAYFMP....FVQNG
RF1_METJA/141-274AYGVILVDRNEATIALVKGRNINILKKLTSGVPGKFKAGGQSARRLERLIDLAAHEFLQRVGQKANEQFLP....LLQEK
B2AWT5_PODAN/146-276KFGFIVMDGNGALFGTLSGNTRDIVHKFSVDLPKKHGRGGQSALRFARLREEKRHNYVRKVAELAVQNFI.....TNDKV
E1EZY6_GIAIA/150-287TFGFIIMDGKETLMATLSGTVRTILDRFTVDLPKKHGRGGQSSVRFARLREEARHNYVRKVAERANSLFISSGPTGTNKP
I7MKI5_TETTS/145-275.FGFIVMDGQGALYANLQGNTKTVLNKFSVELPKKHGRGGQSSVRFARLRVEKRHNYLRKVCEVATQTFI.....SQDKI
Q386S9_TRYB2/146-277KFGFIVVDGSGTTYATLCGSVKEKLSSFTVELPKKHGRGGQSKNRFARIRMERRHNYLRKVAEGATQLFI.....TNDRP
RF1_THEKO/140-272.YGLITVEKNEATIGLLRGKRIEVIDELTSNVPGKTRAGGQSARRYERIREQETHEFMKRIGEHANKAFLP....LLEKG
RF1_THEAC/144-273.YGLIVIDRKEATVGFLNGTRIEVVDNVQSQVPSKHHQGGQSSRRFERLIEIAANEFFKKVGEIANNAFM......PKIK

PF00411

RS11_HALMA/10-127R---VRGPGGNLQTSPGPGAQATIRALAR-------AGL---------------------EIGRIEDVTPTPH-------
RR11_MAIZE/36-142M---VKG........AGSGRDAALRAIAK-------SGV---------------------RLSCIRDVTPMPH-------
RS11_SULAC/10-128K---VRAQGGYGSKTPGPGAQPAIRALAR-------AGF---------------------IIGRIEDVTPLPH-------
RS141_MAIZE/27-145K---LRATGGNKTKTPGPGAQSALRALAR-------SGM---------------------KIGRIEDVTPVPT-------
RS11_GEOKA/19-128N---VKG........PGAGREAAIRALQA-------AGL---------------------EITAIKDVTPIPH-------
RR11_PHYPA/20-129M---ISG........PGPGRDTALRAIRR-------SGV---------------------ILNFVRDVTPMPH-------
W0L7X1_SERFO/19-128M---VKG........PGPGRESTIRALNA-------AGF---------------------RITNITDVTPIPH-------

PF00861

RL5_YEAST/26-173R.YGITHGLTNWAAAYATGLLIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVFGAL
RL18_HALMA/10-130E.YGWEAPTGNMPSAYLTGLLAGLRAQE........AGVE...................EAVLDIGLNSPTPGSKVFAIQ
RL18_MYCPN/5-116......NG..NKDNAKLVGQDIADKLVK........LKL.....................TNVVFDTGGSKYHGRIAALA
RL18_BORBU/7-119S.LNLGKN...IDDVKKLGEVLAKRLKE........KNI.....................NNLIFDRNGYKYHGLIASFA
RL51_ORYSJ/27-173R.YGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEGNIEATGEDYYV.EPADERRPFRALLDVGLIRTTTGNRVFGAL
RL18_HAEIN/1-117E.QV.KYTGNKDA.AAAVGKAVAERALA........KGV.....................QAVAFDRSGFKYHGRVQTLA
RL18_SYNY3/4-120K.S..LSSTATQEASAEVGKLVAQRAIA........KGI.....................NQVVFDRGGKLYHGRVKALA
RL18_ARCFU/12-132E.FGWKGDLNNTPAAYLTGILIAKKALQ........KG.I..................GEAVLDIGLHTPTRGSRVFAVL
RL18_SULAC/10-131KKYGWKGDTNNTPAAYLTGYLAGLRAVK........SGVK...................AAVSDIGLFVPVKGGRIFAVI
RL18_HELPY/9-119K.MGFKNT...QEDAKKLGALFAEELKK........AGI.....................ERAVYDRNGYLYHGVVAAFA
RL5_CAEEL/26-172R.YGLKVGLTNYAAAYATGLLLARRHLKTIGLDSTYKGHEELTGEDYNV.EEEGDRAPFKAVLDIGLARTTTGSKIFAVM
RL18_METTH/10-130K.MGWLGGTSNTAAAYLTGYLCGKRALK........EG.I..................EEAVLDIGLRPAIRGSKVFAAL
RL5A_SCHPO/26-173R.YGIKWGLANWTAAYATGLLVARRALAKVGLADKYEGVTEPEGEFELTEAIEDGPRPFKVFLDVGLKRTSTGSRVFGAM
RL18_STRCO/13-127...GGEAD..KSAQAKQVGALVAERAKA........AGV.....................EAVVFDRGGNQYAGRIAALA
RL18_BACSU/6-120...VESTG..DTSAATKVGELVAKRAAE........KGI.....................SDVVFDRGGYLYHGRVKALA
RL18_METJA/10-130K.LGYKGHTGNLPSAYLTGYLLGKKALA........KG.Y..................TEAVLDIGLHRATKGNAIFAIL
RL18_AQUAE/6-124K.ITGKRGGKSIKDAEVVAEIIARRALE........KGI.....................KKVVFDRGGFKYHGKIKAFA
RL18_CHLTR/7-123T.SGLTRK..NQDNAKALGIKIAELGKG........LQV.....................DRVVFDRGAHKYHGVVAMVA
C5CC47_MICLC/11-124A.L..E..GDKTAKAKRVGELVAERAKA........AGI.....................EAAVFDRGGNKYHGRVAAVA
F7DSA5_XENTR/26-173K.YGVKVGLTNYAAAYCTGLLLARRLLNKFGLDKVYEGQVEVTGDEYNVESIDGEPGAFTCYLDAGLTRTTTGNKVFGAL
F7YKM5_VIBA7/2-117E.LV..KNTGNVDAAKAVGKAIAERALE........KGV.....................SAVAFDRSGFQYHGRVAALA
RL18_MYCTU/9-122...G..VPGDKKARSVRVGQLIAERAKA........AGI.....................DTVVFDRGGYTYGGRIAALA
RL18_SYNE7/5-120Q.SLTSGG..NQQASAAVGKLIAERAQA........KGV.....................TTVVFDRGGNLYHGRVKALA
RL18_GEOKA/8-120.....LDSTNNIEAAKKVGELVAKRALE........KGI.....................KKVVFDRGGYLYHGRVKALA
RL18_METMP/11-130K.MGYKGHCGNLPAAYLTGLLLGAKAVK........EDVK...................EAVLDKGLHRATKGAAIFAVL
RL18_MYCMS/5-116S.....KS..NTLAAQKVAEEIAKKALA........ANI.....................TQVVFDRNGYLYHGKIKAFA
R4I0E9_9ENTR/2-117E.Q.LKYS.GNKNAAAAVGKTLAKRALE........KGI.....................AKVSFDRSGFQYHGRVQALA

PF03464

ERF1_CAEEL/153-285TVAGLILAGSADFKTELGQSDMFDQRLQA........KM---------------------IK.TVDIAYGGENGFNQAIE
PELO_HUMAN/136-268VVKCILVASPGFVREQFCDYLFQQAVKTDNKLLLENRSK---------------------FL.QVHASSGHKYSLKEALC
PELO_METTH/136-256DLETIIIAGPGFYKSDFYDYLMERYPEIA........KK---------------------AV.LENTGTGGRAGISEVLR
DOM34_YEAST/141-274KLKTIILCSPGFYAKILMDKIFQYAEEEHNKKILDNKGM---------------------FF.IAHCSTGYLQGINEVLK
RF1_AERPE/142-276VLKGVIVAGPGLAKQEFVEGNYLDYRLK........KIL---------------------APELVDVAYQGLQGLKEAVM
O96203_PLAF7/141-273NVTGIVLAGSADFKNDLLNSDMFDQRLFA........KV---------------------IK.IVDISYGGDNGFNQAIE
RF1_HALSA/147-278EIDGILVGGPSPTKDEFLDGDYLHHELQD........KV---------------------LG.KFDVSYTDESGLSDLVD
RF1_METTH/141-271DLKGIILGGPGHTKEEFLNGDYLHHELKK........KV---------------------IT.TVDTSYTGEFGIREVID
PEL1_ARATH/136-268VVRCAVVASPGFTKDQFHRHLLLEAERRQLRPIIENKSR---------------------II.LVHTNSGYRHSLGEVLH
PELO_DROME/136-268VVKCVLIASPGFVRDQFYDYMFQQAVKMDYKLLLDNKSK---------------------FM.LVHASSGFKHSLREILQ
YNU6_CAEEL/136-268VVKCVIVASRGFVKDAFMQHLIAHADANGKKFTTEQRAK---------------------FM.LTHSSSGFKHALKEVLE
DOM34_SCHPO/136-268KLKVVILASPGFVARGLYDYIFSMAVKLDLKQIVKSKNK---------------------FV.ILHSSTGHIHSLNEILK
ERF1_SCHPO/142-274NVAGIVLAGSADFKTELGQSDLFDQRLQS........RI---------------------IK.TVDVSYGGDAGFNQAIE
RF1_ARCFU/136-267KLIGILIGGPSPTKEEFYEGEYLHHELQK........KV---------------------LG.LFDVGYTDESGLYELVE
RF1_SULSO/138-272KMKGVLLGGPGYAKEDFYKEDYVDYRIKN........LI---------------------LQPLIDVSDQGEVGLREMIM
RF1_METJA/141-274KLRGILVGGPGHTKNEFVEGDYLHHELKK........IV---------------------LD.TFDLCYTEEFGIRELLE
B2AWT5_PODAN/146-276NVMGIVLAGSADFKNDLNASDMFDQRLAT........KV---------------------IK.VVDVSYGGENGFNQAIE
E1EZY6_GIAIA/150-287IVSGLILGGSADFKNVLSTSAIFDQRLQS........IV---------------------MK.QIDINYGGEQGFNQAIE
I7MKI5_TETTS/145-275NVQGLVLAGSGDFKNELSTTQMFDPRLAC........KI---------------------IK.IVDVSYGGENGLNQAIE
Q386S9_TRYB2/146-277NIVGLVLAGSAEFKEVLYQSDLFDPRLKA........IV---------------------VK.VVDVAHPGDVGLNQAID
RF1_THEKO/140-272ELRGIIIGGPGPTKEEFVEGDYLHHELRK........KV---------------------IG.VVDISYHGEYGLRELVE
RF1_THEAC/144-273DIRAIFLGGPGATKEYFFEKDYLRNEVKE........KI---------------------KD.LFDVGYTDESGLRELVE

PF00411

RS11_HALMA/10-127DGTRAPKNS.
RR11_MAIZE/36-142NGCRPPKKRR
RS11_SULAC/10-128DTIRRPGGRR
RS141_MAIZE/27-145DSTRRKGGRR
RS11_GEOKA/19-128NGCRPPKRRR
RR11_PHYPA/20-129NGCRPPKKRR
W0L7X1_SERFO/19-128NGCRPPKKRR

PF00861

RL5_YEAST/26-173KGASDGGLYV
RL18_HALMA/10-130EGAIDAGLDI
RL18_MYCPN/5-116EAARERGLNF
RL18_BORBU/7-119TSLREFGINI
RL51_ORYSJ/27-173KGALDGGLDI
RL18_HAEIN/1-117DAAREAGLQF
RL18_SYNY3/4-120EAAREAGLNF
RL18_ARCFU/12-132RGAVEGGLEV
RL18_SULAC/10-131KGAIDAGLKV
RL18_HELPY/9-119ESLRENGIAL
RL5_CAEEL/26-172KGVADGGINV
RL18_METTH/10-130KGAVDAGLNV
RL5A_SCHPO/26-173KGASDGGLFI
RL18_STRCO/13-127DAAREAGLKF
RL18_BACSU/6-120DAAREAGLKF
RL18_METJA/10-130KGALDAGMEI
RL18_AQUAE/6-124DKCREMGLEF
RL18_CHLTR/7-123DGAREGGLQF
C5CC47_MICLC/11-124DGAREGGLQL
F7DSA5_XENTR/26-173KGAVDGGLSI
F7YKM5_VIBA7/2-117ESAREAGLKF
RL18_MYCTU/9-122DAARENGLSF
RL18_SYNE7/5-120EAAREAGLEF
RL18_GEOKA/8-120DAAREAGLEF
RL18_METMP/11-130KGALDAGMDI
RL18_MYCMS/5-116ETARENGLKF
R4I0E9_9ENTR/2-117DAARKAGLQF

PF03464

ERF1_CAEEL/153-285L..AADTLAS
PELO_HUMAN/136-268DPTVASRLSD
PELO_METTH/136-256KGTVERVSSE
DOM34_YEAST/141-274NPLYASKLQD
RF1_AERPE/142-276K..AEKVVEA
O96203_PLAF7/141-273L..SSEALQN
RF1_HALSA/147-278A..GQAALAE
RF1_METTH/141-271K..SMDVLSE
PEL1_ARATH/136-268APNVMNMIKD
PELO_DROME/136-268DPAVLAKMSD
YNU6_CAEEL/136-268TPQVALRLAD
DOM34_SCHPO/136-268DPAVESKLAD
ERF1_SCHPO/142-274L..AADTLSN
RF1_ARCFU/136-267K..AKDVLQE
RF1_SULSO/138-272K..AEDLLKN
RF1_METJA/141-274K..AAPLLKD
B2AWT5_PODAN/146-276L..ASETL..
E1EZY6_GIAIA/150-287M..AGDTLKD
I7MKI5_TETTS/145-275L..AQESLT.
Q386S9_TRYB2/146-277L..AADALS.
RF1_THEKO/140-272K..ASDILKD
RF1_THEAC/144-273K..ASESIK.

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window