Sequence alignment for CL0268

PF12218

ENAN_BPK1E/39-102--------------------------------------------------------------------------------
Q858B1_BPK1F/246-312--------------------------------------------------------------------------------
A5VW57_9CAUD/146-212--------------------------------------------------------------------------------
O80102_9VIRU/167-233--------------------------------------------------------------------------------

PF12708

B9DJC5_STACT/126-337--------------------------------------------------------------------SINI.---DE.Y
Q7URR5_RHOBA/63-307--------------------------------------------------------------------SINA.---TH.F
C6Y0W6_PEDHD/63-325--------------------------------------------------------------------IFKV.---DD.Y
Q09C01_STIAD/75-328--------------------------------------------------------------------IIDVT---QAPY
Q87XU1_PSESM/2-255--------------------------------------------------------------------IFNT.---KD.F
B6IU75_RHOCS/4-239--------------------------------------------------------------------QVSI.---TD.F
B6IPQ6_RHOCS/4-238--------------------------------------------------------------------YVSI.---TD.F
Q9K7M8_BACHD/30-252--------------------------------------------------------------------VVNA.---RD.F
C7Q7K8_CATAD/223-454--------------------------------------------------------------------SVSV.---VT.E
B3VMP8_BPPH2/104-333--------------------------------------------------------------------GVSV.---KT.Y
C4L0K4_EXISA/96-329--------------------------------------------------------------------RVDV.---TD.Y
Q184L0_PEPD6/13-220--------------------------------------------------------------------WINV.---LD.Y
Q184L1_PEPD6/12-216--------------------------------------------------------------------WINV.---VE.R
Q184L3_PEPD6/10-203--------------------------------------------------------------------WINV.---LE.L
B8GG97_METPE/553-766--------------------------------------------------------------------ATNV.---RS.S
B8GGB4_METPE/99-337--------------------------------------------------------------------ATNV.---RS.S
B6H126_PENCW/211-429--------------------------------------------------------------------YRNV.---MD.Y
Q4WIW4_ASPFU/77-298--------------------------------------------------------------------FRNVV---TD.F
B8MQM9_TALSN/123-346--------------------------------------------------------------------FRNVV---TD.F
Q5B3M8_EMENI/219-441--------------------------------------------------------------------FRNVV---TD.Y
B8NUX0_ASPFN/88-302--------------------------------------------------------------------FRNVV---SD.Y
A2QF38_ASPNC/247-469--------------------------------------------------------------------FRNVV---KD.F
A9V1W5_MONBE/50-262--------------------------------------------------------------------FRNA.---KD.Y
B2ANL4_PODAN/41-256--------------------------------------------------------------------FRNV.---RD.F
Q7S3S0_NEUCR/218-448--------------------------------------------------------------------FRNV.---LD.Y
Q5B3Q5_EMENI/170-388--------------------------------------------------------------------FRNVV---TD.Y
Q5ATA0_EMENI/247-460--------------------------------------------------------------------WRNV.---RD.Y
A2RBJ4_ASPNC/164-404--------------------------------------------------------------------WRNV.---RD.Y
C5FIT8_ARTOC/207-432--------------------------------------------------------------------FRNV.---KD.Y
B6QWE5_PENMQ/71-313--------------------------------------------------------------------FRNV.---KD.F
Q7S602_NEUCR/168-396--------------------------------------------------------------------FRSV.---KD.F
B2AQ98_PODAN/93-316--------------------------------------------------------------------WRNV.---KD.F
Q2GRE2_CHAGB/224-446--------------------------------------------------------------------FRNV.---KD.Y
Q0CRX2_ASPTN/83-312--------------------------------------------------------------------FRNV.---KD.Y
Q2H3L6_CHAGB/41-260--------------------------------------------------------------------FRNV.---KK.L
Q7SGI7_NEUCR/41-267--------------------------------------------------------------------FRNV.---KD.Y
Q0UIW6_PHANO/70-284--------------------------------------------------------------------FRNV.---KD.Y
A8NNP9_COPC7/68-294--------------------------------------------------------------------FRNV.---KD.F
B2WKN5_PYRTR/68-291--------------------------------------------------------------------FRNV.---KD.L
C4JXY6_UNCRE/64-288--------------------------------------------------------------------FRNV.---KE.F
C1H3L4_PARBA/65-289--------------------------------------------------------------------YRKV.---TD.F
Q7S324_NEUCR/222-446--------------------------------------------------------------------FRNV.---RD.Y
B2AVA4_PODAN/55-279--------------------------------------------------------------------FRNV.---QD.Y
Q7S6I5_NEUCR/41-263--------------------------------------------------------------------FRNV.---KD.Y
B2AQV4_PODAN/41-263--------------------------------------------------------------------FRNV.---RD.Y
B6QD92_PENMQ/79-303--------------------------------------------------------------------FRNV.---RD.Y
B6QUF4_PENMQ/72-296--------------------------------------------------------------------FRNV.---KD.Y
Q4WLX5_ASPFU/93-315--------------------------------------------------------------------FRNV.---KD.F
B2W2R6_PYRTR/89-320--------------------------------------------------------------------FRNV.---KD.Y
A7EWZ9_SCLS1/45-272--------------------------------------------------------------------FRNV.---KD.F
A7EV58_SCLS1/85-323--------------------------------------------------------------------FRNV.---KD.F

PF01095

PME13_ARATH/301-598--------------------------------------------------------------------NATVA---KD--
PME42_ARATH/215-510--------------------------------------------------------------------DVVVA---KD--
PME23_ARATH/257-554--------------------------------------------------------------------NAVVA---QD--
PME44_ARATH/212-509--------------------------------------------------------------------DVSVA---LD--
PME16_ARATH/213-502--------------------------------------------------------------------DAVVA---PD--
PME24_ARATH/255-548--------------------------------------------------------------------DIVVA---KD--
PME51_ARATH/240-544--------------------------------------------------------------------DVTVC---KD--
PME61_ARATH/273-571--------------------------------------------------------------------DITVS---KD--
PMEU1_SOLLC/272-570--------------------------------------------------------------------DVVVA---AD--
PME2_ARATH/276-573--------------------------------------------------------------------DATVA---DD--
PME35_ARATH/228-514--------------------------------------------------------------------HAVVA---AD--
PME21_ARATH/255-552--------------------------------------------------------------------DIVVA---QD--
PME47_ARATH/307-606--------------------------------------------------------------------AVTVG---PY--
PME12_ARATH/237-533--------------------------------------------------------------------SLVVA---AD--
PME26_ARATH/660-954--------------------------------------------------------------------HVTVA---AD--
PME17_ARATH/206-499--------------------------------------------------------------------NAVVA---KD--
PME43_ARATH/391-688--------------------------------------------------------------------NVVVA---KD--
PME1_SOLLC/233-531--------------------------------------------------------------------NAVVA---QD--
PME58_ARATH/259-556--------------------------------------------------------------------NVVVA---HD--
PME46_ARATH/257-550--------------------------------------------------------------------TIVVA---KD--
PME34_ARATH/284-583--------------------------------------------------------------------DIIVS---KD--
PME22_ARATH/240-525--------------------------------------------------------------------NTVVA---ID--
PME32_ARATH/214-511--------------------------------------------------------------------DAVVA---AD--
Q9S767_ORYSJ/304-592--------------------------------------------------------------------DVVVA---QD--
B4FCY2_MAIZE/251-546--------------------------------------------------------------------NAIVA---KD--
B9IKC0_POPTR/283-579--------------------------------------------------------------------NVTVA---KD--
K7KZN7_SOYBN/877-1170--------------------------------------------------------------------DAVVA---SD--
U5GQ29_POPTR/312-608--------------------------------------------------------------------DVVVA---AD--

PF03718

IPUA_ASPNG/7-563LLTLSAAFQVAQAAVTANNSQLLTWWHNTGEINTQTPVADGNVRQSGLYSVKVQTTPASSSLYYDSFVYLAIP---GNGM
DEXT_PENMI/26-608PGNSHPGTHMGTTNNTHCGADFCTWWHDSGEINTQTPVQPGNVRQSHKYSVQVSLAGT.NN.FHDSFVYESIP---RNGN
P77813_ARTGO/20-620AAGQEPAAATEQTGFTASGPELRTWWHNNYEYNATSPTQNGNVRRSSFYEVQVATAAAPET.RYDSFAYMSIP---RSGK
DEXT_ARTSD/41-636PGVPA.ALKAERAITTVDNGNLHTWWHDNGVFSPATPTQSSEVRRSSFYDVQVAQANQPQK.LYDAFSYMSIP---RSGK

PF07971

R6CE95_9BACE/252-740---------------------------------FYY..N.....TTQDEQ..........VLVSTALSAVSMD...GAEQ
Q8A6K3_BACTN/246-733---------------------------------ATF..D.....LKP.GDE.........LMMKVALSTTSVE...GAKK
C6XXW8_PEDHD/284-772---------------------------------FDF..E.....TAE.GEQ.........VQVKFALSPVSQA...NALE
B8LV53_TALSN/266-771---------------------------------VRF..K.......PE..TD......STVLARVGLSFISED...QACS
W5WJ40_9PSEU/298-772---------------------------------VTF..D......TLKS.A........TVNVKVGVSFVSVD...GAKA
A4VXP8_STRSY/216-705---------------------------------INF...........SSTS.........IKGRLATSFISPE...QAAF
F8EET3_RUNSL/240-740---------------------------------IGF..K.....TKK.GEE.........VHIKVASSFISAE...QAAR
K4L2L4_SIMAS/261-762---------------------------------FSY..D......FAEATE.........IELRVGISFVSVE...NARE
R6VKF5_9BACT/153-626---------------------------------VSF..P.....TES.GEE.........VEVKIGTSFINFE...QARR
Q8A5N9_BACTN/240-739---------------------------------LKF..D.....VPA.GEK.........LTIRTASSFISPE...QAAI
A6KYE2_BACV8/400-910---------------------------------AQY..........QVRRGE.......QVCLKMAVSYVSIA...NAKE
F4CBM4_SPHS2/248-748---------------------------------VGF..S.....VRGKTDQ.........VHAKVASSFISEE...QALL
R6VZN3_9BACT/256-743---------------------------------LDF..G.....AS..SEP.........LIVKVALSPVSVD...NARE
M2ZGR3_PSEFD/7-543---------------------------------FSW..KRTGANASAEHV..........IESRVGISYISAD...QACK
R7L3G4_9BACT/243-737---------------------------------IDF..G.....LKK.GDV.........LTIKIGISSVDAA...GANL
Q8A113_BACTN/217-733---------------------------------ALY..Y......GSEKN..........LNLRYGISFISAE...QAKK
G8TLM2_NIAKG/240-740---------------------------------VGF..K.....TKK.GEQ.........VHIRTASSFISFE...QAEL
D3PUH5_STANL/247-764---------------------------------IGF..D......ASK.DR........EVVAKVGLSYTGMD...GARK
B2FTT2_STRMK/526-1060---------------------------------IKF..D......AGSERR.........VTMRIATSLISVE...QARH
R6D727_9BACE/236-736---------------------------------VRF..S.....TQR.GEQ.........VQARVASSFISFE...QAEL
E8UZA2_TERSS/262-752---------------------------------VHY..K.....TAD.SEK.........ILVKVGISMVSAE...NAML
R6X4R5_9BACT/257-729---------------------------------ADF..H.....TTE.GEQ.........VMLKVAVSPASEE...KAAL
B6HPH9_PENCW/257-760---------------------------------ARF..H.......AP..KD......NNILVRVGVSFISVH...QACS
W8F287_9BACT/273-763---------------------------------FDF..K.....TTA.GEQ.........VKVKMALSGVSTE...GALR
D2PP99_KRIFD/286-782---------------------------------VTF..A......PGA..K.........VRMRLGISYVSLA...GAER
Q9AAM3_CAUCR/256-729---------------------------------LTFKTTP...TKP..............LLVKIAVSFVSAE...MAKA
F4C4J4_SPHS2/532-1035---------------------------------VEF..........DLRKKH.......TVQVRTGISFVGLT...QAEQ
N1QLN3_SPHMS/228-731---------------------------------VRF..Q.......KP..GN......GTMKARVGVSFVSTQ...QACR
F9Z496_ODOSD/396-890---------------------------------ALH..........RLKKGE.......ELQVKIAISYTNIE...NARH
M3B4L8_PSEFD/279-788---------------------------------ARF..K.......AP.KSN......NQILARVGVSFISTK...QACS
F9D252_PREDD/265-751---------------------------------FTY..N......VDEAEQ.........IEVQVAVSFVSVD...NARR
R6VNE2_9BACT/226-707---------------------------------LTF..A......PG.TTS.........LTAAVGLSAVSAE...NARE
A6KYE5_BACV8/247-734---------------------------------FCF..D.....KKW.NNE.........LICKVALSSVSIE...NARL
I3ZHR8_TERRK/253-727---------------------------------FDF..NA....RA....HQ.......VVQAKVGISFISAE...QAKK
A0A0E1RV06_COCIM/260-765---------------------------------VRF..R.......AS..NS......TKVSARVGVSFISAD...QACQ
A2R7B1_ASPNC/265-756---------------------------------FSW..DT....ETD.AQ..........ISSRVGISFISTE...KARS
C7PRR1_CHIPD/258-758---------------------------------IGF..A.....TAK.GEK.........VNVKVASSFISPE...QAEL
F4B1S1_DOKS4/242-723---------------------------------LQF..D......NPKNEE.........IIIKIGISAVDEA...GARK
D6CYS0_9BACE/218-733---------------------------------LLY..S......TDIKT..........IKVRYGISFIDEK...QAKA
Q1ASW5_RUBXD/250-760---------------------------------VSF..G......TGG.SR........EVVARVGISYVSVE...GARR
Q5LHH6_BACFN/241-740---------------------------------LRF..N.....VPA.GEK.........LTVRTASSFISPA...QALV
R5JE95_9BACE/220-736---------------------------------VGW..D......AAPLS..........LNVRYGISYISVE...QAKR
U5W717_9ACTN/586-1115---------------------------------LKF..D......TTTNKT.........VQMRIATSLISVA...QAKK
I4A2R7_ORNRL/265-744---------------------------------FSY..N......FKKPTQ.........LELKIGVSYVSIE...NAKE
Q63NY9_BURPS/276-755---------------------------------LAF..D......SGAT...........VRMKIGISYVSVD...NAKA
X5E1R5_9BACT/243-744---------------------------------VGF..K.....TQK.GEE.........VNVKLASSFISAE...QAEL
R5JB76_9BACE/261-739---------------------------------IDF..D.....KSS..PQ.........IQVQIATSFISIE...QARM
I4WZK2_9GAMM/265-751---------------------------------FDF..G......KLKQ.P.........LEVKVAISPVSEA...NAIA
B2FTQ4_STRMK/277-764---------------------------------FAF..G......KLDA.P.........LVVKVAISPVSEA...GAIA
H2K488_STRHJ/282-784---------------------------------VRF..A......PGD..G........PVNVKVGISYVSRE...AAEA
G0L6Z0_ZOBGA/241-764---------------------------------VFL..........KDGVDE.......VL.MKAGISYTSVA...NAKA
G7XUX9_ASPKW/176-669---------------------------------FTF..K.....DS...V..........VTSRVGISWISTE...KACK
F6GE18_LACS5/241-722---------------------------------LNF..I......NPNNEP.........VYVKVGISAVDIE...GAKE
F8EMI3_RUNSL/257-744---------------------------------VEF..E......TNENLV.........VNVRVGSSFTDTE...GARR
A5FGD3_FLAJ1/253-738---------------------------------LDF..K.....TLK.NKQ.........ILVKVGISPVSTE...NASA
M2RQI9_CERS8/269-747---------------------------------VRF..A.....EGT..KQ.........VNVRVGVSFISVE...QARR
F3ZH20_9ACTN/296-799---------------------------------VTF..P......KGT..T........EVGAKVAISYVSDA...GAEA
K0K341_SACES/608-1133---------------------------------LRF..D......TSTEKA.........VTLRIATSLLGVD...QARR
G3XPX4_ASPNA/260-769---------------------------------VRF..E.......RP..DN......GTVSVRVGVSYISTE...KACE
A6LGN6_PARD8/241-738---------------------------------VQF..A......K..GSK.........VQAKVSTSYISPE...QAEV
R6SEB5_9BACE/264-743---------------------------------FTF..D......TTEGEA.........IEVSIGVSFVSIE...NARL
C6W5S0_DYAFD/239-739---------------------------------VGF..K.....TKR.GEQ.........VGIKVASSFISPE...QAEL
R6FR09_9BACT/239-726---------------------------------FKF..A.....TEGFDK..........LVVTTALSPTSLE...GAQK
U5VWY0_9ACTN/415-918---------------------------------IRF..A......TTANEQ.........VTLKMATSYISVA...QATA
A4AVQ7_MARSH/263-741---------------------------------MHY..N......FDKPTQ.........VEMKVGVSYVSLE...NARE
M7SRL0_EUTLA/328-835---------------------------------VRF..R.....SDT..KR.........VEVRTGVSFVSVE...QARK
K1VMQ9_TRIAC/331-806---------------------------------AIF..P.....RDT..KS.........VDVRIGVSFISIE...QARR
F8PNH6_SERL3/272-749---------------------------------VKF..E.....SNL..TT.........VNVRVGVSFISID...QARK
U5VS77_9ACTN/291-788---------------------------------VGFDTA......TGG..D.........VRMRVGISYVSAA...GAAA
F2KZ10_PREDF/247-747---------------------------------VGF..H.....TRR.GEQ.........VNVQIASSFISDE...QALR
Q8A193_BACTN/250-734---------------------------------LTF.........GN.VKE.........VKIKVAISSVSCD...NAAM
R5IIM1_9PORP/219-735---------------------------------FRF..A......PDQRK..........VKVRYGVSFISEE...QAKR
G3YEZ1_ASPNA/266-770---------------------------------TRF..N.......MS.TND......QALMARVGVSFISVE...QACA
A0A0C4E0X3_MAGP6/267-771---------------------------------IRF..K.......SA..DN.......PILVRTANSFISVE...QACR
R7JK19_9PORP/295-763---------------------------------TEF..E.....TTK.DEV.........VLMKAGISFVCEE...NARE
W0F0W6_9SPHI/239-738---------------------------------VGF..K.....TAK.GEK.........VHMRMATSFISFE...QAEL
Q5LHF2_BACFN/248-750---------------------------------LHF..D......TTKDEQ.........VFVKVGISAVDIE...GARK
F2IHY2_FLUTR/251-730---------------------------------FLM..E.....FPEGVKE.........ISVRVGLSGTDET...GATS
B6QUE6_PENMQ/232-737---------------------------------FGW..GN...DTTAPRN..........IISRIGVSFMSID...TAKD
Q2G5L6_NOVAD/254-749---------------------------------LHY..D.....DAG.AAP.........LVVRCGISAVDAQ...GARA
D5EV06_PRER2/237-737---------------------------------VGF..Q.....TVR.GET.........VTLRIASSFISAE...QARQ
B2AN89_PODAN/262-766---------------------------------VRF..S.......SG..AE.......PILVRTANSFISAE...QACK
M3CXH6_SPHMS/267-777---------------------------------TRF..E.......AP.DND......GQILARVGVSFISPQ...QACN
C9A6J8_ENTCA/202-695---------------------------------LRF..G......ACQTQT.........I..RFATSFLSRE...QACL
B5HEX3_STRPR/283-800---------------------------------VTF..D......AAD.DR........DVVVKVGLSYTGIE...GARK
J4IB15_FIBRA/280-758---------------------------------GRF..A.....PGT..QV.........VDVRVGVSFISED...QAWA
I2ERB7_EMTOG/238-738---------------------------------IRF..K.....TKT.NEQ.........INLKVASSFISAE...QAEL
R5VNB2_9PORP/259-749---------------------------------MKF..K.....TET.GEK.........VYVKTAISAVSTE...GAKL
F0SAJ1_PSESL/255-739---------------------------------VGF..K......LNKNEQ.........LKLRVGTSFTSIE...NAIK
H1XSR1_9BACT/247-733---------------------------------VKY..K......TGQSEA.........ILVKVGISAVSEE...GALK
E3S9H8_PYRTT/269-771---------------------------------IRF..K.......GP..LS......GPILARMGLSFISTD...QACR
H8KS37_SOLCM/242-742---------------------------------IGF..K.....TQK.GEK.........VNLRVASSFISYE...QAAL
R6D9S0_9BACE/256-746---------------------------------VSF..A.....TND.GEA.........VTVRVAVSGVSTD...GAVD
C6WE78_ACTMD/249-759---------------------------------ATF..D......TTA.DR........DVVVKVGLSYTGIE...GARK
R6Y8B5_9PORP/255-742---------------------------------IKL..T......SDKPGK.........ILVKVATSFTSID...NARK
R6CWA8_9BACE/240-728---------------------------------LSF..D......T...DT.........LLVKVGLSTVSVE...GALQ
R7YLH4_CONA1/250-746---------------------------------FTF..G.....QG...T..........VTSRVGISFISTA...KACQ
R5GD99_9PORP/267-748---------------------------------FTF..D......TEADET.........IEVQMGVSFVSIE...NARE
G2NMH0_STREK/623-1146---------------------------------FRF..D......AGKDRT.........VGLRLATSLISVD...QAKK
N1JF10_BLUG1/293-846---------------------------------FSF..D........TVN..........VKSKVGISWISEE...KACQ
R5UP48_9PORP/239-739---------------------------------IGF..K.....TRR.GEK.........IHARVASSFIGFE...QAER
R5LY91_9BACE/245-734---------------------------------FDF..H.....TAAGEQ..........ILVTTAISGVSME...GAAR
I3ZB09_TERRK/260-749---------------------------------LYF..D.....TKA.NET.........ILVKTGISAVGAD...GAAN
R5AV27_9BACE/242-742---------------------------------VGF..P.....TSR.GEK.........VNVKVASSFISPE...QALL
R7DGG5_9PORP/278-761---------------------------------VEF..A.....TAN.KEQ.........VLAQISTSFISLE...QARI
B6Q8F4_PENMQ/348-844---------------------------------FTF..N.....AS...T..........VTSRVGISWLSTS...QACT
B6H4A8_PENCW/263-778---------------------------------VRF..E.......PA..PD......NTVLARVGISFMGTQ...QACA
X5E0Z5_9BACT/266-745---------------------------------FTF..N......TKANEE.........ILVEVGISYVSIE...NARL
Q5LAE2_BACFN/240-727---------------------------------MSF..D.....MKP.DEQ.........LLMKVAISTVGVD...GAHK
F8JSP5_STREN/254-762---------------------------------LRF..D......TRS.DR........TVTATTALSYVSAA...GARR
F4C4K0_SPHS2/257-777---------------------------------LRF..........GTREGE.......QVNIKVGLSYTSVE...NARE
C7M956_CAPOD/241-706---------------------------------LRY..A.....TADNEA..........IVVKTALSMHSIA...EAYK
T5AF87_OPHSC/253-761---------------------------------ARF..E.....PR.G..PD......AAVTARVGISFRSAE...QACR
D5ES81_PRER2/228-725---------------------------------VSF..K.....TRR.GEK.........VCARVASSFISLE...QAEQ
G2QF21_THIHA/227-734---------------------------------LQF..ER....PA....NN.......SLLARVGVSFISMD...QACQ
Q0CPM5_ASPTN/209-715---------------------------------LRV..Q.......RP..DS......GTVTVRVGVSYISTD...KACT
M2N2U4_BAUCO/278-768---------------------------------FSF..S.....QS...K..........VASRVGISFISSA...QACQ
R6Y700_9BACE/245-733---------------------------------FNF..D.....TQAGDQ..........LVLATSLSSVSAE...GAAK
R5PE19_9PORP/254-773---------------------------------LNY..........KTKAGE.......VIDVKIGLSYTSVE...NAKL
Q0UTF3_PHANO/200-688---------------------------------LRF..Q.......GP..VS......GPILARMGLSFISTE...QACQ
G8TCQ4_NIAKG/241-727---------------------------------AGF..K......LKKGEQ.........LRIRIGTSFSSVA...EARK
R7JG93_9PORP/266-784---------------------------------LTY..........QTKAGE.......TVTAKVGLSYTSVE...NARL
A5FGD4_FLAJ1/238-738---------------------------------VSF..K.....TKK.GEK.........VNVKIASSFISFE...QAEL
R5UUU5_9PORP/269-756---------------------------------FDF..D.....LKE.GEA.........LEVKVALSPVSAS...GALA
R5NWJ1_9BACT/294-769---------------------------------TEF..P.....TRE.GEQ.........VLMRTAISFVSLE...GAEA
N1PXL6_DOTSN/322-820---------------------------------VRF..G......GS..KR.........VEVRTGVSFVSVE...QARR
H5X5L5_9PSEU/413-920---------------------------------ATF..A.........EHE.........VTMRIATSLISAA...QARS
A5FF74_FLAJ1/248-743---------------------------------LSF..GN....SG....KE.......ELNVKIGISFLSEL...KAKN
E3FCN8_STIAD/239-745---------------------------------IRF..N......TFAGEK.........VTMSIATSFISVA...QAQS
G8TEK7_NIAKG/226-741---------------------------------AGF..P......ASAPAV.........IEFKYAISYVSAA...QAKK
R7DKN9_9PORP/250-752---------------------------------LHF..A......TSEGEK.........VLVKVGISGVDMA...GARR
Q094Q3_STIAD/650-1180---------------------------------FRF..T.....VPAADRT.........VTMRIATSLISVE...QAQK
D8Q3G4_SCHCM/267-790---------------------------------LTW..PAN.PAGE..TS..........ILARVGVSLISSE...QACQ
V6KI06_STRNV/541-1068---------------------------------VRL..D......AGQDRT.........VNLRIATSLISVD...QAKK
G8P189_GRAMM/264-740---------------------------------AKF..K.....TAE.GEI.........VEARVGTSFISIE...QARE
J4HRZ5_FIBRA/333-848---------------------------------FSY..AG....EP..SE..........INIRVGISFVSAE...QACL
A4FBR3_SACEN/262-779---------------------------------LSF..........GDRQ..........VTATTAISHVDQQ...GADT
E8X5W4_GRATM/238-723---------------------------------AEF.........AP.GSS.........LLMRVGTSFLSVD...QARE
F8JXU3_STREN/242-752---------------------------------VRF..D......TRDGDR........SVVATTAISYVDAA...GAVR
F2KYG1_PREDF/268-750---------------------------------MDY..D......TEAGDQ.........VEVQMGVSFVSMA...NARE
M3A5V7_PSEFD/265-773---------------------------------FSW..ADASYSNST.TT..........VKSRIGISMISIE...KACK
R6KAU3_9BACE/268-756---------------------------------VEF..D......VTEGEE.........VLVKAASSFTDRD...GALK
Q7MU52_PORGI/216-732---------------------------------LNY..D......LAGTD..........LFLRYGISYISVA...QAKK
G2Y9J9_BOTF4/278-790---------------------------------TQF..K.......AP..AS......NQILARVGVSFISIA...KACQ
A4APM0_MARSH/260-778---------------------------------LTF..........NMEKDS.......VLEIQTGLSYTSIA...NARL
Q4WT26_ASPFU/264-769---------------------------------VRF..K.......AA..SD......ITVQARVGLSFISSE...RACS
V5XU82_ENTMU/203-697---------------------------------LYF..G......HIKQQT.........I..RLGTSFISNE...QAHH
F8EA41_RUNSL/306-821---------------------------------VGY..K.....TQK.DDQ.........VTVKVAISHVSVE...GARK
Q15ZN6_PSEA6/250-751---------------------------------IGF..K.....TKR.GET.........VSVKIASSFISPE...QAQL
A6LGN2_PARD8/236-704---------------------------------FTF..P......LKEGNQ........AVQYKIGVSYVSVE...NARE
D5BFU0_ZUNPS/244-744---------------------------------VGF..D.....TKD.GAV.........VHAKVASSFISFD...QAQL
J3P1C3_GAGT3/286-815---------------------------------FEF..P.....AG.ADV..........VQSRVGVSWISAD...KACQ
C8VGN1_EMENI/274-778---------------------------------VRF..N.......SV.SAD......DVISARVGVSFMSVE...QACS
H1Y6J5_9SPHI/252-746---------------------------------AYF..DD....AS....LQ.......QIKVKIGISFISEL...KARQ
R7ECF1_9BACE/250-752---------------------------------LQF..Q......TEPNEE.........VLVKVGVSAVDMD...GARK
R5VDA0_9BACE/235-735---------------------------------IGF..A.....TRK.GEK.........VHARVASSFISQA...QALE
E8V2C0_TERSS/276-763---------------------------------VRF..P.....ALTQGDA.........VVARIGTSFVSVE...EARK
M7U9N7_BOTF1/268-775---------------------------------VRF..Q.......SP..GD.......GIIARVGVSYISSD...QACA
A4APL9_MARSH/554-1057---------------------------------LEF..........DTKKNQ.......VVQTRTGLSYVSIE...NAAL
C4JIN1_UNCRE/55-557---------------------------------FEF..P.....HN.ITK..........VRSKVGVSFISTE...KACE
M2YKL8_PSEFD/253-759---------------------------------LRF..K.......DK..S........PVTVRMAYSFVSSE...QACK
J4UKE8_BEAB2/251-758---------------------------------VRF..K......TTG..KD......RTVTARVGVSFKSGE...QACR
R6Y942_9BACE/296-766---------------------------------MEF..D.....TEA.DEK.........VLFKSGISYVSES...GAEM
J4WIX0_BEAB2/270-764---------------------------------FAF..N.....QT...V..........VVSRVGVSFISTQ...QACD
M4NBS4_9GAMM/429-959---------------------------------FGF..D......TTQAKV.........VNLRIASSLISLE...QARR
R6F8M5_9BACT/252-740---------------------------------ATF..D.....IPR.GEQ.........LLVKVAMSTTSVE...GARR
G7DU14_MIXOS/252-767---------------------------------LEL..DT....SA..QH...........SIRVGVSFVSEE...QACA
G8NVE4_GRAMM/278-774---------------------------------VKF..K......S.G.TR.........LEARIGTSFISFE...QALF
R4SVV6_AMYOR/595-1126---------------------------------LKF..D......AGADKT.........VNMRIATSLISAD...QAKK
G4NF02_MAGO7/328-841---------------------------------VQF..D.....PPTA..GG.......AIVARVGVSFMSVD...QACA
R5FMY1_9BACT/239-739---------------------------------VGF..A.....TRR.GEQ.........VLVRVASSFISPE...QAEV
Q15ZM6_PSEA6/263-747---------------------------------LNF..G.....DIA.DKA.........LVAKVGISYVSIA...GAKQ
G0AF00_COLFT/387-870---------------------------------VTF..D......ASTT.P........AVLMKVGLSYVSSD...NARK
V5GCY0_BYSSN/587-1092---------------------------------FTW..DD....NTKTSQ..........ISSRIGISFISVD...KARS
F8JRR9_STREN/286-769---------------------------------VSF..D......TVKS.R........TVTAAVGISYTTDA...AAGL
I2G215_USTH4/351-880---------------------------------VRF..P.....QDT..IK.........VRVRLGMSLISEE...QARY
I3YTY8_AEQSU/270-759---------------------------------FNF..D.....TKE.NEK.........ISIKFALSSVSTE...GAMK
R5JSK3_9BACE/267-748---------------------------------FSF..D......TAEGEQ.........IEVELGVSFVSIE...NARL
M2TG81_COCH5/268-771---------------------------------VRF..K.......GP..LS......GPLLARMGLSFISTD...QACQ
R6EZA8_9BACT/224-710---------------------------------VVV..S.....VADNTKP.........LLVKVALSPVSID...KAKL
A1S294_SHEAM/264-749---------------------------------LNF..D.....LAQSQSKD......RSLLVHTAISSVSID...NALA
I3ZK24_TERRK/245-732---------------------------------VSF..D......LAGSRD.........VVAQVGTSFTSLE...AARR
K0F0T9_9NOCA/270-745---------------------------------LQF..D......S..D.L........PVQMRTAISYVSVE...GARR
A4AVR4_MARSH/251-737---------------------------------FFF..K.....KEI.S.Q.........VEVKISVSSVSIE...NAGL
E8RVN8_ASTEC/281-753---------------------------------MTF..DT....TN....SS.......VVQMKLAVSFISVE...KAKA
N1QGM3_SPHMS/253-759---------------------------------IRF..Q.......DS..S........PVTARMGYSFISSE...QACQ
R6K435_9BACE/400-907---------------------------------AHY..........RVKTGD.......KICVRTAISYVSVD...NARE
R5I4F6_9PORP/266-747---------------------------------FSY..D......TKPGEQ.........IQVQIGVSFVNIE...NARE
R5HXL6_9BACT/230-726---------------------------------VTF..A......P.GTGQ.........VTVKVGISSVSSD...NARE
G9NTU6_HYPAI/285-779---------------------------------FKF..P.....SK.TTV..........VKSKTGVSFISVE...KACA
D5EVW5_PRER2/248-767---------------------------------LNY..........TTRQND.......QVNVKIGLSYTSIA...NAKL
R5VXR7_9BACE/251-735---------------------------------VNF..A.....AGN.QEP.........VYMKVALSPTSEE...GAQL
C6Y1U7_PEDHD/246-774---------------------------------LRF..........KTAENE.......VRKMKVAISYVSTA...EAKR
R6VPA7_9BACT/243-728---------------------------------VSF..G......EP.IDR.........LCIKVAISSVSEE...NALE
A6LEE3_PARD8/399-910---------------------------------ACF.........GSFKAGD.......ELLLKTAISYVSEE...NARE
E8V399_TERSS/273-763---------------------------------LTF..K......D.GVTA.........LDVRIGTSFISFE...QAEH
C6W4W9_DYAFD/265-751---------------------------------VGF.........GDAKQV.........VTVRIGTSFTSIE...GARA
G2R1P2_THITE/262-767---------------------------------VRF..N.......SA..AE.......PILVRTATSFISVE...RACE
A6RG74_AJECN/261-763---------------------------------VQF..Q.......AP..DN......RELIARVGLSFMSID...QACS
A3HRW3_9BACT/238-765---------------------------------FSF..........DNSSSE.......LL.MKIGISYVSAE...QALL
L2G5N5_COLGN/296-800---------------------------------VRF..K.......SA..EQ.......PITARVATSFHSTE...RACA
R5P2L7_9BACT/242-728---------------------------------FDF..G.....RQ...DV.........VECKLAISPVSIE...NARL
R6VFG8_9BACT/272-759---------------------------------FDF..G......DD.PAP.........LEVRVALSAVGTQ...GARA
W0EKX8_9PORP/238-729---------------------------------LEF..K.....LKP.GES.........LQTKVALSTVGVE...GAQS
R5IAY0_9PORP/237-733---------------------------------IKF..P.....AA..NKK.........VSLKIASSYISLE...QAHQ
S3BSV4_OPHP1/323-857---------------------------------LQF..AP....PSASEEKD......YSIDVRVGVSFISTD...QACA
H8KZ70_FRAAD/285-773---------------------------------FDF..G......DLKGQA.........LVVEVAISDVDEA...GAIA
R7JAF0_9PORP/33-518---------------------------------LTF..K......DA.PKE.........VKCKIAISSVSCA...NAQA
F9YRT9_CAPCC/245-747---------------------------------LSF..S.....TEK.GEK.........VTAKVASSFISIE...QAEL
R0K5A1_SETT2/227-737---------------------------------FTW..K.....NA..TK..........VKSRVGISFMSVD...KACA
X5DYF1_9BACT/280-769---------------------------------FNF..D.....TAE.NEK.........LKVKFALSPVSMA...GALK
F0RGV3_CELLC/258-737---------------------------------MRY..N......FKKKTT.........VEVKIGVSYVSIE...NARE
R7NSX4_9BACE/247-749---------------------------------LRF..D......TAEDEQ.........VMVRFSISSVDGE...GARQ
U5VWI8_9ACTN/585-1110---------------------------------ASF..A......TKPGQE.........VLLRLATSFISLD...QAHR
G0FHU3_AMYMS/259-774---------------------------------LTF..A.......GGGQ..........VTATTAISQVDAA...GARG
A2U4A4_9FLAO/235-716---------------------------------LKI..N......NPKNET.........VFVKIGISAVDSK...GAKQ
D3Q7H1_STANL/259-730---------------------------------VEF.........GDGG.P........QVNAKIGMSFVSAA...GARA
R5IR26_9PORP/203-716---------------------------------AQF..G......KELEQ..........LGIRYGISYISVE...QAKK
Q8A0E8_BACTN/295-770---------------------------------TEF..P.....TKE.GEQ.........VEMKVGISFVDME...GAAN
Q8A3K6_BACTN/415-889---------------------------------IRF..K.....TGK.NEV.........IKAIVGTSFISVE...QARI
A8L8V7_FRASN/275-745---------------------------------LRM..P......PAAD.G........AVMLRAAVSYTSVE...GARA
R6KI45_9BACE/225-723---------------------------------VKF..Q.....LEA.GEK.........MTVRTASSFISHD...QACL
M9M713_PSEA3/355-876---------------------------------VRF..P.....TDT..TK.........IRVRVGLSLISEE...QARY
R9P496_PSEHS/345-860---------------------------------VRF..P.....IDT..TR.........VRVRMGLSLISEQ...QARY
Q0UBD4_PHANO/213-718---------------------------------VQF..E.......KP.KKN......NQILARVGMSFISEA...QACS
R5PLD1_9PORP/276-763---------------------------------FDF..D.....FSG.GET.........LEIKVALSPVSSR...GALN
D5EXZ8_PRER2/240-726---------------------------------VDF..L.....NNKGSRA.........LELKIGFSFVSIA...NAKQ
A1CAZ9_ASPCL/252-745---------------------------------FTF..Q.....ER...V..........VTSRVGISWISTD...RACQ
C7PCT9_CHIPD/259-743---------------------------------INF..D.....KAP.AE..........AMLKVGISPVSSE...NALA
E3QRP8_COLGM/249-752---------------------------------VRF..K......E.L..TN......NTVTARVGVSFKSSD...QACR
G4MT72_MAGO7/278-774---------------------------------FTF..D.....AA...N..........VVSRVGVSFISED...QACT
D6D1V6_9BACE/208-724---------------------------------MKF..P......ENDKR..........INLRYGISFISVD...QAKK
C7QF41_CATAD/257-740---------------------------------LNF..N......TSSN.Q........TVQAKVGISYVSAA...NASA
Q481A5_COLP3/312-819---------------------------------VDL..D......LSQQ.K........TVTMTVGISYVSLA...NARE
I3YTY7_AEQSU/239-720---------------------------------FEF..D......PSVGNE.........LEIKIAISAVDEA...GAKK
V6KVF3_STRRC/274-755---------------------------------VTF..D......TTTH.R........AVQAKVGISYVSAA...DAVG
A1CUM0_ASPCL/259-763---------------------------------VRF..Q.......AP.ADA......SGILARVGVSFISVE...RACA
V6KU68_STRRC/243-754---------------------------------VRF..D......TTK.HR........TVEATTAMSYVDAR...GAAG
G8UPB2_TANFA/230-730---------------------------------IGF..R.....TEK.GEI.........VHARVASSFISPE...QAEQ
R6SCI2_9BACE/261-777---------------------------------FTF..........SNEQQE.......AVTAKIGLSYTSVE...NARI
G0G0P7_AMYMS/236-745---------------------------------LTF..G......TDSNQ..........VGASVGLSYTSVD...GARL
U7PU00_SPOS1/336-876---------------------------------IQF..EP....PAAG..SD......HTITARVGMSFISTD...QACA
C5DCG1_LACTC/314-832---------------------------------FEF..E......KGTKV..........LYSHVGVSFSETDGINVARQ
E6SVL4_BACT6/252-756---------------------------------LNF..A......TTEGEQ.........VLVKAAVSSVDYE...GAEN
R6XE16_9PORP/267-757---------------------------------LSF..A.....TGE.GEE.........VIVKTAISSVSTS...GAKM
E4RQ41_LEAB4/244-733---------------------------------IYF..P.....SKLKE...........VKIKVALSPVSYD...NARL
M4S534_9SPHN/268-753---------------------------------LDF..G......KLAS.P.........LEVKVAISSVDED...AAIA
S3CZA3_GLAL2/246-742---------------------------------FTF..D.....EG...A..........VLSRVGISWISKE...QACR
W0ESN6_9PORP/249-751---------------------------------LQF..A......TTQNEE.........VLVKVGISAVDMD...GARR
R5PZ68_9BACT/299-769---------------------------------ADF..A.....TDE.DEA.........VTLTCAVSYVDIE...GARR
S8E8T9_FOMPI/283-761---------------------------------ARF..S.....GTA..PV.........VDVRVGVSFISVD...QARR
Q8A325_BACTN/241-728---------------------------------FRF..G.....QLN.GKP.........LTCKVALSSVSME...NARQ
F4C4M8_SPHS2/235-718---------------------------------VHL..T......NESKAP.........VELKIGLSFVSME...NAKQ
X5DBU2_9BACT/254-773---------------------------------LTF..........STKENE.......AVTVKVGLSYTSVE...NARL
F0RGV6_CELLC/245-745---------------------------------ISF..S.....TKD.GEQ.........VTAKVASSFISLE...QAEI
C7M5H0_CAPOD/268-751---------------------------------IFF..D......NT.DEK.........LEVKVALSSVSEE...NALD
F4CDU4_SPHS2/244-731---------------------------------LVF..D.....EQ..QKN.........IEIKVALSMTDEN...KALQ
D5QF63_KOMHA/274-760---------------------------------FDF..G......TLST.P.........LGVKVAISPISET...NAIA
X5D9C9_9BACT/239-767---------------------------------VNL..........GDSVDE.......VL.MKAGISYTSVE...NAEV
R6VVJ6_9BACT/255-739---------------------------------VRL..P......DD.TRS.........VSVKVGISPVSMS...GADR
K5X7A2_PHACS/171-650---------------------------------VKF..K.....EDV..TT.........VDVRIGVSFISVD...QARK
G0RA48_HYPJQ/261-756---------------------------------FSF..W.....KS...S..........VTSRVGVSFVSEA...QACA
I3YNN2_ALIFI/253-753---------------------------------VHF..P.....TRR.GQQ.........VCASVASSFISPE...QAVQ
R5PP34_9PORP/240-740---------------------------------IGF..K.....TRR.GEK.........IRARVASSFISYE...QAER
R6YLY3_9BACE/249-722---------------------------------IEF..E.....DNI..RS.........VEVRIGSSFIDYS...QAAY
C8VSU5_EMENI/263-768---------------------------------VRF..N.......HR..LN......HTIKARIGLSFISID...QACS
T0TUP6_9STRE/218-704---------------------------------.TF...........SSKE.........VTVQLGSSYLSQD...MAHS
D5BAG1_ZUNPS/257-741---------------------------------LFF..D.....KKD.K.K.........LQVAVALSSVSIE...NAKE
C4LZ28_ENTHI/214-702---------------------------------IKL............NTT.........TEIKIGTSFISNEYSYSHAL
F9XL31_ZYMTI/230-730---------------------------------VRF..A.....GNC..KS.........VEVRTGVSFVSVE...QARK
Q8A5Y1_BACTN/527-1039---------------------------------LDF..........NLNTGD.......DVMVRTGISLVSID...NARL
R6TED2_9BACE/220-721---------------------------------LSF..........PEESGE......STVKVRTGVSLVDIA...GARN
C1F144_ACIC5/262-749---------------------------------LRF..V......TTQDEQ.........VLVKVATG.VSYE...QAEQ
G8Y985_PICSO/254-746---------------------------------FSF..P......SGTSK..........LRSKMGISHISTD...QACS
M2TDD4_COCSN/274-779---------------------------------VQF..E.......KP.TQN......KQMLVRVGVSLVSED...QACA
Q8P5J8_XANCP/519-1052---------------------------------IKF..A......AGSTRE.........VQMRIATSLISLE...QAKH
M2Y3U8_DOTSN/266-776---------------------------------VRL..Q.......KP..EN......GKIQARMGVSFFSTE...QACR
Q1IUD1_KORVE/260-750---------------------------------VHY..Q.....TAA.GKP.........IFVKTALSGVSTE...GALK
F4A019_MAHA5/200-715---------------------------------VDY..K......TEDNEC.........IELKIGLSYIDVD...QAYQ
H1XZC8_9SPHI/280-769---------------------------------FDF..S.....ASE.GEK.........IKIKFALSPVSMD...GALK
R6SWH3_9BACE/256-775---------------------------------LNY..........KTKKDE.......IVNVKIGLSYTSIE...NAKV
Q5LHF3_BACFN/230-730---------------------------------IGF..S.....TRK.GEI.........VHARIASSFISFE...QAAQ
A6KWP8_BACV8/600-1122---------------------------------VRF..........KTEKDE.......KVMLKVAISYVSVE...QARK
G0RBQ3_HYPJQ/267-767---------------------------------VTF..D.....KSV..QR.........VEVRTGVSYVSVE...QARK
G8TBJ6_NIAKG/238-722---------------------------------ISF..L......KA.PAT.........IMLKVGISPVSSA...NALA
R6TIU0_9BACE/257-760---------------------------------LRF..A.....PLAGGEQ.........VMVKTGLSAVDME...GARA
R6W3J5_9BACT/250-725---------------------------------VRF..A.....SDV..RT.........VEVRIGSSFIDYA...QAAD
W0ESP1_9PORP/265-746---------------------------------FTY..Q......TQPGEQ.........IQVQIGVSFVSTE...NARQ
G8NT21_GRAMM/267-754---------------------------------LDL..T......TTAGEQ.........VLVKIAHG.TSYE...QAEQ
S3CDT6_OPHP1/260-781---------------------------------VQY..NG....DESP..P........EVIVRVGVSFMSSA...QACA
D3EHM8_GEOS4/215-711---------------------------------IRF..K......DCERGT.........LDVKLATSFISQE...QAEL
G0AF01_COLFT/312-844---------------------------------LNFDLS......QSAA.S........SALVKIGLSYVSPA...NARL
R6Y5H0_9PORP/268-754---------------------------------FEF..K......EG.SAP.........LEIKVALSAVGTD...GAVK
F9ZBX8_ODOSD/247-732---------------------------------VDF..G......QKTNK..........ILAKISISSANTE...GAIA
A3HZJ9_9BACT/233-716---------------------------------LSL..S......DQDAGV.........VTMKIGISYVSIA...NAKE
L0JB66_PREDD/632-1138---------------------------------VTL..D......ARAGEP.........VLVRAASSFVDVD...GAWA
Q8A6V7_BACTN/216-731---------------------------------WRF..A......DGTTT..........VNLRYGISFISEE...QAEK
J3NHS8_GAGT3/313-827---------------------------------VQF..EA....PPSG..QA.......SLMARVGISFMTVE...QACA
S3CIA7_OPHP1/268-767---------------------------------FTF..N.....SSQV.V..........VTSRVGVSFISSD...QACS
I4A0R9_ORNRL/240-740---------------------------------VGF..N.....KTKKGEK.........IICRVASSFISLE...QAEQ
C6Y1K7_PEDHD/386-892---------------------------------AKY..........NVKAGD.......EIKMKVALSYTNIA...NARK
D5QHV3_KOMHA/266-755---------------------------------CHF..G.....RAR.D...........IITRTGISSVDVN...GAKH
R6VRM0_9BACT/240-752---------------------------------LSF..E......MDGDAE.........LGVRIALSTTSVE...AARR
F0R289_BACSH/242-731---------------------------------FEY..P.....TQEGEQ..........ITLATAISGTGME...GALK
A6KY22_BACV8/243-732---------------------------------FNF..D.....TEKGEQ..........IVLSTALSGVSME...GAAK
R6MN00_9BACE/218-702---------------------------------VKF..I.....NSKGKKP.........LELKIGFSFVSIE...NAKM
G0G534_AMYMS/257-729---------------------------------VTF..D......TSSN.T........TVQAKVGISFVSLA...NAQA
R5Q370_9BACT/273-760---------------------------------FNF..D.....NSD.SQP.........LVIKVALSAVGTD...GALK
A3UBV0_CROAH/238-719---------------------------------LKF..H......NPKNEP.........IYVKVGISAVDEQ...GAKL
A0A0C4DWV3_MAGP6/255-752---------------------------------FTF..A.....DS...A..........VSSRVGVSFISES...QACA
N1PUA1_DOTSN/281-786---------------------------------FSF..SD....SAA.AT..........VKSRVGISFISIE...KACQ
C5M3L3_CANTT/286-786---------------------------------FEF..NKD..DLNNNGE..........LISRIGVSFVSTT...QACS
R5W019_9BACE/262-742---------------------------------FTF..D......TEENEQ.........IEVAVGVSFVSME...NARQ
E4V245_ARTGP/290-791---------------------------------FEF..P.....PD.TTT..........LKSRIGISFISTE...KACH
F9D249_PREDD/222-708---------------------------------YTI..Q.....VEDDGKP.........LLVKLGLSAVGTA...NAKE
F2KXB9_PREDF/398-873---------------------------------FTY..K......TKKGEA.........IYMKIAISFKSIE...QARK
D6D0Y6_9BACE/239-739---------------------------------IGF..S.....TKK.GEL.........VHAKVASSFISPE...QAEL
R7JIS0_9PORP/261-742---------------------------------FKY..D......VAEQEQ.........IEVKIGVSFVSIE...NARE
R7EQ20_9BACE/242-723---------------------------------LSF..D.....NSD.GEP.........VIAKVGLSIVSEK...NARE
Q8A5X5_BACTN/531-1033---------------------------------AEF..........DTTDHP.......EVMVRSGISYVDMA...GASN
F2UPM6_SALR5/301-791---------------------------------LQFDNP......D..............IEITSAISFVSLH...QARV
I6SXV1_ENTHA/204-698---------------------------------IYF..G......DVKKQV.........I..RFGTSFISSE...QALF
D5BAF6_ZUNPS/249-732---------------------------------LNY..E.....TTSEEQ..........IVVKTGVSSANIE...GAYA
Q023I7_SOLUE/234-715---------------------------------LTF..D......TSAN.S........TVRVRVGLSFVSFT...NAYT
K5Y2M0_AGABU/280-805---------------------------------FTF..SPA.PSGK..TT..........ILARVGVSFISSE...QACA
A6LGN5_PARD8/299-769---------------------------------TEF..E.....TEA.NEE.........VLFKAGISFVSLE...GAEK
Q1ASW2_RUBXD/614-1155---------------------------------ARF..E......AGSDRS.........VTMRAATSLISVE...QARK
A6L7S3_BACV8/264-743---------------------------------FTY..D......TTAEEV.........IEVSMGVSFVSIE...NARL
R5B6I7_9BACE/267-752---------------------------------WSY..R.....DLKPGEQ.........IEVSLGISYVSIA...NARE
R5INP1_9PORP/204-719---------------------------------MQF..K......TSDRE..........IKVRYGISLISVE...QAKR
S7ZU94_PENO1/254-747---------------------------------FTF..S.....DD...E..........VISRVGISWISSD...QACR
R6KBU8_9BACE/239-730---------------------------------LSF..D.....LKP.GEN.........VQVKVGLSTVSIE...GAQE
Q9PF36_XYLFA/273-763---------------------------------LHF..P.....DAG.EAP.........LLVKVGLSAVSAA...NALA
B8MZQ6_ASPFN/290-775---------------------------------FSW..DD....VEE.SQ..........IRSRVGISFISTE...KARS
R6KIJ4_9BACE/530-1032---------------------------------VEF..........DTQKQS.......VIQVRTGISLVSVA...NASE
D5GHL1_TUBMM/334-842---------------------------------FSF..G.....ASRNITHP......LAVESDIGISFISAE...KACK
W5WHY7_9PSEU/275-764---------------------------------VSF..A......PGS..R.........VSMRLAISYVSLE...GAER
E8UZF7_TERSS/277-787---------------------------------LGF..........GTG.G........DLRLRVAISYVSLA...NARA
Q7S6N7_NEUCR/312-905---------------------------------IQF..EK....PDEE..MK......DSILARVGVSFMSVD...KACE
Q15ZP0_PSEA6/279-760---------------------------------MRF..D......TQANEQ.........VEVKVGISYVSIE...NARQ
Q097W8_STIAD/262-779---------------------------------VTF..D......ATT.DL........DVTVKVGLSYTGLE...GARK
F3ZQV4_9BACE/237-737---------------------------------VSF..N.....TKR.GDQ.........VHVRIASSFISIE...QAEL
E3QRS6_COLGM/300-809---------------------------------LHF..ER....PK....NH.......QILARVGLSFVSVD...KACQ
R5M1V6_9BACE/288-757---------------------------------TEF..P.....TRK.DEQ.........VQLKCGISFVSME...GAQR
D2QHT3_SPILD/256-741---------------------------------VNF..S.....TQA.NEK.........VLLKVGISPVSSA...NALG
Q832K9_ENTFA/202-695---------------------------------LSF..G......NIAQQV.........V..HFSSSFISEK...QAQL
Q0UGQ6_PHANO/180-696---------------------------------IRF..K.......TN..PS......EGVLARIAVSLISSE...QACQ
S5VGA2_STRCU/306-788---------------------------------VTF..D......TRSN.P........VVQAKVGISYVSAA...DAVA
Q5KC19_CRYNJ/398-905---------------------------------VSF..E.....EEA..VT.........VDVKVGVSFISVE...QAGR
Q0CFC9_ASPTN/253-746---------------------------------YTF..N.....ES...V..........VTSRVGISWLSTE...KACQ
M3AXL3_PSEFD/143-645---------------------------------VRF..R.......KP..TN......GVIQARMGVSFLSTD...QACQ
V2XHT4_MONRO/288-803---------------------------------FSY..KG....TP..KT..........ITLRVGVSFLSTE...QACA
G8TN43_NIAKG/285-774---------------------------------TEF..A.....TKE.NEP.........VLMKAGISFTDVA...HAKM
E4ZUP2_LEPMJ/404-904---------------------------------FTF..S.....KP...N..........ITSRVGISFLSTE...KACQ
R4LP30_9ACTN/289-770---------------------------------LTF..K......QGAK...........VVAKTGFSYTSVA...NAAL
G9NFV5_HYPAI/280-778---------------------------------VKF..N.....KSV..QR.........VEVRTGVSYISVA...QARR
G8TN43_NIAKG/1001-1499---------------------------------LQF..P......K..GAV.........VQVKIASSYISPQ...QAAT
Q5LED8_BACFN/267-748---------------------------------FTF..D......TDEGET.........IEVSMGVSFVSIA...NARL
A5FHD9_FLAJ1/280-769---------------------------------FDF..D.....TNE.GEK.........IKIKMALSPVSSA...GALE
G0RIK4_HYPJQ/265-770---------------------------------IRF..A.......SA..QE.......PIYARTGISFISSA...QACS
R7DIY0_9PORP/236-734---------------------------------LQF..D.....VPE.GEK.........LTVRVASSFIGEE...QAWL
F9YRP8_CAPCC/247-730---------------------------------LLF..P.....TASDEK..........IVVKTAISTANIQ...GAYA
R4L6G3_9ACTN/280-936---------------------------------ITF..A......PGT..T........SVTMRVGISYVSLD...GART
M2QZJ7_CERS8/289-803---------------------------------FSY..EG....EP..EE..........VNIRVGISFVSVD...QACS
E3QZM0_COLGM/297-801---------------------------------VRF..K.......SA..DK.......PIIARVATSFISER...RACS
G0FHU2_AMYMS/248-722---------------------------------VTF..A......NLNG.A........QVNVQVGLSFVSVD...GAKA
R6T8N5_9BACE/254-773---------------------------------LNY..........KTSENE.......QIDVKLGLSYTSVE...NAKA
R5GRT6_9BACT/247-729---------------------------------ASF..D.....VTT.DTV.........VGVRMALSSVSLA...GAMA
Q9AAR3_CAUCR/283-754---------------------------------LTF..DT....TA....NR.......QVQMKLAVSFISAD...KARA
W5W2K6_9PSEU/259-740---------------------------------LTF..D......TTAN.Q........VVQAKVGISYVSTG...NAQG
G0SAP0_CHATD/309-829---------------------------------VQF..ER....PE....GD.......ELLVRVGVSFISVD...QACE
Q15ZN9_PSEA6/255-739---------------------------------FDF..D.....FSEVSSQK.......LVTVRTAISSVSIE...NAKQ
R5C0J2_9BACE/253-738---------------------------------LTF..K......NN.PKN.........VQLKVALSSVSCA...NALA
R5I4F3_9PORP/249-751---------------------------------LQF..A......TENDEE.........VLVKVGISAVDIN...GARQ
X5DYI4_9BACT/238-720---------------------------------VSF..N......ESDEE..........LELKLALSFVSIE...NAKQ
R5NK85_9BACT/256-731---------------------------------VEF..P.....AGT..TW.........VDVRIGSSFIDFE...QAAV
R4LXQ2_9ACTN/240-751---------------------------------VSF..D......ATQ.DR........DVVVKVALSYTGLD...GARK
K5WZS2_AGABU/308-802---------------------------------VMY..HGE.ETKKP..FV.........VSVKVGTSFISIE...QARK
G0FQH4_AMYMS/596-1127---------------------------------LRF..D......AGAGKT.........VNMRIATSLISVE...QAKQ
F8PWD0_SERL3/288-803---------------------------------FSY..DG....TP..EQ..........VNIRVGVSFVSTE...QACQ
R5PL83_9BACT/260-779---------------------------------LDY..........KTHDRE.......KVDFKIGLSYTSIE...NARH
C4JL73_UNCRE/259-764---------------------------------VRF..M.......PA..NR......TTISARVGVSLISAD...RACQ
R5FGS5_9BACT/226-714---------------------------------AVY..E.....VSDPSKP.........LVIRVGLSATSTE...GARK
D3Q0N4_STANL/446-976---------------------------------MRF..D......AGDDRT.........VTMRLGTSLLSVE...QARK
E9F417_METRA/351-849---------------------------------ATF..D.....TAH..DR.........IEVRTGVSFISVE...QARK
R6U2T8_9BACE/244-730---------------------------------IDF..H.....TTE.GEQ.........IMVKVALSPVSMD...GAEA
H1Y2M1_9SPHI/268-754---------------------------------LNF..N.....TTD.NEQ.........VLVKVALSPVSME...NARQ
A6KYE4_BACV8/288-756---------------------------------TEF..S.....TRE.GEQ.........ALLKCGISFVSIE...GARK
S8AUX2_PENO1/262-765---------------------------------VTF..E.......RP..DD......GVVTVRVGVSYLSSQ...QACA
R6XA11_9BACT/243-734---------------------------------FTF..NT....NG....HK.......TVKVKVGISYMGYG...KAKE
Q02D57_SOLUE/238-722---------------------------------AEF.........RP.GEL.........VEVRVGTSFLSID...QARA
F9YQE4_CAPCC/264-743---------------------------------FRY..K......FEKPEM.........VELKVGVSYVSIE...NARE
G2WXK7_VERDV/282-782---------------------------------FTF..S.....TN.SST..........VTSKVGISWISSD...KACQ
R6VXX4_9BACT/550-1053---------------------------------AVF..........DPAENP.......VVQVRTGISLVSVE...NAAE
F3ZIF3_9ACTN/648-1175---------------------------------LRF..D......AGRDRT.........VTLRLATSLIGVD...QAKA
R5BAT3_9BACE/237-723---------------------------------ASF..A.....TDS.AEQ.........VLMKVAISPTSIE...GAKA
M3C6Z1_SPHMS/285-790---------------------------------FVW..PR....GGA.CT..........VKSRIGISFISTE...KACF
A5E0Q5_LODEL/281-789---------------------------------FEF..S.......NLSQ..........VQSHIGVSFISKE...QACA
R7DDE0_9PORP/246-730---------------------------------ARF..E......KA.PSN.........VVWKIGISSVSCA...NAME
B8NLD2_ASPFN/278-780---------------------------------ARF..T.......PP.QAN......GTIDVRVGISFISAT...QACS
C5CEA2_KOSOT/248-734---------------------------------VRY..S.....TEE.NEK.........IIIKVAVSYTGIE...GARK
R6WSC1_9PORP/262-743---------------------------------FKY..D......TEEDEV.........IEVKMGVSFVSIE...NARL
W5W8J6_9PSEU/288-763---------------------------------LTF..A......Q..D.R........PVNVRVGLSYVDAD...GARR
D7B4B3_NOCDD/292-794---------------------------------VSF..P......EGS..D.........VGVRVGISYVSAE...NAEA
W5W9Q6_9PSEU/250-766---------------------------------VTF..D......ATT.QR........SVTAKVGLSYTSLD...GARR
E3S2L0_PYRTT/266-770---------------------------------FTW..NG....TKAPST..........LRSRVGISFISAE...KACA
D8PMG3_SCHCM/286-801---------------------------------FSY..SG....DA..QE..........ITIRVGVSFVSTE...QACA
G2Y0H1_BOTF4/251-747---------------------------------FSF..N.....TT...T..........VVSRVGISFMSSA...QACE
B8NJS3_ASPFN/266-776---------------------------------VRF..N.......SL..AD......RTVLARVGLSFISSE...QACS
C8VIR9_EMENI/285-802---------------------------------FSW..NT....HEE.LS..........ISSRVGISFISSE...KAHS
Q01W62_SOLUE/253-752---------------------------------AGF..A.....TRA.GET.........VTVRIGVSLISVE...QARR
D5BJC2_ZUNPS/206-722---------------------------------LSF..S......KSQSN..........LELPYGVSFINEQ...QAKS
A5FIB1_FLAJ1/251-737---------------------------------LFF..D.....PKN.SDQ.........LFVKVALSSVSTA...NAKE
M2PK65_CERS8/288-800---------------------------------LTF..TPN.SNGT..TT..........ILVRVGMSFISAE...QACS
K5W0L8_PHACS/310-823---------------------------------FTF..APKTDNSI..TS..........IFARVGVSFISAD...QACA
G8SIR1_ACTS5/255-721---------------------------------VTF..D......TSSN.A........VVNATVGISFVSVA...NAQN
G8T7Y9_NIAKG/245-747---------------------------------ANF..........KTKQND.......VLLMQSAISLVSIE...NARL
Q73SJ7_MYCPA/258-750---------------------------------VEF..P......AGSV...........LEARTAISYVGIE...GARA
Q7MVS0_PORGI/271-766---------------------------------FSF..N......CDQGEK.........IYVRSAVSFVSEA...NALY
D2QFK0_SPILD/269-757---------------------------------FDF..D.....TEA.GEK.........VKVKMALSPVSQE...NALA
R6X327_9BACT/277-768---------------------------------ARF..K.....TGA.DES.........IFIDVAVSAVGTD...GALN
H8KZE1_FRAAD/293-782---------------------------------LHF..S.....TRR.GET.........ILVKTGISAVDIE...GALR
R6ZMR2_9BACE/259-762---------------------------------LRF..D.....RTQADEQ.........VLVKVGLSSVDAA...GAKA
W8ETM9_9BACT/230-730---------------------------------VGF..K.....THK.GEQ.........VQVRVASSFISPE...QALR
A1S316_SHEAM/276-762---------------------------------ARF..D......NPHQAP.........LLVKVGISAVDKS...NALD
F9XLT5_ZYMTI/326-825---------------------------------ARF..EN....VK....AT......DTIWVRYGLSWLSIE...RACE
L0G543_ECHVK/243-744---------------------------------IGF..K.....TTK.GEI.........VNAKVASSFISYE...QAAL
F4C7L7_SPHS2/244-743---------------------------------IGF..A.....TAK.GEQ.........VHARVASSFISFE...QAAI
N1PGL0_DOTSN/249-756---------------------------------VRF..M.......NA..S........PVLARVGLSYISSE...QACQ
E9DYP6_METAQ/264-768---------------------------------ARF..S......P.G..PD......NTVTARVGLSFKSSE...QACG
K0KAH3_SACES/260-771---------------------------------LTF..........AEGP..........VTAATAISHVDPA...GATK
H1Y718_9SPHI/240-740---------------------------------IGF..K.....THQ.GEQ.........VHLKVASSFISFE...QAEL
F3ZTR3_9BACE/257-743---------------------------------ALF..E.....TEE.NED.........IYLKLAVSPVSIE...NAKL
R5IMK2_9PORP/258-745---------------------------------FDF..D.....TRH.NTT.........VMAKVALSPVSIE...NAIQ
G8TJR4_NIAKG/268-756---------------------------------FNF..N.....TEE.GEK.........IKMKMALSSVSTE...GALL
Q481A4_COLP3/300-787---------------------------------THF..K......DANTEP.........LMVKVGLSAVSRK...NALE
R6ZR28_9BACE/244-723---------------------------------ASF.........GE.KKT.........VLAKVGISIVSEE...NARE
Q0CV76_ASPTN/830-1332---------------------------------VRF..A.....PST..TR.........VEVRVGVSYVSIE...QARA
D5EX99_PRER2/205-696---------------------------------.AF..KQ....AS....ENTIAFTDTLINIKIGISYVSEQ...QAKR
S3CNE2_GLAL2/263-771---------------------------------VRF..T.......SP..TS......NGILARVGVSFISSQ...QACS
D5BAF4_ZUNPS/270-746---------------------------------MTY..D......FATPQE.........VEVKIGVSYVSIE...NARE
B8NXN6_ASPFN/169-672---------------------------------ARF..H.......TL..RD......NTITARVGVSFMSVE...QACS
R6W0P6_9BACT/241-740---------------------------------IGF..K.....TRK.GEV.........VNARVASSFISAE...QAEV
Q8P6S1_XANCP/273-763---------------------------------LHY..P.....DAS.EAP.........LLIKVGISAVSAD...NALA
H1Y8C2_9SPHI/255-740---------------------------------VSF..E.....TLD.GEK.........VYVKVGLSPISTE...NALL
A0A068NT61_9BACT/252-735---------------------------------..N..Y.....RTKAGEP.........ILVKVGISATGMD...GAMK
A4AVR0_MARSH/245-752---------------------------------VGF..K.....TKR.GQQ.........VNVKVASSFISPG...QAQL
G8NVG8_GRAMM/266-756---------------------------------LHY..K.....TSA.QEQ.........ILMKTAVSGVDEA...GAMK
R7DIA9_9PORP/253-762---------------------------------LTF..I.....PEEAKKE.........VLVKVGISSVDCE...GAKK
A1S293_SHEAM/260-740---------------------------------LSF..D......TREQEA.........IEVKLGISFVSME...NARE
A5FI93_FLAJ1/272-748---------------------------------FTY..K......FDKQET.........VEVKIGISYVSIE...NARE
E9F2Y7_METRA/266-770---------------------------------VRF..V.......DG..NK.......PVYARVGLSFMSSE...QACA
V5FJJ3_BYSSN/329-821---------------------------------FTF..N.....SP...Q..........VVSRVGISWISTA...QACQ
E2PV07_STRC2/620-1148---------------------------------FRF..D......AGADRT.........VVLRIATSLISVD...QARK
D3IB54_9BACT/269-751---------------------------------IDF..N......TKQNEE.........VEVLMGVSFVSME...NARL
R7DMG2_9PORP/275-756---------------------------------FTF..D......TQSGEQ.........IEVQIGVSFVSIA...NARE
R6XF07_9BACT/689-1242---------------------------------LTF..K......GKAGKP.........IEIRAASSFTSKK...NACD
M1WGU2_CLAP2/276-809---------------------------------VQF..S.......PP..KS......NRIKARVGLSFISMD...KACR
N1PP62_DOTSN/270-779---------------------------------VRF..H.......PP.HTN......NQILARVGISFIGAD...QACG
R6W673_9BACT/250-751---------------------------------VHF..T.....TAR.GEQ.........VNVRIASSFISRE...QAFQ
G8NSC1_GRAMM/274-786---------------------------------ISF..D......PAQA.K........QVHVRVGISYVSEA...DARE
F9YPS9_CAPCC/306-792---------------------------------FFF..D.....NST.GEE.........LVVRVAVSSVSEE...NALA
R6VFA8_9BACT/233-724---------------------------------VEY..R.....DLKPGER.........IGVQVGISFVGAE...GAGR
I6ZRZ1_MELRP/243-724---------------------------------FHF..R......TNPNEP.........VYVKVGISHTSLE...GAEK
R5PXF8_9BACT/236-732---------------------------------VGF..S.....TKR.GEQ.........VNVRVASSFISPE...QALL
F8JNS7_STREN/261-770---------------------------------VRF..D......TRA.DK........VVTAVTGVSWTGLD...GARR
V2X6S9_MONRO/261-766---------------------------------VGF..PSN.PSKP..SS..........ILARVGVSLISTE...QACW
J3P516_GAGT3/279-792---------------------------------VRF..GA....TN..GT..........VVVRRGVSFVSAA...KACE
E8RS95_ASTEC/253-744---------------------------------LHF..D.....EAG.SAP.........LLVKVGISAVDIE...GALK
R5KVZ5_9FIRM/666-1195---------------------------------ASF..N.........SNT.........VTMKLATSYISYD...QAKK
V5FTD6_BYSSN/272-765---------------------------------VSF..S.......AP..AN......NVIMARAGVSFISVD...KACA
G8NVQ7_GRAMM/268-755---------------------------------VTL..A......NNTPQS.........VIVRIGTSFTSIA...EAER
Q8PBN8_XANCP/275-762---------------------------------FDV..A......NDGT.P.........LVVTVALSPVSED...SAIA
G2WSC5_VERDV/69-567---------------------------------FAF..D.....GT...D..........ITSRVGVSFISTQ...QACE
G0FZ68_AMYMS/246-762---------------------------------ASF..D......ATT.DH........DVVLKVGLSYTGLD...GARK
R6B5C9_9BACT/680-1193---------------------------------LTF..K......GQAEKS.........MELRTASSFTGKE...NAIS
C1F7W7_ACIC5/302-791---------------------------------..F..T.....QADSADA.........LVVRVGISATSME...GAAK
S3CJ02_OPHP1/292-810---------------------------------VRF..T.......SG..AQ.......PITARTATSFISAE...QACA
R5PMH4_9BACT/241-740---------------------------------IKF..R......P..GSK.........VQAKAASSYISYA...QAEL
I3YPK4_ALIFI/227-708---------------------------------LTF..A......PD.VRT.........LTIAVGLSSVSVE...NARM
R5IRF6_9PORP/213-728---------------------------------FHF.........ADAQQ..........INIRYGVSFISEE...QAKN
R6YWL1_9BACE/243-731---------------------------------ATF..Q.....VQP.GEA.........VQMKVALSTTGIE...GAKA
M2TSE6_COCH5/349-888---------------------------------FSW..SPTEARVNGTLT..........LEARLGISYISAA...QACS
C5BV25_BEUC1/280-761---------------------------------VRF..P.....AGT..RR.........VVVRTGVSLISVE...QARA
R7JDH8_9PORP/245-728---------------------------------FDF..K.....TKQNEE..........ILVTTALSGTSME...AAAR
B8MW61_ASPFN/266-768---------------------------------ARF..E.......RP..TN......GSVSVRVGISYISTD...RACE
H8KS39_SOLCM/267-756---------------------------------FDF..K.....TEE.GEK.........IKIKFALSPVSTE...GALH
G8NZ99_GRAMM/267-757---------------------------------LYF..K.....TKA.NEA.........ILVKTGFSGVSPE...GAAK
S7ZPF5_PENO1/272-783---------------------------------IRH..E.......AA..AD......RIVQARVGVSFVSSA...QACS
M3C4G9_SPHMS/319-826---------------------------------VQF..S.....QDH..KT.........VEIRTAVSFVSIE...QARF
R7LDI0_9BACT/243-732---------------------------------VYF..D.....LKP.GEQ.........LGVKIAISSASVE...GAAQ
R7DME3_9PORP/244-727---------------------------------FDF..G.....TKEGEQ..........ILVNTGISGVSME...GAAL
K0KDA2_SACES/301-776---------------------------------VTF..A......D....P........EVTMRVGLSFVSVD...GAKK
R5PNA6_9BACT/253-743---------------------------------ATF..S.....TDA.DEV.........VTVKTSISAISTD...GAAL
H2K489_STRHJ/587-1110---------------------------------LRF..D......AGADHT.........VTLRLATSLISVD...QAKD
F0R5A0_BACSH/248-742---------------------------------LRF..A.....EG....DS.......VVQLKIGISFLSSQ...RAKH
R6YIX3_9BACE/221-737---------------------------------WEL..G......NQAKA..........YTLRYGISFIDEA...QAKK
W0EN75_9PORP/241-738---------------------------------VGF..S.....TQR.GEK.........VHARVASSFISIE...QAEL
R5NWD8_9PORP/223-750---------------------------------LSA..D......RVTE...........VEARVGISFISVE...QARQ
R6WZT0_9BACT/250-735---------------------------------VDF..D.....MAE.GEQ.........LLMKVALSPVSIE...GAEA
F3ZQD9_9BACE/265-746---------------------------------FSF..D......TEENEQ.........VEVQMGVSFVSIE...NARL
A4X9V9_SALTO/601-1141---------------------------------LAF..D......TSTAKV.........VTLRIATSLISLD...QARK
A4AN18_MARSH/255-759---------------------------------LSF..T.....NLEEDEP.........LLIKVSISSVDQE...GAKK
W5W3K0_9PSEU/253-732---------------------------------LTF..D......TTGN.Q........VVQAKVGVSYVSVD...NARG
R6MPC3_9BACE/260-779---------------------------------LNY..........KTSKDQ.......VVDVKIGLSYTSID...NAKL
R5W4N0_9BACE/266-754---------------------------------IGF..H......VENNEQ.........ILVKAASSFTDKE...GAEK
D4IQF8_9BACT/240-741---------------------------------VYF..T.....TRR.GEQ.........VTARVASSFISEE...QALR
R6WWU7_9BACT/271-758---------------------------------FKF..A.....TSR.NPE.........LTVKVALSATGAE...GALK
A8AZ30_STRGC/202-690---------------------------------.DF...........EQGQ.........LQFSLATSFISEE...QALI
G4MXA7_MAGO7/252-764---------------------------------VQF..E.......AP..ED......NQILARVGVSAISAA...QACK
R5AYY0_9BACE/229-719---------------------------------CYF..N.....TAPDEK..........IVLCTGLSGVSEE...GAGK
G8UKZ7_TANFA/286-774---------------------------------FEF..D.....FSD.GRP.........LEVQVAFSPVDCL...GARK
A6LCT9_PARD8/270-758---------------------------------FDF..N.....TKKDEE..........ILVTTGISGVSME...GAGK
I3ZE22_TERRK/242-726---------------------------------VEF.........TP.GAD.........VEMRVGTSFLSID...QARE
C1F5Z0_ACIC5/277-763---------------------------------VSW..P.....QSSDAQT.........VTAKIGISYVDLK...GAEG
F8PL93_SERL3/213-728---------------------------------LTF..PPASNDSSLPTT..........ILARVGVSFISPE...QACA
J4KN82_BEAB2/265-779---------------------------------VQF..E.......PP..QN......NQILVRVGLSFISAD...QACK
G0G6H4_AMYMS/276-770---------------------------------VTF..A......PGS..T.........VTMRIAISYVSLE...GAER
F0R2N2_BACSH/263-745---------------------------------FTF..D......TEEGEQ.........IEVAMGVSFVSIE...NARE
R5N958_9BACT/222-738---------------------------------LSW..S......PALSS..........LNVRYGVSYISVE...QAKK
G8NZ65_GRAMM/265-739---------------------------------FDY..TT....KA....NQ.......AIQAKVGISFISAE...QAKQ
H1Y4F5_9SPHI/240-740---------------------------------VNF..K.....TTA.GEQ.........VGLKVASSFINYE...QAEL
D6D182_9BACE/235-702---------------------------------FTF..D......VSK.KK........NVQYKIGVSYVSVE...NARE
M2LV24_BAUCO/282-788---------------------------------FTW..SN....ASV.ST..........IKSRVGISFISAD...KACA
Q7MVX2_PORGI/246-734---------------------------------LSF..L.....IAKSDST.........LTISTALSGVDEK...GAAN
R6W2H2_9BACT/222-708---------------------------------AVL..E.....LADATRP.........VLVKVGLSAVNEG...NAML
A6LCG5_PARD8/264-780---------------------------------LTF..........RTQDQE.......SVTAKVGLSYTSVE...NARL
Q8P357_XANCP/270-798---------------------------------LSF..P......LGKGKNA......RAVTVVSAISHVDAE...GART
R5PMC5_9BACT/645-1146---------------------------------LTF..R......GKTDVP.........MEFATASSFTNKA...NALN
E5A3T8_LEPMJ/375-905---------------------------------FA...........GSAQ..........VEAKVGISYISAE...RACR
T0K2G4_COLGC/281-786---------------------------------FSF..P.....ST.VST..........LTSKVGVSWISTE...KACQ
R6WV50_9BACT/252-767---------------------------------LRY..........RTSADE.......RIELRIGLSYTSVE...NARA
Q0UBG2_PHANO/7-546---------------------------------FSW..TPSDQIANGSLT..........LEAKVGISYISAA...QACS
F5WRB0_ERYRF/195-684---------------------------------FK...T......DSNHLQ.........I..HASFSHQSLE...QAHR
I3ZYE3_ORNRL/259-745---------------------------------AFF..N.....NEN.K.E.........LLVKVALSSVSTD...NALQ
G8T7Z2_NIAKG/256-773---------------------------------LTF..........TTSEQE.......AITIKAGLLYTSIE...NARL
L0G487_ECHVK/269-758---------------------------------FDF..D.....LED.GEQ.........LIAKMAISPVSTA...GAIK
R5PXP4_9BACT/246-746---------------------------------VGF..K.....TKR.GEQ.........VNVQVASSFISPE...QALL
H1YA33_9SPHI/259-746---------------------------------LGF..K......LQAGQS.........IRVKVGTSFSSIE...GARK
R6W152_9BACT/272-759---------------------------------FNF..D.....NTD.RKP.........ITVKVALSAVSTE...GALK
D1BF94_SANKS/373-883---------------------------------VTF..D.........AAA.........ADVLIGVSTIDAA...QARD
R6YT08_9BACE/236-736---------------------------------IGF..K.....TAK.GEK.........VHARVASSFISLE...QAEL
A6LE00_PARD8/240-738---------------------------------IGF..E.....TKA.GEV.........VHANVASSFISTE...QAEL
E8X2K1_GRATM/259-749---------------------------------MYF..K.....TKA.QET.........ILVKTGISGVSAE...AAGK
Q0CS76_ASPTN/251-770---------------------------------ARF..H.......AP..ED......GVLLARVGVSFMSVD...QACA
F0XC67_GROCL/1251-1766---------------------------------IQF..EA....PSG...PG......RDILARVGVSFLSSD...QACT
G4N8Y8_MAGO7/278-772---------------------------------FTF..N.....DA...Q..........VISRVGVSFMSES...QACD
B8MB98_TALSN/256-758---------------------------------VMF..D.......SL..SS......HTLYARVGVSLVSTE...KACQ
D5BAW8_ZUNPS/242-740---------------------------------IQF..K......D..GQK.........VQAKIASSYVSLD...QAQL
X5DJ68_9BACT/251-738---------------------------------ISF..D......EA.PEK.........VEWKVGISPVSTA...NALA
F4C7M2_SPHS2/216-732---------------------------------VQY..P......KGTTK..........IKLRYGVSFISTE...QAKR
G4ND73_MAGO7/266-773---------------------------------VRF..K.......NA..DK.......PILARTATSFISTD...QACR
L0G0Y1_ECHVK/252-736---------------------------------MEF..A.....TTA.DEK.........VLLKVGISPVSVV...NAMD
I2EXN5_EMTOG/238-766---------------------------------INF..........TTQTGE.......VRKMKVAISYVSEE...QARL
K0KND0_WICCF/267-760---------------------------------FQF..E......KGTH...........VQSKVGISFLSKE...QAKK
R1GPT3_BOTPV/261-768---------------------------------VRF..D.......DP..GD......SPILARVGVSLISEQ...QACS
G2PCH2_STRVO/284-786---------------------------------LQF..A......PGT..R........RVGVKVGISYVGDK...GARA
A6LCF7_PARD8/253-738---------------------------------ITF..K.....GDA.PTA.........L.VKVAISSVSCE...NALA
R5IJ85_9BACT/272-764---------------------------------FGF..D.....PSE.GRE.........LEVKVALSGVSTA...GAVK
X5DJ19_9BACT/236-721---------------------------------VEI..E.....FEG.NGE.........LLVKTAISPVSAD...GAKN
M7UMW1_BOTF1/292-792---------------------------------VRF..Q.......AQ..TN......GTISARVGVSLISSD...KACR
F5HDD2_PORGI/255-752---------------------------------CRF..D.........SQE.........VTVRVASSFISVE...QAER
R6K5T3_9BACE/248-753---------------------------------MSF..R.....NLPADGR.........VLAKVGISSVDEE...GARL
A6LGS3_PARD8/221-704---------------------------------LTF..D.....TTT.GKP.........IICKVGVSIVNEE...NARL
C7PM47_CHIPD/237-735---------------------------------IRF..R......S..GTK.........VQARVASSYISTE...QAEL
E5A4R8_LEPMJ/281-782---------------------------------FQF..P.....SN.SSA..........VMSKVGVSWISAD...KACQ
B2FPN6_STRMK/269-794---------------------------------LSF..D......LAKGQS.........VTAVSAISHVDAE...GARI
B4EPR5_BURCJ/303-860---------------------------------LQFDLT.......DAD.K........TVTVKVGISSVSVS...NAQA
L7WBB4_NONDD/242-736---------------------------------LEF..D......NPNNEP.........ITIKIGISPVDEA...GAKL
E8WYV5_GRATM/244-730---------------------------------VSF..D......LKPGES.........VKVKVGTSFTSLD...EARK
R5NRY2_9PORP/247-732---------------------------------IDF..G......CKTDK..........ILAKISLSSANID...GADA
S8F5G2_FOMPI/257-774---------------------------------FTF..NPN.PDAT..TS..........ILVRAGISFISTE...QACA
J4KLI3_BEAB2/265-769---------------------------------VRF..A.......DS..HI.......PVYARVGVSFMSEE...QACS
G0J3Z4_CYCMS/229-757---------------------------------VSF..........GKSKGK.......PLQMKVALSYTTAE...NAAL
D2QG27_SPILD/252-752---------------------------------VSF..K.....TEK.GEQ.........VNARVASSFISPE...QAER
Q759D8_ASHGO/342-852---------------------------------FEF..A......EDVRV..........LKSHVGISFNKDDGVEVAKW
F0R7B2_BACSH/262-750---------------------------------VQF..A......VTEGET.........LLVKAASSFTDRE...GALR
R6FAY9_9BACE/256-750---------------------------------LRF..E.....GD....AT.......TLQLKVGISFLSCL...RAEA
F3Z5Q3_9ACTN/260-756---------------------------------LTF..D......TSRE.R........RVTAKVGMSYVSQD...GAAR
A6LCF6_PARD8/222-738---------------------------------LSF..G......EDVKK..........LGVRYGISFISEE...QAKK
I3YLR2_ALIFI/247-701---------------------------------...........................VLLKIAVSLRSES...NARK
K2QZK9_MACPH/55-546---------------------------------FTF..N.....ET...A..........VSSRVGVSFISSE...KACG
F0SF03_PSESL/226-741---------------------------------LTF..G......K.ESN..........IRLKYGISFIDEN...QAKA
F9XHL5_ZYMTI/256-758---------------------------------IRF..Q.......DP..TN......GTVQVRMGVSFMSTE...QACS
N1PC12_DOTSN/324-861---------------------------------FSW..TRSGSNSSEESV..........IESRIGISYISAA...QACS
D2Q3X9_KRIFD/623-1153---------------------------------FSF..G......PQTQQ..........VQLRIATSLIGTA...QAKK
I2FQ04_USTH4/298-813---------------------------------LTF..DQDKLSSPPYNGN.........LPVRMAISWVSTE...AACK
R6XA16_9BACT/218-718---------------------------------VGF..K.....TVK.GQK.........VNLKVASSFISQE...QAEL
C7PPX9_CHIPD/276-765---------------------------------FDF..K.....VQA.GEK.........IKIKFALSPVSTE...GALA
R5MRY8_9BACE/246-740---------------------------------LRF..N.....SS....EE.......VVQLKVGISFLSSL...KARQ
R6SN01_9BACE/243-745---------------------------------VEF..........DVKKDE.......SVLVQVSLSLVDQQ...GCKN
F4C6P9_SPHS2/295-781---------------------------------LGF..F......LKKGES.........ICFKIGTSFTDIA...GAEQ
D2QCX6_SPILD/245-773---------------------------------LSF..........KTKAGE.......VRKMKVAISYVSEE...QARI
T0M9R2_COLGC/274-789---------------------------------VRF..KPS.SDQK..GS..........IIVRRGVSYTSTD...VACK
A0A0C4DST4_MAGP6/262-774---------------------------------VQF..Q.......AP..AN......DQILVRVGVSFISVA...QACS
R5I8Z8_9PORP/234-723---------------------------------IRF..A.....DEK...E.........VQVKVAFSMVSVE...GAKK
R7LIY3_9BACT/52-535---------------------------------FSF..D......THEGEQ.........VVVRMGVSFVSIE...NARE
B2HSF1_MYCMM/261-753---------------------------------VEF..P......SGAA...........LEVQTAISYVGID...GARA
R6F0G4_9BACT/265-751---------------------------------MSY..D......CAEGEQ.........VEVQVGVSFVSID...NARE
R6EVC1_9BACT/239-739---------------------------------VGF..K.....TKR.GEQ.........LNVRIASSFISEE...QAVE
R5M3G3_9BACE/219-734---------------------------------MHF..A......DGTKT..........VNLRYGISFISEE...QAKK
R6TIT6_9BACE/237-737---------------------------------VGF..R.....TAK.GEQ.........VHVRVASSFISPE...QAEL
B4EIV1_BURCJ/298-797---------------------------------LTF..N......VDSKHP........DVMMKLGISFVSEA...NAKA
Q5L991_BACFN/274-761---------------------------------FNF..D.....TRQ.NPE.........LVIKVALSAVSTE...GAVK
Q099T5_STIAD/279-767---------------------------------FDF..G......ELKNQE.........LLVKVAISPVSEE...NALR
E5R5G1_LEPMJ/254-756---------------------------------LRF..Q.......GP..LS......GPLLARMGLSFTNTE...QACG
Q59VA0_CANAL/271-776---------------------------------FQF..NK...QDLKNNE..........LISRVGISFISTD...KACA
W8EZC7_9BACT/264-748---------------------------------LTF..A.....TRA.GER.........VQLKVGISPVSTM...GALA
C7M5Q1_CAPOD/260-760---------------------------------IGF..R.....TKK.GEQ.........VTVRVASSFISPE...QALL
C6WEC8_ACTMD/279-779---------------------------------LGF..E......PGS..T.........VGVRVGISYVSQD...GAVR
B0T313_CAUSK/268-755---------------------------------FDF..G......TIDG.P.........LVAKVAISSVSEE...NAVL
R6TFX8_9BACE/278-765---------------------------------FEF..D.....TSD.GNE.........LEIKVGLSGVSTE...GALR
C6WHL9_ACTMD/612-1137---------------------------------LRF..D......TSAEKT.........VTLRIATSLLGVE...QARK
R6VUD4_9BACT/265-751---------------------------------FSY..D......AEEGEQ.........VEVQIGVSFVSIA...NARE
U5W074_9ACTN/234-751---------------------------------VTF..D......TTG.DR........DVVAKVALSYTGAD...GARR
C7M4B4_CAPOD/265-742---------------------------------FRY..K......FDKDEV.........VELKVGISYVNIA...NARE
G2WSL9_VERDV/229-751---------------------------------LLF..DE....TG....PD.......GIFARVGVSFVSSA...QACH
G2ND96_STREK/290-797---------------------------------VGF..D......TSSD.E........DVRMRIGISYVSQA...GAEA
F4CF68_SPHS2/236-734---------------------------------LVF..K......S..GAT.........VQVKVASSYISQE...QAEL
C1GGA7_PARBD/273-775---------------------------------VQF..R.......TP..KD......RKILVRVGTSFINTD...RACS
G2QSP3_THITE/223-732---------------------------------LQF..AP....PA....NN.......SLLARVGVSFVSVD...RACE
B5RUQ1_DEBHA/245-737---------------------------------FTF..P......SNQAI..........IRSRVGISFISTD...QACS
D4Z5J6_SPHJU/285-770---------------------------------LDF..G......RLHG.P.........LEVQVALSGVDES...GAIA
I3YHM3_ALIFI/278-761---------------------------------FGF..R.....TEE.NER.........ITVKVGLSAVSAE...NARR
G0RVA4_HYPJQ/270-784---------------------------------VQF..N.......KP..SN......NQILARVGLSFISTN...QACS
G3JDG1_CORMM/243-753---------------------------------VRF..A.....PQDG..AS......RTVTARVGLSFKSSE...QACH
S8ENP9_FOMPI/263-760---------------------------------YTF..A.....DQ...D..........VLSHVGVSWISSE...KACQ
F9XJZ4_ZYMTI/261-768---------------------------------VRF..T.......SG..S........SITARVGLSFISSE...QACQ
G9MLE1_HYPVG/269-783---------------------------------AQF..H.......PP..AN......NQILARVGLSFISTD...QACH
G8NTY4_GRAMM/260-746---------------------------------VTF..S......HWEGKS.........LLVKVGTSFTSIE...EAEK
M3K288_CANMX/256-756---------------------------------FEF..DQ...NDLNNGE..........LLSRVGISFISTD...QACS
K2R029_MACPH/272-784---------------------------------VRF..E.......AP.ASN......NQITARVGMSFIGVE...KACQ
F2ICV0_FLUTR/268-759---------------------------------FDF..D.....LDS.SKE.........LLLKVSLSSVSME...GAVE
F3ZHF5_9ACTN/295-773---------------------------------LTF..A......RGAK...........VTSHTGLSYVDVD...GAAA
D5BFU1_ZUNPS/300-789---------------------------------FNF..D.....LEP.QEK.........LKVKMAISPVSSE...GALN
R7DGR9_9PORP/234-734---------------------------------IGF..K.....TRR.GQT.........VQAKVSSSFISFD...QAWL
A5FF75_FLAJ1/239-766---------------------------------IHF..........DKTKEQ.......VL.MKVGISYTSIE...NANN
G2Z075_FLABF/225-715---------------------------------LDF..D.....LAK.NKL.........LNIKIALSTVSVE...GAKL
E8X698_GRATM/269-765---------------------------------FDF..G......EMKG.P.........LVVKVALSPTSED...EAMA
V2WSZ4_MONRO/282-799---------------------------------ISY..KG....TP..QN..........ITWRVGVSFVSAE...RACA
K1X3Q1_MARBU/245-749---------------------------------SKF..Q.......PP..GS......DYVMARVGLSFISQA...QACQ
M2TXV2_COCH5/277-776---------------------------------FTW..K.....GN.QTT..........VRSKIGISFISEE...KACR
R5PTZ2_9BACT/224-709---------------------------------AIF..S......VEKGEP.........LLVKVALSPVDID...KAKQ
R6DAV4_9BACE/249-751---------------------------------LKF..K......SPKVEE.........VLVKVGLSVTDEE...GAKN
M2NEA8_BAUCO/263-772---------------------------------TRF..Q.......APNNTS......NEMLARVGVSFISVE...KACS
A0A0C4DMF0_MAGP6/256-752---------------------------------FTF..D.....AA...A..........VSSRVGVSFISED...KACQ
K8E6J4_CARML/214-711---------------------------------IRF..L......DATEKT.........VIANFSTSYISIE...QAEL
F9XNM6_ZYMTI/270-780---------------------------------VRF..N.......AP.KAS......NQILARVGLSLISVE...QACR
R5KV09_9BACT/241-727---------------------------------LDF..D.....PKG.GNE.........LTVKVALSTTSIE...NARL
I0KEB5_9BACT/243-742---------------------------------VGF..R.....TQK.GEQ.........VHVRVASSFISAE...QADR
R7J4K5_9PORP/111-614---------------------------------LQF..........DVKQNP.......TVQVRSGISLVSLE...NASL
R6CRV2_9BACE/268-755---------------------------------LNF..N.....TAK.DSE.........LTVKVALSPVSMD...GALK
T0JX50_COLGC/252-747---------------------------------FTF..E.....DT...A..........VKSRVGVSFISTS...QACS
M7TSY3_BOTF1/251-757---------------------------------YTF..N.....TT...V..........VASRVGISWISKE...KACQ
I3YNM9_ALIFI/265-751---------------------------------FSY..D......TTEGEQ.........LEVRMGVSFVSVE...NARL
F4C7I4_SPHS2/295-771---------------------------------TTF..A.....TED.QEQ.........VFMKAGISFVDEA...GAEQ
A1S298_SHEAM/257-758---------------------------------IGF..K.....TQR.GEQ.........VHAKVASSFISPE...QAEI
U5Q3W7_9BACT/229-716---------------------------------LTF..S......PDKSGK.........IFVKTAISSVSEE...NARL
E4RWA0_LEAB4/233-733---------------------------------IGF..S.....TKK.GEK.........VHAKVASSFISLE...QAEL
C7PN00_CHIPD/257-749---------------------------------LEF..........ATTDQE.......VVELKIGLSYTSTL...HAQK
B6HMT5_PENCW/260-763---------------------------------MIF..D.......RP..YN......GIVTVRVGVSFVSSD...QACK
I3YNN1_ALIFI/246-730---------------------------------VEF..D.....TTD.GEP.........LYMKVAISPVSIE...NAKL
C7PBJ2_CHIPD/233-716---------------------------------VHL..A......DGNKGP.........VEMKIGLSFVSTE...NAKQ
U1HIK3_ENDPU/223-713---------------------------------FSF..D.....QA...S..........ITCRVGISFISSD...QACD
D8PPV4_SCHCM/274-762---------------------------------ARF..APEDSDNGS..LT.........VNVRVGVSFISTE...QACK
K5VRS2_PHACS/288-802---------------------------------VSF..QG....TP..ET..........ITIRVGVSFVSAD...QACA
C7MEN4_BRAFD/401-930---------------------------------LTF.........APGTQQ.........VTVRLVSSYIGHA...QTRR
E9E5Q1_METAQ/271-791---------------------------------VQF..H.......PP..QS......NQIQARVGLSFISTE...RACN
R6VYQ1_9BACT/267-757---------------------------------VRF..A.....TRE.EEQ.........VTVRVAISSVDPD...GARG
V6JHL2_STRRC/315-798---------------------------------LTF..D......TSSH.T........TVRAKVGISYTSDA...NAAG
R6F0X9_9BACE/243-743---------------------------------VGF..K.....TVR.GQV.........VNLRVASSFISID...QAHL
R7DJ79_9PORP/248-732---------------------------------VRF..A......DD.VED.........VQVKVGISPVSIE...NAAQ
N1JJ74_BLUG1/241-757---------------------------------VRF..........AP..GT......TTVLARVGVSFISSE...RACT
R5CB12_9BACE/293-780---------------------------------FNF..D.....TDR.QSE.........LVVKVALSATSTA...GALK
D6D181_9BACE/239-737---------------------------------IKF..K......K..GAK.........VQAKAASSYISAE...QAVI
H8KNH9_SOLCM/233-718---------------------------------LIF..K.....TQD.NEQ.........VLMKVAISSANIE...GAVK
F4KQF8_HALH1/236-733---------------------------------VHF..K.....SGV..RT.........VNVKLASSFISHE...QAEL
R5IB22_9PORP/238-729---------------------------------FYF..K.....LKK.GQP.........LLAKVAFSTVSID...NAKE
R6YV68_9BACE/255-749---------------------------------LSF..E.....NECGE...........LTVKTALSSVSME...GAAA
Q6CNV6_KLULA/310-818---------------------------------FEF..D......EDTTV..........LKSHVGISFNKNEGVKVAAQ
U5W551_9ACTN/255-723---------------------------------VTF..D......TTSN.A........VVNATVGISFVSVA...NAQN
Q7S947_NEUCR/263-767---------------------------------VRF..K.......SG..AK.......PILARTATSFTSVE...QACR
B6QAQ2_PENMQ/267-763---------------------------------IRF..K..........AGT......TSVVARVGVSFISVD...QACS
C7PXX1_CATAD/362-846---------------------------------LTF..D......TSSD.Q........VVQAKVGISFTSGP...NAQA
F4CCU7_SPHS2/241-741---------------------------------IHF..K.....TSKAGEQ.........INIKVASSFISHE...QATL
C6X1W4_FLAB3/266-755---------------------------------FDF..A.....TEQ.DEQ.........ILIKFALSNTSTN...GALK
G0FQH3_AMYMS/372-894---------------------------------FEF..D.........GPD.........VTLRIATSLISLA...QAKR
A1S315_SHEAM/327-827---------------------------------LEL..D......TSVQ.Q........KVTMRVGISYVSEA...NARQ
E6SVM9_BACT6/267-748---------------------------------LTF..N......TEEGEQ.........IEVQMGVSFVSME...NARL
R6FB01_9BACE/264-752---------------------------------VEF..D......VNEGEN.........LLVKAASSFVSAE...GAMN
R6WZ31_9PORP/239-739---------------------------------VGF..S.....TRK.GEI.........VHARVASSFISPE...QAEL
Q826D8_STRAW/248-758---------------------------------ARF..D......ATE.DR........TVEATTALSYVDAR...GAEV
R6X226_9PORP/240-731---------------------------------LEF..D.....TKP.GEA.........VQVKIAMSSVSID...GALA
R6LH54_9BACE/272-772---------------------------------IGF..A.....TRK.GEK.........VCARIASSFISPE...QAEQ
R4LBG1_9ACTN/595-1120---------------------------------ATF..D......LTAGPT.........VTLRLATSFISTA...QAQR
G9NN10_HYPAI/258-762---------------------------------VRL..D.......PP..SD......GTATVRMGISYISSQ...QACQ
F4CBM6_SPHS2/270-759---------------------------------FDF..S.....TEE.GEK.........VKIKFAISPVSMQ...NALA
H1Y1A2_9SPHI/239-746---------------------------------IQF..D......SPGE...........VISKVGISSVSTE...GALK
Q9CFH5_LACLA/204-698---------------------------------LDF..K......AAKQVQ.........I..HFATSFISKE...QAAL
C5BZR8_BEUC1/383-897---------------------------------ASF..S.........APV.........VELRLATSFLGAE...QAAA
E8RV90_ASTEC/245-718---------------------------------LTFKGDP...SKP..............VLVKLAVSFTSAE...TAEA
I3ZBQ9_TERRK/288-775---------------------------------FDF..A......SSRA.P.........LLVKVALSSVSED...SAIA
W5WNG1_9PSEU/607-1138---------------------------------VGF..D......TSASKT.........VTMRIATSLLSTE...QAKR
R5JGM2_9BACE/244-744---------------------------------LGF..R.....TSK.GEK.........IGVKVSSSFISEE...QAWL
M3A2E6_PSEFD/230-729---------------------------------VKF..A.....KGT..RY.........VEVRTGVSFVSIE...QARA
G8BG81_CANPC/256-743---------------------------------FNF..G.......QDQE..........VVSRIGISHISEK...QACS
I6NCS8_ERECY/337-847---------------------------------FEF..D......ESVKV..........LKSHVGVSFNKDSGIEDAKR
W0F3Z3_9SPHI/269-758---------------------------------FDF..K.....TSE.NEK.........LLIKFALSPVSTA...NAIE
R5UGR2_9BACE/236-713---------------------------------LDF..D.....LKK.GEE.........LLVKVALSSVSIE...GAKR
R5JG70_9BACE/239-739---------------------------------IGF..A.....TKN.GET.........VKVRVASSFISFD...QAEL
H1Y4F6_9SPHI/259-745---------------------------------LNF..S.....TTD.KEQ.........VLVKVALSAVSID...NAKM
I0KBV7_9BACT/258-770---------------------------------LDY..........ATNANE.......AIELKVGLSYTSIA...NAKA
C7PM40_CHIPD/274-748---------------------------------TEF..A.....TTA.NEK.........VLMKAGISFVSID...GAKA
R7DDY6_9PORP/216-732---------------------------------LYF..G......DKAQV..........QKIRYGISFISEE...QAKS
K9FZU0_PEND2/320-823---------------------------------VKF..A.....DST..SR.........VEVRTGVSYISIA...QARK
G8UK11_TANFA/263-747---------------------------------AFF..E.....TED.NET.........VYVKVALSPVSAE...NAKM
H8KM31_SOLCM/246-738---------------------------------FRF..S......TRENEI.........IYAKVAISSVSIE...GARK
D5BC60_ZUNPS/250-762---------------------------------LKF..........NTEDKE.......EIVIKTGFSYTSIE...NARL
R4SVW2_AMYOR/376-888---------------------------------LEF..A.........AGE.........VTMRIATSLISLA...QAKR
R7DDV2_9PORP/212-727---------------------------------FCF..D......GQ.TQ..........INARYGISFISIE...QAKK
Y584_MYCTU/259-751---------------------------------VGF..P......AGSV...........LEVRTALSYVSVD...GARA
R6WV75_9BACT/212-714---------------------------------ALF..........TTTEGE.......RITVCTGLSLVSID...QARL
B2WBV9_PYRTR/254-739---------------------------------FTF..S.....ES...K..........VMSRVGISFISPS...KACA
D3I9D1_9BACT/237-737---------------------------------VSF..E.....TQR.GEK.........IEARVASSFISVE...QAEI
D5ES75_PRER2/226-712---------------------------------MVL..T.....FEDISKP.........VMVKCAISAVSVE...DAKA
R5RRS9_9BACE/236-755---------------------------------FSY..D.....NVAENEQ.........ICVQMGVSFVSCE...NARM
R6MN58_9BACE/248-751---------------------------------LSF..K......TKKDEQ.........VMVKMGISAVDTE...GAKK
D7C6N5_STRBB/606-1133---------------------------------FRF..K......PGADRT.........VTLRIATSLISLD...QAKT
U7PQB8_SPOS1/253-757---------------------------------FSF..N.....STSTNT..........VTSRVGVSFMSTA...QACS
R7JIM0_9PORP/271-758---------------------------------FEF..D.....PKA.SQE.........LEVKVALSGVSTA...GALK
M7TB74_EUTLA/294-802---------------------------------MRF..AD...IPE.E..QD......NTITARVGISFISAE...QACN
G0G342_AMYMS/285-763---------------------------------LTF..D......P..A.K........PVQVRVGLSYVDAA...GARL
R5JRR1_9BACE/254-758---------------------------------VTY..........KTAENE.......EILIQTGLSLVSIE...GARQ
A6LFI6_PARD8/246-748---------------------------------FHY..K.....FSEKAQP.........LYVKVALSVVDPE...GAEK
A5DND2_PICGU/248-740---------------------------------FTF..P......EGTTS..........ISSRVGISFISTD...QACR
F3ZHW0_9ACTN/256-766---------------------------------VRF..D......TRK.DR........TVEATTALSYVDAA...GAAR
V2XIK0_MONRO/301-813---------------------------------FGW..NLA.PSGQ..TK..........ILVRVGVSFINAD...KACA
K5WLA8_AGABU/297-800---------------------------------VLF..ARP..KNQP..IS.........FTARVGTSFISID...QARM
V2WYF3_MONRO/235-747---------------------------------LSF..S.....AS...T..........VTTRFGLSFINLD...RACS
Q5LHE9_BACFN/242-731---------------------------------FDF..D.....TQKGEQ..........ILVNTALSGVSME...GAAQ
F2KXB7_PREDF/254-736---------------------------------VSF..G......NRKD.R........PVKMKMAISYVSID...NARQ

PF05860

Q9K0S7_NEIMB/78-201--------------------------------------------------------------------------------
Q9CPI1_PASMU/122-258--------------------------------------------------------------------------------
P73032_SYNY3/38-157--------------------------------------------------------------------------------
HXUA1_HAEIN/23-136--------------------------------------------------------------------------------
Q8XYI3_RALSO/66-200--------------------------------------------------------------------------------
Q8YM34_NOSS1/26-139--------------------------------------------------------------------------------
Q8YM26_NOSS1/34-153--------------------------------------------------------------------------------
Q8XSD6_RALSO/71-208--------------------------------------------------------------------------------
Q8YX21_NOSS1/35-151--------------------------------------------------------------------------------
Q9K0T0_NEIMB/84-219--------------------------------------------------------------------------------
Q8YKQ8_NOSS1/28-144--------------------------------------------------------------------------------
Q9AAJ5_CAUCR/22-135--------------------------------------------------------------------------------
Q8YZU0_NOSS1/29-144--------------------------------------------------------------------------------
Q9PEY9_XYLFA/72-207--------------------------------------------------------------------------------
Q9I791_PSEAE/29-168--------------------------------------------------------------------------------
Q8YV10_NOSS1/28-152--------------------------------------------------------------------------------
Q8P9Q5_XANCP/41-176--------------------------------------------------------------------------------
Q8XPV0_RALSO/28-144--------------------------------------------------------------------------------
Q8YM30_NOSS1/29-148--------------------------------------------------------------------------------
Q9HVN6_PSEAE/51-166--------------------------------------------------------------------------------
Q9I5N6_PSEAE/132-249--------------------------------------------------------------------------------
Q8YVR8_NOSS1/44-162--------------------------------------------------------------------------------
Q8YM29_NOSS1/26-145--------------------------------------------------------------------------------
Q9HVG6_PSEAE/40-153--------------------------------------------------------------------------------
Q8YM35_NOSS1/26-137--------------------------------------------------------------------------------
FHAB_BORPE/71-205--------------------------------------------------------------------------------
Q8YNX6_NOSS1/33-149--------------------------------------------------------------------------------
Q8YXM8_NOSS1/29-153--------------------------------------------------------------------------------
Q8YLL8_NOSS1/28-146--------------------------------------------------------------------------------
Q8XQZ5_RALSO/71-206--------------------------------------------------------------------------------
Q9HWU6_PSEAE/51-167--------------------------------------------------------------------------------
Q8XQ42_RALSO/54-167--------------------------------------------------------------------------------
Q8XPU1_RALSO/114-253--------------------------------------------------------------------------------
Q8YM31_NOSS1/26-139--------------------------------------------------------------------------------
Q8YKI4_NOSS1/31-147--------------------------------------------------------------------------------
B4F0Z9_PROMH/33-166--------------------------------------------------------------------------------
C5BBG7_EDWI9/32-166--------------------------------------------------------------------------------
G1UB82_HAEDU/106-235--------------------------------------------------------------------------------
Q7DDD8_NEIMB/84-217--------------------------------------------------------------------------------
Q7VLE8_HAEDU/114-240--------------------------------------------------------------------------------
Q7VLT6_HAEDU/25-160--------------------------------------------------------------------------------
Q8RI19_FUSNN/27-164--------------------------------------------------------------------------------
Q9CPH9_PASMU/119-250--------------------------------------------------------------------------------

PF13332

D1APU8_SEBTE/1787-1948-----------------------------------------------LSFS..QSS..YESN..TNST.TS...VAGNIN
D1AGZ0_SEBTE/1910-2071-----------------------------------------------ASYS..QSS..YESN..TSGT.NS...VAGNIN
D1AS25_SEBTE/1798-1959-----------------------------------------------ASYN..QSS..YESN..KNGT.NS...VAGVIN
D1AG88_SEBTE/1784-1945-----------------------------------------------VSAN..KSK..YESN..TSGT.NS...VAGNIN
C7LTZ8_DESBD/1999-2170-----------------------------------------------AGAS..VSQ..SSSS..MDAA.DA...VSSSIR
A6X424_OCHA4/234-403-----------------------------------------------IGFQ..YQK..NSAE..GSSS.TP...VPTTIR
D2U945_XANAP/448-623-----------------------------------------------VGGS..RSH..SEST..QHSD.TS...KGSTLH
B0UW75_HISS2/318-493-----------------------------------------------ITYG..EQKNVQTTD..IQGN.RA...ANSAIN
Q0K4M6_CUPNH/2024-2201-----------------------------------------------LSFG..TSQ..SKRTLTEDSI.SH...NGANVS
Q6D5C2_PECAS/4139-4306-----------------------------------------------VGGG..SSK..SKQQ..QDAM.TR...EGSTLS
C5BAK2_EDWI9/2863-3032-----------------------------------------------VTLG..SSA..QDSR..YHST.RT...QGTTIN
Q9P9U6_XYLFA/2525-2700-----------------------------------------------VGRS..THD..STTT..TTTS.TA...AGSNVT
Q9K0T0_NEIMB/1853-2027-----------------------------------------------ITYGEQKSR..NEQK..RHYT.EA...AASQII
Q1LCC6_RALME/2237-2414-----------------------------------------------LSFG..TSQ..SKQTLTQDST.TH...TGSNIQ
A9BSR3_DELAS/1302-1471-----------------------------------------------LGKS..SSR..STSE..YQVN.SA...VGSLVK
Q8XYI3_RALSO/2318-2490-----------------------------------------------WGST..SSK..NTFT..ENST.QH...NGSNIK
A4G2E3_HERAR/1450-1621-----------------------------------------------IGAS..SSE..SKTT..QTGN.HA...IGSTVV
A6VN27_ACTSZ/1852-2027-----------------------------------------------LTYG..QQKNVDSTH..TQGS.TA...TVSKIN
D0IXU6_COMT2/433-603-----------------------------------------------LGSS..KSQ..SNTA..QTSD.SA...RGSTVK
Q7N911_PHOLL/3665-3839-----------------------------------------------YGRQ..SSR..SEQK..QHQT.TQ...QGSSLM
Q1H434_METFK/1347-1522-----------------------------------------------IGTS..KSS..STST..QTSS.TA...QGSTVM
Q7NU32_CHRVO/3082-3255-----------------------------------------------VGGS..HSE..STTV..SDSH.TE...SGSLLK
B2JXD4_BURP8/2246-2424-----------------------------------------------LSWG..TSQ..SKNTFTEDQT.TQ...TRSSVK
D2RM28_ACIFV/822-989-----------------------------------------------LGMGTQHSS..HAVE..INGT.RA...SGSQVQ
C9LS29_SELS3/1059-1224-----------------------------------------------LGTS..KSY..SRTE..SVTK.EY...AGSKIA
Q143Z8_BURXL/2299-2473-----------------------------------------------LSYG..SSH..SENTYSEAST.TN...RGSNVT
Q140X1_BURXL/260-438-----------------------------------------------LSYG..TSR..TKNTFTEDQT.TQ...TGSTVK
A8ETC6_ARCB4/2319-2486-----------------------------------------------LDVN..GEK..SKQN..INNQ.TS...NASNLN
Q140X4_BURXL/2614-2790-----------------------------------------------YGTS..QSK..NTFT..EDQT.MQ...TGSTIK
B2JV25_BURP8/2057-2238-----------------------------------------------VGSS..HSS..SHSS..TSIT.SA...KGSSII
D1BMQ3_VEIPT/1399-1572-----------------------------------------------IGSS..KFK..QLSE..LKQE.NY...IGSSIG
C5AEA6_BURGB/711-883-----------------------------------------------FGSS..HSA..SQSS..EDQS.TQ...RGSKAQ
C5D1Z2_VARPS/2965-3139-----------------------------------------------ASRN..TSQ..GTSF..STST.TA...VGSSVV
Q6FDM3_ACIAD/2917-3080-----------------------------------------------IGAN..GER..IETT.NTTNT.TQGKWQGSTLE
D1BNY3_VEIPT/1277-1447-----------------------------------------------IGST..SQK..QGQT..VDTA.TY...KGGTII
Q0BRJ1_GRABC/3343-3512-----------------------------------------------VGGS..GSK..ANDR..YFSS.TA...QGSVAV
A8GKD6_SERP5/931-1096-----------------------------------------------ISAN..GGS..SEKR..SRSS.QA...VVSTIT
A0RNY6_CAMFF/1383-1550-----------------------------------------------IGFK..FNQ..SQSS..SSN...E...NITQIT
Q2KX68_BORA1/1752-1925-----------------------------------------------LSAG..MEI..GNSK..SHYRRTA...ENTNV.
E6VYY1_DESAO/1086-1253-----------------------------------------------VSYS..RDA..NDSS..SASS.NA...VVSTIK
D3VFR2_XENNA/1025-1191-----------------------------------------------GKGN..GSY..QETS..DSNT.HA...VTSDIN
D3UYN1_XENBS/1023-1189-----------------------------------------------GKGD..GSY..QATS..NSSA.NA...VTSGVQ
Q7VVJ2_BORPE/2180-2357-----------------------------------------------LSAS..LR...TEWW..NESR.NA...TSENLT
Q7NWR2_CHRVO/941-1107-----------------------------------------------ISAT..GGS..AQSH..SQSS.AA...VTTSIA
D3UFL2_HELM1/1506-1673-----------------------------------------------FSYQ..YSD..DFTK..TQSY.AT...STSNLA
D3UFL2_HELM1/1687-1845-----------------------------------------------LSGG..YGD..SSSK..ENKV.TQ...VASSLS
A3N0W9_ACTP2/1886-2054-----------------------------------------------...Q..KQI..QTQQ..SEGS.KG...VSSRVN
B4F0Z9_PROMH/927-1093-----------------------------------------------VGIK..GGG..SQKS..QTDS.QA...VSTSIN
C5AJP7_BURGB/2314-2492-----------------------------------------------IGSN..HSS..SNAT..TSIS.DA...KGSSII
D2U951_XANAP/1315-1477-----------------------------------------------IGAS..SAS..SKST..THEE.ST...VGSRIQ
CDIA_DICD3/2492-2661-----------------------------------------------LGAQ..RSS..SSQT..SEQS.QS...FASTLN
M9X2Y4_MANHA/1910-2075-----------------------------------------------LGTQ..KQQ..RESR..SQSV.TH...SKSTLN
FHAB_BORPE/2928-3086-----------------------------------------------...........DSSH..SRST.SQ...NTQY..
Q0WAT6_YERPE/1232-1406-----------------------------------------------AGAE..ANV..KNTD..ETSL.TH...QGGIIN
Q0WAT6_YERPE/638-798-----------------------------------------------..IT..GSS..KKAN..NSEE.KS...TGSEVV
Q0WE34_YERPE/1754-1929-----------------------------------------------LGSQ..KSS..SEQH..QEQT.HV...TGSTLT
Q7DDD8_NEIMB/1460-1630-----------------------------------------------.GEQ..KNT..SESR..IKGT.QV...QEGKIT
Q7VV06_BORPE/2141-2297-----------------------------------------------...........GYAD..SHRN.TQ...TENTNY
Q8RGK3_FUSNN/9-171-----------------------------------------------ISYN..KSE..SKSS..VHNE.TV...EKSSLV
Q8XQZ5_RALSO/2322-2494-----------------------------------------------VGGS..KSQ..SKTT..QDAT.QA...AGSQVA
Q9CPH9_PASMU/1932-2088-----------------------------------------------............THE..TKRT.TE...TGDIVT
W8UEG9_YEREN/1054-1220-----------------------------------------------.GFD..TTT..TSSS..STTK.SE...NITNIN

PF05594

Q8P9Q5_XANCP/1557-1633---------------------------------------------------------------------QS---------
Q9JPJ4_NEIME/637-700---------------------------------------------------------------------AE---------
Q9I120_PSEAE/2589-2647---------------------------------------------------------------------VS---------
A0A027YSC5_ECOLX/815-886---------------------------------------------------------------------VI---------
Q9I791_PSEAE/595-645---------------------------------------------------------------------VT---------
Q8P9Q5_XANCP/1172-1235---------------------------------------------------------------------TI---------
Q9I120_PSEAE/1336-1393---------------------------------------------------------------------TT---------
G1UB82_HAEDU/627-686---------------------------------------------------------------------LA---------
Q8P9Q5_XANCP/1040-1116---------------------------------------------------------------------QA---------
Q8KT64_PHOLU/1243-1335---------------------------------------------------------------------IS---------
Q9I120_PSEAE/1841-1914---------------------------------------------------------------------RL---------
Q9I120_PSEAE/215-293---------------------------------------------------------------------IV---------
A0A027YSC5_ECOLX/919-990---------------------------------------------------------------------AL---------
Q47955_HAEDC/208-282---------------------------------------------------------------------II---------
Q9I120_PSEAE/2670-2751---------------------------------------------------------------------VL---------
FHAB_BORPE/1684-1755---------------------------------------------------------------------VA---------
O32608_EDWTA/679-758---------------------------------------------------------------------QA---------
Q9JY30_NEIMB/1201-1277---------------------------------------------------------------------DI---------
A5TVV7_FUSNP/999-1074---------------------------------------------------------------------II---------
Q8PLI3_XANAC/426-488---------------------------------------------------------------------AL---------
Q8KT64_PHOLU/660-719---------------------------------------------------------------------VS---------
Q9I120_PSEAE/2089-2158---------------------------------------------------------------------SA---------
Q8P9Q5_XANCP/781-857---------------------------------------------------------------------SA---------
O32608_EDWTA/409-454---------------------------------------------------------------------AV---------
Q9K0T0_NEIMB/769-825---------------------------------------------------------------------QS---------
Q9I120_PSEAE/1447-1498---------------------------------------------------------------------TL---------
Q7DDD8_NEIMB/265-346---------------------------------------------------------------------VV---------
Q9K0T0_NEIMB/400-459---------------------------------------------------------------------LS---------
Q9I120_PSEAE/382-460---------------------------------------------------------------------VA---------
Q9JP78_BORBO/434-481---------------------------------------------------------------------SA---------
FHAB_BORPE/1233-1308---------------------------------------------------------------------VE---------
Q9I120_PSEAE/1752-1810---------------------------------------------------------------------SS---------
Q9PBE8_XYLFA/878-937---------------------------------------------------------------------TT---------
A0A027YSC5_ECOLX/1075-1143---------------------------------------------------------------------YS---------
A5TVV7_FUSNP/2900-2961---------------------------------------------------------------------VS---------
Q9I120_PSEAE/2281-2332---------------------------------------------------------------------TL---------
Q9JP78_BORBO/1722-1793---------------------------------------------------------------------VA---------
A0A027YSC5_ECOLX/209-286---------------------------------------------------------------------VV---------
Q8RGZ3_FUSNN/335-393---------------------------------------------------------------------DI---------
A5TVV7_FUSNP/868-940---------------------------------------------------------------------IA---------
Q8PLI3_XANAC/3495-3547---------------------------------------------------------------------TA---------
Q8XPV0_RALSO/434-523---------------------------------------------------------------------DG---------
Q8P9Q5_XANCP/224-302---------------------------------------------------------------------AT---------
FHAB_BORPE/613-679---------------------------------------------------------------------SA---------
Q88MW9_PSEPK/1040-1119---------------------------------------------------------------------HS---------
Q9JY23_NEIMB/250-326---------------------------------------------------------------------VS---------
Q9JY30_NEIMB/268-358---------------------------------------------------------------------VV---------
Q9PEY9_XYLFA/2190-2268---------------------------------------------------------------------GT---------
Q9PBE8_XYLFA/1117-1202---------------------------------------------------------------------RL---------
Q8PLI3_XANAC/921-986---------------------------------------------------------------------AL---------
HLYA_PROMI/214-285---------------------------------------------------------------------AF---------
Q9JY30_NEIMB/1708-1775---------------------------------------------------------------------IT---------
Q9L6B0_PASMD/305-383---------------------------------------------------------------------LI---------
Q9PEY9_XYLFA/255-333---------------------------------------------------------------------AT---------
Q8P9Q5_XANCP/641-717---------------------------------------------------------------------TS---------
Q9PEY9_XYLFA/465-546---------------------------------------------------------------------LA---------
FHAB_BORPE/257-336---------------------------------------------------------------------VV---------
Q8PLI3_XANAC/611-700---------------------------------------------------------------------VA---------
O32608_EDWTA/1127-1173---------------------------------------------------------------------TQ---------
Q9I791_PSEAE/1475-1550---------------------------------------------------------------------IS---------
G1UB82_HAEDU/884-936---------------------------------------------------------------------VA---------
Q8P9Q5_XANCP/2538-2612---------------------------------------------------------------------TA---------
G1UB82_HAEDU/481-539---------------------------------------------------------------------VL---------
Q8PLI3_XANAC/1452-1504---------------------------------------------------------------------AS---------
Q9PBE8_XYLFA/1219-1280---------------------------------------------------------------------TA---------
Q9ZHL3_HAEDC/302-381---------------------------------------------------------------------FA---------
Q8PLI3_XANAC/2485-2591---------------------------------------------------------------------VI---------
G1UB82_HAEDU/294-378---------------------------------------------------------------------FA---------
Q9I120_PSEAE/314-379---------------------------------------------------------------------YA---------
Q9L6B0_PASMD/576-644---------------------------------------------------------------------LT---------
Q9CPI1_PASMU/1325-1400---------------------------------------------------------------------DI---------
Q9CPI1_PASMU/310-387---------------------------------------------------------------------FV---------
FHAB_BORPE/1442-1538---------------------------------------------------------------------RL---------
Q8KT64_PHOLU/1391-1522---------------------------------------------------------------------AS---------
A5TVV7_FUSNP/212-286---------------------------------------------------------------------VV---------
Q8XPV0_RALSO/204-291---------------------------------------------------------------------IV---------
Q9I120_PSEAE/3353-3428---------------------------------------------------------------------IS---------
Q8XUK5_RALSO/656-729---------------------------------------------------------------------TI---------
Q9JPJ4_NEIME/882-953---------------------------------------------------------------------VS---------
Q8P9Q5_XANCP/345-458---------------------------------------------------------------------VA---------
HLYA_SERMA/226-296---------------------------------------------------------------------AI---------
Q8PLI3_XANAC/2321-2395---------------------------------------------------------------------TA---------
Q7N9K8_PHOLL/217-289---------------------------------------------------------------------AI---------
Q9I120_PSEAE/2996-3080---------------------------------------------------------------------VA---------
Q9PEY9_XYLFA/586-685---------------------------------------------------------------------AS---------
Q8KT64_PHOLU/782-834---------------------------------------------------------------------IA---------
Q8P9Q5_XANCP/1258-1335---------------------------------------------------------------------VA---------
Q8KT64_PHOLU/342-422---------------------------------------------------------------------QA---------
Q9ZHL3_HAEDC/464-521---------------------------------------------------------------------VS---------
Q9P9U6_XYLFA/773-832---------------------------------------------------------------------TA---------
Q8PLI3_XANAC/1567-1643---------------------------------------------------------------------QS---------
A5TVV7_FUSNP/1095-1173---------------------------------------------------------------------AA---------
Q9I120_PSEAE/3706-3776---------------------------------------------------------------------AS---------
Q9I120_PSEAE/3221-3335---------------------------------------------------------------------VS---------
Q9JP78_BORBO/651-717---------------------------------------------------------------------AA---------
Q8PLI3_XANAC/2019-2068---------------------------------------------------------------------VA---------
Q8PLI3_XANAC/1182-1245---------------------------------------------------------------------AL---------
O32608_EDWTA/1021-1083---------------------------------------------------------------------AA---------
Q8PLI3_XANAC/1050-1126---------------------------------------------------------------------QA---------
Q9RGD1_BARHN/6-64---------------------------------------------------------------------DI---------
Q8PLI3_XANAC/1905-1991---------------------------------------------------------------------AS---------
Q9L6B0_PASMD/1419-1494---------------------------------------------------------------------DI---------
Q9I120_PSEAE/3496-3558---------------------------------------------------------------------AL---------
O32608_EDWTA/214-285---------------------------------------------------------------------AV---------
Q9CPI1_PASMU/559-626---------------------------------------------------------------------VT---------
Q8KT64_PHOLU/2597-2661---------------------------------------------------------------------IR---------
Q9K0T0_NEIMB/606-662---------------------------------------------------------------------IA---------
Q8P9Q5_XANCP/2262-2320---------------------------------------------------------------------GV---------
Q8KT64_PHOLU/440-510---------------------------------------------------------------------VT---------
Q9I120_PSEAE/617-667---------------------------------------------------------------------SL---------
Q9ZHL3_HAEDC/651-728---------------------------------------------------------------------IL---------
HLYA_PROMI/1200-1264---------------------------------------------------------------------SV---------
Q8PLI3_XANAC/3289-3387---------------------------------------------------------------------LV---------
Q9JY30_NEIMB/930-997---------------------------------------------------------------------GA---------
Q9I120_PSEAE/2169-2227---------------------------------------------------------------------AS---------
FHAB_BORPE/947-1021---------------------------------------------------------------------AA---------
Q8KT64_PHOLU/2861-2951---------------------------------------------------------------------VV---------
Q9PBE8_XYLFA/2062-2138---------------------------------------------------------------------LA---------
Q9I120_PSEAE/1670-1741---------------------------------------------------------------------VL---------
A0A027YSC5_ECOLX/354-435---------------------------------------------------------------------AA---------
Q8PLI3_XANAC/1759-1823---------------------------------------------------------------------AV---------
Q9JY30_NEIMB/361-426---------------------------------------------------------------------AA---------
Q47955_HAEDC/409-504---------------------------------------------------------------------TL---------
Q8RGK2_FUSNN/195-268---------------------------------------------------------------------PI---------
Q88MW9_PSEPK/219-293---------------------------------------------------------------------IT---------
O32608_EDWTA/1428-1532---------------------------------------------------------------------DT---------
Q8PLI3_XANAC/989-1047---------------------------------------------------------------------QG---------
Q9JPJ4_NEIME/527-610---------------------------------------------------------------------NA---------
Q9PBE8_XYLFA/1297-1360---------------------------------------------------------------------TA---------
Q8P9Q5_XANCP/1895-1981---------------------------------------------------------------------AA---------
Q8KT64_PHOLU/2531-2595---------------------------------------------------------------------TA---------
FHAB_BORPE/1560-1635---------------------------------------------------------------------DA---------
Q8KT64_PHOLU/1662-1732---------------------------------------------------------------------IS---------
Q9I120_PSEAE/4534-4605---------------------------------------------------------------------DI---------
Q8PLI0_XANAC/107-201---------------------------------------------------------------------AA---------
Q8P9Q5_XANCP/919-976---------------------------------------------------------------------AV---------
Q8P9Q5_XANCP/481-558---------------------------------------------------------------------VA---------
O32608_EDWTA/494-532---------------------------------------------------------------------RA---------
Q8PLI3_XANAC/491-568---------------------------------------------------------------------IA---------
Q9I120_PSEAE/2493-2557---------------------------------------------------------------------RI---------
Q9I791_PSEAE/2650-2727---------------------------------------------------------------------VS---------
Q9ZHL3_HAEDC/759-809---------------------------------------------------------------------DI---------
Q8KT64_PHOLU/257-334---------------------------------------------------------------------VV---------
Q9I120_PSEAE/3156-3216---------------------------------------------------------------------IS---------
G1UB82_HAEDU/773-850---------------------------------------------------------------------TL---------
Q8P9Q5_XANCP/1816-1892---------------------------------------------------------------------RA---------
Q8RGZ3_FUSNN/599-673---------------------------------------------------------------------TG---------
Q88MW9_PSEPK/1135-1205---------------------------------------------------------------------QS---------
Q9PBE8_XYLFA/1003-1082---------------------------------------------------------------------TA---------
Q8KT64_PHOLU/565-616---------------------------------------------------------------------RV---------
Q8RGZ3_FUSNN/22-93---------------------------------------------------------------------VV---------
Q8P9Q5_XANCP/1431-1493---------------------------------------------------------------------RI---------
Q8P9Q5_XANCP/720-778---------------------------------------------------------------------QS---------
FHAB_BORPE/491-557---------------------------------------------------------------------AS---------
A0A027YSC5_ECOLX/697-765---------------------------------------------------------------------WS---------
Q9K0T0_NEIMB/486-548---------------------------------------------------------------------TG---------
Q9PEY9_XYLFA/711-768---------------------------------------------------------------------TA---------

PF13229

A4HFK4_LEIBR/1122-1276-----------------------------------------------ANI....L------------LDHFD-----GAT
A4RWC7_OSTLU/255-410-----------------------------------------------EAI....R------------IKGDS-----RV.
C1MV84_MICPC/432-587-----------------------------------------------QAI....H------------VEGGD-----AV.
A0B575_METTP/145-292-----------------------------------------------YGI....R------------LNGSA-----I..
B1LZG7_METRJ/126-306-----------------------------------------------SGF....I------------IRRGS-----S..
B8IPB3_METNO/205-368-----------------------------------------------YGA....V------------QAAAG-----R..
Q1IR31_KORVE/209-372-----------------------------------------------GAI....G------------GDRSG-----S..
Q1IJK3_KORVE/204-367-----------------------------------------------GAIGGPNG------------KAEHW-----Y..
D2PZ24_KRIFD/241-418-----------------------------------------------GGA....V------------EVGVD-----W..
D2PZ28_KRIFD/298-476-----------------------------------------------AGA....V------------VLSTG-----W..
D1CII1_THET1/254-430-----------------------------------------------DGL...GA------------IANNS-----HS.
Q5KIH2_CRYNJ/125-330-----------------------------------------------ALI....E------------IGNSE-----S..
A2DQI5_TRIVA/133-313-----------------------------------------------IGI....L------------MTGND-----N..
A2GN59_TRIVA/178-358-----------------------------------------------VGI....Y------------ILGDN-----N..
A2DSW4_TRIVA/295-476-----------------------------------------------NAI....T------------FSSCN-----D..
D2VXU7_NAEGR/1914-2119-----------------------------------------------YGL....M------------IDSSD-----V..
D3E003_METRM/246-408-----------------------------------------------SFV....E------------ASDVS-----D..
D2VGY1_NAEGR/119-306-----------------------------------------------VGI....A------------MNDGN-----AIY
A5UJV8_METS3/96-251-----------------------------------------------STV....Y------------TSGEL-----S..
D7DS12_METV3/546-725-----------------------------------------------LGI....F------------THGKS-----N..
D7DT96_METV3/87-251-----------------------------------------------RII....Y------------VNGQY-----A..
A5UN24_METS3/1015-1205-----------------------------------------------SGI....V------------VNNVK-----N..
D3DZT1_METRM/1034-1216-----------------------------------------------YGI....I------------LNNTK-----E..
A5UNL3_METS3/391-540-----------------------------------------------EGI....R------------VAENN-----V..
Q2NFB2_METST/846-1038-----------------------------------------------TGF....I------------AGLNS-----I..
A5UN26_METS3/210-367-----------------------------------------------SPVFTIES------------SKAAG-----T..
Q11PH9_CYTH3/3751-3918-----------------------------------------------TGI....N------------IKTTG-----FI.
A2DZP5_TRIVA/237-393-----------------------------------------------SSI....S------------IINQF-----V..
A2EWG4_TRIVA/238-392-----------------------------------------------SAI....S------------CAASK-----I..
Q2K708_RHIEC/156-330-----------------------------------------------DGF....W------------IEKVE-----G..
C6X284_FLAB3/105-267-----------------------------------------------GAI....R------------LYDSH-----F..
B7GKQ0_ANOFW/105-265-----------------------------------------------AGV....L------------IQKSS-----H..
A5UM93_METS3/570-727-----------------------------------------------WGV....N------------VVDTN-----Q..
B1Y807_LEPCP/135-286-----------------------------------------------NGV....Q------------LYNTQ-----G..
C4ZN21_THASP/165-316-----------------------------------------------NGI....Q------------LYNTQ-----R..
Q5NZ04_AROAE/165-316-----------------------------------------------NGI....Q------------LYNTT-----G..
A7ZFW4_CAMC1/149-307-----------------------------------------------DAV....R------------LWYSH-----E..
D4H675_DENA2/149-307-----------------------------------------------DGI....R------------LWYSH-----L..
A2F6G3_TRIVA/566-720-----------------------------------------------GGV....I------------LEEGC-----H..
B2A266_NATTJ/667-827-----------------------------------------------GGI....L------------IDGSE-----A..
D3DZT1_METRM/180-349-----------------------------------------------HGIFYISP------------EASGT-----V..
Q21PK3_SACD2/316-486-----------------------------------------------SGV...SS------------FYGNA-----T..
A8ZSU8_DESOH/610-786-----------------------------------------------TGA....R------------IKEVS-----V..
Q01V78_SOLUE/318-510-----------------------------------------------YAI....W------------FGRGS-----K..
B4NKK3_DROWI/907-1062-----------------------------------------------SGV....Q------------IRTGS-----N..
Q1RQ01_CIOIN/615-770-----------------------------------------------SGV....Q------------IRTGS-----N..
Q1RQ01_CIOIN/338-494-----------------------------------------------SAV....S------------CAGEG-----A..
A8LUC6_DINSH/146-309-----------------------------------------------DAV....Y------------LRNAS-----D..
A9WDN6_CHLAA/503-681-----------------------------------------------AAV....L------------IEPCA-----S..
Q0W3D6_METAR/107-264-----------------------------------------------SAI....L------------VESSD-----N..
D2RS85_HALTV/217-421-----------------------------------------------MAI....S------------FSRCT-----N..
A9B4J4_HERA2/210-386-----------------------------------------------RGV....V------------TLGES-----N..
D3F6E1_CONWI/144-334-----------------------------------------------NGV....V------------WYTDG-----E..
Q4E3J7_TRYCC/564-717-----------------------------------------------HGV....V------------VDGEE-----S..
Q8ZXB6_PYRAE/124-281-----------------------------------------------LGI....Y------------IYNSS-----D..
B5IFT4_ACIB4/648-827-----------------------------------------------AKI....F------------GWPGN-----G..
Y1396_METJA/2174-2323-----------------------------------------------EGV....Y------------SKNST-----L..
A8XCU4_CAEBR/377-555-----------------------------------------------LGI....F------------INTDQ-----Q..
A8XCU4_CAEBR/835-1021-----------------------------------------------SGI...DF------------MTPTG-----N..
B8GIH1_METPE/210-388-----------------------------------------------HGF....N------------MNANR-----STM
Q6LZ14_METMP/541-702-----------------------------------------------AGI....L------------SFQNS-----N..
B8GKS8_METPE/88-248-----------------------------------------------TGI....V------------VNPEG-----ESP
B1L3G7_KORCO/159-312-----------------------------------------------AGV....N------------FESSV-----A..
Q8TR94_METAC/114-266-----------------------------------------------SGI....Y------------LDNAT-----Y..
Q12Y38_METBU/125-275-----------------------------------------------PGI....Y------------LDGAH-----N..
Q12Z43_METBU/104-256-----------------------------------------------SGI....Y------------LDEVV-----N..
Q8TLY7_METAC/117-269-----------------------------------------------AGV....Y------------LVRSG-----N..
Q8TQN2_METAC/592-749-----------------------------------------------AGI....F------------YIGSG-----G..
Q8THN3_METAC/410-561-----------------------------------------------VGL....L------------LLGAG-----N..
Q8TMY7_METAC/1017-1166-----------------------------------------------CGI....Y------------LENTR-----E..
D2VGW6_NAEGR/142-294-----------------------------------------------NTI....L------------FNNIN-----I..
A2DG23_TRIVA/257-412-----------------------------------------------DGI....L------------LSGAS-----V..
Q4E3J7_TRYCC/767-933-----------------------------------------------FGV....V------------VNGPS-----A..
A2EXK6_TRIVA/265-421-----------------------------------------------NII....I------------MTQQA-----Q..
A4X252_SALTO/119-272-----------------------------------------------PAI....S------------VADRS-----E..
B8GHS2_METPE/296-452-----------------------------------------------EGI....H------------VGMVS-----D..
A2DG23_TRIVA/493-649-----------------------------------------------SGI....Q------------LLCCS-----G..
A2E713_TRIVA/471-626-----------------------------------------------SGL....E------------INGVQ-----T..
A2DGW8_TRIVA/182-337-----------------------------------------------RGL....N------------LRSAT-----T..
A2FYC7_TRIVA/339-494-----------------------------------------------NGL....I------------VKARA-----A..
A2FPW6_TRIVA/308-481-----------------------------------------------SCV....L------------VKKDS-----E..
Q5WHY7_BACSK/106-258-----------------------------------------------WGI....H------------VLEDG-----H..
A2DIY9_TRIVA/83-240-----------------------------------------------GGI....C------------TNTAS-----Y..
A2EAN8_TRIVA/175-332-----------------------------------------------CGI....L------------CTDSA-----Q..
A2ENP8_TRIVA/245-395-----------------------------------------------SGV....H------------AQFNC-----K..
A2GD34_TRIVA/590-746-----------------------------------------------VGL....E------------LTNVK-----D..
A2DQW2_TRIVA/362-515-----------------------------------------------SAV....D------------ISGSS-----G..
A2FHX0_TRIVA/618-765-----------------------------------------------THI....N------------HKNNQ-----M..
A2ERI6_TRIVA/309-462-----------------------------------------------AGI....A------------IDNVF-----G..
B1HXQ4_LYSSC/149-305-----------------------------------------------AQI....I------------AQNCE-----M..
A2ELJ5_TRIVA/1001-1152-----------------------------------------------NAV....I------------VDHGE-----S..
A2ENP8_TRIVA/80-239-----------------------------------------------QGL...VH------------CTGEG-----T..
D3BJ88_POLPA/671-831-----------------------------------------------GGV....W------------ATQTS-----L..
A2EXP7_TRIVA/122-276-----------------------------------------------SAL....L------------VRDRS-----K..
A2FHX0_TRIVA/309-464-----------------------------------------------PCV....F------------VNAQS-----S..
A2EYD0_TRIVA/230-382-----------------------------------------------TSL....F------------INDSN-----L..
A9V8X4_MONBE/130-296-----------------------------------------------LGV....L------------VEGSR-----H..
C3Y624_BRAFL/300-474-----------------------------------------------PGV.....------------..GGE-----RC.
C8W2D1_DESAS/138-297-----------------------------------------------FGI....G------------LWGQN-----T..
D3TBL1_ACIB4/958-1108-----------------------------------------------SGI....E------------LWYSS-----N..
G1LPY2_AILME/2243-2418-----------------------------------------------.GL....S------------MSRTM-----G..
PLYL_DICD3/133-313-----------------------------------------------YGF....Y------------VTGDY-----W..
Q251J0_DESHY/90-272-----------------------------------------------..V....S------------IKGDG-----V..
Q2K908_RHIEC/104-274-----------------------------------------------DGI....E------------ANNVH-----H..
R6P1V8_9CLOT/1010-1182-----------------------------------------------..I....E------------AASNY-----N..

PF02415

A0A0F7X457_CHLPN/182-200-----------------------------------------------SAI------------------------------
Q7USQ0_RHOBA/609-626-----------------------------------------------GGS------------------------------
Q7USQ0_RHOBA/574-600-----------------------------------------------DAS------------------------------
PMPB_CHLTR/763-781-----------------------------------------------SLS------------------------------
PMP19_CHLPN/219-236-----------------------------------------------EIL------------------------------
Q7USQ0_RHOBA/1476-1499-----------------------------------------------DSS------------------------------
Q823X6_CHLCV/212-230-----------------------------------------------AIS------------------------------
Q824E7_CHLCV/831-849-----------------------------------------------VSN------------------------------
Q7UYI1_RHOBA/341-359-----------------------------------------------DSN------------------------------
PMPD_CHLTR/805-823-----------------------------------------------AVV------------------------------
PMPE_CHLMU/231-248-----------------------------------------------DLL------------------------------
Q823W9_CHLCV/240-262-----------------------------------------------AVV------------------------------
Q7USQ0_RHOBA/2205-2228-----------------------------------------------GTT------------------------------
Q7USQ0_RHOBA/459-477-----------------------------------------------LAI------------------------------
Q823W9_CHLCV/304-325-----------------------------------------------PTV------------------------------
PMPC_CHLTR/1040-1077-----------------------------------------------SVL------------------------------
PMP19_CHLPN/181-206-----------------------------------------------TIL------------------------------
PMP10_CHLPN/237-266-----------------------------------------------NCT------------------------------
YFAL_ECOLI/186-211-----------------------------------------------DVI------------------------------
PMPC_CHLTR/166-192-----------------------------------------------EVV------------------------------
PMPD_CHLTR/359-377-----------------------------------------------GIT------------------------------
PMPE_CHLMU/197-220-----------------------------------------------SFL------------------------------
PMPF_CHLMU/270-296-----------------------------------------------KLI------------------------------
PMP9_CHLPN/239-260-----------------------------------------------AIS------------------------------
PMPI_CHLMU/192-210-----------------------------------------------SLS------------------------------
Q7UWZ8_RHOBA/3661-3680-----------------------------------------------NIT------------------------------
PMP2_CHLPN/189-207-----------------------------------------------SLS------------------------------
Q7UWZ8_RHOBA/1086-1105-----------------------------------------------DSL------------------------------
PMPB_CHLMU/941-958-----------------------------------------------SFT------------------------------
Q7USQ0_RHOBA/1185-1203-----------------------------------------------GGT------------------------------
PMP14_CHLPN/232-274-----------------------------------------------SLL------------------------------
PMPA_CHLMU/277-295-----------------------------------------------TLS------------------------------
PMPC_CHLMU/644-671-----------------------------------------------PVT------------------------------
Q8VU50_CHLPS/186-204-----------------------------------------------YVV------------------------------
PMPA_CHLMU/360-379-----------------------------------------------SIT------------------------------
PMPD_CHLMU/841-866-----------------------------------------------DVI------------------------------
Q823X1_CHLCV/274-292-----------------------------------------------QLL------------------------------
PMPB_CHLMU/588-607-----------------------------------------------TIS------------------------------
PMP7_CHLPN/218-236-----------------------------------------------IVS------------------------------
PMP6_CHLPN/158-176-----------------------------------------------SVT------------------------------
PMPG_CHLMU/264-281-----------------------------------------------AVE------------------------------
Q824E7_CHLCV/575-593-----------------------------------------------ILE------------------------------
Q823Y0_CHLCV/253-275-----------------------------------------------NLI------------------------------
Q823X5_CHLCV/226-244-----------------------------------------------SIL------------------------------
PMP7_CHLPN/344-360-----------------------------------------------DIT------------------------------
A0A0F7WD76_CHLPN/85-112-----------------------------------------------KVS------------------------------
YFAL_ECOLI/67-82-----------------------------------------------FSD------------------------------
PMP20_CHLPN/1045-1063-----------------------------------------------SVL------------------------------
PMPD_CHLTR/612-641-----------------------------------------------STS------------------------------
PMP9_CHLPN/276-294-----------------------------------------------ELN------------------------------
PMP1_CHLPN/182-199-----------------------------------------------SVS------------------------------
Q823X6_CHLCV/313-331-----------------------------------------------PTY------------------------------
PMP20_CHLPN/830-848-----------------------------------------------TGS------------------------------
M4UH44_9XANT/369-387-----------------------------------------------NST------------------------------
A0A0F7X457_CHLPN/211-229-----------------------------------------------TLK------------------------------
Q7UWZ8_RHOBA/3685-3702-----------------------------------------------GIE------------------------------
Q823Y2_CHLCV/321-338-----------------------------------------------LVQ------------------------------
PMP16_CHLPN/208-226-----------------------------------------------PLL------------------------------
PMPB_CHLTR/1072-1106-----------------------------------------------SVL------------------------------
Q823Y1_CHLCV/197-218-----------------------------------------------DII------------------------------
PMPB_CHLTR/735-753-----------------------------------------------QLN------------------------------
PMPF_CHLMU/242-259-----------------------------------------------PVV------------------------------
PMPH_CHLMU/292-310-----------------------------------------------PIT------------------------------
PMP18_CHLPN/177-195-----------------------------------------------TAY------------------------------
Q8VU50_CHLPS/154-172-----------------------------------------------KLI------------------------------
PMPG_CHLTR/364-382-----------------------------------------------VVF------------------------------
PMPD_CHLTR/529-572-----------------------------------------------GIS------------------------------
PMPC_CHLMU/389-407-----------------------------------------------EVV------------------------------
H2VFH2_CHLAB/217-238-----------------------------------------------PTL------------------------------
PMPF_CHLTR/341-358-----------------------------------------------PVY------------------------------
Q823W9_CHLCV/212-230-----------------------------------------------KVI------------------------------
Q823Y1_CHLCV/168-186-----------------------------------------------RCQ------------------------------
PMP20_CHLPN/278-296-----------------------------------------------SLK------------------------------
Q823X2_CHLCV/93-111-----------------------------------------------LLY------------------------------
PMPC_CHLTR/138-164-----------------------------------------------NSI------------------------------
Q7UWZ8_RHOBA/1058-1077-----------------------------------------------RTT------------------------------
PMPF_CHLMU/202-231-----------------------------------------------IVA------------------------------
Q823Y2_CHLCV/258-284-----------------------------------------------LIL------------------------------
PMPG_CHLTR/304-343-----------------------------------------------KTL------------------------------
PMPD_CHLTR/267-286-----------------------------------------------AIS------------------------------
Q7USQ0_RHOBA/1794-1815-----------------------------------------------DAT------------------------------
PMPE_CHLTR/297-315-----------------------------------------------RIF------------------------------
Q824E6_CHLCV/333-352-----------------------------------------------PII------------------------------
Q824E7_CHLCV/420-438-----------------------------------------------DTL------------------------------
PMP6_CHLPN/449-467-----------------------------------------------NVS------------------------------
Q824E7_CHLCV/803-821-----------------------------------------------HLN------------------------------
Q7UYI1_RHOBA/313-332-----------------------------------------------ESA------------------------------
Q7UZ67_RHOBA/447-470-----------------------------------------------DVA------------------------------
Q823X5_CHLCV/347-365-----------------------------------------------DIL------------------------------
PMP10_CHLPN/94-112-----------------------------------------------SLS------------------------------
PMPB_CHLTR/1044-1062-----------------------------------------------NIT------------------------------
PMP21_CHLPN/543-572-----------------------------------------------AIT------------------------------
PMP11_CHLPN/180-198-----------------------------------------------DAL------------------------------
PMPC_CHLTR/394-412-----------------------------------------------EVI------------------------------
PMP1_CHLPN/307-329-----------------------------------------------PTL------------------------------
PMP20_CHLPN/390-421-----------------------------------------------DLT------------------------------
PMPB_CHLTR/456-474-----------------------------------------------IIE------------------------------
Q823Y0_CHLCV/225-242-----------------------------------------------DIV------------------------------
A0A0F7X457_CHLPN/298-316-----------------------------------------------SIN------------------------------
PMPC_CHLTR/515-533-----------------------------------------------NVA------------------------------
Q823X4_CHLCV/217-241-----------------------------------------------PTL------------------------------
PMP20_CHLPN/517-574-----------------------------------------------EVR------------------------------
PMPD_CHLMU/324-348-----------------------------------------------ELV------------------------------
Q7USQ0_RHOBA/2265-2283-----------------------------------------------GTT------------------------------
Q7UYI1_RHOBA/607-625-----------------------------------------------DSV------------------------------
Q821X9_CHLCV/727-745-----------------------------------------------SVS------------------------------
PMP21_CHLPN/750-771-----------------------------------------------NVV------------------------------
PMP21_CHLPN/710-740-----------------------------------------------NLR------------------------------
PMPB_CHLMU/792-820-----------------------------------------------LCQ------------------------------
PMP19_CHLPN/248-265-----------------------------------------------TTS------------------------------
PMP15_CHLPN/87-105-----------------------------------------------NVF------------------------------
PMP1_CHLPN/280-298-----------------------------------------------QLV------------------------------
PMP16_CHLPN/179-197-----------------------------------------------TFY------------------------------
PMPH_CHLTR/242-260-----------------------------------------------KVS------------------------------
PMPF_CHLMU/173-191-----------------------------------------------SLN------------------------------
Q823Y1_CHLCV/295-313-----------------------------------------------GLI------------------------------
PMP1_CHLPN/154-172-----------------------------------------------VVR------------------------------
PMPF_CHLMU/133-164-----------------------------------------------NIL------------------------------
PMPG_CHLTR/169-195-----------------------------------------------DLL------------------------------
Q823X0_CHLCV/153-171-----------------------------------------------KLL------------------------------
PMPG_CHLMU/196-214-----------------------------------------------LCT------------------------------
Q823X5_CHLCV/171-189-----------------------------------------------NVL------------------------------
PMP6_CHLPN/317-335-----------------------------------------------EMS------------------------------
Q821X9_CHLCV/301-320-----------------------------------------------NVL------------------------------
Q7USQ0_RHOBA/1096-1117-----------------------------------------------DST------------------------------
PMP20_CHLPN/1071-1089-----------------------------------------------GAT------------------------------
PMP13_CHLPN/338-356-----------------------------------------------SVT------------------------------
PMP19_CHLPN/62-80-----------------------------------------------VCD------------------------------
PMP20_CHLPN/489-507-----------------------------------------------LTT------------------------------
Q7USQ0_RHOBA/635-652-----------------------------------------------GTT------------------------------
PMPE_CHLMU/324-342-----------------------------------------------PTY------------------------------
PMP20_CHLPN/716-734-----------------------------------------------EAL------------------------------
PMP6_CHLPN/633-650-----------------------------------------------PVS------------------------------
PMP15_CHLPN/278-296-----------------------------------------------GVL------------------------------
A0A0F7XIJ9_CHLPN/185-203-----------------------------------------------FVA------------------------------
PMPI_CHLTR/163-181-----------------------------------------------FTA------------------------------
Q824E7_CHLCV/731-748-----------------------------------------------LID------------------------------
H2VFH0_CHLAB/248-268-----------------------------------------------DIT------------------------------
PMP16_CHLPN/113-131-----------------------------------------------HAF------------------------------
PMPA_CHLTR/332-350-----------------------------------------------TIR------------------------------
PMP20_CHLPN/1099-1128-----------------------------------------------QLI------------------------------
PMPE_CHLTR/159-186-----------------------------------------------NLY------------------------------
PMP13_CHLPN/194-212-----------------------------------------------SLL------------------------------
Q7USQ0_RHOBA/252-270-----------------------------------------------GGE------------------------------
PMPB_CHLMU/867-899-----------------------------------------------QTV------------------------------
Q7USQ0_RHOBA/339-362-----------------------------------------------GTI------------------------------
PMP12_CHLPN/187-205-----------------------------------------------YLV------------------------------
Q823X9_CHLCV/100-118-----------------------------------------------PIF------------------------------
Q7UYI1_RHOBA/474-492-----------------------------------------------DSS------------------------------
PMP13_CHLPN/280-319-----------------------------------------------DLT------------------------------
Q7USQ0_RHOBA/1004-1030-----------------------------------------------DVN------------------------------
PMP16_CHLPN/300-318-----------------------------------------------TIL------------------------------
Q823X3_CHLCV/188-206-----------------------------------------------SML------------------------------
Q7USQ0_RHOBA/1151-1176-----------------------------------------------DVS------------------------------
Q7USQ0_RHOBA/2527-2545-----------------------------------------------NST------------------------------
PMP20_CHLPN/776-794-----------------------------------------------NVN------------------------------
Q7UYI1_RHOBA/394-412-----------------------------------------------DTV------------------------------
PMP11_CHLPN/152-170-----------------------------------------------KLV------------------------------
Q823X9_CHLCV/310-327-----------------------------------------------PVY------------------------------
Q823X5_CHLCV/255-280-----------------------------------------------AVR------------------------------
Q823X1_CHLCV/301-322-----------------------------------------------TTV------------------------------
PMP7_CHLPN/187-207-----------------------------------------------FAS------------------------------
PMP8_CHLPN/308-330-----------------------------------------------PTL------------------------------
Q821X9_CHLCV/805-823-----------------------------------------------QVL------------------------------
Q7USQ0_RHOBA/279-304-----------------------------------------------DVL------------------------------
Q7USQ0_RHOBA/313-331-----------------------------------------------GGT------------------------------
Q823X1_CHLCV/238-260-----------------------------------------------RVE------------------------------
PMPE_CHLMU/258-286-----------------------------------------------DIV------------------------------
PMPF_CHLTR/180-198-----------------------------------------------TLA------------------------------
PMP9_CHLPN/182-200-----------------------------------------------NLT------------------------------
PMPB_CHLMU/459-477-----------------------------------------------RLQ------------------------------
PMPD_CHLTR/679-697-----------------------------------------------YVL------------------------------
Q824E6_CHLCV/279-297-----------------------------------------------PVV------------------------------
Q821X9_CHLCV/422-440-----------------------------------------------NSL------------------------------
PMP8_CHLPN/281-299-----------------------------------------------SLT------------------------------
Q7USQ0_RHOBA/949-970-----------------------------------------------DSE------------------------------
PMPC_CHLMU/242-260-----------------------------------------------KLA------------------------------
Q823X6_CHLCV/107-125-----------------------------------------------KLV------------------------------
PMP9_CHLPN/303-325-----------------------------------------------PTL------------------------------
PMP7_CHLPN/308-331-----------------------------------------------PTL------------------------------
Q7UYI1_RHOBA/555-573-----------------------------------------------DTK------------------------------
PMP19_CHLPN/303-320-----------------------------------------------SIV------------------------------
A0A0F7X457_CHLPN/154-172-----------------------------------------------TLV------------------------------
Q823Y2_CHLCV/201-220-----------------------------------------------PIL------------------------------
PMP20_CHLPN/221-239-----------------------------------------------NLT------------------------------
Q7USQ0_RHOBA/1647-1668-----------------------------------------------SST------------------------------
PMPF_CHLTR/140-171-----------------------------------------------DVL------------------------------
PMPG_CHLMU/225-243-----------------------------------------------PLS------------------------------
Q7USQ0_RHOBA/486-509-----------------------------------------------GGA------------------------------
P71135_CHLAO/277-295-----------------------------------------------VLI------------------------------
PMP14_CHLPN/314-332-----------------------------------------------ALL------------------------------
PMP7_CHLPN/281-299-----------------------------------------------NLS------------------------------
PMP21_CHLPN/952-977-----------------------------------------------NVS------------------------------
PMPI_CHLTR/135-153-----------------------------------------------SMS------------------------------
PMPH_CHLTR/318-336-----------------------------------------------SIV------------------------------
PMPI_CHLTR/281-298-----------------------------------------------PVS------------------------------
PMPD_CHLTR/492-518-----------------------------------------------VLT------------------------------
Q823Y2_CHLCV/221-247-----------------------------------------------DCE------------------------------
PMPD_CHLTR/176-203-----------------------------------------------DLI------------------------------
PMPA_CHLTR/304-322-----------------------------------------------PIL------------------------------
PMPB_CHLMU/197-268-----------------------------------------------QAT------------------------------
A0A0F7XIJ9_CHLPN/214-232-----------------------------------------------ILS------------------------------
Q7USQ0_RHOBA/2144-2170-----------------------------------------------GTT------------------------------
A0A0F7XIJ9_CHLPN/277-295-----------------------------------------------SLH------------------------------
Q7USQ0_RHOBA/1562-1580-----------------------------------------------ETE------------------------------
PMPI_CHLTR/219-236-----------------------------------------------PLF------------------------------
PMP13_CHLPN/223-241-----------------------------------------------PVI------------------------------
YFAL_ECOLI/97-118-----------------------------------------------MTL------------------------------
Q7USQ0_RHOBA/224-245-----------------------------------------------DST------------------------------
PMPD_CHLMU/529-572-----------------------------------------------EIS------------------------------
PMPD_CHLTR/446-482-----------------------------------------------TID------------------------------
PMPB_CHLMU/54-125-----------------------------------------------EYI------------------------------
PMP20_CHLPN/886-922-----------------------------------------------AVT------------------------------
PMPB_CHLMU/666-684-----------------------------------------------ELN------------------------------
PMPD_CHLTR/846-871-----------------------------------------------DVV------------------------------
PMPE_CHLTR/231-248-----------------------------------------------DLF------------------------------
PMP10_CHLPN/149-175-----------------------------------------------DLT------------------------------
PMPE_CHLMU/126-159-----------------------------------------------PVL------------------------------
PMP15_CHLPN/143-170-----------------------------------------------NCS------------------------------
Q821X9_CHLCV/889-906-----------------------------------------------SVA------------------------------
PMPD_CHLMU/267-286-----------------------------------------------PVC------------------------------
Q82QS3_STRAW/268-286-----------------------------------------------DST------------------------------
Q7USQ0_RHOBA/370-391-----------------------------------------------NAT------------------------------
Q82QS3_STRAW/181-198-----------------------------------------------RVA------------------------------
PMP11_CHLPN/270-288-----------------------------------------------TLI------------------------------
Q823Y0_CHLCV/194-215-----------------------------------------------SCI------------------------------
A0A0F7XIJ9_CHLPN/234-260-----------------------------------------------NLV------------------------------
PMPD_CHLTR/650-668-----------------------------------------------SVD------------------------------
PMP13_CHLPN/93-111-----------------------------------------------VFS------------------------------
PMP9_CHLPN/211-229-----------------------------------------------SAS------------------------------
PMPD_CHLTR/297-314-----------------------------------------------KTS------------------------------
PMPG_CHLTR/391-408-----------------------------------------------PVQ------------------------------
PMPC_CHLTR/202-220-----------------------------------------------EAT------------------------------
PMP6_CHLPN/579-597-----------------------------------------------SLS------------------------------
PMP21_CHLPN/501-519-----------------------------------------------EIL------------------------------
Q823Y0_CHLCV/165-183-----------------------------------------------PIY------------------------------
Q823Y0_CHLCV/312-329-----------------------------------------------DIF------------------------------
A0A0F7WD76_CHLPN/57-75-----------------------------------------------EVS------------------------------
PMP14_CHLPN/435-451-----------------------------------------------DIT------------------------------
A0A0F7WD76_CHLPN/154-176-----------------------------------------------LTL------------------------------
Q823X6_CHLCV/277-304-----------------------------------------------SVT------------------------------
PMP11_CHLPN/297-318-----------------------------------------------FTE------------------------------
PMPC_CHLMU/214-232-----------------------------------------------SLT------------------------------
Q824E7_CHLCV/231-249-----------------------------------------------NVT------------------------------
PMP21_CHLPN/840-864-----------------------------------------------NIA------------------------------
Q823Y2_CHLCV/172-190-----------------------------------------------TIC------------------------------
PMPF_CHLMU/307-325-----------------------------------------------PIY------------------------------
PMP18_CHLPN/325-342-----------------------------------------------PVY------------------------------
PMPC_CHLTR/884-909-----------------------------------------------TVT------------------------------
PMP16_CHLPN/142-168-----------------------------------------------PLI------------------------------
Q821X9_CHLCV/667-688-----------------------------------------------ELA------------------------------
Q7USQ0_RHOBA/1675-1693-----------------------------------------------GST------------------------------
Q7USQ0_RHOBA/2553-2570-----------------------------------------------SVT------------------------------
Q7UWZ8_RHOBA/1112-1132-----------------------------------------------NTT------------------------------
Q823X5_CHLCV/290-318-----------------------------------------------QLL------------------------------
P71133_CHLAO/155-173-----------------------------------------------SLV------------------------------
PMPI_CHLMU/136-154-----------------------------------------------NMS------------------------------
PMPE_CHLMU/160-187-----------------------------------------------DVY------------------------------
PMP19_CHLPN/122-138-----------------------------------------------SLV------------------------------
YFAL_ECOLI/127-145-----------------------------------------------DVI------------------------------
PMP15_CHLPN/305-322-----------------------------------------------PVY------------------------------
PMPA_CHLMU/333-351-----------------------------------------------AIR------------------------------
PMPA_CHLTR/359-378-----------------------------------------------TII------------------------------
PMPB_CHLMU/278-296-----------------------------------------------EIV------------------------------
Q824E7_CHLCV/950-977-----------------------------------------------KLT------------------------------
Q7UZ67_RHOBA/529-546-----------------------------------------------HST------------------------------
PMP15_CHLPN/241-268-----------------------------------------------LIE------------------------------
Q821X9_CHLCV/451-469-----------------------------------------------NIT------------------------------
Q823X0_CHLCV/177-199-----------------------------------------------NSS------------------------------
PMPD_CHLTR/378-405-----------------------------------------------NCQ------------------------------
PMP6_CHLPN/533-561-----------------------------------------------ALV------------------------------
PMPB_CHLTR/158-176-----------------------------------------------GLT------------------------------
Q7USQ0_RHOBA/2353-2376-----------------------------------------------GTV------------------------------
PMP2_CHLPN/216-237-----------------------------------------------ETL------------------------------
Q7UYI1_RHOBA/181-199-----------------------------------------------DSI------------------------------
Q824E6_CHLCV/222-239-----------------------------------------------EIL------------------------------
PMP20_CHLPN/613-631-----------------------------------------------RLQ------------------------------
PMPE_CHLTR/203-220-----------------------------------------------NIC------------------------------
PMP15_CHLPN/181-202-----------------------------------------------PII------------------------------
PMP20_CHLPN/803-820-----------------------------------------------NLT------------------------------
Q7USQ0_RHOBA/2500-2517-----------------------------------------------RST------------------------------
PMP20_CHLPN/250-268-----------------------------------------------AVT------------------------------
H2VFH2_CHLAB/149-175-----------------------------------------------NTT------------------------------
PMP14_CHLPN/286-304-----------------------------------------------KCT------------------------------
PMPF_CHLTR/250-267-----------------------------------------------PIV------------------------------
PMP16_CHLPN/327-344-----------------------------------------------HVY------------------------------
PMPB_CHLTR/857-885-----------------------------------------------TCQ------------------------------
PMPD_CHLMU/581-606-----------------------------------------------TVV------------------------------
PMP21_CHLPN/875-893-----------------------------------------------DIL------------------------------
PMPC_CHLTR/916-947-----------------------------------------------PVV------------------------------
PMP21_CHLPN/472-490-----------------------------------------------EVA------------------------------
PMPG_CHLMU/168-186-----------------------------------------------KVS------------------------------
PMP20_CHLPN/460-478-----------------------------------------------NLK------------------------------
YFAL_ECOLI/228-246-----------------------------------------------NTA------------------------------
Q823X5_CHLCV/199-216-----------------------------------------------SMQ------------------------------
PMPF_CHLTR/314-332-----------------------------------------------SIY------------------------------
Q7USQ0_RHOBA/1507-1528-----------------------------------------------DSD------------------------------
PMPG_CHLMU/401-421-----------------------------------------------DII------------------------------
PMP20_CHLPN/1010-1027-----------------------------------------------EIT------------------------------
PMP8_CHLPN/188-206-----------------------------------------------SIT------------------------------
Q824E7_CHLCV/905-939-----------------------------------------------DCT------------------------------
A0A0F7WD76_CHLPN/28-46-----------------------------------------------SAL------------------------------
PMP1_CHLPN/239-261-----------------------------------------------YVL------------------------------
PMP10_CHLPN/305-327-----------------------------------------------GIS------------------------------
Q824E7_CHLCV/203-221-----------------------------------------------SIS------------------------------
PMPD_CHLMU/616-637-----------------------------------------------FVR------------------------------
P71135_CHLAO/183-201-----------------------------------------------EIS------------------------------
PMPA_CHLTR/247-264-----------------------------------------------QIT------------------------------
PMPG_CHLMU/283-329-----------------------------------------------NIS------------------------------
PMP8_CHLPN/245-266-----------------------------------------------SLF------------------------------
A0A0F7XIJ9_CHLPN/157-175-----------------------------------------------NLD------------------------------
Q823X9_CHLCV/250-273-----------------------------------------------PIT------------------------------
PMP14_CHLPN/108-126-----------------------------------------------SIN------------------------------
Q823X4_CHLCV/95-113-----------------------------------------------SLT------------------------------
P71135_CHLAO/240-262-----------------------------------------------HVA------------------------------
P71135_CHLAO/304-325-----------------------------------------------PTA------------------------------
PMP13_CHLPN/166-184-----------------------------------------------SIL------------------------------
PMP15_CHLPN/213-230-----------------------------------------------AIQ------------------------------
Q83U05_CHLTH/100-133-----------------------------------------------PVI------------------------------
PMP21_CHLPN/582-608-----------------------------------------------NIQ------------------------------
Q824E7_CHLCV/260-330-----------------------------------------------SIE------------------------------
M4UH44_9XANT/166-184-----------------------------------------------NSQ------------------------------
PMPF_CHLTR/277-303-----------------------------------------------RII------------------------------
Q7USQ0_RHOBA/1124-1142-----------------------------------------------GSD------------------------------
PMPC_CHLTR/421-439-----------------------------------------------TVT------------------------------
PMPB_CHLTR/342-360-----------------------------------------------QSL------------------------------
Q7USQ0_RHOBA/193-216-----------------------------------------------NVT------------------------------
PMPE_CHLTR/324-342-----------------------------------------------PTY------------------------------
Q824E7_CHLCV/603-621-----------------------------------------------RIQ------------------------------
PMPG_CHLTR/205-223-----------------------------------------------LCV------------------------------
Q7USQ0_RHOBA/547-565-----------------------------------------------NTS------------------------------
Q823Y2_CHLCV/294-312-----------------------------------------------PIC------------------------------
PMP11_CHLPN/237-255-----------------------------------------------FLY------------------------------
Q823X6_CHLCV/340-357-----------------------------------------------PTI------------------------------
PMPD_CHLMU/176-203-----------------------------------------------DLI------------------------------
PMP6_CHLPN/375-392-----------------------------------------------TVT------------------------------
PMPD_CHLTR/407-433-----------------------------------------------IVS------------------------------
Q7UZ67_RHOBA/477-494-----------------------------------------------RVT------------------------------
PMP7_CHLPN/159-177-----------------------------------------------QII------------------------------
PMP19_CHLPN/94-112-----------------------------------------------ALT------------------------------
PMP1_CHLPN/210-229-----------------------------------------------EIR------------------------------
YFAL_ECOLI/159-178-----------------------------------------------NAM------------------------------
Q823X2_CHLCV/182-208-----------------------------------------------TLT------------------------------
Q824E6_CHLCV/150-168-----------------------------------------------SLL------------------------------
Q824E7_CHLCV/859-895-----------------------------------------------EFT------------------------------
Q82QS3_STRAW/231-259-----------------------------------------------NST------------------------------
PMPF_CHLMU/103-123-----------------------------------------------DLF------------------------------
PMPD_CHLMU/800-818-----------------------------------------------PIL------------------------------
PMPB_CHLTR/898-925-----------------------------------------------SYI------------------------------
Q7USQ0_RHOBA/2117-2135-----------------------------------------------NTT------------------------------
PMP15_CHLPN/107-142-----------------------------------------------NCT------------------------------
Q823Y1_CHLCV/322-339-----------------------------------------------PIL------------------------------
PMP6_CHLPN/606-624-----------------------------------------------SIN------------------------------
Q821X9_CHLCV/386-412-----------------------------------------------RIS------------------------------
Q823X2_CHLCV/153-171-----------------------------------------------DVS------------------------------
Q823X9_CHLCV/222-239-----------------------------------------------KIT------------------------------
PMPC_CHLTR/355-373-----------------------------------------------SLQ------------------------------
Q823X2_CHLCV/217-235-----------------------------------------------NTV------------------------------
PMP18_CHLPN/205-224-----------------------------------------------PCL------------------------------
PMP2_CHLPN/161-179-----------------------------------------------KVL------------------------------
PMPD_CHLMU/297-314-----------------------------------------------KIS------------------------------
Q823Y1_CHLCV/219-245-----------------------------------------------NCS------------------------------
PMP21_CHLPN/780-798-----------------------------------------------SVE------------------------------
PMPB_CHLTR/613-631-----------------------------------------------SIS------------------------------
PMPE_CHLTR/258-286-----------------------------------------------NIV------------------------------
PMP10_CHLPN/276-294-----------------------------------------------SVT------------------------------
Q823Y1_CHLCV/132-158-----------------------------------------------DCC------------------------------
PMPB_CHLMU/560-579-----------------------------------------------ETI------------------------------
Q823X1_CHLCV/210-228-----------------------------------------------VIS------------------------------
A0A0F7X457_CHLPN/239-260-----------------------------------------------ELI------------------------------
Q7UWZ8_RHOBA/1006-1025-----------------------------------------------TVR------------------------------
PMP8_CHLPN/217-235-----------------------------------------------QLV------------------------------
Q824E7_CHLCV/704-722-----------------------------------------------SAV------------------------------
PMP20_CHLPN/858-884-----------------------------------------------SFT------------------------------
PMP6_CHLPN/186-204-----------------------------------------------AAL------------------------------
PMP20_CHLPN/432-450-----------------------------------------------TTL------------------------------
P71135_CHLAO/212-230-----------------------------------------------TIR------------------------------
PMP6_CHLPN/476-494-----------------------------------------------TLT------------------------------
PMPB_CHLTR/932-969-----------------------------------------------PAT------------------------------
Q7USQ0_RHOBA/1039-1057-----------------------------------------------GGT------------------------------
PMPA_CHLTR/175-193-----------------------------------------------HIA------------------------------
PMP6_CHLPN/272-300-----------------------------------------------QVL------------------------------
Q823X5_CHLCV/374-391-----------------------------------------------KTM------------------------------
Q7USQ0_RHOBA/1450-1468-----------------------------------------------NAQ------------------------------
Q7UYI1_RHOBA/234-252-----------------------------------------------DST------------------------------
P71133_CHLAO/188-206-----------------------------------------------NLV------------------------------
PMP20_CHLPN/585-603-----------------------------------------------ILS------------------------------
PMP14_CHLPN/182-199-----------------------------------------------SIK------------------------------
Q823X3_CHLCV/154-172-----------------------------------------------KLI------------------------------
PMP12_CHLPN/150-168-----------------------------------------------EVT------------------------------
Q824E7_CHLCV/448-466-----------------------------------------------NLK------------------------------
PMPC_CHLTR/841-871-----------------------------------------------QGI------------------------------
PMPB_CHLMU/362-420-----------------------------------------------EIR------------------------------
PMP20_CHLPN/642-660-----------------------------------------------KTL------------------------------
Q824E6_CHLCV/251-269-----------------------------------------------TIT------------------------------
PMPC_CHLTR/542-560-----------------------------------------------NLE------------------------------
PMP11_CHLPN/209-227-----------------------------------------------YVR------------------------------
PMP18_CHLPN/139-166-----------------------------------------------SII------------------------------
PMPD_CHLMU/351-377-----------------------------------------------SVV------------------------------
PMPB_CHLTR/791-847-----------------------------------------------GFS------------------------------
PMP12_CHLPN/214-236-----------------------------------------------PSC------------------------------
PMPE_CHLMU/297-315-----------------------------------------------QIF------------------------------
PMPC_CHLTR/562-588-----------------------------------------------SVE------------------------------
Q823W9_CHLCV/277-295-----------------------------------------------VLL------------------------------
Q7USQ0_RHOBA/432-450-----------------------------------------------GTD------------------------------
PMPC_CHLTR/275-316-----------------------------------------------QTE------------------------------
PMP19_CHLPN/275-293-----------------------------------------------DTL------------------------------
Q823Y1_CHLCV/256-285-----------------------------------------------TIT------------------------------
Q823X3_CHLCV/215-233-----------------------------------------------TTL------------------------------
PMPD_CHLTR/881-898-----------------------------------------------NVL------------------------------
Q7USQ0_RHOBA/1616-1639-----------------------------------------------GTN------------------------------
Q823X6_CHLCV/182-199-----------------------------------------------NIS------------------------------
PMPE_CHLTR/126-158-----------------------------------------------PVI------------------------------
PMP18_CHLPN/262-288-----------------------------------------------SVI------------------------------
Q821X9_CHLCV/757-794-----------------------------------------------KVE------------------------------
PMPF_CHLTR/110-130-----------------------------------------------NLL------------------------------
Q821X9_CHLCV/628-657-----------------------------------------------VLS------------------------------
PMPC_CHLTR/327-345-----------------------------------------------TID------------------------------
PMP6_CHLPN/344-363-----------------------------------------------TLT------------------------------
PMPA_CHLTR/276-294-----------------------------------------------PLA------------------------------
Q823Y1_CHLCV/104-122-----------------------------------------------PIV------------------------------
PMP13_CHLPN/365-382-----------------------------------------------STI------------------------------
Q7USQ0_RHOBA/919-942-----------------------------------------------DAT------------------------------
Q824E7_CHLCV/987-1022-----------------------------------------------SIY------------------------------
PMPH_CHLTR/373-390-----------------------------------------------SIL------------------------------
Q823X1_CHLCV/181-199-----------------------------------------------IAN------------------------------
PMP20_CHLPN/743-761-----------------------------------------------SVT------------------------------
PMPB_CHLTR/484-502-----------------------------------------------RLQ------------------------------
PMPE_CHLTR/93-111-----------------------------------------------GIY------------------------------
PMPI_CHLTR/254-272-----------------------------------------------ETL------------------------------
PMPD_CHLMU/156-174-----------------------------------------------GIT------------------------------
PMPG_CHLTR/277-294-----------------------------------------------AVE------------------------------
PMPC_CHLMU/764-796-----------------------------------------------SVL------------------------------
PMPB_CHLMU/639-657-----------------------------------------------STT------------------------------
Q822Q5_CHLCV/185-203-----------------------------------------------YLL------------------------------
Q821X9_CHLCV/570-618-----------------------------------------------AIT------------------------------
PMPH_CHLMU/245-280-----------------------------------------------EML------------------------------
PMPC_CHLMU/571-599-----------------------------------------------YGT------------------------------
PMP6_CHLPN/215-233-----------------------------------------------TVT------------------------------
PMP20_CHLPN/970-1001-----------------------------------------------PII------------------------------
Q824E7_CHLCV/632-650-----------------------------------------------KTL------------------------------
PMPG_CHLTR/234-252-----------------------------------------------PIA------------------------------
Q823X9_CHLCV/283-301-----------------------------------------------PVL------------------------------
Q7UYI1_RHOBA/206-225-----------------------------------------------DSV------------------------------
PMP21_CHLPN/436-462-----------------------------------------------TLT------------------------------
Q7USQ0_RHOBA/2384-2405-----------------------------------------------DAT------------------------------
Q823Y2_CHLCV/105-123-----------------------------------------------DIK------------------------------
PMPB_CHLTR/709-726-----------------------------------------------DTT------------------------------
PMP20_CHLPN/933-960-----------------------------------------------PIL------------------------------
Q7USQ0_RHOBA/1589-1607-----------------------------------------------DAT------------------------------
Q823X3_CHLCV/94-112-----------------------------------------------SLI------------------------------
A0A0F7WD76_CHLPN/127-145-----------------------------------------------MLL------------------------------
PMPI_CHLTR/191-209-----------------------------------------------PIS------------------------------
PMPH_CHLMU/217-235-----------------------------------------------KIL------------------------------
PMP21_CHLPN/347-366-----------------------------------------------AIV------------------------------
Q823X9_CHLCV/128-153-----------------------------------------------RII------------------------------
PMP19_CHLPN/330-349-----------------------------------------------PVR------------------------------
PMP18_CHLPN/234-251-----------------------------------------------PIY------------------------------
Q7UWZ8_RHOBA/1032-1051-----------------------------------------------DSE------------------------------
Q7USQ0_RHOBA/2473-2491-----------------------------------------------EVV------------------------------
Q824E6_CHLCV/307-324-----------------------------------------------PIL------------------------------
PMP10_CHLPN/185-206-----------------------------------------------SIS------------------------------
PMPB_CHLTR/585-604-----------------------------------------------ETV------------------------------
Q7UZ67_RHOBA/504-522-----------------------------------------------NVT------------------------------
Q821X9_CHLCV/852-879-----------------------------------------------DVV------------------------------
PMPB_CHLTR/306-332-----------------------------------------------DVS------------------------------
PMP14_CHLPN/341-358-----------------------------------------------PIE------------------------------
PMPG_CHLTR/421-446-----------------------------------------------DII------------------------------
Q824E7_CHLCV/776-794-----------------------------------------------TTN------------------------------
PMPC_CHLMU/736-754-----------------------------------------------TAT------------------------------
PMP21_CHLPN/810-827-----------------------------------------------AVS------------------------------
Q822Q5_CHLCV/153-171-----------------------------------------------KII------------------------------
PMP16_CHLPN/264-290-----------------------------------------------SVI------------------------------
PMP13_CHLPN/253-270-----------------------------------------------GVL------------------------------
PMP19_CHLPN/140-166-----------------------------------------------DLS------------------------------
PMPH_CHLTR/270-306-----------------------------------------------GIF------------------------------
Q7USQ0_RHOBA/1065-1088-----------------------------------------------NTT------------------------------
PMPD_CHLMU/407-433-----------------------------------------------TVA------------------------------
PMPA_CHLTR/208-234-----------------------------------------------AII------------------------------
PMPD_CHLTR/324-349-----------------------------------------------ELV------------------------------
Q821X9_CHLCV/533-559-----------------------------------------------EVT------------------------------
PMP6_CHLPN/402-430-----------------------------------------------NLL------------------------------
PMPC_CHLMU/417-435-----------------------------------------------SLK------------------------------
PMPG_CHLTR/97-115-----------------------------------------------SLT------------------------------
PMPH_CHLTR/345-363-----------------------------------------------SVV------------------------------
Q7USQ0_RHOBA/1212-1229-----------------------------------------------GTL------------------------------
A0A0F7X457_CHLPN/360-404-----------------------------------------------DIV------------------------------
H2VFH2_CHLAB/190-208-----------------------------------------------NLV------------------------------
PMPB_CHLTR/286-304-----------------------------------------------EVL------------------------------
Q823Y2_CHLCV/125-161-----------------------------------------------NCT------------------------------
Q824E6_CHLCV/183-209-----------------------------------------------AIS------------------------------
Q823X6_CHLCV/240-274-----------------------------------------------RIT------------------------------
PMPB_CHLTR/130-148-----------------------------------------------SLT------------------------------
PMPF_CHLTR/209-238-----------------------------------------------GIL------------------------------
PMP12_CHLPN/81-108-----------------------------------------------NLF------------------------------
Q824E7_CHLCV/477-495-----------------------------------------------LTQ------------------------------
PMPB_CHLTR/513-531-----------------------------------------------KTL------------------------------
P71135_CHLAO/155-173-----------------------------------------------SIL------------------------------
A0A0F7XIJ9_CHLPN/305-326-----------------------------------------------GVL------------------------------
PMPD_CHLMU/387-405-----------------------------------------------PVV------------------------------
M4UH44_9XANT/193-210-----------------------------------------------KSS------------------------------
PMP7_CHLPN/246-268-----------------------------------------------QVI------------------------------
Q821X9_CHLCV/496-523-----------------------------------------------AVN------------------------------
Q823X9_CHLCV/191-212-----------------------------------------------SIH------------------------------
Q7UYI1_RHOBA/260-278-----------------------------------------------NSL------------------------------
Q823X1_CHLCV/153-171-----------------------------------------------SVL------------------------------
PMP14_CHLPN/212-230-----------------------------------------------TMS------------------------------
Q823X4_CHLCV/190-208-----------------------------------------------KVT------------------------------
PMPB_CHLMU/141-159-----------------------------------------------SLT------------------------------
Q7UYI1_RHOBA/367-385-----------------------------------------------DSR------------------------------
PMP10_CHLPN/217-235-----------------------------------------------PTL------------------------------
Q823X0_CHLCV/210-228-----------------------------------------------QML------------------------------
PMP18_CHLPN/298-316-----------------------------------------------IAA------------------------------
PMP1_CHLPN/92-112-----------------------------------------------GLY------------------------------
A0A0F7X457_CHLPN/326-347-----------------------------------------------GAL------------------------------
Q823X9_CHLCV/162-180-----------------------------------------------ETL------------------------------
A0A0F7X457_CHLPN/262-288-----------------------------------------------DLT------------------------------
PMP8_CHLPN/157-178-----------------------------------------------TIL------------------------------
Q823Y0_CHLCV/285-303-----------------------------------------------IIS------------------------------
PMPB_CHLMU/722-782-----------------------------------------------GLS------------------------------
PMP16_CHLPN/236-253-----------------------------------------------PIY------------------------------
PMP9_CHLPN/155-173-----------------------------------------------SCY------------------------------
Q7USQ0_RHOBA/2439-2464-----------------------------------------------GGS------------------------------
PMP21_CHLPN/914-942-----------------------------------------------DIL------------------------------

PF16318

R5CQ17_9BACT/88-243----------------------------------GQYTMS.......GDIDF.AS------------MNANL-----YTV
R5CCW6_9BACT/186-337----------------------------------GQYTMS.......GSVDF.GN------------KRVQL-----RTT
R5D267_9BACT/46-177----------------------------------GTYT.........GDINLPDG------------KTVTL-----KA.
E4RYT9_LEAB4/243-375----------------------------------GTYTS........GDITI..S------------KSISI-----KGA
Q8A8Z1_BACTN/189-338----------------------------------GEYTIS.......GPIDF.GA------------RKVTI-----RG.
R5CUG9_9BACT/252-392----------------------------------GTYTIAGENGGA.GNAQI..K------------KNITI-----KGI
A5FNJ9_FLAJ1/248-389----------------------------------GVYSTT.......GEIIV..N------------KTLIF-----RGV
R6WLV0_9BACT/178-330----------------------------------GEYTMS.......KSVDF.GN------------KQVTL-----RTT
Q8A8Y7_BACTN/184-327----------------------------------GVYEMD.......GNIDL.GT------------TTLTI-----RG.
W0F9F3_9SPHI/258-400----------------------------------ATYELP.......SALTF..S------------KSLGI-----MSG
R5CWT1_9BACT/177-332----------------------------------GLYTVS.......NILDF.GG------------NKIQL-----RCT
D5ETE2_PRER2/247-384----------------------------------GTYGIATDEAAFGGSVTV..S------------KNLTI-----KGL
R6DD72_9BACE/316-461----------------------------------ATYKLG.......TQTEI..P------------KALYI-----MGQ
R7CWS4_9BACE/178-324----------------------------------GHYTMS.......GETDF.GS------------HRITL-----RG.
R5C4L0_9BACE/248-386----------------------------------GTYTIPSEEGGV.GKLNI..S------------TSIEI-----KAV
R6E5N3_9BACE/182-333----------------------------------GNYTLS.......APIDF.GK------------QKVTF-----RG.
C6Y3U4_PEDHD/247-381----------------------------------GNFDFAG......ATIAV..T------------KSISV-----VAF
R5UTT0_9BACE/253-386----------------------------------GEYVLTA......AKLQI..N------------NNVVI-----AAK

PF03211

U4KZB8_PYROM/36-231-----------------------------------------------TTV------------------------------
N4URI8_COLOR/120-318-----------------------------------------------QTT------------------------------
G2YGI6_BOTF4/126-326-----------------------------------------------GDS------------------------------
M7SI60_EUTLA/18-215-----------------------------------------------TTT------------------------------
U5W5Z4_9ACTN/38-237-----------------------------------------------ATA------------------------------
G2YHG4_BOTF4/24-226-----------------------------------------------TGG------------------------------
K1XD07_MARBU/185-384-----------------------------------------------.GG------------------------------
M5BPL9_THACB/50-249-----------------------------------------------TCT------------------------------
C7YTS6_NECH7/7-209-----------------------------------------------TGG------------------------------
M7SJD8_EUTLA/23-220-----------------------------------------------EGG------------------------------
T0M282_COLGC/23-218-----------------------------------------------...------------------------------
N4VGC5_COLOR/253-453-----------------------------------------------VGD------------------------------
M5BUQ1_THACB/42-237-----------------------------------------------..T------------------------------
G4N3X4_MAGO7/18-215-----------------------------------------------TTT------------------------------
B5I637_9ACTN/39-241-----------------------------------------------.AT------------------------------
G2XEV0_VERDV/54-253-----------------------------------------------NTV------------------------------
G2QG74_THIHA/26-225-----------------------------------------------TTT------------------------------
Q829M8_STRAW/47-250-----------------------------------------------ATS------------------------------
A8NTC3_COPC7/28-228-----------------------------------------------TNV------------------------------
C6WMH9_ACTMD/38-241-----------------------------------------------.SS------------------------------
G8S809_ACTS5/262-462-----------------------------------------------STT------------------------------
F9X162_ZYMTI/31-229-----------------------------------------------GGG------------------------------
G0S9D6_CHATD/128-328-----------------------------------------------TTA------------------------------
I1RLQ0_GIBZE/23-220-----------------------------------------------TGG------------------------------
V2XPM5_MONRO/28-226-----------------------------------------------.NV------------------------------
K2RXU6_MACPH/35-230-----------------------------------------------TNV------------------------------
L2FCH6_COLGN/26-225-----------------------------------------------.DA------------------------------
N4V6F8_COLOR/112-311-----------------------------------------------TTT------------------------------
E3EDF5_PAEPS/30-221-----------------------------------------------...------------------------------
S8AHU9_DACHA/114-312-----------------------------------------------..N------------------------------
C7ZI42_NECH7/20-217-----------------------------------------------TKT------------------------------
H3GY48_PHYRM/27-237-----------------------------------------------..T------------------------------
U4LBE6_PYROM/18-216-----------------------------------------------TTT------------------------------
Q6D881_PECAS/102-322-----------------------------------------------SNA------------------------------
Q7C4I5_PSESM/215-419-----------------------------------------------AGS------------------------------
N4VEF5_COLOR/166-363-----------------------------------------------TKT------------------------------
K2RMN8_MACPH/74-272-----------------------------------------------AAG------------------------------
Q2H8P5_CHAGB/58-258-----------------------------------------------TTT------------------------------
PLYF_ASPTN/22-224-----------------------------------------------EGG------------------------------
PLYC_BACSU/18-214-----------------------------------------------SQF------------------------------
PLYE_ASPFN/39-234-----------------------------------------------...------------------------------
C7YXY0_NECH7/23-222-----------------------------------------------TGG------------------------------
PLYG_ASPTN/27-222-----------------------------------------------...------------------------------
B3PKE5_CELJU/106-320-----------------------------------------------SST------------------------------
T0K0R1_COLGC/25-223-----------------------------------------------EGG------------------------------
F2R0Z1_STRVP/47-250-----------------------------------------------LPA------------------------------
H3H676_PHYRM/399-600-----------------------------------------------..T------------------------------
D8PQN8_SCHCM/23-225-----------------------------------------------NKG------------------------------
PLYD_ASPFU/22-218-----------------------------------------------...------------------------------
C9SJ36_VERA1/19-214-----------------------------------------------TTT------------------------------
M5C0K5_THACB/40-238-----------------------------------------------SCS------------------------------
N1RGU5_FUSC4/156-353-----------------------------------------------TRT------------------------------
Q2HHN7_CHAGB/24-222-----------------------------------------------QTQ------------------------------
I0HH67_ACTM4/194-394-----------------------------------------------TTP------------------------------
N1QBX5_PSEFD/2-198-----------------------------------------------...------------------------------
I0H512_ACTM4/182-378-----------------------------------------------..A------------------------------
C6WMH1_ACTMD/31-234-----------------------------------------------GST------------------------------
PLYD_EMENI/42-239-----------------------------------------------...------------------------------
Q7S4B7_NEUCR/27-227-----------------------------------------------QTT------------------------------
G4TNX7_PIRID/34-234-----------------------------------------------SSN------------------------------
I0GXB6_ACTM4/290-490-----------------------------------------------TAA------------------------------
K2RTS7_MACPH/22-219-----------------------------------------------..T------------------------------
K2SGW5_MACPH/29-225-----------------------------------------------TLP------------------------------
M5BX85_THACB/52-251-----------------------------------------------SCT------------------------------
G1WXZ0_ARTOA/97-294-----------------------------------------------TTV------------------------------
E3Q1Z9_COLGM/95-295-----------------------------------------------GGG------------------------------
F2JTB7_MARM1/279-472-----------------------------------------------TTM------------------------------
B2APR3_PODAN/24-223-----------------------------------------------RST------------------------------
M5BPI1_THACB/35-233-----------------------------------------------..P------------------------------
D8QKC3_SCHCM/33-233-----------------------------------------------SAT------------------------------
H6NS60_9BACL/19-215-----------------------------------------------VFA------------------------------
D6X7B4_STRPR/40-243-----------------------------------------------ATA------------------------------
D7CEB6_STRBB/44-244-----------------------------------------------..T------------------------------
C7YZY2_NECH7/19-218-----------------------------------------------TTV------------------------------
K2RAB2_MACPH/20-220-----------------------------------------------SLP------------------------------
K1WSP2_MARBU/22-217-----------------------------------------------KLS------------------------------
M3CJL1_SPHMS/22-219-----------------------------------------------..A------------------------------
C9SY14_VERA1/23-220-----------------------------------------------EGG------------------------------
C9S8R7_VERA1/23-222-----------------------------------------------SGG------------------------------
M5BYG9_THACB/44-239-----------------------------------------------...------------------------------
S8CBN6_DACHA/113-310-----------------------------------------------TKS------------------------------
E0SM75_DICD3/100-319-----------------------------------------------SNA------------------------------
C7ZNK4_NECH7/23-222-----------------------------------------------EGG------------------------------
G2XBC9_VERDV/24-222-----------------------------------------------TGG------------------------------
C7ZB71_NECH7/24-221-----------------------------------------------KNS------------------------------
A8L1K4_FRASN/141-339-----------------------------------------------..S------------------------------
PLYC_BACLD/19-214-----------------------------------------------GQA------------------------------

PF14592

F0S763_PSESL/26-457----------------------------------VASV---------KEVYSKVD------------QLKAG-----DTL
G0L7T1_ZOBGA/39-464----------------------------------VKNS---------TELNEAID------------QANPG-----DEI
CSLB_PEDHD/28-451----------------------------------VASN---------ETLYQVVK------------EVKPG-----GLV
A2TXR8_9FLAO/26-451----------------------------------VSSN---------SELEEALS------------NAKKG-----DNI
A0M0H6_GRAFK/28-451----------------------------------VTNI---------SEFNSAVE------------KAGPG-----DVI
A3UA26_CROAH/32-454----------------------------------VTNT---------KELTQAIK------------DCVAG-----DEI
L7W9A4_NONDD/2-423----------------------------------VSNI---------NELQEAIT------------NSEPG-----DVI
F4AY36_DOKS4/8-431----------------------------------VTTP---------DELKEAIE------------DAEPG-----DVI
T2KLV7_9FLAO/30-455----------------------------------VNNA---------KELDQAIK------------AAKPG-----DHL
E6XAU2_CELAD/28-451----------------------------------VSTQ---------AELQEAIF------------NAKAG-----SEI

PF05048

A0B5Z3_METTP/119-363-----------------------MDCQVSGNR...............YGIVLSFA............EGCTL....ENIL
A0B8G3_METTP/432-668-----------------------EGNIIRQGS...............SGVLVEAS............DGFAA.....VDN
A0B9A8_METTP/209-441-----------------------ISTEMIDCEK..............AGLNASNS............RAFTV....TGCR
A0M187_GRAFK/155-382-----------------------FNNTIIGDAKEEFS........SGNGIQLWYC............QNVEV.....AGN
A3Q9S9_SHELP/163-403-----------------------KDNQIEGEAEAFLLD.......RGDGIHLLKV............NYPHV.....SGN
A3QIG9_SHELP/167-406-----------------------HHNRIQGNPGLRSAD.......RGNGIQLSIV............QNVEV.....SDN
A4CHB0_ROBBH/128-355-----------------------RGNQISGDAVDEYN........SGNGIQLWYS............NNVEV.....SEN
A6Q5Y3_NITSB/155-390-----------------------IGNYITSKPFPLGI........RGDGIRLWYS............NDNIL.....QDN
A6QCA8_SULNB/133-366-----------------------NDNYIESKPFDLGI........RGDGIRLWYS............NDNHL.....SGN
B9LN19_HALLT/206-436-----------------------ADSRIEGTQAPRFAN.......RGNGINLWET............NGTEV.....RNT
O28859_ARCFU/803-1050-----------------------KNLGLSSNS...............HGIILYNT............SHSAI.......E
Q0A9R0_ALKEH/149-394-----------------------IANRISGDTRMRSAE.......RGDGIRMFRL............TDSVI.....IAN
Q0W3C2_METAR/236-481-----------------------SDNLMQLNGGTVARDGGAHVYRLGDGVQLKNT............RDSVV.....KDN
Q0W3C3_METAR/195-446-----------------------SDNTMKQNGGTITRQPGNRVYRLGDGVQLYET............RDNVV.....KNN
Q0W3M9_METAR/204-442-----------------------FNISITNCT...............TGIISEFS............HDSRI.....TGC
Q12VI3_METBU/415-643-----------------------TKNNVSDNS...............GGIHLTSGGA.......SRGSNLLI.....QNT
Q16A16_ROSDO/136-364-----------------------ARNVIEGRQGHRMNQ.......RGNGIYVWNA............PGTVI.....EGN
Q21TJ4_RHOFT/155-381-----------------------IGNRITGKRDHASAQ.......RGNGIQLYNT............TGAQI.....IGN
Q2FLC7_METHJ/579-839-----------------------INTAPPGSAILVRYGYYPEKLTINKPITLIGESS........SDGQKPIIDAQFTGT
Q2FLS3_METHJ/168-426-----------------------FNTVEDTGDVCIFS........YG....................DNSSL.....YHN
Q2FM56_METHJ/94-353-----------------------FGGSITNVTIKNLKLEDWNNGVSYQYVKGKEG............DTNVI.....SNL
Q2FPE3_METHJ/417-660-----------------------CNNLHAERNLV.............SGYYISNT............NNFTL.....TSI
Q2FQK2_METHJ/621-869-----------------------EDNQITKNL...............YGIVLDGS............SLSMV....NKNL
Q2FSR9_METHJ/59-324-----------------------VGVIITSSSVILD..........G....................QGYQV.....RPA
Q3SJ26_THIDA/142-368-----------------------ENNLITGKRDYRSPQ.......RGNGIQLYNT............TGARI.....IGN
Q47FR5_DECAR/172-407-----------------------RGNSIRSKDRELGV........RGDGLRLWYS............NDNTI.....EKN
Q47UZ5_COLP3/153-392-----------------------SHNRVKGNLTLRSAD.......RGNGIQVANV............TNSHV.....FLN
Q5LLH6_RUEPO/140-368-----------------------KGNRIEGRQDRRMNA.......RGNGVYVWNA............PGAVV.....EGN
Q5V4X0_HALMA/184-414-----------------------QNNTIVGREEITQLT......RRGNGIQIWKT............EDSVI.....RNN
Q6LJ10_PHOPR/142-381-----------------------EGNEIEGNTKLRSAD.......RGNGIQLSKV............EYVEV.....IGN
Q6M0J5_METMP/167-417-----------------------SENLVYENGVIGIV.........TSGIFLDGS...........EFNNIT.....KNT
Q7MRZ6_WOLSU/132-365-----------------------SRNHITSKPFDLGL........RGDAIRLWYS............HDNTI.....SEN
Q8TI41_METAC/43-307-----------------------LHATSVGDEVFVYNGT.....YNN....................ESNDIVQFYKSNT
Q8TJK2_METAC/50-308-----------------------VNAASPGDTVYVY...........EGLYIENIYLDKEISVRSISGIPDM.....INI
Q8TJW3_METAC/46-306-----------------------VNGASTGDLIVVKPGVYHETVDITVLELVFKG............EGMPEVDGFKEDI
Q8TLA5_METAC/47-287-----------------------LDNAVDGDTIIVRPGNYNEDLAVDVSVTLNGS............SGYPT.....VGK
Q8TLD5_METAC/175-426-----------------------SNNTVSSNSD..............TGIYLDNS............ASNVL.....SNN
Q8TLD5_METAC/552-811-----------------------LNNSMSSNTYNFK..........DSGTLQNEIDTG......NTVEGKPVYYLCEKSD
Q8TLY6_METAC/248-494-----------------------SINNASQNS...............KGIYLQSS...........ASENTL.....SGN
Q8TLY7_METAC/376-620-----------------------LNNNAVKNR...............YGAYLLRS............GWNVL.....SNN
Q8TN36_METAC/103-334-----------------------NSNSVTIDGFYILGYQSG.TDGSEAGIHLEGV............QDCSL.....SNN
Q8TPF2_METAC/96-327-----------------------NSSNVTIDGFFISGVSSG.GDKYEVGIYLEGV............ENCSL.....SNN
Q8TPZ7_METAC/43-292-----------------------VNSASSGDTIYVYAGTYNEFAVPIPYLTIKGE............GPDLV.....TVN
Q8TQ14_METAC/197-463-----------------------LNGSIGVTEG..................................PGCEI.....LGN
Q8TQM3_METAC/233-470-----------------------SENNFSRDGIWFD...........EGCNKNMV............INNSI.....DRG
Q8TSE8_METAC/43-302-----------------------VNSASSGDTIFVYSGTYSGFYVNIPYLSIIGE............GADVV.....TVG
Q8TT51_METAC/53-286-----------------------VDAANDGDTIFVS...........QGTYN...............ENLKINKQVRIWS
Q8TTT9_METAC/43-302-----------------------VDNASSGDVITIQ...........AGTYTENLKIYTDSLTIRSESGD.......PDD
Q9K0L5_NEIMB/44-271-----------------------RENKIVGDATLRVNE.......RGNGVTVWNA............PGAQV.....VGN
B2UHW3_RALPJ/148-378-----------------------.ANTITGKRDYNSAQ.......RGNGVELYNT............QGARI.....IGN
M1FI95_9ALTE/142-381-----------------------.GNVIRGDASMRSND.......RGNGIHLFNT............QGALI.....ESN
Q63UJ4_BURPS/145-366-----------------------.GNVIVGKRDLLSPR.......RGNGIQLYNT............TGARI.....AGN
NOSD_PSEAE/144-383-----------------------.DNRIEGDESVRSQD.......RGNGIHLYAV............KDALV.....RGN

PF08480

Q8TLE9_METAC/305-493---------------------------------------------MNDIE------------------------------
Q8TNA9_METAC/274-466---------------------------------------------MDDIE------------------------------
Q8THR8_METAC/274-457---------------------------------------------MNDIE------------------------------
Q8TKN2_METAC/356-545---------------------------------------------MNDIE------------------------------
Q8TNF1_METAC/197-388---------------------------------------------MDDIE------------------------------
Q8TRX3_METAC/275-470---------------------------------------------MDDIE------------------------------

PF07602

Q8F2E8_LEPIN/52-316--------------------------------------------------------------------------------
Q7NNK7_GLOVI/49-321--------------------------------------------------------------------------------
Q8YX73_NOSS1/82-347--------------------------------------------------------------------------------
Q8F8Y2_LEPIN/64-326--------------------------------------------------------------------------------
Q8F1R3_LEPIN/65-310--------------------------------------------------------------------------------
Q8YWJ6_NOSS1/15-284--------------------------------------------------------------------------------
Q8F0U7_LEPIN/64-323--------------------------------------------------------------------------------

PF00544

PLY1_PECAS/71-278-----------------------------------------------FPL------------------------------
E0SAZ3_DICD3/83-313-----------------------------------------------DPK------------------------------
E0SJQ6_DICD3/72-279-----------------------------------------------YPL------------------------------
PLYA_DICD3/85-318-----------------------------------------------.AK------------------------------
Q6D727_PECAS/47-241-----------------------------------------------TIV------------------------------

PF00295

PGLR1_MAIZE/68-409-----------------------CGGTGKQTILIPK.GDFLVGQ---LNFTG..PCKGDVTIQVDGNLLAT.........
PGLR_YEAST/43-361-----------------------CSSIVIKDLTVPA..GQTLDL---TGLS......SGTTVTFEGTTTFQ.........
PGLR_SOLLC/103-443-----------------------CSSRTPVQFVVPKNKNYLLKQ---ITFSG..PCRSSISVKIFGSLEAS.........
PGLR1_ASPNC/50-368-----------------------CSDVVLSSIEVPA..GETLDL---SDAA......DGSTITFEGTTSFG.........
PGLRB_ASPFN/46-363-----------------------CSTITLSNIEVPA..GETLDL---TGLN......DGTTVIFSGETTFG.........
G3XYE5_ASPNA/45-362-----------------------CSTITLNNIEVPA..GTTLDL---TGLT......SGTKVIFEGTTTFQ.........
M2QZD9_COCSN/45-364-----------------------CTDIVISGMTVPA..GTTLDL---TGLK......SGTTVTFQGTTTFG.........
M4FG11_BRARP/47-378-----------------------CQAPAPSQVLIPK.GDFKLGE---TVMTG..PCKSPIEFTLQGNVKAD.........
PGLR1_ASPOR/52-367-----------------------...IVLKNIAVPA..GETLDL---SKAK......DGATITFEGTTTFG.........
Q6D880_PECAS/62-401-----------------------CGQGKAVRLSAGSSSVFLSGP---LSLPSGASLLIDKGVTLRAINNAKSFENSPSSC
S0EGK1_GIBF5/43-372-----------------------CTNIVLAGFQVPT..GKQLDL---SKLK......AGTTVTFEGKTTFA.........

PF01696

Q9W859_ADEP3/86-474-----------------------------------------------GGAGGEGS........GEEAGGSSM--------
E1BL_ADECT/56-441-----------------------------------------------DPLYVMQA....LQRDHTLEMPRGQ--------
Q64892_ADEM1/37-434-----------------------------------------------SGARELSL....RVNEEVTEPPYNS--------
Q3ZKW1_9ADEN/107-489-----------------------------------------------SGNNSRTE....LALSLMSRRRPET--------
Q5GFC6_ADE04/98-480-----------------------------------------------DETNHRIE....LTVGLMSRKRPET--------
Q9EEG1_ADEB2/14-388-----------------------------------------------SGASVRVQRGFHLPFARGNGLEPNK--------
Q64844_ADEB3/35-420-----------------------------------------------GDSPPRAS....LEEAEQSSTRFEH--------
A0MK44_9ADEN/90-471-----------------------------------------------EPRNFLNE....LTVSLMNRQRPET--------
E1BL_ADET1/2-390-----------------------------------------------AQNNSDGV....EGASPAKRRRLDQ--------
E1BL_ADE12/96-479-----------------------------------------------KEAAVLSR....LTVNLMSRPRLET--------
E1U5L8_ADE06/110-492-----------------------------------------------EATEEARN....LTFSLMTRHRPEC--------
Q695T4_9ADEN/122-506-----------------------------------------------ESSTFLAD....VTVALMAKNRLEV--------
E1BL_ADE40/96-475-----------------------------------------------EGEDFLKE....LTLSLMSRRHHES--------
Q9YL98_ADE09/110-492-----------------------------------------------GNTGMMTE....LTASLMNRKRPER--------
Q83459_ADEP4/28-410-----------------------------------------------SLRVIEDE....LGEMERLGRQSQR--------

PF12541

D6DHZ7_CLOSC/2-271-----------------------------------------------KTIENKT--------------------------
R5PWU1_9BURK/2-278-----------------------------------------------QILQNVE--------------------------
A5VMS3_LACRD/2-277-----------------------------------------------EEIKEAY--------------------------
R5L1C9_9CLOT/2-273-----------------------------------------------KTFENEQ--------------------------
R5GK22_9BACT/2-278-----------------------------------------------ETIKNTE--------------------------
R6F061_9BACT/2-278-----------------------------------------------EKISNKV--------------------------
Q6LZ36_METMP/37-311-----------------------------------------------..YNELN--------------------------
R5A3D5_9CLOT/2-271-----------------------------------------------ETIQNKT--------------------------
R5VXN8_9DELT/3-274-----------------------------------------------K.IQNKK--------------------------
R7EP62_9FIRM/5-279-----------------------------------------------KVIKAEF--------------------------
R6VTW4_9BACT/2-278-----------------------------------------------NLIKDKE--------------------------
Q8A7X5_BACTN/2-278-----------------------------------------------KQIKNTH--------------------------
R7HQ78_9BACT/2-277-----------------------------------------------ELIKDKE--------------------------
D7DSW7_METV3/56-328-----------------------------------------------KTYDNLK--------------------------
R6G7J9_9FIRM/8-282-----------------------------------------------KEIHQEF--------------------------
R7DGS5_9PORP/2-278-----------------------------------------------KTISNAE--------------------------
R7R6X9_9FIRM/2-276-----------------------------------------------EEITRGY--------------------------
Q5FL14_LACAC/3-277-----------------------------------------------E.YKNNY--------------------------
R6JX58_9FIRM/7-281-----------------------------------------------EKISNKY--------------------------
R5YM64_9FIRM/4-278-----------------------------------------------KVIQQEY--------------------------
R5R5M3_9FIRM/2-276-----------------------------------------------EIIKQKY--------------------------
A7ZFS8_CAMC1/2-276-----------------------------------------------QERNAEI--------------------------
R6XGP3_9FIRM/2-276-----------------------------------------------DIIKNKV--------------------------
R7BSW2_9FIRM/8-275-----------------------------------------------..VENKT--------------------------
R6N8F1_9CLOT/2-271-----------------------------------------------AVIENQT--------------------------
R6CNQ1_9BACT/2-275-----------------------------------------------ELIKNKS--------------------------
M1MK35_9CLOT/2-276-----------------------------------------------KIIEQEL--------------------------
A2DNE3_TRIVA/4-279-----------------------------------------------.TVEGKT--------------------------
R6E1V7_9BACE/2-278-----------------------------------------------EKIIGQE--------------------------
R5G5K3_9FIRM/6-274-----------------------------------------------..VKDIT--------------------------
R5YBV7_9BACE/2-278-----------------------------------------------EQIKNTE--------------------------
R6X1F7_9BACT/2-278-----------------------------------------------EKIINQE--------------------------
C4Z7J5_EUBE2/13-287-----------------------------------------------KLVKQQL--------------------------
A6LAN5_PARD8/2-278-----------------------------------------------QQIKDME--------------------------
E6UH73_RUMA7/2-277-----------------------------------------------NSIENKT--------------------------
J9VZH1_LACBU/2-277-----------------------------------------------KQYTNQY--------------------------
A2DXQ6_TRIVA/15-290-----------------------------------------------.IIDGKT--------------------------
R7J179_9BACT/4-280-----------------------------------------------TKIENKE--------------------------
R7IJ73_9BURK/2-278-----------------------------------------------QLITNQT--------------------------
R5UHT9_9FIRM/12-285-----------------------------------------------.VLRQQK--------------------------
R7C9P6_9CLOT/2-276-----------------------------------------------KEIRQQF--------------------------
R7FLD7_9CLOT/4-277-----------------------------------------------.KVIQEL--------------------------
R5GYL3_9FIRM/5-279-----------------------------------------------KELRQEY--------------------------
R5PEP4_9BACT/2-278-----------------------------------------------ETIKDRS--------------------------
F9URY5_LACPL/2-277-----------------------------------------------KTITQQY--------------------------
R5KIW2_9BACT/2-278-----------------------------------------------KLIANTE--------------------------
D6S309_9LACO/2-277-----------------------------------------------KLIKEAY--------------------------
R7ADB3_9FIRM/2-270-----------------------------------------------.KIENKS--------------------------
C4ZDA1_EUBR3/5-279-----------------------------------------------KQIHQEF--------------------------
B2UN04_AKKM8/4-280-----------------------------------------------RMIKNAS--------------------------
R7BJD2_9FIRM/4-275-----------------------------------------------...IQQT--------------------------
R5ZSK8_9CLOT/2-276-----------------------------------------------EVINNRI--------------------------
R5P9J9_9CLOT/3-277-----------------------------------------------KQIRQTY--------------------------
R7K3P1_9CLOT/2-276-----------------------------------------------QVIREER--------------------------
R7A2C4_9FIRM/3-270-----------------------------------------------..IENQT--------------------------
R5EWD8_9GAMM/2-279-----------------------------------------------NIIKDKE--------------------------
R6UKR3_9STAP/2-276-----------------------------------------------NNINNLI--------------------------
R5QNY5_9PROT/3-277-----------------------------------------------..YENLF--------------------------
R6WGE2_9FIRM/2-277-----------------------------------------------QTINGKN--------------------------
R6DEH5_9CLOT/2-276-----------------------------------------------KKYTEQR--------------------------
Q74K41_LACJO/2-277-----------------------------------------------QEIKEKY--------------------------
R7GEC7_9CLOT/2-271-----------------------------------------------NRINNQA--------------------------
C4LFU5_TOLAT/2-277-----------------------------------------------NIIKNTF--------------------------
R5QQP9_9FIRM/2-277-----------------------------------------------ELVKQAY--------------------------
R5V321_9FIRM/3-274-----------------------------------------------QKIENQI--------------------------
Q03TK5_LACBA/3-278-----------------------------------------------TEINQQT--------------------------
R5G0S8_9ACTN/11-287-----------------------------------------------QVIENQT--------------------------
R5R960_9FIRM/2-274-----------------------------------------------KKIENGT--------------------------
B8DUR7_BIFA0/2-277-----------------------------------------------QAITQQL--------------------------
R7HU56_9CLOT/5-279-----------------------------------------------ETITQEL--------------------------
L0J7T7_PREDD/11-287-----------------------------------------------EIIKDKK--------------------------
D5HFQ7_9FIRM/8-282-----------------------------------------------KIIRQEF--------------------------
R6XZ15_9FIRM/2-276-----------------------------------------------KKLEQGL--------------------------
D4IWA9_BUTFI/2-277-----------------------------------------------KEYRQQF--------------------------
T0T8D2_9STRE/2-277-----------------------------------------------KIINQEL--------------------------
R7FNU4_9CLOT/2-276-----------------------------------------------EKIKNLT--------------------------
R6BWW4_9CLOT/5-279-----------------------------------------------KEVSRAF--------------------------
R7H8Z4_9FIRM/5-279-----------------------------------------------RQINQEY--------------------------
R5QFI9_9FIRM/2-276-----------------------------------------------NQYTQQK--------------------------
R6CSF1_9CLOT/4-277-----------------------------------------------.KIIGQT--------------------------
R6TW54_9FIRM/2-276-----------------------------------------------KEIKRQN--------------------------
R7N4D9_9FIRM/2-276-----------------------------------------------EEMKQQF--------------------------
R7DLF6_9FIRM/2-277-----------------------------------------------EHVKGGL--------------------------
R7IW89_9FIRM/9-282-----------------------------------------------.RISRGH--------------------------
I0GVU7_SELRL/2-272-----------------------------------------------EEYREQT--------------------------
R5N9S7_9BACT/2-278-----------------------------------------------QLIKDME--------------------------
D5EVR1_PRER2/2-278-----------------------------------------------ELIRGKE--------------------------
A1A134_BIFAA/22-296-----------------------------------------------SETRQAF--------------------------

PF09251

Q8SCG9_BPSP6/3-550-----------------------LTKPRCFRKASYLSQLGTLQNLANTGDDVLVIDVDYKFTNGETVDFKGRLVRIECEA
FIBER_BPP22/116-665-----------------------IEADKKFKYSVKLSDYPTLQDAASAAVDGLLIDRDYNFYGGETVDFGGKVLTIECKA

PF03212

YPJA_ECOLI/1057-1180--------------------------------------------------------------------------------
YEJO_ECOLI/430-556--------------------------------------------------------------------------------
J7RCG5_BORP1/480-606--------------------------------------------------------------------------------
O86044_BORPT/332-450--------------------------------------------------------------------------------
BRKA_BORPE/583-704--------------------------------------------------------------------------------
PERT_BORPA/444-564--------------------------------------------------------------------------------
TIBA_ECOH1/506-627--------------------------------------------------------------------------------
YCGV_ECOLI/494-616--------------------------------------------------------------------------------

PF12218

ENAN_BPK1E/39-102--------------------------------------------------AKG----D--GK------------------
Q858B1_BPK1F/246-312--------------------------------------------------AKG----D--GV------------------
A5VW57_9CAUD/146-212--------------------------------------------------AIG----D--GV------------------
O80102_9VIRU/167-233--------------------------------------------------AVG----D--GV------------------

PF12708

B9DJC5_STACT/126-337H-------------------------------------------------PDK----T..GK------------------
Q7URR5_RHOBA/63-307G-------------------------------------------------LSA----D..SD------------------
C6Y0W6_PEDHD/63-325G-------------------------------------------------AKP----D..DD------------------
Q09C01_STIAD/75-328Y-------------------------------------------------ANN----T..GG------------------
Q87XU1_PSESM/2-255G-------------------------------------------------ALG----D..GV------------------
B6IU75_RHOCS/4-239G-------------------------------------------------ARG----D..GR------------------
B6IPQ6_RHOCS/4-238G-------------------------------------------------ARG----D..GR------------------
Q9K7M8_BACHD/30-252G-------------------------------------------------ATP----G..IA------------------
C7Q7K8_CATAD/223-454G-------------------------------------------------ADP----T..GA------------------
B3VMP8_BPPH2/104-333G-------------------------------------------------AKG----D..GV------------------
C4L0K4_EXISA/96-329G-------------------------------------------------AVG----D..GQ------------------
Q184L0_PEPD6/13-220G-------------------------------------------------ICN----D..ET------------------
Q184L1_PEPD6/12-216G-------------------------------------------------IKN----D..GS------------------
Q184L3_PEPD6/10-203N-------------------------------------------------SKI----DITGK------------------
B8GG97_METPE/553-766G-------------------------------------------------LKG----D..GV------------------
B8GGB4_METPE/99-337G-------------------------------------------------LKG----D..GV------------------
B6H126_PENCW/211-429S-------------------------------------------------VVN----D..GS------------------
Q4WIW4_ASPFU/77-298G-------------------------------------------------ADN----T..GA------------------
B8MQM9_TALSN/123-346G-------------------------------------------------ADN----T..GA------------------
Q5B3M8_EMENI/219-441G-------------------------------------------------ADN----T..GQ------------------
B8NUX0_ASPFN/88-302K-------------------------------------------------ADN----T..GN------------------
A2QF38_ASPNC/247-469G-------------------------------------------------ADN----T..GK------------------
A9V1W5_MONBE/50-262G-------------------------------------------------AAG----D..GV------------------
B2ANL4_PODAN/41-256G-------------------------------------------------AKG----D..GV------------------
Q7S3S0_NEUCR/218-448G-------------------------------------------------AVG----D..GI------------------
Q5B3Q5_EMENI/170-388H-------------------------------------------------ADP----T..GA------------------
Q5ATA0_EMENI/247-460G-------------------------------------------------AKG----D..GV------------------
A2RBJ4_ASPNC/164-404G-------------------------------------------------AKG----D..GI------------------
C5FIT8_ARTOC/207-432G-------------------------------------------------AKG----D..GV------------------
B6QWE5_PENMQ/71-313G-------------------------------------------------AVG----D..GV------------------
Q7S602_NEUCR/168-396G-------------------------------------------------ARG----D..GI------------------
B2AQ98_PODAN/93-316G-------------------------------------------------AVG----D..GI------------------
Q2GRE2_CHAGB/224-446G-------------------------------------------------AKG----D..GV------------------
Q0CRX2_ASPTN/83-312G-------------------------------------------------AVG----D..GV------------------
Q2H3L6_CHAGB/41-260G-------------------------------------------------AKG----D..GA------------------
Q7SGI7_NEUCR/41-267G-------------------------------------------------AKG----D..GV------------------
Q0UIW6_PHANO/70-284G-------------------------------------------------AKG----.....------------------
A8NNP9_COPC7/68-294G-------------------------------------------------AVG----D..GI------------------
B2WKN5_PYRTR/68-291G-------------------------------------------------AKG----D..GV------------------
C4JXY6_UNCRE/64-288G-------------------------------------------------AKG----D..GS------------------
C1H3L4_PARBA/65-289G-------------------------------------------------AKG----D..GV------------------
Q7S324_NEUCR/222-446G-------------------------------------------------AKG----D..GS------------------
B2AVA4_PODAN/55-279G-------------------------------------------------AKG----D..GA------------------
Q7S6I5_NEUCR/41-263G-------------------------------------------------AKG----D..GV------------------
B2AQV4_PODAN/41-263G-------------------------------------------------ARG----D..GI------------------
B6QD92_PENMQ/79-303G-------------------------------------------------AAG----D..GV------------------
B6QUF4_PENMQ/72-296G-------------------------------------------------AVG----D..GV------------------
Q4WLX5_ASPFU/93-315G-------------------------------------------------AKG----D..GI------------------
B2W2R6_PYRTR/89-320G-------------------------------------------------AVG----D..GV------------------
A7EWZ9_SCLS1/45-272G-------------------------------------------------ATG----N..GV------------------
A7EV58_SCLS1/85-323G-------------------------------------------------AKG----D..GV------------------

PF01095

PME13_ARATH/301-598----------------------------------------------------G----S--GD------------------
PME42_ARATH/215-510----------------------------------------------------G----T--GK------------------
PME23_ARATH/257-554----------------------------------------------------G----T--GQ------------------
PME44_ARATH/212-509----------------------------------------------------G----T--GN------------------
PME16_ARATH/213-502----------------------------------------------------G----S--GT------------------
PME24_ARATH/255-548----------------------------------------------------G----S--GK------------------
PME51_ARATH/240-544----------------------------------------------------G----K--CG------------------
PME61_ARATH/273-571----------------------------------------------------G----S--GT------------------
PMEU1_SOLLC/272-570----------------------------------------------------G----S--GD------------------
PME2_ARATH/276-573----------------------------------------------------G----S--GD------------------
PME35_ARATH/228-514----------------------------------------------------G----S--GT------------------
PME21_ARATH/255-552----------------------------------------------------G----S--GQ------------------
PME47_ARATH/307-606----------------------------------------------------E----T--DN------------------
PME12_ARATH/237-533----------------------------------------------------G----T--GN------------------
PME26_ARATH/660-954----------------------------------------------------G----S--GD------------------
PME17_ARATH/206-499----------------------------------------------------G----S--GN------------------
PME43_ARATH/391-688----------------------------------------------------G----S--GK------------------
PME1_SOLLC/233-531----------------------------------------------------G----T--GD------------------
PME58_ARATH/259-556----------------------------------------------------G----S--GQ------------------
PME46_ARATH/257-550----------------------------------------------------G----S--GK------------------
PME34_ARATH/284-583----------------------------------------------------G----N--GT------------------
PME22_ARATH/240-525----------------------------------------------------G----K--GK------------------
PME32_ARATH/214-511----------------------------------------------------G----T--GN------------------
Q9S767_ORYSJ/304-592----------------------------------------------------G----S--GR------------------
B4FCY2_MAIZE/251-546----------------------------------------------------G----S--GQ------------------
B9IKC0_POPTR/283-579----------------------------------------------------G----S--GD------------------
K7KZN7_SOYBN/877-1170----------------------------------------------------G----S--GQ------------------
U5GQ29_POPTR/312-608----------------------------------------------------G----S--GN------------------

PF03718

IPUA_ASPNG/7-563S...................DQLQYTQGYNQTQAWTSFLYSHDATVKIS.RNG----SSANS------------------
DEXT_PENMI/26-608GRIYAPTDPPNSNTLDSSVDDGISIEPSIGLNMAWSQFEYSHDVDVKILATDG----SSLGS------------------
P77813_ARTGO/20-620GKI............GYTEPDGAEFSSSANLSMSWSSFEYSTAVWVDVKLTTG----QTITS------------------
DEXT_ARTSD/41-636GKI............GYTEEDGAEFSSDARLTMSWSSFEYAKDVWVEVSLRTG----QTISS------------------

PF07971

R6CE95_9BACE/252-740N-------------------------------------------------LKV....EV..P..........D.......
Q8A6K3_BACTN/246-733N-------------------------------------------------LQA....EI..P..........D.......
C6XXW8_PEDHD/284-772N-------------------------------------------------MKA....EA..R..........G.......
B8LV53_TALSN/266-771N-------------------------------------------------AEK....EI..P.........DF.......
W5WJ40_9PSEU/298-772N-------------------------------------------------LKS....EN..S..........T.......
A4VXP8_STRSY/216-705L-------------------------------------------------LKD....VP.............D.......
F8EET3_RUNSL/240-740N-------------------------------------------------LSR....EL..G..........N.......
K4L2L4_SIMAS/261-762N-------------------------------------------------LKV....EQ..Q..........G.......
R6VKF5_9BACT/153-626N-------------------------------------------------LCS....EI..G..........D.......
Q8A5N9_BACTN/240-739N-------------------------------------------------FNR....EV..A..........D.......
A6KYE2_BACV8/400-910N-------------------------------------------------LET....EC..N..........H.......
F4CBM4_SPHS2/248-748N-------------------------------------------------L.K....EL..A..........N.......
R6VZN3_9BACT/256-743N-------------------------------------------------MEA....EN..P..........G.......
M2ZGR3_PSEFD/7-543N-------------------------------------------------VAK....EV..S.........SV.......
R7L3G4_9BACT/243-737N-------------------------------------------------LQT....EI..P..........H.......
Q8A113_BACTN/217-733N-------------------------------------------------LQR....DI..T..........T.......
G8TLM2_NIAKG/240-740N-------------------------------------------------AQR....EL..G..........N.......
D3PUH5_STANL/247-764N-------------------------------------------------LDA....ET..G.........DS.......
B2FTT2_STRMK/526-1060N-------------------------------------------------LAL....EIAAT..........D.......
R6D727_9BACE/236-736N-------------------------------------------------L.K....EL..G..........G.......
E8UZA2_TERSS/262-752N-------------------------------------------------LKK....EQ..P..........A.......
R6X4R5_9BACT/257-729N-------------------------------------------------MSA....EL..P..........G.......
B6HPH9_PENCW/257-760N-------------------------------------------------AER....EQ..P.........DF.......
W8F287_9BACT/273-763N-------------------------------------------------MRA....EV..P..........G.......
D2PP99_KRIFD/286-782N-------------------------------------------------LAT....EV..Q.........PK.......
Q9AAM3_CAUCR/256-729L-------------------------------------------------LDR....EI..P..........D.......
F4C4J4_SPHS2/532-1035N-------------------------------------------------LME....EI..S..........KP......
N1QLN3_SPHMS/228-731N-------------------------------------------------AEA....EI..P.........DF.......
F9Z496_ODOSD/396-890N-------------------------------------------------LAH....EC..A..........H.......
M3B4L8_PSEFD/279-788S-------------------------------------------------AEK....EI..P.........DF.......
F9D252_PREDD/265-751N-------------------------------------------------LAH....EQ..Q..........G.......
R6VNE2_9BACT/226-707N-------------------------------------------------ALE....EV..P..........E.......
A6KYE5_BACV8/247-734N-------------------------------------------------MAA....EV..P..........G.......
I3ZHR8_TERRK/253-727S-------------------------------------------------IQV....EI..P.........GW.......
A0A0E1RV06_COCIM/260-765N-------------------------------------------------AMN....EI..PG.......SQW.......
A2R7B1_ASPNC/265-756Y-------------------------------------------------ITS....EI..P.........SW.......
C7PRR1_CHIPD/258-758N-------------------------------------------------LQK....EI..G..........N.......
F4B1S1_DOKS4/242-723N-------------------------------------------------LET....EI..G..........N.......
D6CYS0_9BACE/218-733N-------------------------------------------------LQR....EI..K..........D.......
Q1ASW5_RUBXD/250-760N-------------------------------------------------LEA....EA..S..........G.......
Q5LHH6_BACFN/241-740N-------------------------------------------------FSR....EV..G..........G.......
R5JE95_9BACE/220-736N-------------------------------------------------LRR....EI..K..........D.......
U5W717_9ACTN/586-1115N-------------------------------------------------LDL....EIAAD..........A.......
I4A2R7_ORNRL/265-744N-------------------------------------------------LMK....EI..G..........Q.......
Q63NY9_BURPS/276-755N-------------------------------------------------LDA....EN..R..........T.......
X5E1R5_9BACT/243-744N-------------------------------------------------LSR....EI..S..........D.......
R5JB76_9BACE/261-739N-------------------------------------------------LEH....EV..P..........E.......
I4WZK2_9GAMM/265-751N-------------------------------------------------LDQ....DG..A..........G.......
B2FTQ4_STRMK/277-764N-------------------------------------------------LDA....EV..A..........D.......
H2K488_STRHJ/282-784N-------------------------------------------------LAA....EN..P.........PG.......
G0L6Z0_ZOBGA/241-764N-------------------------------------------------IDA....EL..P..........H.......
G7XUX9_ASPKW/176-669N-------------------------------------------------VED....EI..PE........DK.......
F6GE18_LACS5/241-722N-------------------------------------------------LKA....EI..G..........N.......
F8EMI3_RUNSL/257-744N-------------------------------------------------LVA....EL..P..........H.......
A5FGD3_FLAJ1/253-738N-------------------------------------------------IKA....EI..P..........N.......
M2RQI9_CERS8/269-747N-------------------------------------------------LDA....EI..P..........D.......
F3ZH20_9ACTN/296-799N-------------------------------------------------LRA....EN..P.........SR.......
K0K341_SACES/608-1133N-------------------------------------------------LEL....EVSTS..........D.......
G3XPX4_ASPNA/260-769N-------------------------------------------------ARM....EI..PS.......PLE.......
A6LGN6_PARD8/241-738T-------------------------------------------------MTR....EL..G..........K.......
R6SEB5_9BACE/264-743N-------------------------------------------------LET....EQ..P.........AG.......
C6W5S0_DYAFD/239-739N-------------------------------------------------LQR....EL..G..........N.......
R6FR09_9BACT/239-726N-------------------------------------------------LQA....EA..T..........T.......
U5VWY0_9ACTN/415-918N-------------------------------------------------LSQ....EV.GA..........K.......
A4AVQ7_MARSH/263-741N-------------------------------------------------LEK....ET..S..........D.......
M7SRL0_EUTLA/328-835N-------------------------------------------------LDI....EV..P..........D.......
K1VMQ9_TRIAC/331-806N-------------------------------------------------IDL....EI..P..........D.......
F8PNH6_SERL3/272-749N-------------------------------------------------LEA....EI..P..........D.......
U5VS77_9ACTN/291-788N-------------------------------------------------RDA....EV..P.........VA.......
F2KZ10_PREDF/247-747N-------------------------------------------------L.K....EV..E..........G.......
Q8A193_BACTN/250-734N-------------------------------------------------LQA....EL..S..........H.......
R5IIM1_9PORP/219-735N-------------------------------------------------VDR....EI..K..........S.......
G3YEZ1_ASPNA/266-770N-------------------------------------------------AEK....EQ..P.........NF.......
A0A0C4E0X3_MAGP6/267-771N-------------------------------------------------AER....EI..P.........DF.......
R7JK19_9PORP/295-763N-------------------------------------------------LET....EI..A..........D.......
W0F0W6_9SPHI/239-738N-------------------------------------------------LKR....EL..A..........K.......
Q5LHF2_BACFN/248-750N-------------------------------------------------VET....EI..P..........D.......
F2IHY2_FLUTR/251-730N-------------------------------------------------LKS....EL..N..........T.......
B6QUE6_PENMQ/232-737Y-------------------------------------------------ITT....EI..P.........TW.......
Q2G5L6_NOVAD/254-749N-------------------------------------------------LAA....EA..K..........H.......
D5EV06_PRER2/237-737N-------------------------------------------------L.K....EV..S..........N.......
B2AN89_PODAN/262-766H-------------------------------------------------AET....EI..P.........DY.......
M3CXH6_SPHMS/267-777N-------------------------------------------------AEA....EI..P.........TF.......
C9A6J8_ENTCA/202-695N-------------------------------------------------LQR....EQ.............Q.......
B5HEX3_STRPR/283-800N-------------------------------------------------LAA....ET..G.........DS.......
J4IB15_FIBRA/280-758N-------------------------------------------------LEK....EI..P..........D.......
I2ERB7_EMTOG/238-738N-------------------------------------------------LKN....EI..G..........D.......
R5VNB2_9PORP/259-749N-------------------------------------------------IR.....EL..D..........G.......
F0SAJ1_PSESL/255-739N-------------------------------------------------LHA....EI..K..........H.......
H1XSR1_9BACT/247-733N-------------------------------------------------LKK....EA..P..........D.......
E3S9H8_PYRTT/269-771N-------------------------------------------------AER....EI..PG.......PKH.......
H8KS37_SOLCM/242-742N-------------------------------------------------LNR....EI..G..........A.......
R6D9S0_9BACE/256-746N-------------------------------------------------LR.....ES..E..........S.......
C6WE78_ACTMD/249-759N-------------------------------------------------LAA....ET..D..........G.......
R6Y8B5_9PORP/255-742N-------------------------------------------------LAA....EI..P..........G.......
R6CWA8_9BACE/240-728S-------------------------------------------------LKK....EN..S..........Q.......
R7YLH4_CONA1/250-746N-------------------------------------------------VNN....EI..PP........GT.......
R5GD99_9PORP/267-748N-------------------------------------------------LRQ....EV..S..........G.......
G2NMH0_STREK/623-1146N-------------------------------------------------LAA....ELPAK..........H.......
N1JF10_BLUG1/293-846F-------------------------------------------------KEE....EM..P.........GW.......
R5UP48_9PORP/239-739N-------------------------------------------------L.E....EL..G..........E.......
R5LY91_9BACE/245-734N-------------------------------------------------LAA....EA..P..........D.......
I3ZB09_TERRK/260-749N-------------------------------------------------VKM....EV..P..........A.......
R5AV27_9BACE/242-742N-------------------------------------------------I.K....EV..E..........G.......
R7DGG5_9PORP/278-761N-------------------------------------------------MEK....EL..P..........D.......
B6Q8F4_PENMQ/348-844N-------------------------------------------------LQN....EI..PA........DI.......
B6H4A8_PENCW/263-778H-------------------------------------------------AES....EI..P.........HF.......
X5E0Z5_9BACT/266-745N-------------------------------------------------LNF....ES..Q..........N.......
Q5LAE2_BACFN/240-727N-------------------------------------------------MEK....EL..A..........D.......
F8JSP5_STREN/254-762N-------------------------------------------------LDR....EG..G.........GG.......
F4C4K0_SPHS2/257-777N-------------------------------------------------LIA....EA..S..........N.......
C7M956_CAPOD/241-706N-------------------------------------------------MEV....EA..P..........H.......
T5AF87_OPHSC/253-761S-------------------------------------------------AEA....EI..PD.......PLG.......
D5ES81_PRER2/228-725N-------------------------------------------------L.N....EI..G..........K.......
G2QF21_THIHA/227-734N-------------------------------------------------AES....EM..G.........DW.......
Q0CPM5_ASPTN/209-715N-------------------------------------------------AET....EI..PR.......PLE.......
M2N2U4_BAUCO/278-768N-------------------------------------------------IAS....EI..PP........NT.......
R6Y700_9BACE/245-733N-------------------------------------------------LQA....EA..P..........H.......
R5PE19_9PORP/254-773N-------------------------------------------------FET....EA..A..........G.......
Q0UTF3_PHANO/200-688N-------------------------------------------------AER....EI..PG.......PEF.......
G8TCQ4_NIAKG/241-727N-------------------------------------------------LLA....EI..T..........T.......
R7JG93_9PORP/266-784N-------------------------------------------------REE....ETNQD..........Q.......
A5FGD4_FLAJ1/238-738N-------------------------------------------------LKN....EL..G..........T.......
R5UUU5_9PORP/269-756N-------------------------------------------------LQA....EA..G..........G.......
R5NWJ1_9BACT/294-769N-------------------------------------------------FKA....EL..K..........G.......
N1PXL6_DOTSN/322-820N-------------------------------------------------IEI....ES..P..........A.......
H5X5L5_9PSEU/413-920N-------------------------------------------------LEA....ELAPP..........L.......
A5FF74_FLAJ1/248-743N-------------------------------------------------IEI....EI..P.........HW.......
E3FCN8_STIAD/239-745N-------------------------------------------------LAQ....EI.GT..........K.......
G8TEK7_NIAKG/226-741N-------------------------------------------------YDN....EL..A..........N.......
R7DKN9_9PORP/250-752N-------------------------------------------------VEV....EL..P..........D.......
Q094Q3_STIAD/650-1180N-------------------------------------------------LAL....EISDT..........D.......
D8Q3G4_SCHCM/267-790N-------------------------------------------------AEE....EI..P.........DF.......
V6KI06_STRNV/541-1068N-------------------------------------------------LAD....ELPAD..........L.......
G8P189_GRAMM/264-740N-------------------------------------------------LKL....EI..P..........D.......
J4HRZ5_FIBRA/333-848N-------------------------------------------------AET....EV..G.........SA.......
A4FBR3_SACEN/262-779N-------------------------------------------------LAAEGLDES..G.........RP.......
E8X5W4_GRATM/238-723N-------------------------------------------------IRR....EI..P..........G.......
F8JXU3_STREN/242-752N-------------------------------------------------LDQ....EG..R.........GT.......
F2KYG1_PREDF/268-750N-------------------------------------------------LDA....EQ..R..........G.......
M3A5V7_PSEFD/265-773F-------------------------------------------------KDE....EI..K.........SW.......
R6KAU3_9BACE/268-756N-------------------------------------------------LKA....EI..P..........H.......
Q7MU52_PORGI/216-732N-------------------------------------------------LRQ....EI..Q..........A.......
G2Y9J9_BOTF4/278-790N-------------------------------------------------AEN....EI..P.........DF.......
A4APM0_MARSH/260-778N-------------------------------------------------LKT....ET..N..........G.......
Q4WT26_ASPFU/264-769N-------------------------------------------------AES....EI..P.........DF.......
V5XU82_ENTMU/203-697N-------------------------------------------------LKQ....EQ.............E.......
F8EA41_RUNSL/306-821N-------------------------------------------------LQA....EV..S..........H.......
Q15ZN6_PSEA6/250-751N-------------------------------------------------LDR....EI..G..........Q.......
A6LGN2_PARD8/236-704N-------------------------------------------------LRV....EN..P..........A.......
D5BFU0_ZUNPS/244-744N-------------------------------------------------LDR....EI..A..........K.......
J3P1C3_GAGT3/286-815F-------------------------------------------------LRD....EI..P.........TW.......
C8VGN1_EMENI/274-778N-------------------------------------------------GEK....EQ..P.........DF.......
H1Y6J5_9SPHI/252-746N-------------------------------------------------IEQ....EA..P.........HW.......
R7ECF1_9BACE/250-752N-------------------------------------------------VEA....EI..S..........G.......
R5VDA0_9BACE/235-735N-------------------------------------------------L.K....EL..G..........N.......
E8V2C0_TERSS/276-763N-------------------------------------------------LHA....EI..P..........T.......
M7U9N7_BOTF1/268-775N-------------------------------------------------AEA....EI..P.........GF.......
A4APL9_MARSH/554-1057N-------------------------------------------------LEK....EV..E..........EP......
C4JIN1_UNCRE/55-557F-------------------------------------------------I.K....EI..P.........SW.......
M2YKL8_PSEFD/253-759L-------------------------------------------------AET....EI..A.........NF.......
J4UKE8_BEAB2/251-758S-------------------------------------------------AET....EI..EY.......PLD.......
R6Y942_9BACE/296-766N-------------------------------------------------LKK....EI..A..........D.......
J4WIX0_BEAB2/270-764C-------------------------------------------------VAR....EI..PR........GT.......
M4NBS4_9GAMM/429-959N-------------------------------------------------LAL....EIAPH..........E.......
R6F8M5_9BACT/252-740N-------------------------------------------------MEA....EV..P..........A.......
G7DU14_MIXOS/252-767N-------------------------------------------------ADQ....EI..G.........QD.......
G8NVE4_GRAMM/278-774N-------------------------------------------------LRE....EV..G..........E.......
R4SVV6_AMYOR/595-1126N-------------------------------------------------MEQ....ELAPN..........A.......
G4NF02_MAGO7/328-841N-------------------------------------------------AEA....EI..P.........TF.......
R5FMY1_9BACT/239-739N-------------------------------------------------L.K....EL..G..........Q.......
Q15ZM6_PSEA6/263-747N-------------------------------------------------LAA....EV..A..........D.......
G0AF00_COLFT/387-870N-------------------------------------------------LEQ....EN..P..........G.......
V5GCY0_BYSSN/587-1092Y-------------------------------------------------IRS....EI..T.........SW.......
F8JRR9_STREN/286-769N-------------------------------------------------LAK....EI..R..........G.......
I2G215_USTH4/351-880N-------------------------------------------------LDV....EM..H..........N.......
I3YTY8_AEQSU/270-759N-------------------------------------------------LKA....EI..P..........H.......
R5JSK3_9BACE/267-748N-------------------------------------------------LNK....EQ..E..........G.......
M2TG81_COCH5/268-771N-------------------------------------------------AER....EI..PN.......PDI.......
R6EZA8_9BACT/224-710N-------------------------------------------------MQA....EL..A..........G.......
A1S294_SHEAM/264-749N-------------------------------------------------LEA....DG..K..........L.......
I3ZK24_TERRK/245-732N-------------------------------------------------LD.....EV..P..........A.......
K0F0T9_9NOCA/270-745N-------------------------------------------------LAA....EV..G..........A.......
A4AVR4_MARSH/251-737N-------------------------------------------------MEA....R...G..........G.......
E8RVN8_ASTEC/281-753N-------------------------------------------------LAA....EL..P.........GW.......
N1QGM3_SPHMS/253-759L-------------------------------------------------AET....EI..S.........DF.......
R6K435_9BACE/400-907N-------------------------------------------------LEN....DA..V..........T.......
R5I4F6_9PORP/266-747N-------------------------------------------------LEC....EQ..Q..........G.......
R5HXL6_9BACT/230-726N-------------------------------------------------LLS....DVPED..........S.......
G9NTU6_HYPAI/285-779F-------------------------------------------------Q.K....EI..P.........SW.......
D5EVW5_PRER2/248-767N-------------------------------------------------LET....EA..K..........N.......
R5VXR7_9BACE/251-735N-------------------------------------------------MQT....EL..S..........G.......
C6Y1U7_PEDHD/246-774N-------------------------------------------------LQT....EL..P..........H.......
R6VPA7_9BACT/243-728N-------------------------------------------------LRR....EI..P..........H.......
A6LEE3_PARD8/399-910N-------------------------------------------------IER....EC..Q..........H.......
E8V399_TERSS/273-763N-------------------------------------------------LDS....EL..G..........S.......
C6W4W9_DYAFD/265-751N-------------------------------------------------LEK....EM..G..........D.......
G2R1P2_THITE/262-767H-------------------------------------------------AET....EI..P.........DF.......
A6RG74_AJECN/261-763N-------------------------------------------------AER....EQ..P.........FF.......
A3HRW3_9BACT/238-765N-------------------------------------------------MDT....EL..N..........H.......
L2G5N5_COLGN/296-800H-------------------------------------------------ATA....EI..P.........DY.......
R5P2L7_9BACT/242-728N-------------------------------------------------LRT....EA..D..........G.......
R6VFG8_9BACT/272-759N-------------------------------------------------LEA....ET..A..........G.......
W0EKX8_9PORP/238-729A-------------------------------------------------LLT....ES..P..........N.......
R5IAY0_9PORP/237-733T-------------------------------------------------LSL....EI..G..........E.......
S3BSV4_OPHP1/323-857N-------------------------------------------------AER....EI..PDTS...HGKGW.......
H8KZ70_FRAAD/285-773N-------------------------------------------------LHA....EA..P..........D.......
R7JAF0_9PORP/33-518N-------------------------------------------------MNA....EL..A..........G.......
F9YRT9_CAPCC/245-747N-------------------------------------------------LRN....EI..G..........N.......
R0K5A1_SETT2/227-737Y-------------------------------------------------KNS....EL..S.........TW.......
X5DYF1_9BACT/280-769N-------------------------------------------------MAA....EI..P..........H.......
F0RGV3_CELLC/258-737N-------------------------------------------------LEK....ET..A..........N.......
R7NSX4_9BACE/247-749N-------------------------------------------------LLA....EL..P..........D.......
U5VWI8_9ACTN/585-1110N-------------------------------------------------LDL....EV.TG..........K.......
G0FHU3_AMYMS/259-774N-------------------------------------------------LASE..HI......................
A2U4A4_9FLAO/235-716N-------------------------------------------------LEA....EI..G..........N.......
D3Q7H1_STANL/259-730N-------------------------------------------------LAA....EQ..D..........G.......
R5IR26_9PORP/203-716N-------------------------------------------------LNK....EI..N..........D.......
Q8A0E8_BACTN/295-770N-------------------------------------------------FKQ....EI..A..........S.......
Q8A3K6_BACTN/415-889N-------------------------------------------------LER....EI..G..........A.......
A8L8V7_FRASN/275-745N-------------------------------------------------LEA....EY..P..................
R6KI45_9BACE/225-723N-------------------------------------------------FNR....EV..A..........G.......
M9M713_PSEA3/355-876N-------------------------------------------------LDV....EM..P..........D.......
R9P496_PSEHS/345-860N-------------------------------------------------LDV....EM..P..........N.......
Q0UBD4_PHANO/213-718N-------------------------------------------------AEK....EI..P.........RT.......
R5PLD1_9PORP/276-763N-------------------------------------------------LQV....ET..A..........G.......
D5EXZ8_PRER2/240-726N-------------------------------------------------LEA....EM..L..........G.......
A1CAZ9_ASPCL/252-745N-------------------------------------------------VQD....EI..PH........GT.......
C7PCT9_CHIPD/259-743N-------------------------------------------------INS....EI..P..........S.......
E3QRP8_COLGM/249-752N-------------------------------------------------AQK....EI..AD.......PLG.......
G4MT72_MAGO7/278-774N-------------------------------------------------LDQ....QI..PE........ST.......
D6D1V6_9BACE/208-724N-------------------------------------------------MER....EV..A..........G.......
C7QF41_CATAD/257-740N-------------------------------------------------LAA....EQ..S..........G.......
Q481A5_COLP3/312-819N-------------------------------------------------LAK....EQ..TETLVNSSQTKE.......
I3YTY7_AEQSU/239-720N-------------------------------------------------LKT....EI..G..........D.......
V6KVF3_STRRC/274-755N-------------------------------------------------RQA....EN..P..........G.......
A1CUM0_ASPCL/259-763N-------------------------------------------------AER....EQ..P.........DF.......
V6KU68_STRRC/243-754N-------------------------------------------------LGA....EG..G.........RS.......
G8UPB2_TANFA/230-730N-------------------------------------------------L.K....EL..D..........V.......
R6SCI2_9BACE/261-777N-------------------------------------------------LQA....EA..E..........G.......
G0G0P7_AMYMS/236-745N-------------------------------------------------RGA....EQ..P.........KS.......
U7PU00_SPOS1/336-876N-------------------------------------------------AEA....EI..P.........DW.......
C5DCG1_LACTC/314-832N-------------------------------------------------LAL....NY..PEE......NMF.......
E6SVL4_BACT6/252-756N-------------------------------------------------LMT....EM..P..........T.......
R6XE16_9PORP/267-757N-------------------------------------------------MQ.....EL..D..........G.......
E4RQ41_LEAB4/244-733N-------------------------------------------------MDK....EL..P..........H.......
M4S534_9SPHN/268-753N-------------------------------------------------LES....E..............A.......
S3CZA3_GLAL2/246-742N-------------------------------------------------VNE....QI..PE........TA.......
W0ESN6_9PORP/249-751N-------------------------------------------------VET....EI..P..........H.......
R5PZ68_9BACT/299-769N-------------------------------------------------FEA....EA..Q..........G.......
S8E8T9_FOMPI/283-761N-------------------------------------------------LET....EI..P..........D.......
Q8A325_BACTN/241-728N-------------------------------------------------MEQ....EA..P..........H.......
F4C4M8_SPHS2/235-718N-------------------------------------------------LLQ....EI..G..........N.......
X5DBU2_9BACT/254-773N-------------------------------------------------LET....EA..T..........N.......
F0RGV6_CELLC/245-745N-------------------------------------------------LKR....EI..G..........D.......
C7M5H0_CAPOD/268-751N-------------------------------------------------LEL....Y...N..........A.......
F4CDU4_SPHS2/244-731A-------------------------------------------------LGE....I...G..........D.......
D5QF63_KOMHA/274-760N-------------------------------------------------LEA....EG..R..........G.......
X5D9C9_9BACT/239-767N-------------------------------------------------IQE....EL..P..........D.......
R6VVJ6_9BACT/255-739N-------------------------------------------------IES....EL..P..........G.......
K5X7A2_PHACS/171-650N-------------------------------------------------LET....EI..P..........D.......
G0RA48_HYPJQ/261-756N-------------------------------------------------VKA....EI..PL........GT.......
I3YNN2_ALIFI/253-753N-------------------------------------------------LR.....EL..G..........A.......
R5PP34_9PORP/240-740N-------------------------------------------------L.K....EL..E..........N.......
R6YLY3_9BACE/249-722N-------------------------------------------------LNE....EM..P..........D.......
C8VSU5_EMENI/263-768S-------------------------------------------------AED....EI..P.........NF.......
T0TUP6_9STRE/218-704H-------------------------------------------------LPH....LP.....................
D5BAG1_ZUNPS/257-741N-------------------------------------------------LD.....S...D..................
C4LZ28_ENTHI/214-702D-------------------------------------------------STT...........................
F9XL31_ZYMTI/230-730N-------------------------------------------------LDL....EA..P..........S.......
Q8A5Y1_BACTN/527-1039N-------------------------------------------------LEE....EI..A..........RP......
R6TED2_9BACE/220-721N-------------------------------------------------LQK....EL..V..........EP......
C1F144_ACIC5/262-749R-------------------------------------------------LTQ....ED..P..........S.......
G8Y985_PICSO/254-746N-------------------------------------------------IAS....EI..N.........DF.......
M2TDD4_COCSN/274-779N-------------------------------------------------AER....EI..P.........SF.......
Q8P5J8_XANCP/519-1052N-------------------------------------------------LAL....EIAPQ..........D.......
M2Y3U8_DOTSN/266-776S-------------------------------------------------AEL....EI..PDGL...SGSTW.......
Q1IUD1_KORVE/260-750N-------------------------------------------------LES....EI..P..........S.......
F4A019_MAHA5/200-715N-------------------------------------------------LMN....EI..Q..........D.......
H1XZC8_9SPHI/280-769N-------------------------------------------------MQA....EV..P..........G.......
R6SWH3_9BACE/256-775N-------------------------------------------------LES....EA..K..........D.......
Q5LHF3_BACFN/230-730N-------------------------------------------------L.K....EL..G..........N.......
A6KWP8_BACV8/600-1122N-------------------------------------------------MLT....EL..S..........G.......
G0RBQ3_HYPJQ/267-767N-------------------------------------------------LDI....DI..P..........D.......
G8TBJ6_NIAKG/238-722N-------------------------------------------------INA....EI..P..........H.......
R6TIU0_9BACE/257-760N-------------------------------------------------VEQ....EI..P..........G.......
R6W3J5_9BACT/250-725N-------------------------------------------------LDR....EI..G..........R.......
W0ESP1_9PORP/265-746N-------------------------------------------------LDN....EQ..Q..........G.......
G8NT21_GRAMM/267-754R-------------------------------------------------LQS....ED..P..........G.......
S3CDT6_OPHP1/260-781N-------------------------------------------------AEH....EI..P.........SF.......
D3EHM8_GEOS4/215-711N-------------------------------------------------LTR....EL.............D.......
G0AF01_COLFT/312-844N-------------------------------------------------LKK....EN..A..........G.......
R6Y5H0_9PORP/268-754N-------------------------------------------------LQA....EA..T..........G.......
F9ZBX8_ODOSD/247-732N-------------------------------------------------LEK....EL..S..........H.......
A3HZJ9_9BACT/233-716N-------------------------------------------------LES....ES..I..........D.......
L0JB66_PREDD/632-1138N-------------------------------------------------LRA....EL..P..........A.......
Q8A6V7_BACTN/216-731N-------------------------------------------------LHR....EL..K..........D.......
J3NHS8_GAGT3/313-827N-------------------------------------------------AEA....QI..P.........DF.......
S3CIA7_OPHP1/268-767N-------------------------------------------------VDS....EV..PA........GT.......
I4A0R9_ORNRL/240-740N-------------------------------------------------LKA....EL..G..........S.......
C6Y1K7_PEDHD/386-892N-------------------------------------------------MDT....EC..P..........G.......
D5QHV3_KOMHA/266-755N-------------------------------------------------LAT....EI..T..........D.......
R6VRM0_9BACT/240-752N-------------------------------------------------LAE....EAADS..........E.......
F0R289_BACSH/242-731N-------------------------------------------------LQA....EA..P..........D.......
A6KY22_BACV8/243-732N-------------------------------------------------MAA....EA..P..........H.......
R6MN00_9BACE/218-702N-------------------------------------------------LEY....EM..F..........H.......
G0G534_AMYMS/257-729N-------------------------------------------------LAA....EN..P..........G.......
R5Q370_9BACT/273-760N-------------------------------------------------LRA....EA..S..........G.......
A3UBV0_CROAH/238-719N-------------------------------------------------LEK....EI..G..........T.......
A0A0C4DWV3_MAGP6/255-752N-------------------------------------------------VQS....QI..PE........GT.......
N1PUA1_DOTSN/281-786F-------------------------------------------------KDD....EI..K.........SW.......
C5M3L3_CANTT/286-786N-------------------------------------------------IVK....QT..N.........EF.......
R5W019_9BACE/262-742N-------------------------------------------------LEA....EQ..H..........G.......
E4V245_ARTGP/290-791F-------------------------------------------------I.N....EI..R.........SW.......
F9D249_PREDD/222-708N-------------------------------------------------LEH....EI..P..........E.......
F2KXB9_PREDF/398-873Y-------------------------------------------------LAK....EI..P..........A.......
D6D0Y6_9BACE/239-739N-------------------------------------------------L.K....EI..G..........N.......
R7JIS0_9PORP/261-742N-------------------------------------------------LKA....EQ..P..........G.......
R7EQ20_9BACE/242-723N-------------------------------------------------LEA....EV..T..........G.......
Q8A5X5_BACTN/531-1033N-------------------------------------------------LSN....EI..T..........EP......
F2UPM6_SALR5/301-791N-------------------------------------------------FGA....QTENG..................
I6SXV1_ENTHA/204-698N-------------------------------------------------LEQ....EL.............H.......
D5BAF6_ZUNPS/249-732S-------------------------------------------------LET....EA..P..........D.......
Q023I7_SOLUE/234-715N-------------------------------------------------MTS....EV..T..........G.......
K5Y2M0_AGABU/280-805N-------------------------------------------------AEE....EI..P.........DF.......
A6LGN5_PARD8/299-769N-------------------------------------------------LKA....EI..K..........D.......
Q1ASW2_RUBXD/614-1155N-------------------------------------------------LRL....EISPG..........D.......
A6L7S3_BACV8/264-743N-------------------------------------------------LEK....EQ..P.........FG.......
R5B6I7_9BACE/267-752N-------------------------------------------------LEK....EQ..K..........G.......
R5INP1_9PORP/204-719N-------------------------------------------------LRR....EI..V..........N.......
S7ZU94_PENO1/254-747N-------------------------------------------------VNN....EI..PS........GT.......
R6KBU8_9BACE/239-730A-------------------------------------------------LEK....EN..P..........D.......
Q9PF36_XYLFA/273-763N-------------------------------------------------LDA....EL..P..........D.......
B8MZQ6_ASPFN/290-775Y-------------------------------------------------IQS....EI..P.........SW.......
R6KIJ4_9BACE/530-1032N-------------------------------------------------LQK....EI..S..........DK......
D5GHL1_TUBMM/334-842F-------------------------------------------------IQS....EI..PP........NQ.......
W5WHY7_9PSEU/275-764N-------------------------------------------------LRA....E...A..........H.......
E8UZF7_TERSS/277-787N-------------------------------------------------LDA....ES..A.........TA.......
Q7S6N7_NEUCR/312-905N-------------------------------------------------AER....EM..E.........DW.......
Q15ZP0_PSEA6/279-760N-------------------------------------------------LNT....EQ..P..........D.......
Q097W8_STIAD/262-779N-------------------------------------------------LAK....ET..G.........ES.......
F3ZQV4_9BACE/237-737N-------------------------------------------------L.A....EL..G..........D.......
E3QRS6_COLGM/300-809N-------------------------------------------------AEN....EI..P.........LF.......
R5M1V6_9BACE/288-757N-------------------------------------------------LEQ....DI..P..........D.......
D2QHT3_SPILD/256-741N-------------------------------------------------IRA....EL..P..........H.......
Q832K9_ENTFA/202-695N-------------------------------------------------LAR....EI.............S.......
Q0UGQ6_PHANO/180-696S-------------------------------------------------AES....EI..S.........DF.......
S5VGA2_STRCU/306-788N-------------------------------------------------RTA....EN..P..........G.......
Q5KC19_CRYNJ/398-905N-------------------------------------------------IDL....EI..P..........R.......
Q0CFC9_ASPTN/253-746N-------------------------------------------------VAS....EI..PA........DT.......
M3AXL3_PSEFD/143-645N-------------------------------------------------AEQ....EI..P.........DF.......
V2XHT4_MONRO/288-803N-------------------------------------------------AES....EV..G.........SS.......
G8TN43_NIAKG/285-774N-------------------------------------------------LEH....EI..T..........G.......
E4ZUP2_LEPMJ/404-904N-------------------------------------------------VDK....EI..PE........RT.......
R4LP30_9ACTN/289-770N-------------------------------------------------RDT....EV..G..........D.......
G9NFV5_HYPAI/280-778N-------------------------------------------------LDT....EI..P..........D.......
G8TN43_NIAKG/1001-1499T-------------------------------------------------LQR....EL..G..........A.......
Q5LED8_BACFN/267-748N-------------------------------------------------LEK....EQ..A..........G.......
A5FHD9_FLAJ1/280-769N-------------------------------------------------MKK....ET..P..........N.......
G0RIK4_HYPJQ/265-770N-------------------------------------------------AEK....EI..T.........EW.......
R7DIY0_9PORP/236-734N-------------------------------------------------FDR....EV..K..........N.......
F9YRP8_CAPCC/247-730S-------------------------------------------------MQT....EA..A..........D.......
R4L6G3_9ACTN/280-936N-------------------------------------------------LAT....ES..P.........DR.......
M2QZJ7_CERS8/289-803N-------------------------------------------------AET....EV..G.........DS.......
E3QZM0_COLGM/297-801H-------------------------------------------------AQN....EI..P.........DF.......
G0FHU2_AMYMS/248-722N-------------------------------------------------LKA....EN..T..........G.......
R6T8N5_9BACE/254-773N-------------------------------------------------YMA....EA..E..........N.......
R5GRT6_9BACT/247-729N-------------------------------------------------LDS....ES..A..........G.......
Q9AAR3_CAUCR/283-754N-------------------------------------------------LDE....EA..P.........GW.......
W5W2K6_9PSEU/259-740N-------------------------------------------------RDT....EN..G..........G.......
G0SAP0_CHATD/309-829N-------------------------------------------------AER....EI..G.........DW.......
Q15ZN9_PSEA6/255-739N-------------------------------------------------LLA....QG..P..........V.......
R5C0J2_9BACE/253-738N-------------------------------------------------LEA....EQ..P..........G.......
R5I4F3_9PORP/249-751N-------------------------------------------------VEK....EI..P..........S.......
X5DYI4_9BACT/238-720N-------------------------------------------------LEA....EL..A..........G.......
R5NK85_9BACT/256-731N-------------------------------------------------LSK....EI..P..........A.......
R4LXQ2_9ACTN/240-751N-------------------------------------------------LAA....ET..G.........DS.......
K5WZS2_AGABU/308-802N-------------------------------------------------LEM....EI..P..........DSS.....
G0FQH4_AMYMS/596-1127N-------------------------------------------------LAQ....EIAPA..........A.......
F8PWD0_SERL3/288-803N-------------------------------------------------AES....EV..G.........TT.......
R5PL83_9BACT/260-779N-------------------------------------------------LEK....EA..S..........G.......
C4JL73_UNCRE/259-764N-------------------------------------------------AEK....EI..PN.......ILG.......
R5FGS5_9BACT/226-714N-------------------------------------------------LRA....EI..Q..........D.......
D3Q0N4_STANL/446-976N-------------------------------------------------MES....EI.GG..........K.......
E9F417_METRA/351-849N-------------------------------------------------LDI....EI..P..........D.......
R6U2T8_9BACE/244-730N-------------------------------------------------MKA....EM..P..........E.......
H1Y2M1_9SPHI/268-754N-------------------------------------------------LSV....EL..P..........G.......
A6KYE4_BACV8/288-756N-------------------------------------------------LQS....DI..S..........D.......
S8AUX2_PENO1/262-765N-------------------------------------------------AEA....EV..PD.......PIP.......
R6XA11_9BACT/243-734N-------------------------------------------------IR.....EL..G.........SW.......
Q02D57_SOLUE/238-722N-------------------------------------------------LRQ....EI..P..........E.......
F9YQE4_CAPCC/264-743N-------------------------------------------------LEK....EI..G..........N.......
G2WXK7_VERDV/282-782F-------------------------------------------------LND....EI..P.........HW.......
R6VXX4_9BACT/550-1053N-------------------------------------------------LST....EL..A..........TP......
F3ZIF3_9ACTN/648-1175N-------------------------------------------------LEQ....EIPGR..........K.......
R5BAT3_9BACE/237-723N-------------------------------------------------MAA....EL..P..........G.......
M3C6Z1_SPHMS/285-790N-------------------------------------------------MNE....EI..A.........SW.......
A5E0Q5_LODEL/281-789N-------------------------------------------------I.......D..Y.........TK.......
R7DDE0_9PORP/246-730N-------------------------------------------------LDA....EM..P..........S.......
B8NLD2_ASPFN/278-780N-------------------------------------------------AEK....EQ..P.........NF.......
C5CEA2_KOSOT/248-734N-------------------------------------------------L.S....EV..P..........D.......
R6WSC1_9PORP/262-743N-------------------------------------------------MNT....EQ..P..........D.......
W5W8J6_9PSEU/288-763N-------------------------------------------------LSA....EQ..G..........E.......
D7B4B3_NOCDD/292-794N-------------------------------------------------LAA....EI..A.........PG.......
W5W9Q6_9PSEU/250-766N-------------------------------------------------LTQ....ET..G.........DS.......
E3S2L0_PYRTT/266-770F-------------------------------------------------MHA....EI..P.........TW.......
D8PMG3_SCHCM/286-801N-------------------------------------------------AEE....EI..G.........EK.......
G2Y0H1_BOTF4/251-747N-------------------------------------------------VNS....QI..PS........GT.......
B8NJS3_ASPFN/266-776N-------------------------------------------------AES....EI..P.........NF.......
C8VIR9_EMENI/285-802Y-------------------------------------------------IRN....EI..P.........SW.......
Q01W62_SOLUE/253-752N-------------------------------------------------LEQ....DM..P..........Q.......
D5BJC2_ZUNPS/206-722N-------------------------------------------------YQR....EI..K..........G.......
A5FIB1_FLAJ1/251-737N-------------------------------------------------LD.....G...E..........K.......
M2PK65_CERS8/288-800N-------------------------------------------------AEE....EI..P.........DF.......
K5W0L8_PHACS/310-823N-------------------------------------------------AES....EI..P.........DF.......
G8SIR1_ACTS5/255-721N-------------------------------------------------ATA....EA..A..........S.......
G8T7Y9_NIAKG/245-747N-------------------------------------------------LET....EM.............NP......
Q73SJ7_MYCPA/258-750N-------------------------------------------------LAA....EG..N.........AG.......
Q7MVS0_PORGI/271-766N-------------------------------------------------LEA....EQ..EEVFKSVGGNPA.......
D2QFK0_SPILD/269-757N-------------------------------------------------MQT....EI..P..........H.......
R6X327_9BACT/277-768N-------------------------------------------------LK.....EL..E..........G.......
H8KZE1_FRAAD/293-782N-------------------------------------------------LEA....EV..S..........G.......
R6ZMR2_9BACE/259-762N-------------------------------------------------VET....EI..P..........D.......
W8ETM9_9BACT/230-730N-------------------------------------------------LEQ....EI..G..........A.......
A1S316_SHEAM/276-762N-------------------------------------------------LTS....EL..P..........H.......
F9XLT5_ZYMTI/326-825N-------------------------------------------------AEN....EV..G.........DW.......
L0G543_ECHVK/243-744N-------------------------------------------------L.Q....EI..G..........G.......
F4C7L7_SPHS2/244-743N-------------------------------------------------L.K....EL..G..........A.......
N1PGL0_DOTSN/249-756L-------------------------------------------------AEE....EI..P.........NF.......
E9DYP6_METAQ/264-768N-------------------------------------------------AER....EI..PN.......PLK.......
K0KAH3_SACES/260-771N-------------------------------------------------LAE........A.........RD.......
H1Y718_9SPHI/240-740N-------------------------------------------------LKR....EL..G..........T.......
F3ZTR3_9BACE/257-743N-------------------------------------------------MEE....EL..P..........E.......
R5IMK2_9PORP/258-745N-------------------------------------------------MSA....EI..P..........G.......
G8TJR4_NIAKG/268-756N-------------------------------------------------LRT....EA..P..........N.......
Q481A4_COLP3/300-787N-------------------------------------------------LIT....EN..P..........G.......
R6ZR28_9BACE/244-723N-------------------------------------------------LEK....EI..P..........A.......
Q0CV76_ASPTN/830-1332N-------------------------------------------------LDL....EI..P..........D.......
D5EX99_PRER2/205-696N-------------------------------------------------........I..P.........DN.......
S3CNE2_GLAL2/263-771N-------------------------------------------------AES....EI..P.........TF.......
D5BAF4_ZUNPS/270-746N-------------------------------------------------LEQ....EV..G..........D.......
B8NXN6_ASPFN/169-672N-------------------------------------------------AET....EL..P.........NF.......
R6W0P6_9BACT/241-740N-------------------------------------------------L.G....EI..G..........N.......
Q8P6S1_XANCP/273-763N-------------------------------------------------LDA....EL..P..........D.......
H1Y8C2_9SPHI/255-740N-------------------------------------------------IAA....EI..P..........G.......
A0A068NT61_9BACT/252-735N-------------------------------------------------LDT....EV..P..........G.......
A4AVR0_MARSH/245-752N-------------------------------------------------LDR....EI..G..........E.......
G8NVG8_GRAMM/266-756N-------------------------------------------------LEA....EA..P..........H.......
R7DIA9_9PORP/253-762N-------------------------------------------------MKA....DI..S..........G.......
A1S293_SHEAM/260-740N-------------------------------------------------LDT....EQ..P..........G.......
A5FI93_FLAJ1/272-748N-------------------------------------------------LAK....EV..G..........N.......
E9F2Y7_METRA/266-770N-------------------------------------------------AED....EM..P.........EF.......
V5FJJ3_BYSSN/329-821N-------------------------------------------------VQN....EI..PP........GT.......
E2PV07_STRC2/620-1148N-------------------------------------------------LAD....EIPPG..........T.......
D3IB54_9BACT/269-751N-------------------------------------------------AEK....EL..T..........Q.......
R7DMG2_9PORP/275-756N-------------------------------------------------LDK....EQ..S..........G.......
R6XF07_9BACT/689-1242N-------------------------------------------------LVG....ET..A..........G.......
M1WGU2_CLAP2/276-809N-------------------------------------------------AEQ....EI..P.........DF.......
N1PP62_DOTSN/270-779N-------------------------------------------------AEK....EV..P.........DF.......
R6W673_9BACT/250-751N-------------------------------------------------LK.....EL..G..........D.......
G8NSC1_GRAMM/274-786N-------------------------------------------------LKA....EN..P.........EG.......
F9YPS9_CAPCC/306-792N-------------------------------------------------LDL....Y...D..........K.......
R6VFA8_9BACT/233-724N-------------------------------------------------LEA....EA..A..........G.......
I6ZRZ1_MELRP/243-724N-------------------------------------------------LKS....EI..N..........Q.......
R5PXF8_9BACT/236-732N-------------------------------------------------L.K....EL..G..........D.......
F8JNS7_STREN/261-770N-------------------------------------------------LDA....EG..G.........GT.......
V2X6S9_MONRO/261-766N-------------------------------------------------AEK....EI..P.........DW.......
J3P516_GAGT3/279-792N-------------------------------------------------LEA....EI..P.........AA.......
E8RS95_ASTEC/253-744N-------------------------------------------------LEA....EQ..P..........G.......
R5KVZ5_9FIRM/666-1195N-------------------------------------------------LKL....EI.GG..........D.......
V5FTD6_BYSSN/272-765N-------------------------------------------------SEN....EI..P.........DY.......
G8NVQ7_GRAMM/268-755N-------------------------------------------------LSA....EE..P..........D.......
Q8PBN8_XANCP/275-762N-------------------------------------------------LAA....EV..P..........G.......
G2WSC5_VERDV/69-567N-------------------------------------------------VDR....EI..PS........GT.......
G0FZ68_AMYMS/246-762N-------------------------------------------------LAA....ET..K..........D.......
R6B5C9_9BACT/680-1193N-------------------------------------------------LEK....EV..D..........NL......
C1F7W7_ACIC5/302-791N-------------------------------------------------LAA....EI..P..........H.......
S3CJ02_OPHP1/292-810H-------------------------------------------------AER....EI..P.........AF.......
R5PMH4_9BACT/241-740N-------------------------------------------------LER....EL..G..........G.......
I3YPK4_ALIFI/227-708N-------------------------------------------------SLA....EV..P..........E.......
R5IRF6_9PORP/213-728N-------------------------------------------------LIR....EI..P..........D.......
R6YWL1_9BACE/243-731N-------------------------------------------------LQA....EI..P..........G.......
M2TSE6_COCH5/349-888H-------------------------------------------------VEN....EL..PY........TK.......
C5BV25_BEUC1/280-761N-------------------------------------------------LDA....EV..P..........D.......
R7JDH8_9PORP/245-728N-------------------------------------------------LEA....EA..P..........K.......
B8MW61_ASPFN/266-768N-------------------------------------------------ARR....EI..PH.......PLE.......
H8KS39_SOLCM/267-756N-------------------------------------------------LRT....EI..P..........H.......
G8NZ99_GRAMM/267-757N-------------------------------------------------LTA....EI..P..........A.......
S7ZPF5_PENO1/272-783H-------------------------------------------------AEN....EI..G.........DF.......
M3C4G9_SPHMS/319-826N-------------------------------------------------LES....EA..P..........S.......
R7LDI0_9BACT/243-732N-------------------------------------------------LQA....EC..K..........H.......
R7DME3_9PORP/244-727N-------------------------------------------------LKA....EV..P..........D.......
K0KDA2_SACES/301-776N-------------------------------------------------LKA....EN..V..........A.......
R5PNA6_9BACT/253-743N-------------------------------------------------MR.....EL..D..........G.......
H2K489_STRHJ/587-1110N-------------------------------------------------LRQ....EIPDG..........T.......
F0R5A0_BACSH/248-742N-------------------------------------------------ART....YI..P.........HW.......
R6YIX3_9BACE/221-737N-------------------------------------------------LER....EI..A..........S.......
W0EN75_9PORP/241-738N-------------------------------------------------L.K....EL..G..........N.......
R5NWD8_9PORP/223-750N-------------------------------------------------LEK....ET..G..........N.......
R6WZT0_9BACT/250-735N-------------------------------------------------LEA....EL..P..........G.......
F3ZQD9_9BACE/265-746N-------------------------------------------------LET....EQ..K..........D.......
A4X9V9_SALTO/601-1141N-------------------------------------------------LAL....EIAEN..........D.......
A4AN18_MARSH/255-759N-------------------------------------------------MTT....EL..P..........H.......
W5W3K0_9PSEU/253-732N-------------------------------------------------RDT....EN..R..........A.......
R6MPC3_9BACE/260-779N-------------------------------------------------LEK....EA..A..........D.......
R5W4N0_9BACE/266-754N-------------------------------------------------MQQ....EI..P..........H.......
D4IQF8_9BACT/240-741N-------------------------------------------------LET....EV..G..........D.......
R6WWU7_9BACT/271-758N-------------------------------------------------LAA....EA..S..........G.......
A8AZ30_STRGC/202-690N-------------------------------------------------LPQ....SS.....................
G4MXA7_MAGO7/252-764S-------------------------------------------------AET....EI..P.........GF.......
R5AYY0_9BACE/229-719N-------------------------------------------------LTA....EA..P..........G.......
G8UKZ7_TANFA/286-774N-------------------------------------------------LEA....ET..G..........G.......
A6LCT9_PARD8/270-758N-------------------------------------------------LRA....EA..P..........K.......
I3ZE22_TERRK/242-726N-------------------------------------------------LQH....EI..P..........T.......
C1F5Z0_ACIC5/277-763N-------------------------------------------------LKA....EA..A..........G.......
F8PL93_SERL3/213-728N-------------------------------------------------AED....EI..P.........DF.......
J4KN82_BEAB2/265-779N-------------------------------------------------AEK....EI..P.........NF.......
G0G6H4_AMYMS/276-770N-------------------------------------------------LRA....EQ..P.........KK.......
F0R2N2_BACSH/263-745N-------------------------------------------------LEK....EQ..H..........G.......
R5N958_9BACT/222-738N-------------------------------------------------LKR....EI..P..........G.......
G8NZ65_GRAMM/265-739N-------------------------------------------------VQQ....EV..P.........AW.......
H1Y4F5_9SPHI/240-740N-------------------------------------------------LKR....EL..G..........N.......
D6D182_9BACE/235-702N-------------------------------------------------LKA....EN..T..........G.......
M2LV24_BAUCO/282-788F-------------------------------------------------KNS....EI..R.........SW.......
Q7MVX2_PORGI/246-734N-------------------------------------------------LAK....EA..P..........H.......
R6W2H2_9BACT/222-708N-------------------------------------------------MQA....EV..P..........G.......
A6LCG5_PARD8/264-780N-------------------------------------------------RET....EA..A..........T.......
Q8P357_XANCP/270-798N-------------------------------------------------LRAD.GMQG..G.........TL.......
R5PMC5_9BACT/645-1146N-------------------------------------------------LIV....ET..A..........SL......
E5A3T8_LEPMJ/375-905H-------------------------------------------------IEA....EL..PL........SK.......
T0K2G4_COLGC/281-786F-------------------------------------------------IKD....EI..P.........HW.......
R6WV50_9BACT/252-767N-------------------------------------------------LRA....EA..D..........G.......
Q0UBG2_PHANO/7-546H-------------------------------------------------VEY....EL..PD........AN.......
F5WRB0_ERYRF/195-684N-------------------------------------------------QSR....ES.............D.......
I3ZYE3_ORNRL/259-745N-------------------------------------------------MA.....T...E..........G.......
G8T7Z2_NIAKG/256-773N-------------------------------------------------LQQ....EA..A..........K.......
L0G487_ECHVK/269-758N-------------------------------------------------MQA....ET..P..........G.......
R5PXP4_9BACT/246-746N-------------------------------------------------L.K....EL..G..........D.......
H1YA33_9SPHI/259-746N-------------------------------------------------LQA....EI..P..........G.......
R6W152_9BACT/272-759N-------------------------------------------------LKA....EA..E..........G.......
D1BF94_SANKS/373-883N-------------------------------------------------........VSRA..........G.......
R6YT08_9BACE/236-736N-------------------------------------------------L.K....EL..G..........N.......
A6LE00_PARD8/240-738N-------------------------------------------------L.R....EV..G..........D.......
E8X2K1_GRATM/259-749N-------------------------------------------------VKA....EI..P..........A.......
Q0CS76_ASPTN/251-770N-------------------------------------------------AEN....EQ..P.........DF.......
F0XC67_GROCL/1251-1766N-------------------------------------------------AES....EI..P.........EW.......
G4N8Y8_MAGO7/278-772S-------------------------------------------------VDS....EI..LE........GT.......
B8MB98_TALSN/256-758N-------------------------------------------------AEK....EI..PE.......PTS.......
D5BAW8_ZUNPS/242-740N-------------------------------------------------LKR....EL..G..........K.......
X5DJ68_9BACT/251-738N-------------------------------------------------IEA....EI..P..........G.......
F4C7M2_SPHS2/216-732N-------------------------------------------------LRR....EI..R..........D.......
G4ND73_MAGO7/266-773N-------------------------------------------------AEQ....EM..P.........KF.......
L0G0Y1_ECHVK/252-736N-------------------------------------------------LKE....EI..P..........H.......
I2EXN5_EMTOG/238-766N-------------------------------------------------LTS....EL..P..........H.......
K0KND0_WICCF/267-760N-------------------------------------------------LEN....DF..PES......SDF.......
R1GPT3_BOTPV/261-768N-------------------------------------------------AES....EI..P.........DF.......
G2PCH2_STRVO/284-786N-------------------------------------------------LAA....EN..P.........PR.......
A6LCF7_PARD8/253-738N-------------------------------------------------LRT....EL..S..........H.......
R5IJ85_9BACT/272-764N-------------------------------------------------LEA....EA..A..........G.......
X5DJ19_9BACT/236-721N-------------------------------------------------LNA....EL..A..........Q.......
M7UMW1_BOTF1/292-792N-------------------------------------------------AEH....EI..P.........DW.......
F5HDD2_PORGI/255-752N-------------------------------------------------L.A....EV..K..........G.......
R6K5T3_9BACE/248-753N-------------------------------------------------VEA....EI..P..........N.......
A6LGS3_PARD8/221-704N-------------------------------------------------LEQ....ETDSY..........G.......
C7PM47_CHIPD/237-735T-------------------------------------------------WQK....EL..A..........G.......
E5A4R8_LEPMJ/281-782F-------------------------------------------------I.D....EI..P.........HW.......
B2FPN6_STRMK/269-794N-------------------------------------------------LRAD.GMQD..G.........AL.......
B4EPR5_BURCJ/303-860N-------------------------------------------------LAA....EG..E..........K.......
L7WBB4_NONDD/242-736N-------------------------------------------------LET....EI..G..........D.......
E8WYV5_GRATM/244-730N-------------------------------------------------LQA....EI..P..........D.......
R5NRY2_9PORP/247-732N-------------------------------------------------LKK....EL..P..........H.......
S8F5G2_FOMPI/257-774N-------------------------------------------------AEE....EI..P.........TF.......
J4KLI3_BEAB2/265-769N-------------------------------------------------AEK....EI..P.........NF.......
G0J3Z4_CYCMS/229-757N-------------------------------------------------KKE....EL..P..........H.......
D2QG27_SPILD/252-752N-------------------------------------------------L.A....EI..G..........N.......
Q759D8_ASHGO/342-852N-------------------------------------------------IVR....DI..PPE......HKF.......
F0R7B2_BACSH/262-750N-------------------------------------------------LAA....EI..P..........H.......
R6FAY9_9BACE/256-750N-------------------------------------------------AHS....EI..P.........HW.......
F3Z5Q3_9ACTN/260-756N-------------------------------------------------LTT....E...I.........PG.......
A6LCF6_PARD8/222-738N-------------------------------------------------LER....EI..A..........A.......
I3YLR2_ALIFI/247-701F-------------------------------------------------LAE....QI..P..........G.......
K2QZK9_MACPH/55-546F-------------------------------------------------LED....EL..PS........DA.......
F0SF03_PSESL/226-741N-------------------------------------------------LAR....EI..K..........D.......
F9XHL5_ZYMTI/256-758N-------------------------------------------------AER....EI..S.........DW.......
N1PC12_DOTSN/324-861N-------------------------------------------------LQA....EL..PC........SV.......
D2Q3X9_KRIFD/623-1153N-------------------------------------------------LEL....ELGAD..........S.......
I2FQ04_USTH4/298-813F-------------------------------------------------AAS....EI..PA.......FLF.......
R6XA16_9BACT/218-718N-------------------------------------------------L.N....EL..S..........G.......
C7PPX9_CHIPD/276-765N-------------------------------------------------LRA....EI..P..........G.......
R5MRY8_9BACE/246-740N-------------------------------------------------AHS....DI..P.........HW.......
R6SN01_9BACE/243-745N-------------------------------------------------YEA....EL.............KP......
F4C6P9_SPHS2/295-781N-------------------------------------------------LKE....EI..P..........F.......
D2QCX6_SPILD/245-773N-------------------------------------------------LKT....EL..S..........H.......
T0M9R2_COLGC/274-789N-------------------------------------------------MKR....EL..P.........DT.......
A0A0C4DST4_MAGP6/262-774N-------------------------------------------------AER....EI..P.........NF.......
R5I8Z8_9PORP/234-723N-------------------------------------------------LDS....EV..K..........H.......
R7LIY3_9BACT/52-535N-------------------------------------------------LEA....EQ..R..........G.......
B2HSF1_MYCMM/261-753N-------------------------------------------------LAA....EG..A.........AS.......
R6F0G4_9BACT/265-751N-------------------------------------------------LNA....EQ..N..........G.......
R6EVC1_9BACT/239-739N-------------------------------------------------L.K....EL..G..........N.......
R5M3G3_9BACE/219-734N-------------------------------------------------LQR....EL..A..........D.......
R6TIT6_9BACE/237-737N-------------------------------------------------L.K....EL..G..........D.......
B4EIV1_BURCJ/298-797N-------------------------------------------------LRA....EN..P..........ATDAR...
Q5L991_BACFN/274-761N-------------------------------------------------LQA....EA..A..........G.......
Q099T5_STIAD/279-767N-------------------------------------------------LDG....DL..P..........G.......
E5R5G1_LEPMJ/254-756N-------------------------------------------------AER....EI..PG.......PDF.......
Q59VA0_CANAL/271-776N-------------------------------------------------I......ED..E.........NF.......
W8EZC7_9BACT/264-748N-------------------------------------------------IRA....EI..P..........H.......
C7M5Q1_CAPOD/260-760N-------------------------------------------------LQT....EL..G..........N.......
C6WEC8_ACTMD/279-779N-------------------------------------------------LRA....EN..T..........G.......
B0T313_CAUSK/268-755N-------------------------------------------------LDS....DE..K..........G.......
R6TFX8_9BACE/278-765N-------------------------------------------------LQE....ET..G..........G.......
C6WHL9_ACTMD/612-1137N-------------------------------------------------LDL....EVSTS..........D.......
R6VUD4_9BACT/265-751N-------------------------------------------------LDH....EQ..Q..........G.......
U5W074_9ACTN/234-751N-------------------------------------------------LTA....ET..G.........TS.......
C7M4B4_CAPOD/265-742N-------------------------------------------------LEK....EI..G..........N.......
G2WSL9_VERDV/229-751N-------------------------------------------------AEE....EI..P.........EV.......
G2ND96_STREK/290-797N-------------------------------------------------LRQ....EI..A.........PR.......
F4CF68_SPHS2/236-734N-------------------------------------------------LDR....EL..G..........D.......
C1GGA7_PARBD/273-775N-------------------------------------------------AER....EQ..P.........DF.......
G2QSP3_THITE/223-732N-------------------------------------------------AER....EI..G.........DW.......
B5RUQ1_DEBHA/245-737N-------------------------------------------------IKN....DF..K.........DY.......
D4Z5J6_SPHJU/285-770N-------------------------------------------------LDA....E..............G.......
I3YHM3_ALIFI/278-761N-------------------------------------------------MQA....EC..P..........G.......
G0RVA4_HYPJQ/270-784N-------------------------------------------------AQS....EI..P.........RF.......
G3JDG1_CORMM/243-753S-------------------------------------------------AET....EI..GR.......PLE.......
S8ENP9_FOMPI/263-760Y-------------------------------------------------IDD....EL..PA........TK.......
F9XJZ4_ZYMTI/261-768L-------------------------------------------------AES....EL..P.........DF.......
G9MLE1_HYPVG/269-783N-------------------------------------------------AEK....EI..P.........NF.......
G8NTY4_GRAMM/260-746N-------------------------------------------------LDA....EE..S..........G.......
M3K288_CANMX/256-756N-------------------------------------------------I......ED..K.........NF.......
K2R029_MACPH/272-784N-------------------------------------------------AES....EI..P.........GY.......
F2ICV0_FLUTR/268-759N-------------------------------------------------MKY....ET..P..........D.......
F3ZHF5_9ACTN/295-773N-------------------------------------------------VRA....ES..A..........G.......
D5BFU1_ZUNPS/300-789N-------------------------------------------------MKK....EV..P..........N.......
R7DGR9_9PORP/234-734N-------------------------------------------------L.K....EL..G..........D.......
A5FF75_FLAJ1/239-766N-------------------------------------------------IET....EL..P..........Y.......
G2Z075_FLABF/225-715N-------------------------------------------------LQT....EI..P..........H.......
E8X698_GRATM/269-765N-------------------------------------------------LNA....EV..A..........G.......
V2WSZ4_MONRO/282-799N-------------------------------------------------LDS....EV..G.........SS.......
K1X3Q1_MARBU/245-749N-------------------------------------------------AES....EI..P.........NF.......
M2TXV2_COCH5/277-776F-------------------------------------------------KDE....EI..K.........SW.......
R5PTZ2_9BACT/224-709N-------------------------------------------------MKA....EM..P..........G.......
R6DAV4_9BACE/249-751N-------------------------------------------------LDT....EI..P..........D.......
M2NEA8_BAUCO/263-772N-------------------------------------------------AVS....EI..P.........TF.......
A0A0C4DMF0_MAGP6/256-752N-------------------------------------------------LED....QV..PA........GT.......
K8E6J4_CARML/214-711N-------------------------------------------------FSR....EN.............Q.......
F9XNM6_ZYMTI/270-780N-------------------------------------------------AQT....EI..P.........DF.......
R5KV09_9BACT/241-727N-------------------------------------------------MQR....EA..A..........S.......
I0KEB5_9BACT/243-742N-------------------------------------------------L.G....EL..G..........T.......
R7J4K5_9PORP/111-614N-------------------------------------------------LKT....EI..S..........DP......
R6CRV2_9BACE/268-755N-------------------------------------------------LRA....EA..S..........G.......
T0JX50_COLGC/252-747N-------------------------------------------------VNA....EI..PA........DK.......
M7TSY3_BOTF1/251-757N-------------------------------------------------VNN....EI..PD........DT.......
I3YNM9_ALIFI/265-751N-------------------------------------------------LEA....EQ..Q..........E.......
F4C7I4_SPHS2/295-771N-------------------------------------------------LRT....EI..K..........D.......
A1S298_SHEAM/257-758N-------------------------------------------------LRR....EI..G..........G.......
U5Q3W7_9BACT/229-716N-------------------------------------------------LES....EI..D..........N.......
E4RWA0_LEAB4/233-733N-------------------------------------------------L.K....EL..G..........T.......
C7PN00_CHIPD/257-749N-------------------------------------------------LVA....EA..T..........G.......
B6HMT5_PENCW/260-763N-------------------------------------------------AEA....EV..PE.......PED.......
I3YNN1_ALIFI/246-730N-------------------------------------------------MQA....EL..P..........G.......
C7PBJ2_CHIPD/233-716N-------------------------------------------------LEK....EI..G..........Q.......
U1HIK3_ENDPU/223-713S-------------------------------------------------VQR....EI..PA........TS.......
D8PPV4_SCHCM/274-762N-------------------------------------------------VDN....EI..P..........D.......
K5VRS2_PHACS/288-802N-------------------------------------------------AES....EV..G.........DS.......
C7MEN4_BRAFD/401-930T-------------------------------------------------FDL....EL.AG..........R.......
E9E5Q1_METAQ/271-791N-------------------------------------------------AEA....EI..P.........DF.......
R6VYQ1_9BACT/267-757N-------------------------------------------------LR.....ET..D..........G.......
V6JHL2_STRRC/315-798N-------------------------------------------------LAS....EV..R..........N.......
R6F0X9_9BACE/243-743N-------------------------------------------------L.R....EV..E..........G.......
R7DJ79_9PORP/248-732N-------------------------------------------------IVS....EI..P..........E.......
N1JJ74_BLUG1/241-757S-------------------------------------------------AET....EI..P.........EY.......
R5CB12_9BACE/293-780N-------------------------------------------------LQA....EA..A..........Q.......
D6D181_9BACE/239-737T-------------------------------------------------LND....EL..G..........K.......
H8KNH9_SOLCM/233-718A-------------------------------------------------LDA....E...K..........G.......
F4KQF8_HALH1/236-733N-------------------------------------------------LQR....EI..G..........A.......
R5IB22_9PORP/238-729N-------------------------------------------------MMS....EI..S..........H.......
R6YV68_9BACE/255-749N-------------------------------------------------LLT....EV..R..........D.......
Q6CNV6_KLULA/310-818N-------------------------------------------------LLD....DY..PED......SQF.......
U5W551_9ACTN/255-723N-------------------------------------------------ATA....ET..A..........A.......
Q7S947_NEUCR/263-767H-------------------------------------------------AES....EI..P.........DF.......
B6QAQ2_PENMQ/267-763N-------------------------------------------------GEK....EI..P.........DF.......
C7PXX1_CATAD/362-846N-------------------------------------------------LAA....EQ..T..........G.......
F4CCU7_SPHS2/241-741N-------------------------------------------------L.K....EI..G..........N.......
C6X1W4_FLAB3/266-755N-------------------------------------------------LEA....EI..P..........H.......
G0FQH3_AMYMS/372-894N-------------------------------------------------LEL....EIPAG..........T.......
A1S315_SHEAM/327-827N-------------------------------------------------LIA....EQ..A..........H.......
E6SVM9_BACT6/267-748N-------------------------------------------------LEV....EQ..K..........G.......
R6FB01_9BACE/264-752N-------------------------------------------------LEA....EI..P..........H.......
R6WZ31_9PORP/239-739N-------------------------------------------------L.K....EL..G..........D.......
Q826D8_STRAW/248-758N-------------------------------------------------LRS....AE..G.........RS.......
R6X226_9PORP/240-731S-------------------------------------------------LQK....EN..P..........A.......
R6LH54_9BACE/272-772N-------------------------------------------------L.K....EL..G..........S.......
R4LBG1_9ACTN/595-1120N-------------------------------------------------LDL....EV.TG..........R.......
G9NN10_HYPAI/258-762N-------------------------------------------------AQR....EI..PS.......PLK.......
F4CBM6_SPHS2/270-759N-------------------------------------------------MQA....EI..P..........H.......
H1Y1A2_9SPHI/239-746N-------------------------------------------------LDT....EV..P..........D.......
Q9CFH5_LACLA/204-698N-------------------------------------------------LER....EQ.............D.......
C5BZR8_BEUC1/383-897N-------------------------------------------------LT.....EV..S..........G.......
E8RV90_ASTEC/245-718L-------------------------------------------------LDQ....EI..P..........D.......
I3ZBQ9_TERRK/288-775N-------------------------------------------------MDA....EV..P..........A.......
W5WNG1_9PSEU/607-1138N-------------------------------------------------LEQ....EVSAA..........D.......
R5JGM2_9BACE/244-744N-------------------------------------------------L.E....EI..G..........S.......
M3A2E6_PSEFD/230-729N-------------------------------------------------LEI....EA..P..........A.......
G8BG81_CANPC/256-743N-------------------------------------------------I.......N..Y.........QQ.......
I6NCS8_ERECY/337-847N-------------------------------------------------IAI....DY..PEE......HKF.......
W0F3Z3_9SPHI/269-758N-------------------------------------------------LRI....ET..P..........G.......
R5UGR2_9BACE/236-713N-------------------------------------------------LET....EL..P..........G.......
R5JG70_9BACE/239-739N-------------------------------------------------L.Q....EL..G..........N.......
H1Y4F6_9SPHI/259-745N-------------------------------------------------MAA....EL..P..........G.......
I0KBV7_9BACT/258-770N-------------------------------------------------FEA....EA..S..........G.......
C7PM40_CHIPD/274-748N-------------------------------------------------LQA....EI..K..........G.......
R7DDY6_9PORP/216-732N-------------------------------------------------MER....EQ..K..........F.......
K9FZU0_PEND2/320-823N-------------------------------------------------LEI....QT..P..........D.......
G8UK11_TANFA/263-747N-------------------------------------------------LQA....EL..P..........G.......
H8KM31_SOLCM/246-738N-------------------------------------------------LAA....ES..P..........G.......
D5BC60_ZUNPS/250-762N-------------------------------------------------FAK....EA..K..........D.......
R4SVW2_AMYOR/376-888N-------------------------------------------------LDQ....EIPAG..........T.......
R7DDV2_9PORP/212-727N-------------------------------------------------LQN....EI..P..........D.......
Y584_MYCTU/259-751N-------------------------------------------------LDA....EG..G.........AS.......
R6WV75_9BACT/212-714N-------------------------------------------------MQT....EL.............GP......
B2WBV9_PYRTR/254-739N-------------------------------------------------LE.....EI..TE........NK.......
D3I9D1_9BACT/237-737N-------------------------------------------------L.K....EL..K..........D.......
D5ES75_PRER2/226-712N-------------------------------------------------LKA....EL..P..........G.......
R5RRS9_9BACE/236-755N-------------------------------------------------LDA....EQ..N..........G.......
R6MN58_9BACE/248-751N-------------------------------------------------LDA....EI..P..........A.......
D7C6N5_STRBB/606-1133N-------------------------------------------------LDR....EIPAS..........A.......
U7PQB8_SPOS1/253-757N-------------------------------------------------VNS....QV..PP........GT.......
R7JIM0_9PORP/271-758N-------------------------------------------------LQA....EA..A..........S.......
M7TB74_EUTLA/294-802R-------------------------------------------------ATD....EI..PD.......ALG.......
G0G342_AMYMS/285-763N-------------------------------------------------ADL....EQ..R..........H.......
R5JRR1_9BACE/254-758N-------------------------------------------------LEK....EM..I..........RP......
A6LFI6_PARD8/246-748N-------------------------------------------------LEA....EL..P..........G.......
A5DND2_PICGU/248-740N-------------------------------------------------IEN....EL..S.........GY.......
F3ZHW0_9ACTN/256-766N-------------------------------------------------LRA....EG..G.........TS.......
V2XIK0_MONRO/301-813N-------------------------------------------------AEQ....DI..P.........DF.......
K5WLA8_AGABU/297-800N-------------------------------------------------LEL....EI..P..........NPQPDLTN
V2WYF3_MONRO/235-747N-------------------------------------------------AEE....EI..P.........DW.......
Q5LHE9_BACFN/242-731N-------------------------------------------------LAA....EV..P..........E.......
F2KXB7_PREDF/254-736N-------------------------------------------------LNA....EI..S..........C.......

PF05860

Q9K0S7_NEIMB/78-201---------------------------------------------------------DKSAP------------------
Q9CPI1_PASMU/122-258---------------------------------------------------------AHHDA------------------
P73032_SYNY3/38-157---------------------------------------------------------AQNIT------------------
HXUA1_HAEIN/23-136---------------------------------------------------------ARDLP------------------
Q8XYI3_RALSO/66-200---------------------------------------------------------DRSVP------------------
Q8YM34_NOSS1/26-139---------------------------------------------------------AQVIP------------------
Q8YM26_NOSS1/34-153---------------------------------------------------------AQVTS------------------
Q8XSD6_RALSO/71-208---------------------------------------------------------AQVVA------------------
Q8YX21_NOSS1/35-151---------------------------------------------------------TTLGS------------------
Q9K0T0_NEIMB/84-219---------------------------------------------------------DKSAP------------------
Q8YKQ8_NOSS1/28-144---------------------------------------------------------AQINA------------------
Q9AAJ5_CAUCR/22-135---------------------------------------------------------SQGGP------------------
Q8YZU0_NOSS1/29-144---------------------------------------------------------AQVTA------------------
Q9PEY9_XYLFA/72-207---------------------------------------------------------DPHAP------------------
Q9I791_PSEAE/29-168---------------------------------------------------------AGLAL------------------
Q8YV10_NOSS1/28-152---------------------------------------------------------AEIIP------------------
Q8P9Q5_XANCP/41-176---------------------------------------------------------PTPNP------------------
Q8XPV0_RALSO/28-144---------------------------------------------------------AGIVP------------------
Q8YM30_NOSS1/29-148---------------------------------------------------------AQVTS------------------
Q9HVN6_PSEAE/51-166---------------------------------------------------------AFALP------------------
Q9I5N6_PSEAE/132-249---------------------------------------------------------DASLP------------------
Q8YVR8_NOSS1/44-162---------------------------------------------------------PDQTL------------------
Q8YM29_NOSS1/26-145---------------------------------------------------------AQVTS------------------
Q9HVG6_PSEAE/40-153---------------------------------------------------------AMAAP------------------
Q8YM35_NOSS1/26-137---------------------------------------------------------AQVTS------------------
FHAB_BORPE/71-205---------------------------------------------------------AQGLV------------------
Q8YNX6_NOSS1/33-149---------------------------------------------------------DSTLP------------------
Q8YXM8_NOSS1/29-153---------------------------------------------------------TQLNP------------------
Q8YLL8_NOSS1/28-146---------------------------------------------------------AQITQ------------------
Q8XQZ5_RALSO/71-206---------------------------------------------------------DPGAP------------------
Q9HWU6_PSEAE/51-167---------------------------------------------------------AYALP------------------
Q8XQ42_RALSO/54-167---------------------------------------------------------AFAAP------------------
Q8XPU1_RALSO/114-253---------------------------------------------------------DPTAP------------------
Q8YM31_NOSS1/26-139---------------------------------------------------------AQVTP------------------
Q8YKI4_NOSS1/31-147---------------------------------------------------------AQITP------------------
B4F0Z9_PROMH/33-166---------------------------------------------------------...VP------------------
C5BBG7_EDWI9/32-166---------------------------------------------------------..IVP------------------
G1UB82_HAEDU/106-235---------------------------------------------------------...GA------------------
Q7DDD8_NEIMB/84-217---------------------------------------------------------.KSAP------------------
Q7VLE8_HAEDU/114-240---------------------------------------------------------.....------------------
Q7VLT6_HAEDU/25-160---------------------------------------------------------.DIVS------------------
Q8RI19_FUSNN/27-164---------------------------------------------------------..LVV------------------
Q9CPH9_PASMU/119-250---------------------------------------------------------....L------------------

PF13332

D1APU8_SEBTE/1787-1948.-------------------------------------------------------------------------------
D1AGZ0_SEBTE/1910-2071.-------------------------------------------------------------------------------
D1AS25_SEBTE/1798-1959.-------------------------------------------------------------------------------
D1AG88_SEBTE/1784-1945.-------------------------------------------------------------------------------
C7LTZ8_DESBD/1999-2170.-------------------------------------------------------------------------------
A6X424_OCHA4/234-403.-------------------------------------------------------------------------------
D2U945_XANAP/448-623.-------------------------------------------------------------------------------
B0UW75_HISS2/318-493A-------------------------------------------------------------------------------
Q0K4M6_CUPNH/2024-2201.-------------------------------------------------------------------------------
Q6D5C2_PECAS/4139-4306.-------------------------------------------------------------------------------
C5BAK2_EDWI9/2863-3032.-------------------------------------------------------------------------------
Q9P9U6_XYLFA/2525-2700.-------------------------------------------------------------------------------
Q9K0T0_NEIMB/1853-2027G-------------------------------------------------------------------------------
Q1LCC6_RALME/2237-2414.-------------------------------------------------------------------------------
A9BSR3_DELAS/1302-1471.-------------------------------------------------------------------------------
Q8XYI3_RALSO/2318-2490.-------------------------------------------------------------------------------
A4G2E3_HERAR/1450-1621.-------------------------------------------------------------------------------
A6VN27_ACTSZ/1852-2027.-------------------------------------------------------------------------------
D0IXU6_COMT2/433-603.-------------------------------------------------------------------------------
Q7N911_PHOLL/3665-3839.-------------------------------------------------------------------------------
Q1H434_METFK/1347-1522.-------------------------------------------------------------------------------
Q7NU32_CHRVO/3082-3255S-------------------------------------------------------------------------------
B2JXD4_BURP8/2246-2424.-------------------------------------------------------------------------------
D2RM28_ACIFV/822-989.-------------------------------------------------------------------------------
C9LS29_SELS3/1059-1224.-------------------------------------------------------------------------------
Q143Z8_BURXL/2299-2473.-------------------------------------------------------------------------------
Q140X1_BURXL/260-438.-------------------------------------------------------------------------------
A8ETC6_ARCB4/2319-2486.-------------------------------------------------------------------------------
Q140X4_BURXL/2614-2790.-------------------------------------------------------------------------------
B2JV25_BURP8/2057-2238G-------------------------------------------------------------------------------
D1BMQ3_VEIPT/1399-1572.-------------------------------------------------------------------------------
C5AEA6_BURGB/711-883.-------------------------------------------------------------------------------
C5D1Z2_VARPS/2965-3139G-------------------------------------------------------------------------------
Q6FDM3_ACIAD/2917-3080L-------------------------------------------------------------------------------
D1BNY3_VEIPT/1277-1447.-------------------------------------------------------------------------------
Q0BRJ1_GRABC/3343-3512.-------------------------------------------------------------------------------
A8GKD6_SERP5/931-1096A-------------------------------------------------------------------------------
A0RNY6_CAMFF/1383-1550.-------------------------------------------------------------------------------
Q2KX68_BORA1/1752-1925.-------------------------------------------------------------------------------
E6VYY1_DESAO/1086-1253A-------------------------------------------------------------------------------
D3VFR2_XENNA/1025-1191A-------------------------------------------------------------------------------
D3UYN1_XENBS/1023-1189.-------------------------------------------------------------------------------
Q7VVJ2_BORPE/2180-2357H-------------------------------------------------------------------------------
Q7NWR2_CHRVO/941-1107.-------------------------------------------------------------------------------
D3UFL2_HELM1/1506-1673I-------------------------------------------------------------------------------
D3UFL2_HELM1/1687-1845A-------------------------------------------------------------------------------
A3N0W9_ACTP2/1886-2054.-------------------------------------------------------------------------------
B4F0Z9_PROMH/927-1093.-------------------------------------------------------------------------------
C5AJP7_BURGB/2314-2492.-------------------------------------------------------------------------------
D2U951_XANAP/1315-1477.-------------------------------------------------------------------------------
CDIA_DICD3/2492-2661.-------------------------------------------------------------------------------
M9X2Y4_MANHA/1910-2075.-------------------------------------------------------------------------------
FHAB_BORPE/2928-3086.-------------------------------------------------------------------------------
Q0WAT6_YERPE/1232-1406.-------------------------------------------------------------------------------
Q0WAT6_YERPE/638-798.-------------------------------------------------------------------------------
Q0WE34_YERPE/1754-1929.-------------------------------------------------------------------------------
Q7DDD8_NEIMB/1460-1630.-------------------------------------------------------------------------------
Q7VV06_BORPE/2141-2297.-------------------------------------------------------------------------------
Q8RGK3_FUSNN/9-171.-------------------------------------------------------------------------------
Q8XQZ5_RALSO/2322-2494.-------------------------------------------------------------------------------
Q9CPH9_PASMU/1932-2088K-------------------------------------------------------------------------------
W8UEG9_YEREN/1054-1220.-------------------------------------------------------------------------------

PF05594

Q8P9Q5_XANCP/1557-1633--------------------------------------------------------------------------------
Q9JPJ4_NEIME/637-700--------------------------------------------------------------------------------
Q9I120_PSEAE/2589-2647--------------------------------------------------------------------------------
A0A027YSC5_ECOLX/815-886--------------------------------------------------------------------------------
Q9I791_PSEAE/595-645--------------------------------------------------------------------------------
Q8P9Q5_XANCP/1172-1235--------------------------------------------------------------------------------
Q9I120_PSEAE/1336-1393--------------------------------------------------------------------------------
G1UB82_HAEDU/627-686--------------------------------------------------------------------------------
Q8P9Q5_XANCP/1040-1116--------------------------------------------------------------------------------
Q8KT64_PHOLU/1243-1335--------------------------------------------------------------------------------
Q9I120_PSEAE/1841-1914--------------------------------------------------------------------------------
Q9I120_PSEAE/215-293--------------------------------------------------------------------------------
A0A027YSC5_ECOLX/919-990--------------------------------------------------------------------------------
Q47955_HAEDC/208-282--------------------------------------------------------------------------------
Q9I120_PSEAE/2670-2751--------------------------------------------------------------------------------
FHAB_BORPE/1684-1755--------------------------------------------------------------------------------
O32608_EDWTA/679-758--------------------------------------------------------------------------------
Q9JY30_NEIMB/1201-1277--------------------------------------------------------------------------------
A5TVV7_FUSNP/999-1074--------------------------------------------------------------------------------
Q8PLI3_XANAC/426-488--------------------------------------------------------------------------------
Q8KT64_PHOLU/660-719--------------------------------------------------------------------------------
Q9I120_PSEAE/2089-2158--------------------------------------------------------------------------------
Q8P9Q5_XANCP/781-857--------------------------------------------------------------------------------
O32608_EDWTA/409-454--------------------------------------------------------------------------------
Q9K0T0_NEIMB/769-825--------------------------------------------------------------------------------
Q9I120_PSEAE/1447-1498--------------------------------------------------------------------------------
Q7DDD8_NEIMB/265-346--------------------------------------------------------------------------------
Q9K0T0_NEIMB/400-459--------------------------------------------------------------------------------
Q9I120_PSEAE/382-460--------------------------------------------------------------------------------
Q9JP78_BORBO/434-481--------------------------------------------------------------------------------
FHAB_BORPE/1233-1308--------------------------------------------------------------------------------
Q9I120_PSEAE/1752-1810--------------------------------------------------------------------------------
Q9PBE8_XYLFA/878-937--------------------------------------------------------------------------------
A0A027YSC5_ECOLX/1075-1143--------------------------------------------------------------------------------
A5TVV7_FUSNP/2900-2961--------------------------------------------------------------------------------
Q9I120_PSEAE/2281-2332--------------------------------------------------------------------------------
Q9JP78_BORBO/1722-1793--------------------------------------------------------------------------------
A0A027YSC5_ECOLX/209-286--------------------------------------------------------------------------------
Q8RGZ3_FUSNN/335-393--------------------------------------------------------------------------------
A5TVV7_FUSNP/868-940--------------------------------------------------------------------------------
Q8PLI3_XANAC/3495-3547--------------------------------------------------------------------------------
Q8XPV0_RALSO/434-523--------------------------------------------------------------------------------
Q8P9Q5_XANCP/224-302--------------------------------------------------------------------------------
FHAB_BORPE/613-679--------------------------------------------------------------------------------
Q88MW9_PSEPK/1040-1119--------------------------------------------------------------------------------
Q9JY23_NEIMB/250-326--------------------------------------------------------------------------------
Q9JY30_NEIMB/268-358--------------------------------------------------------------------------------
Q9PEY9_XYLFA/2190-2268--------------------------------------------------------------------------------
Q9PBE8_XYLFA/1117-1202--------------------------------------------------------------------------------
Q8PLI3_XANAC/921-986--------------------------------------------------------------------------------
HLYA_PROMI/214-285--------------------------------------------------------------------------------
Q9JY30_NEIMB/1708-1775--------------------------------------------------------------------------------
Q9L6B0_PASMD/305-383--------------------------------------------------------------------------------
Q9PEY9_XYLFA/255-333--------------------------------------------------------------------------------
Q8P9Q5_XANCP/641-717--------------------------------------------------------------------------------
Q9PEY9_XYLFA/465-546--------------------------------------------------------------------------------
FHAB_BORPE/257-336--------------------------------------------------------------------------------
Q8PLI3_XANAC/611-700--------------------------------------------------------------------------------
O32608_EDWTA/1127-1173--------------------------------------------------------------------------------
Q9I791_PSEAE/1475-1550--------------------------------------------------------------------------------
G1UB82_HAEDU/884-936--------------------------------------------------------------------------------
Q8P9Q5_XANCP/2538-2612--------------------------------------------------------------------------------
G1UB82_HAEDU/481-539--------------------------------------------------------------------------------
Q8PLI3_XANAC/1452-1504--------------------------------------------------------------------------------
Q9PBE8_XYLFA/1219-1280--------------------------------------------------------------------------------
Q9ZHL3_HAEDC/302-381--------------------------------------------------------------------------------
Q8PLI3_XANAC/2485-2591--------------------------------------------------------------------------------
G1UB82_HAEDU/294-378--------------------------------------------------------------------------------
Q9I120_PSEAE/314-379--------------------------------------------------------------------------------
Q9L6B0_PASMD/576-644--------------------------------------------------------------------------------
Q9CPI1_PASMU/1325-1400--------------------------------------------------------------------------------
Q9CPI1_PASMU/310-387--------------------------------------------------------------------------------
FHAB_BORPE/1442-1538--------------------------------------------------------------------------------
Q8KT64_PHOLU/1391-1522--------------------------------------------------------------------------------
A5TVV7_FUSNP/212-286--------------------------------------------------------------------------------
Q8XPV0_RALSO/204-291--------------------------------------------------------------------------------
Q9I120_PSEAE/3353-3428--------------------------------------------------------------------------------
Q8XUK5_RALSO/656-729--------------------------------------------------------------------------------
Q9JPJ4_NEIME/882-953--------------------------------------------------------------------------------
Q8P9Q5_XANCP/345-458--------------------------------------------------------------------------------
HLYA_SERMA/226-296--------------------------------------------------------------------------------
Q8PLI3_XANAC/2321-2395--------------------------------------------------------------------------------
Q7N9K8_PHOLL/217-289--------------------------------------------------------------------------------
Q9I120_PSEAE/2996-3080--------------------------------------------------------------------------------
Q9PEY9_XYLFA/586-685--------------------------------------------------------------------------------
Q8KT64_PHOLU/782-834--------------------------------------------------------------------------------
Q8P9Q5_XANCP/1258-1335--------------------------------------------------------------------------------
Q8KT64_PHOLU/342-422--------------------------------------------------------------------------------
Q9ZHL3_HAEDC/464-521--------------------------------------------------------------------------------
Q9P9U6_XYLFA/773-832--------------------------------------------------------------------------------
Q8PLI3_XANAC/1567-1643--------------------------------------------------------------------------------
A5TVV7_FUSNP/1095-1173--------------------------------------------------------------------------------
Q9I120_PSEAE/3706-3776--------------------------------------------------------------------------------
Q9I120_PSEAE/3221-3335--------------------------------------------------------------------------------
Q9JP78_BORBO/651-717--------------------------------------------------------------------------------
Q8PLI3_XANAC/2019-2068--------------------------------------------------------------------------------
Q8PLI3_XANAC/1182-1245--------------------------------------------------------------------------------
O32608_EDWTA/1021-1083--------------------------------------------------------------------------------
Q8PLI3_XANAC/1050-1126--------------------------------------------------------------------------------
Q9RGD1_BARHN/6-64--------------------------------------------------------------------------------
Q8PLI3_XANAC/1905-1991--------------------------------------------------------------------------------
Q9L6B0_PASMD/1419-1494--------------------------------------------------------------------------------
Q9I120_PSEAE/3496-3558--------------------------------------------------------------------------------
O32608_EDWTA/214-285--------------------------------------------------------------------------------
Q9CPI1_PASMU/559-626--------------------------------------------------------------------------------
Q8KT64_PHOLU/2597-2661--------------------------------------------------------------------------------
Q9K0T0_NEIMB/606-662--------------------------------------------------------------------------------
Q8P9Q5_XANCP/2262-2320--------------------------------------------------------------------------------
Q8KT64_PHOLU/440-510--------------------------------------------------------------------------------
Q9I120_PSEAE/617-667--------------------------------------------------------------------------------
Q9ZHL3_HAEDC/651-728--------------------------------------------------------------------------------
HLYA_PROMI/1200-1264--------------------------------------------------------------------------------
Q8PLI3_XANAC/3289-3387--------------------------------------------------------------------------------
Q9JY30_NEIMB/930-997--------------------------------------------------------------------------------
Q9I120_PSEAE/2169-2227--------------------------------------------------------------------------------
FHAB_BORPE/947-1021--------------------------------------------------------------------------------
Q8KT64_PHOLU/2861-2951--------------------------------------------------------------------------------
Q9PBE8_XYLFA/2062-2138--------------------------------------------------------------------------------
Q9I120_PSEAE/1670-1741--------------------------------------------------------------------------------
A0A027YSC5_ECOLX/354-435--------------------------------------------------------------------------------
Q8PLI3_XANAC/1759-1823--------------------------------------------------------------------------------
Q9JY30_NEIMB/361-426--------------------------------------------------------------------------------
Q47955_HAEDC/409-504--------------------------------------------------------------------------------
Q8RGK2_FUSNN/195-268--------------------------------------------------------------------------------
Q88MW9_PSEPK/219-293--------------------------------------------------------------------------------
O32608_EDWTA/1428-1532--------------------------------------------------------------------------------
Q8PLI3_XANAC/989-1047--------------------------------------------------------------------------------
Q9JPJ4_NEIME/527-610--------------------------------------------------------------------------------
Q9PBE8_XYLFA/1297-1360--------------------------------------------------------------------------------
Q8P9Q5_XANCP/1895-1981--------------------------------------------------------------------------------
Q8KT64_PHOLU/2531-2595--------------------------------------------------------------------------------
FHAB_BORPE/1560-1635--------------------------------------------------------------------------------
Q8KT64_PHOLU/1662-1732--------------------------------------------------------------------------------
Q9I120_PSEAE/4534-4605--------------------------------------------------------------------------------
Q8PLI0_XANAC/107-201--------------------------------------------------------------------------------
Q8P9Q5_XANCP/919-976--------------------------------------------------------------------------------
Q8P9Q5_XANCP/481-558--------------------------------------------------------------------------------
O32608_EDWTA/494-532--------------------------------------------------------------------------------
Q8PLI3_XANAC/491-568--------------------------------------------------------------------------------
Q9I120_PSEAE/2493-2557--------------------------------------------------------------------------------
Q9I791_PSEAE/2650-2727--------------------------------------------------------------------------------
Q9ZHL3_HAEDC/759-809--------------------------------------------------------------------------------
Q8KT64_PHOLU/257-334--------------------------------------------------------------------------------
Q9I120_PSEAE/3156-3216--------------------------------------------------------------------------------
G1UB82_HAEDU/773-850--------------------------------------------------------------------------------
Q8P9Q5_XANCP/1816-1892--------------------------------------------------------------------------------
Q8RGZ3_FUSNN/599-673--------------------------------------------------------------------------------
Q88MW9_PSEPK/1135-1205--------------------------------------------------------------------------------
Q9PBE8_XYLFA/1003-1082--------------------------------------------------------------------------------
Q8KT64_PHOLU/565-616--------------------------------------------------------------------------------
Q8RGZ3_FUSNN/22-93--------------------------------------------------------------------------------
Q8P9Q5_XANCP/1431-1493--------------------------------------------------------------------------------
Q8P9Q5_XANCP/720-778--------------------------------------------------------------------------------
FHAB_BORPE/491-557--------------------------------------------------------------------------------
A0A027YSC5_ECOLX/697-765--------------------------------------------------------------------------------
Q9K0T0_NEIMB/486-548--------------------------------------------------------------------------------
Q9PEY9_XYLFA/711-768--------------------------------------------------------------------------------

PF13229

A4HFK4_LEIBR/1122-1276.-------------------------------------------------...HETT.....------------------
A4RWC7_OSTLU/255-410.-------------------------------------------------....NAL.....------------------
C1MV84_MICPC/432-587.-------------------------------------------------....DAL.....------------------
A0B575_METTP/145-292.-------------------------------------------------............------------------
B1LZG7_METRJ/126-306.-------------------------------------------------....HVT.....------------------
B8IPB3_METNO/205-368.-------------------------------------------------....NWQ.....------------------
Q1IR31_KORVE/209-372.-------------------------------------------------....GWT.....------------------
Q1IJK3_KORVE/204-367.-------------------------------------------------............------------------
D2PZ24_KRIFD/241-418.-------------------------------------------------......R.....------------------
D2PZ28_KRIFD/298-476.-------------------------------------------------......K.....------------------
D1CII1_THET1/254-430.-------------------------------------------------....WWT.....------------------
Q5KIH2_CRYNJ/125-330.-------------------------------------------------.....QT.....------------------
A2DQI5_TRIVA/133-313.-------------------------------------------------......M.....------------------
A2GN59_TRIVA/178-358.-------------------------------------------------......T.....------------------
A2DSW4_TRIVA/295-476.-------------------------------------------------.....FT.....------------------
D2VXU7_NAEGR/1914-2119.-------------------------------------------------......T.....------------------
D3E003_METRM/246-408.-------------------------------------------------.....IS.....------------------
D2VGY1_NAEGR/119-306.-------------------------------------------------...QNNT.....------------------
A5UJV8_METS3/96-251.-------------------------------------------------............------------------
D7DS12_METV3/546-725.-------------------------------------------------.....TN.....------------------
D7DT96_METV3/87-251.-------------------------------------------------............------------------
A5UN24_METS3/1015-1205.-------------------------------------------------.....TV.....------------------
D3DZT1_METRM/1034-1216.-------------------------------------------------.....AV.....------------------
A5UNL3_METS3/391-540.-------------------------------------------------......S.....------------------
Q2NFB2_METST/846-1038.-------------------------------------------------....NTT.....------------------
A5UN26_METS3/210-367.-------------------------------------------------............------------------
Q11PH9_CYTH3/3751-3918.-------------------------------------------------....YGT.....------------------
A2DZP5_TRIVA/237-393.-------------------------------------------------....PIK.....------------------
A2EWG4_TRIVA/238-392.-------------------------------------------------......E.....------------------
Q2K708_RHIEC/156-330.-------------------------------------------------.....VK.....------------------
C6X284_FLAB3/105-267.-------------------------------------------------.....SV.....------------------
B7GKQ0_ANOFW/105-265.-------------------------------------------------.....VT.....------------------
A5UM93_METS3/570-727.-------------------------------------------------.....VM.....------------------
B1Y807_LEPCP/135-286.-------------------------------------------------.....AR.....------------------
C4ZN21_THASP/165-316.-------------------------------------------------.....AR.....------------------
Q5NZ04_AROAE/165-316.-------------------------------------------------.....AK.....------------------
A7ZFW4_CAMC1/149-307.-------------------------------------------------.....NL.....------------------
D4H675_DENA2/149-307.-------------------------------------------------......N.....------------------
A2F6G3_TRIVA/566-720.-------------------------------------------------.....LS.....------------------
B2A266_NATTJ/667-827.-------------------------------------------------......M.....------------------
D3DZT1_METRM/180-349.-------------------------------------------------............------------------
Q21PK3_SACD2/316-486.-------------------------------------------------............------------------
A8ZSU8_DESOH/610-786.-------------------------------------------------......S.....------------------
Q01V78_SOLUE/318-510.-------------------------------------------------....RNQ.....------------------
B4NKK3_DROWI/907-1062.-------------------------------------------------.....PV.....------------------
Q1RQ01_CIOIN/615-770.-------------------------------------------------.....PV.....------------------
Q1RQ01_CIOIN/338-494.-------------------------------------------------....NPT.....------------------
A8LUC6_DINSH/146-309.-------------------------------------------------.....VL.....------------------
A9WDN6_CHLAA/503-681.-------------------------------------------------....GCS.....------------------
Q0W3D6_METAR/107-264.-------------------------------------------------......E.....------------------
D2RS85_HALTV/217-421.-------------------------------------------------.....VQ.....------------------
A9B4J4_HERA2/210-386.-------------------------------------------------.....QTLGFVI------------------
D3F6E1_CONWI/144-334.-------------------------------------------------.....YA.....------------------
Q4E3J7_TRYCC/564-717.-------------------------------------------------....NAV.....------------------
Q8ZXB6_PYRAE/124-281.-------------------------------------------------.....VL.....------------------
B5IFT4_ACIB4/648-827.-------------------------------------------------.....SEDNPYI------------------
Y1396_METJA/2174-2323.-------------------------------------------------......E.....------------------
A8XCU4_CAEBR/377-555.-------------------------------------------------.....IN.....------------------
A8XCU4_CAEBR/835-1021.-------------------------------------------------.....IE.....------------------
B8GIH1_METPE/210-388Q-------------------------------------------------.DGTRVGSGSYA------------------
Q6LZ14_METMP/541-702.-------------------------------------------------.....AD.....------------------
B8GKS8_METPE/88-248T-------------------------------------------------VQLSNVT.....------------------
B1L3G7_KORCO/159-312.-------------------------------------------------.....CS.....------------------
Q8TR94_METAC/114-266.-------------------------------------------------.....CQ.....------------------
Q12Y38_METBU/125-275.-------------------------------------------------.....SV.....------------------
Q12Z43_METBU/104-256.-------------------------------------------------.....AF.....------------------
Q8TLY7_METAC/117-269.-------------------------------------------------.....CI.....------------------
Q8TQN2_METAC/592-749.-------------------------------------------------......I.....------------------
Q8THN3_METAC/410-561.-------------------------------------------------.....CT.....------------------
Q8TMY7_METAC/1017-1166.-------------------------------------------------.....AR.....------------------
D2VGW6_NAEGR/142-294.-------------------------------------------------............------------------
A2DG23_TRIVA/257-412.-------------------------------------------------.....AK.....------------------
Q4E3J7_TRYCC/767-933.-------------------------------------------------....SVT.....------------------
A2EXK6_TRIVA/265-421.-------------------------------------------------.....AV.....------------------
A4X252_SALTO/119-272.-------------------------------------------------.....FT.....------------------
B8GHS2_METPE/296-452.-------------------------------------------------......S.....------------------
A2DG23_TRIVA/493-649.-------------------------------------------------....EVK.....------------------
A2E713_TRIVA/471-626.-------------------------------------------------....GFS.....------------------
A2DGW8_TRIVA/182-337.-------------------------------------------------.....AF.....------------------
A2FYC7_TRIVA/339-494.-------------------------------------------------.....TT.....------------------
A2FPW6_TRIVA/308-481.-------------------------------------------------.....VS.....------------------
Q5WHY7_BACSK/106-258.-------------------------------------------------.....LD.....------------------
A2DIY9_TRIVA/83-240.-------------------------------------------------.....IT.....------------------
A2EAN8_TRIVA/175-332.-------------------------------------------------.....LK.....------------------
A2ENP8_TRIVA/245-395.-------------------------------------------------.....TQ.....------------------
A2GD34_TRIVA/590-746.-------------------------------------------------.....VK.....------------------
A2DQW2_TRIVA/362-515.-------------------------------------------------.....VF.....------------------
A2FHX0_TRIVA/618-765.-------------------------------------------------...........H------------------
A2ERI6_TRIVA/309-462.-------------------------------------------------.....FT.....------------------
B1HXQ4_LYSSC/149-305.-------------------------------------------------......T.....------------------
A2ELJ5_TRIVA/1001-1152.-------------------------------------------------......T.....------------------
A2ENP8_TRIVA/80-239.-------------------------------------------------.....LI.....------------------
D3BJ88_POLPA/671-831.-------------------------------------------------......T.....------------------
A2EXP7_TRIVA/122-276.-------------------------------------------------.....TE.....------------------
A2FHX0_TRIVA/309-464.-------------------------------------------------.....IL.....------------------
A2EYD0_TRIVA/230-382.-------------------------------------------------......E.....------------------
A9V8X4_MONBE/130-296.-------------------------------------------------......N.....------------------
C3Y624_BRAFL/300-474.-------------------------------------------------....TIK.....------------------
C8W2D1_DESAS/138-297.-------------------------------------------------....HVK.....------------------
D3TBL1_ACIB4/958-1108.-------------------------------------------------......N.....------------------
G1LPY2_AILME/2243-2418.-------------------------------------------------.....LK.....------------------
PLYL_DICD3/133-313.-------------------------------------------------......Y.....------------------
Q251J0_DESHY/90-272.-------------------------------------------------......T.....------------------
Q2K908_RHIEC/104-274.-------------------------------------------------.....VQ.....------------------
R6P1V8_9CLOT/1010-1182.-------------------------------------------------......Y.....------------------

PF02415

A0A0F7X457_CHLPN/182-200--------------------------------------------------------------------------------
Q7USQ0_RHOBA/609-626--------------------------------------------------------------------------------
Q7USQ0_RHOBA/574-600--------------------------------------------------------------------------------
PMPB_CHLTR/763-781--------------------------------------------------------------------------------
PMP19_CHLPN/219-236--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1476-1499--------------------------------------------------------------------------------
Q823X6_CHLCV/212-230--------------------------------------------------------------------------------
Q824E7_CHLCV/831-849--------------------------------------------------------------------------------
Q7UYI1_RHOBA/341-359--------------------------------------------------------------------------------
PMPD_CHLTR/805-823--------------------------------------------------------------------------------
PMPE_CHLMU/231-248--------------------------------------------------------------------------------
Q823W9_CHLCV/240-262--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2205-2228--------------------------------------------------------------------------------
Q7USQ0_RHOBA/459-477--------------------------------------------------------------------------------
Q823W9_CHLCV/304-325--------------------------------------------------------------------------------
PMPC_CHLTR/1040-1077--------------------------------------------------------------------------------
PMP19_CHLPN/181-206--------------------------------------------------------------------------------
PMP10_CHLPN/237-266--------------------------------------------------------------------------------
YFAL_ECOLI/186-211--------------------------------------------------------------------------------
PMPC_CHLTR/166-192--------------------------------------------------------------------------------
PMPD_CHLTR/359-377--------------------------------------------------------------------------------
PMPE_CHLMU/197-220--------------------------------------------------------------------------------
PMPF_CHLMU/270-296--------------------------------------------------------------------------------
PMP9_CHLPN/239-260--------------------------------------------------------------------------------
PMPI_CHLMU/192-210--------------------------------------------------------------------------------
Q7UWZ8_RHOBA/3661-3680--------------------------------------------------------------------------------
PMP2_CHLPN/189-207--------------------------------------------------------------------------------
Q7UWZ8_RHOBA/1086-1105--------------------------------------------------------------------------------
PMPB_CHLMU/941-958--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1185-1203--------------------------------------------------------------------------------
PMP14_CHLPN/232-274--------------------------------------------------------------------------------
PMPA_CHLMU/277-295--------------------------------------------------------------------------------
PMPC_CHLMU/644-671--------------------------------------------------------------------------------
Q8VU50_CHLPS/186-204--------------------------------------------------------------------------------
PMPA_CHLMU/360-379--------------------------------------------------------------------------------
PMPD_CHLMU/841-866--------------------------------------------------------------------------------
Q823X1_CHLCV/274-292--------------------------------------------------------------------------------
PMPB_CHLMU/588-607--------------------------------------------------------------------------------
PMP7_CHLPN/218-236--------------------------------------------------------------------------------
PMP6_CHLPN/158-176--------------------------------------------------------------------------------
PMPG_CHLMU/264-281--------------------------------------------------------------------------------
Q824E7_CHLCV/575-593--------------------------------------------------------------------------------
Q823Y0_CHLCV/253-275--------------------------------------------------------------------------------
Q823X5_CHLCV/226-244--------------------------------------------------------------------------------
PMP7_CHLPN/344-360--------------------------------------------------------------------------------
A0A0F7WD76_CHLPN/85-112--------------------------------------------------------------------------------
YFAL_ECOLI/67-82--------------------------------------------------------------------------------
PMP20_CHLPN/1045-1063--------------------------------------------------------------------------------
PMPD_CHLTR/612-641--------------------------------------------------------------------------------
PMP9_CHLPN/276-294--------------------------------------------------------------------------------
PMP1_CHLPN/182-199--------------------------------------------------------------------------------
Q823X6_CHLCV/313-331--------------------------------------------------------------------------------
PMP20_CHLPN/830-848--------------------------------------------------------------------------------
M4UH44_9XANT/369-387--------------------------------------------------------------------------------
A0A0F7X457_CHLPN/211-229--------------------------------------------------------------------------------
Q7UWZ8_RHOBA/3685-3702--------------------------------------------------------------------------------
Q823Y2_CHLCV/321-338--------------------------------------------------------------------------------
PMP16_CHLPN/208-226--------------------------------------------------------------------------------
PMPB_CHLTR/1072-1106--------------------------------------------------------------------------------
Q823Y1_CHLCV/197-218--------------------------------------------------------------------------------
PMPB_CHLTR/735-753--------------------------------------------------------------------------------
PMPF_CHLMU/242-259--------------------------------------------------------------------------------
PMPH_CHLMU/292-310--------------------------------------------------------------------------------
PMP18_CHLPN/177-195--------------------------------------------------------------------------------
Q8VU50_CHLPS/154-172--------------------------------------------------------------------------------
PMPG_CHLTR/364-382--------------------------------------------------------------------------------
PMPD_CHLTR/529-572--------------------------------------------------------------------------------
PMPC_CHLMU/389-407--------------------------------------------------------------------------------
H2VFH2_CHLAB/217-238--------------------------------------------------------------------------------
PMPF_CHLTR/341-358--------------------------------------------------------------------------------
Q823W9_CHLCV/212-230--------------------------------------------------------------------------------
Q823Y1_CHLCV/168-186--------------------------------------------------------------------------------
PMP20_CHLPN/278-296--------------------------------------------------------------------------------
Q823X2_CHLCV/93-111--------------------------------------------------------------------------------
PMPC_CHLTR/138-164--------------------------------------------------------------------------------
Q7UWZ8_RHOBA/1058-1077--------------------------------------------------------------------------------
PMPF_CHLMU/202-231--------------------------------------------------------------------------------
Q823Y2_CHLCV/258-284--------------------------------------------------------------------------------
PMPG_CHLTR/304-343--------------------------------------------------------------------------------
PMPD_CHLTR/267-286--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1794-1815--------------------------------------------------------------------------------
PMPE_CHLTR/297-315--------------------------------------------------------------------------------
Q824E6_CHLCV/333-352--------------------------------------------------------------------------------
Q824E7_CHLCV/420-438--------------------------------------------------------------------------------
PMP6_CHLPN/449-467--------------------------------------------------------------------------------
Q824E7_CHLCV/803-821--------------------------------------------------------------------------------
Q7UYI1_RHOBA/313-332--------------------------------------------------------------------------------
Q7UZ67_RHOBA/447-470--------------------------------------------------------------------------------
Q823X5_CHLCV/347-365--------------------------------------------------------------------------------
PMP10_CHLPN/94-112--------------------------------------------------------------------------------
PMPB_CHLTR/1044-1062--------------------------------------------------------------------------------
PMP21_CHLPN/543-572--------------------------------------------------------------------------------
PMP11_CHLPN/180-198--------------------------------------------------------------------------------
PMPC_CHLTR/394-412--------------------------------------------------------------------------------
PMP1_CHLPN/307-329--------------------------------------------------------------------------------
PMP20_CHLPN/390-421--------------------------------------------------------------------------------
PMPB_CHLTR/456-474--------------------------------------------------------------------------------
Q823Y0_CHLCV/225-242--------------------------------------------------------------------------------
A0A0F7X457_CHLPN/298-316--------------------------------------------------------------------------------
PMPC_CHLTR/515-533--------------------------------------------------------------------------------
Q823X4_CHLCV/217-241--------------------------------------------------------------------------------
PMP20_CHLPN/517-574--------------------------------------------------------------------------------
PMPD_CHLMU/324-348--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2265-2283--------------------------------------------------------------------------------
Q7UYI1_RHOBA/607-625--------------------------------------------------------------------------------
Q821X9_CHLCV/727-745--------------------------------------------------------------------------------
PMP21_CHLPN/750-771--------------------------------------------------------------------------------
PMP21_CHLPN/710-740--------------------------------------------------------------------------------
PMPB_CHLMU/792-820--------------------------------------------------------------------------------
PMP19_CHLPN/248-265--------------------------------------------------------------------------------
PMP15_CHLPN/87-105--------------------------------------------------------------------------------
PMP1_CHLPN/280-298--------------------------------------------------------------------------------
PMP16_CHLPN/179-197--------------------------------------------------------------------------------
PMPH_CHLTR/242-260--------------------------------------------------------------------------------
PMPF_CHLMU/173-191--------------------------------------------------------------------------------
Q823Y1_CHLCV/295-313--------------------------------------------------------------------------------
PMP1_CHLPN/154-172--------------------------------------------------------------------------------
PMPF_CHLMU/133-164--------------------------------------------------------------------------------
PMPG_CHLTR/169-195--------------------------------------------------------------------------------
Q823X0_CHLCV/153-171--------------------------------------------------------------------------------
PMPG_CHLMU/196-214--------------------------------------------------------------------------------
Q823X5_CHLCV/171-189--------------------------------------------------------------------------------
PMP6_CHLPN/317-335--------------------------------------------------------------------------------
Q821X9_CHLCV/301-320--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1096-1117--------------------------------------------------------------------------------
PMP20_CHLPN/1071-1089--------------------------------------------------------------------------------
PMP13_CHLPN/338-356--------------------------------------------------------------------------------
PMP19_CHLPN/62-80--------------------------------------------------------------------------------
PMP20_CHLPN/489-507--------------------------------------------------------------------------------
Q7USQ0_RHOBA/635-652--------------------------------------------------------------------------------
PMPE_CHLMU/324-342--------------------------------------------------------------------------------
PMP20_CHLPN/716-734--------------------------------------------------------------------------------
PMP6_CHLPN/633-650--------------------------------------------------------------------------------
PMP15_CHLPN/278-296--------------------------------------------------------------------------------
A0A0F7XIJ9_CHLPN/185-203--------------------------------------------------------------------------------
PMPI_CHLTR/163-181--------------------------------------------------------------------------------
Q824E7_CHLCV/731-748--------------------------------------------------------------------------------
H2VFH0_CHLAB/248-268--------------------------------------------------------------------------------
PMP16_CHLPN/113-131--------------------------------------------------------------------------------
PMPA_CHLTR/332-350--------------------------------------------------------------------------------
PMP20_CHLPN/1099-1128--------------------------------------------------------------------------------
PMPE_CHLTR/159-186--------------------------------------------------------------------------------
PMP13_CHLPN/194-212--------------------------------------------------------------------------------
Q7USQ0_RHOBA/252-270--------------------------------------------------------------------------------
PMPB_CHLMU/867-899--------------------------------------------------------------------------------
Q7USQ0_RHOBA/339-362--------------------------------------------------------------------------------
PMP12_CHLPN/187-205--------------------------------------------------------------------------------
Q823X9_CHLCV/100-118--------------------------------------------------------------------------------
Q7UYI1_RHOBA/474-492--------------------------------------------------------------------------------
PMP13_CHLPN/280-319--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1004-1030--------------------------------------------------------------------------------
PMP16_CHLPN/300-318--------------------------------------------------------------------------------
Q823X3_CHLCV/188-206--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1151-1176--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2527-2545--------------------------------------------------------------------------------
PMP20_CHLPN/776-794--------------------------------------------------------------------------------
Q7UYI1_RHOBA/394-412--------------------------------------------------------------------------------
PMP11_CHLPN/152-170--------------------------------------------------------------------------------
Q823X9_CHLCV/310-327--------------------------------------------------------------------------------
Q823X5_CHLCV/255-280--------------------------------------------------------------------------------
Q823X1_CHLCV/301-322--------------------------------------------------------------------------------
PMP7_CHLPN/187-207--------------------------------------------------------------------------------
PMP8_CHLPN/308-330--------------------------------------------------------------------------------
Q821X9_CHLCV/805-823--------------------------------------------------------------------------------
Q7USQ0_RHOBA/279-304--------------------------------------------------------------------------------
Q7USQ0_RHOBA/313-331--------------------------------------------------------------------------------
Q823X1_CHLCV/238-260--------------------------------------------------------------------------------
PMPE_CHLMU/258-286--------------------------------------------------------------------------------
PMPF_CHLTR/180-198--------------------------------------------------------------------------------
PMP9_CHLPN/182-200--------------------------------------------------------------------------------
PMPB_CHLMU/459-477--------------------------------------------------------------------------------
PMPD_CHLTR/679-697--------------------------------------------------------------------------------
Q824E6_CHLCV/279-297--------------------------------------------------------------------------------
Q821X9_CHLCV/422-440--------------------------------------------------------------------------------
PMP8_CHLPN/281-299--------------------------------------------------------------------------------
Q7USQ0_RHOBA/949-970--------------------------------------------------------------------------------
PMPC_CHLMU/242-260--------------------------------------------------------------------------------
Q823X6_CHLCV/107-125--------------------------------------------------------------------------------
PMP9_CHLPN/303-325--------------------------------------------------------------------------------
PMP7_CHLPN/308-331--------------------------------------------------------------------------------
Q7UYI1_RHOBA/555-573--------------------------------------------------------------------------------
PMP19_CHLPN/303-320--------------------------------------------------------------------------------
A0A0F7X457_CHLPN/154-172--------------------------------------------------------------------------------
Q823Y2_CHLCV/201-220--------------------------------------------------------------------------------
PMP20_CHLPN/221-239--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1647-1668--------------------------------------------------------------------------------
PMPF_CHLTR/140-171--------------------------------------------------------------------------------
PMPG_CHLMU/225-243--------------------------------------------------------------------------------
Q7USQ0_RHOBA/486-509--------------------------------------------------------------------------------
P71135_CHLAO/277-295--------------------------------------------------------------------------------
PMP14_CHLPN/314-332--------------------------------------------------------------------------------
PMP7_CHLPN/281-299--------------------------------------------------------------------------------
PMP21_CHLPN/952-977--------------------------------------------------------------------------------
PMPI_CHLTR/135-153--------------------------------------------------------------------------------
PMPH_CHLTR/318-336--------------------------------------------------------------------------------
PMPI_CHLTR/281-298--------------------------------------------------------------------------------
PMPD_CHLTR/492-518--------------------------------------------------------------------------------
Q823Y2_CHLCV/221-247--------------------------------------------------------------------------------
PMPD_CHLTR/176-203--------------------------------------------------------------------------------
PMPA_CHLTR/304-322--------------------------------------------------------------------------------
PMPB_CHLMU/197-268--------------------------------------------------------------------------------
A0A0F7XIJ9_CHLPN/214-232--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2144-2170--------------------------------------------------------------------------------
A0A0F7XIJ9_CHLPN/277-295--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1562-1580--------------------------------------------------------------------------------
PMPI_CHLTR/219-236--------------------------------------------------------------------------------
PMP13_CHLPN/223-241--------------------------------------------------------------------------------
YFAL_ECOLI/97-118--------------------------------------------------------------------------------
Q7USQ0_RHOBA/224-245--------------------------------------------------------------------------------
PMPD_CHLMU/529-572--------------------------------------------------------------------------------
PMPD_CHLTR/446-482--------------------------------------------------------------------------------
PMPB_CHLMU/54-125--------------------------------------------------------------------------------
PMP20_CHLPN/886-922--------------------------------------------------------------------------------
PMPB_CHLMU/666-684--------------------------------------------------------------------------------
PMPD_CHLTR/846-871--------------------------------------------------------------------------------
PMPE_CHLTR/231-248--------------------------------------------------------------------------------
PMP10_CHLPN/149-175--------------------------------------------------------------------------------
PMPE_CHLMU/126-159--------------------------------------------------------------------------------
PMP15_CHLPN/143-170--------------------------------------------------------------------------------
Q821X9_CHLCV/889-906--------------------------------------------------------------------------------
PMPD_CHLMU/267-286--------------------------------------------------------------------------------
Q82QS3_STRAW/268-286--------------------------------------------------------------------------------
Q7USQ0_RHOBA/370-391--------------------------------------------------------------------------------
Q82QS3_STRAW/181-198--------------------------------------------------------------------------------
PMP11_CHLPN/270-288--------------------------------------------------------------------------------
Q823Y0_CHLCV/194-215--------------------------------------------------------------------------------
A0A0F7XIJ9_CHLPN/234-260--------------------------------------------------------------------------------
PMPD_CHLTR/650-668--------------------------------------------------------------------------------
PMP13_CHLPN/93-111--------------------------------------------------------------------------------
PMP9_CHLPN/211-229--------------------------------------------------------------------------------
PMPD_CHLTR/297-314--------------------------------------------------------------------------------
PMPG_CHLTR/391-408--------------------------------------------------------------------------------
PMPC_CHLTR/202-220--------------------------------------------------------------------------------
PMP6_CHLPN/579-597--------------------------------------------------------------------------------
PMP21_CHLPN/501-519--------------------------------------------------------------------------------
Q823Y0_CHLCV/165-183--------------------------------------------------------------------------------
Q823Y0_CHLCV/312-329--------------------------------------------------------------------------------
A0A0F7WD76_CHLPN/57-75--------------------------------------------------------------------------------
PMP14_CHLPN/435-451--------------------------------------------------------------------------------
A0A0F7WD76_CHLPN/154-176--------------------------------------------------------------------------------
Q823X6_CHLCV/277-304--------------------------------------------------------------------------------
PMP11_CHLPN/297-318--------------------------------------------------------------------------------
PMPC_CHLMU/214-232--------------------------------------------------------------------------------
Q824E7_CHLCV/231-249--------------------------------------------------------------------------------
PMP21_CHLPN/840-864--------------------------------------------------------------------------------
Q823Y2_CHLCV/172-190--------------------------------------------------------------------------------
PMPF_CHLMU/307-325--------------------------------------------------------------------------------
PMP18_CHLPN/325-342--------------------------------------------------------------------------------
PMPC_CHLTR/884-909--------------------------------------------------------------------------------
PMP16_CHLPN/142-168--------------------------------------------------------------------------------
Q821X9_CHLCV/667-688--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1675-1693--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2553-2570--------------------------------------------------------------------------------
Q7UWZ8_RHOBA/1112-1132--------------------------------------------------------------------------------
Q823X5_CHLCV/290-318--------------------------------------------------------------------------------
P71133_CHLAO/155-173--------------------------------------------------------------------------------
PMPI_CHLMU/136-154--------------------------------------------------------------------------------
PMPE_CHLMU/160-187--------------------------------------------------------------------------------
PMP19_CHLPN/122-138--------------------------------------------------------------------------------
YFAL_ECOLI/127-145--------------------------------------------------------------------------------
PMP15_CHLPN/305-322--------------------------------------------------------------------------------
PMPA_CHLMU/333-351--------------------------------------------------------------------------------
PMPA_CHLTR/359-378--------------------------------------------------------------------------------
PMPB_CHLMU/278-296--------------------------------------------------------------------------------
Q824E7_CHLCV/950-977--------------------------------------------------------------------------------
Q7UZ67_RHOBA/529-546--------------------------------------------------------------------------------
PMP15_CHLPN/241-268--------------------------------------------------------------------------------
Q821X9_CHLCV/451-469--------------------------------------------------------------------------------
Q823X0_CHLCV/177-199--------------------------------------------------------------------------------
PMPD_CHLTR/378-405--------------------------------------------------------------------------------
PMP6_CHLPN/533-561--------------------------------------------------------------------------------
PMPB_CHLTR/158-176--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2353-2376--------------------------------------------------------------------------------
PMP2_CHLPN/216-237--------------------------------------------------------------------------------
Q7UYI1_RHOBA/181-199--------------------------------------------------------------------------------
Q824E6_CHLCV/222-239--------------------------------------------------------------------------------
PMP20_CHLPN/613-631--------------------------------------------------------------------------------
PMPE_CHLTR/203-220--------------------------------------------------------------------------------
PMP15_CHLPN/181-202--------------------------------------------------------------------------------
PMP20_CHLPN/803-820--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2500-2517--------------------------------------------------------------------------------
PMP20_CHLPN/250-268--------------------------------------------------------------------------------
H2VFH2_CHLAB/149-175--------------------------------------------------------------------------------
PMP14_CHLPN/286-304--------------------------------------------------------------------------------
PMPF_CHLTR/250-267--------------------------------------------------------------------------------
PMP16_CHLPN/327-344--------------------------------------------------------------------------------
PMPB_CHLTR/857-885--------------------------------------------------------------------------------
PMPD_CHLMU/581-606--------------------------------------------------------------------------------
PMP21_CHLPN/875-893--------------------------------------------------------------------------------
PMPC_CHLTR/916-947--------------------------------------------------------------------------------
PMP21_CHLPN/472-490--------------------------------------------------------------------------------
PMPG_CHLMU/168-186--------------------------------------------------------------------------------
PMP20_CHLPN/460-478--------------------------------------------------------------------------------
YFAL_ECOLI/228-246--------------------------------------------------------------------------------
Q823X5_CHLCV/199-216--------------------------------------------------------------------------------
PMPF_CHLTR/314-332--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1507-1528--------------------------------------------------------------------------------
PMPG_CHLMU/401-421--------------------------------------------------------------------------------
PMP20_CHLPN/1010-1027--------------------------------------------------------------------------------
PMP8_CHLPN/188-206--------------------------------------------------------------------------------
Q824E7_CHLCV/905-939--------------------------------------------------------------------------------
A0A0F7WD76_CHLPN/28-46--------------------------------------------------------------------------------
PMP1_CHLPN/239-261--------------------------------------------------------------------------------
PMP10_CHLPN/305-327--------------------------------------------------------------------------------
Q824E7_CHLCV/203-221--------------------------------------------------------------------------------
PMPD_CHLMU/616-637--------------------------------------------------------------------------------
P71135_CHLAO/183-201--------------------------------------------------------------------------------
PMPA_CHLTR/247-264--------------------------------------------------------------------------------
PMPG_CHLMU/283-329--------------------------------------------------------------------------------
PMP8_CHLPN/245-266--------------------------------------------------------------------------------
A0A0F7XIJ9_CHLPN/157-175--------------------------------------------------------------------------------
Q823X9_CHLCV/250-273--------------------------------------------------------------------------------
PMP14_CHLPN/108-126--------------------------------------------------------------------------------
Q823X4_CHLCV/95-113--------------------------------------------------------------------------------
P71135_CHLAO/240-262--------------------------------------------------------------------------------
P71135_CHLAO/304-325--------------------------------------------------------------------------------
PMP13_CHLPN/166-184--------------------------------------------------------------------------------
PMP15_CHLPN/213-230--------------------------------------------------------------------------------
Q83U05_CHLTH/100-133--------------------------------------------------------------------------------
PMP21_CHLPN/582-608--------------------------------------------------------------------------------
Q824E7_CHLCV/260-330--------------------------------------------------------------------------------
M4UH44_9XANT/166-184--------------------------------------------------------------------------------
PMPF_CHLTR/277-303--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1124-1142--------------------------------------------------------------------------------
PMPC_CHLTR/421-439--------------------------------------------------------------------------------
PMPB_CHLTR/342-360--------------------------------------------------------------------------------
Q7USQ0_RHOBA/193-216--------------------------------------------------------------------------------
PMPE_CHLTR/324-342--------------------------------------------------------------------------------
Q824E7_CHLCV/603-621--------------------------------------------------------------------------------
PMPG_CHLTR/205-223--------------------------------------------------------------------------------
Q7USQ0_RHOBA/547-565--------------------------------------------------------------------------------
Q823Y2_CHLCV/294-312--------------------------------------------------------------------------------
PMP11_CHLPN/237-255--------------------------------------------------------------------------------
Q823X6_CHLCV/340-357--------------------------------------------------------------------------------
PMPD_CHLMU/176-203--------------------------------------------------------------------------------
PMP6_CHLPN/375-392--------------------------------------------------------------------------------
PMPD_CHLTR/407-433--------------------------------------------------------------------------------
Q7UZ67_RHOBA/477-494--------------------------------------------------------------------------------
PMP7_CHLPN/159-177--------------------------------------------------------------------------------
PMP19_CHLPN/94-112--------------------------------------------------------------------------------
PMP1_CHLPN/210-229--------------------------------------------------------------------------------
YFAL_ECOLI/159-178--------------------------------------------------------------------------------
Q823X2_CHLCV/182-208--------------------------------------------------------------------------------
Q824E6_CHLCV/150-168--------------------------------------------------------------------------------
Q824E7_CHLCV/859-895--------------------------------------------------------------------------------
Q82QS3_STRAW/231-259--------------------------------------------------------------------------------
PMPF_CHLMU/103-123--------------------------------------------------------------------------------
PMPD_CHLMU/800-818--------------------------------------------------------------------------------
PMPB_CHLTR/898-925--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2117-2135--------------------------------------------------------------------------------
PMP15_CHLPN/107-142--------------------------------------------------------------------------------
Q823Y1_CHLCV/322-339--------------------------------------------------------------------------------
PMP6_CHLPN/606-624--------------------------------------------------------------------------------
Q821X9_CHLCV/386-412--------------------------------------------------------------------------------
Q823X2_CHLCV/153-171--------------------------------------------------------------------------------
Q823X9_CHLCV/222-239--------------------------------------------------------------------------------
PMPC_CHLTR/355-373--------------------------------------------------------------------------------
Q823X2_CHLCV/217-235--------------------------------------------------------------------------------
PMP18_CHLPN/205-224--------------------------------------------------------------------------------
PMP2_CHLPN/161-179--------------------------------------------------------------------------------
PMPD_CHLMU/297-314--------------------------------------------------------------------------------
Q823Y1_CHLCV/219-245--------------------------------------------------------------------------------
PMP21_CHLPN/780-798--------------------------------------------------------------------------------
PMPB_CHLTR/613-631--------------------------------------------------------------------------------
PMPE_CHLTR/258-286--------------------------------------------------------------------------------
PMP10_CHLPN/276-294--------------------------------------------------------------------------------
Q823Y1_CHLCV/132-158--------------------------------------------------------------------------------
PMPB_CHLMU/560-579--------------------------------------------------------------------------------
Q823X1_CHLCV/210-228--------------------------------------------------------------------------------
A0A0F7X457_CHLPN/239-260--------------------------------------------------------------------------------
Q7UWZ8_RHOBA/1006-1025--------------------------------------------------------------------------------
PMP8_CHLPN/217-235--------------------------------------------------------------------------------
Q824E7_CHLCV/704-722--------------------------------------------------------------------------------
PMP20_CHLPN/858-884--------------------------------------------------------------------------------
PMP6_CHLPN/186-204--------------------------------------------------------------------------------
PMP20_CHLPN/432-450--------------------------------------------------------------------------------
P71135_CHLAO/212-230--------------------------------------------------------------------------------
PMP6_CHLPN/476-494--------------------------------------------------------------------------------
PMPB_CHLTR/932-969--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1039-1057--------------------------------------------------------------------------------
PMPA_CHLTR/175-193--------------------------------------------------------------------------------
PMP6_CHLPN/272-300--------------------------------------------------------------------------------
Q823X5_CHLCV/374-391--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1450-1468--------------------------------------------------------------------------------
Q7UYI1_RHOBA/234-252--------------------------------------------------------------------------------
P71133_CHLAO/188-206--------------------------------------------------------------------------------
PMP20_CHLPN/585-603--------------------------------------------------------------------------------
PMP14_CHLPN/182-199--------------------------------------------------------------------------------
Q823X3_CHLCV/154-172--------------------------------------------------------------------------------
PMP12_CHLPN/150-168--------------------------------------------------------------------------------
Q824E7_CHLCV/448-466--------------------------------------------------------------------------------
PMPC_CHLTR/841-871--------------------------------------------------------------------------------
PMPB_CHLMU/362-420--------------------------------------------------------------------------------
PMP20_CHLPN/642-660--------------------------------------------------------------------------------
Q824E6_CHLCV/251-269--------------------------------------------------------------------------------
PMPC_CHLTR/542-560--------------------------------------------------------------------------------
PMP11_CHLPN/209-227--------------------------------------------------------------------------------
PMP18_CHLPN/139-166--------------------------------------------------------------------------------
PMPD_CHLMU/351-377--------------------------------------------------------------------------------
PMPB_CHLTR/791-847--------------------------------------------------------------------------------
PMP12_CHLPN/214-236--------------------------------------------------------------------------------
PMPE_CHLMU/297-315--------------------------------------------------------------------------------
PMPC_CHLTR/562-588--------------------------------------------------------------------------------
Q823W9_CHLCV/277-295--------------------------------------------------------------------------------
Q7USQ0_RHOBA/432-450--------------------------------------------------------------------------------
PMPC_CHLTR/275-316--------------------------------------------------------------------------------
PMP19_CHLPN/275-293--------------------------------------------------------------------------------
Q823Y1_CHLCV/256-285--------------------------------------------------------------------------------
Q823X3_CHLCV/215-233--------------------------------------------------------------------------------
PMPD_CHLTR/881-898--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1616-1639--------------------------------------------------------------------------------
Q823X6_CHLCV/182-199--------------------------------------------------------------------------------
PMPE_CHLTR/126-158--------------------------------------------------------------------------------
PMP18_CHLPN/262-288--------------------------------------------------------------------------------
Q821X9_CHLCV/757-794--------------------------------------------------------------------------------
PMPF_CHLTR/110-130--------------------------------------------------------------------------------
Q821X9_CHLCV/628-657--------------------------------------------------------------------------------
PMPC_CHLTR/327-345--------------------------------------------------------------------------------
PMP6_CHLPN/344-363--------------------------------------------------------------------------------
PMPA_CHLTR/276-294--------------------------------------------------------------------------------
Q823Y1_CHLCV/104-122--------------------------------------------------------------------------------
PMP13_CHLPN/365-382--------------------------------------------------------------------------------
Q7USQ0_RHOBA/919-942--------------------------------------------------------------------------------
Q824E7_CHLCV/987-1022--------------------------------------------------------------------------------
PMPH_CHLTR/373-390--------------------------------------------------------------------------------
Q823X1_CHLCV/181-199--------------------------------------------------------------------------------
PMP20_CHLPN/743-761--------------------------------------------------------------------------------
PMPB_CHLTR/484-502--------------------------------------------------------------------------------
PMPE_CHLTR/93-111--------------------------------------------------------------------------------
PMPI_CHLTR/254-272--------------------------------------------------------------------------------
PMPD_CHLMU/156-174--------------------------------------------------------------------------------
PMPG_CHLTR/277-294--------------------------------------------------------------------------------
PMPC_CHLMU/764-796--------------------------------------------------------------------------------
PMPB_CHLMU/639-657--------------------------------------------------------------------------------
Q822Q5_CHLCV/185-203--------------------------------------------------------------------------------
Q821X9_CHLCV/570-618--------------------------------------------------------------------------------
PMPH_CHLMU/245-280--------------------------------------------------------------------------------
PMPC_CHLMU/571-599--------------------------------------------------------------------------------
PMP6_CHLPN/215-233--------------------------------------------------------------------------------
PMP20_CHLPN/970-1001--------------------------------------------------------------------------------
Q824E7_CHLCV/632-650--------------------------------------------------------------------------------
PMPG_CHLTR/234-252--------------------------------------------------------------------------------
Q823X9_CHLCV/283-301--------------------------------------------------------------------------------
Q7UYI1_RHOBA/206-225--------------------------------------------------------------------------------
PMP21_CHLPN/436-462--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2384-2405--------------------------------------------------------------------------------
Q823Y2_CHLCV/105-123--------------------------------------------------------------------------------
PMPB_CHLTR/709-726--------------------------------------------------------------------------------
PMP20_CHLPN/933-960--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1589-1607--------------------------------------------------------------------------------
Q823X3_CHLCV/94-112--------------------------------------------------------------------------------
A0A0F7WD76_CHLPN/127-145--------------------------------------------------------------------------------
PMPI_CHLTR/191-209--------------------------------------------------------------------------------
PMPH_CHLMU/217-235--------------------------------------------------------------------------------
PMP21_CHLPN/347-366--------------------------------------------------------------------------------
Q823X9_CHLCV/128-153--------------------------------------------------------------------------------
PMP19_CHLPN/330-349--------------------------------------------------------------------------------
PMP18_CHLPN/234-251--------------------------------------------------------------------------------
Q7UWZ8_RHOBA/1032-1051--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2473-2491--------------------------------------------------------------------------------
Q824E6_CHLCV/307-324--------------------------------------------------------------------------------
PMP10_CHLPN/185-206--------------------------------------------------------------------------------
PMPB_CHLTR/585-604--------------------------------------------------------------------------------
Q7UZ67_RHOBA/504-522--------------------------------------------------------------------------------
Q821X9_CHLCV/852-879--------------------------------------------------------------------------------
PMPB_CHLTR/306-332--------------------------------------------------------------------------------
PMP14_CHLPN/341-358--------------------------------------------------------------------------------
PMPG_CHLTR/421-446--------------------------------------------------------------------------------
Q824E7_CHLCV/776-794--------------------------------------------------------------------------------
PMPC_CHLMU/736-754--------------------------------------------------------------------------------
PMP21_CHLPN/810-827--------------------------------------------------------------------------------
Q822Q5_CHLCV/153-171--------------------------------------------------------------------------------
PMP16_CHLPN/264-290--------------------------------------------------------------------------------
PMP13_CHLPN/253-270--------------------------------------------------------------------------------
PMP19_CHLPN/140-166--------------------------------------------------------------------------------
PMPH_CHLTR/270-306--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1065-1088--------------------------------------------------------------------------------
PMPD_CHLMU/407-433--------------------------------------------------------------------------------
PMPA_CHLTR/208-234--------------------------------------------------------------------------------
PMPD_CHLTR/324-349--------------------------------------------------------------------------------
Q821X9_CHLCV/533-559--------------------------------------------------------------------------------
PMP6_CHLPN/402-430--------------------------------------------------------------------------------
PMPC_CHLMU/417-435--------------------------------------------------------------------------------
PMPG_CHLTR/97-115--------------------------------------------------------------------------------
PMPH_CHLTR/345-363--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1212-1229--------------------------------------------------------------------------------
A0A0F7X457_CHLPN/360-404--------------------------------------------------------------------------------
H2VFH2_CHLAB/190-208--------------------------------------------------------------------------------
PMPB_CHLTR/286-304--------------------------------------------------------------------------------
Q823Y2_CHLCV/125-161--------------------------------------------------------------------------------
Q824E6_CHLCV/183-209--------------------------------------------------------------------------------
Q823X6_CHLCV/240-274--------------------------------------------------------------------------------
PMPB_CHLTR/130-148--------------------------------------------------------------------------------
PMPF_CHLTR/209-238--------------------------------------------------------------------------------
PMP12_CHLPN/81-108--------------------------------------------------------------------------------
Q824E7_CHLCV/477-495--------------------------------------------------------------------------------
PMPB_CHLTR/513-531--------------------------------------------------------------------------------
P71135_CHLAO/155-173--------------------------------------------------------------------------------
A0A0F7XIJ9_CHLPN/305-326--------------------------------------------------------------------------------
PMPD_CHLMU/387-405--------------------------------------------------------------------------------
M4UH44_9XANT/193-210--------------------------------------------------------------------------------
PMP7_CHLPN/246-268--------------------------------------------------------------------------------
Q821X9_CHLCV/496-523--------------------------------------------------------------------------------
Q823X9_CHLCV/191-212--------------------------------------------------------------------------------
Q7UYI1_RHOBA/260-278--------------------------------------------------------------------------------
Q823X1_CHLCV/153-171--------------------------------------------------------------------------------
PMP14_CHLPN/212-230--------------------------------------------------------------------------------
Q823X4_CHLCV/190-208--------------------------------------------------------------------------------
PMPB_CHLMU/141-159--------------------------------------------------------------------------------
Q7UYI1_RHOBA/367-385--------------------------------------------------------------------------------
PMP10_CHLPN/217-235--------------------------------------------------------------------------------
Q823X0_CHLCV/210-228--------------------------------------------------------------------------------
PMP18_CHLPN/298-316--------------------------------------------------------------------------------
PMP1_CHLPN/92-112--------------------------------------------------------------------------------
A0A0F7X457_CHLPN/326-347--------------------------------------------------------------------------------
Q823X9_CHLCV/162-180--------------------------------------------------------------------------------
A0A0F7X457_CHLPN/262-288--------------------------------------------------------------------------------
PMP8_CHLPN/157-178--------------------------------------------------------------------------------
Q823Y0_CHLCV/285-303--------------------------------------------------------------------------------
PMPB_CHLMU/722-782--------------------------------------------------------------------------------
PMP16_CHLPN/236-253--------------------------------------------------------------------------------
PMP9_CHLPN/155-173--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2439-2464--------------------------------------------------------------------------------
PMP21_CHLPN/914-942--------------------------------------------------------------------------------

PF16318

R5CQ17_9BACT/88-243D-------------------------------------------------AANPATV....T------------------
R5CCW6_9BACT/186-337D-------------------------------------------------QNNPATI....K------------------
R5D267_9BACT/46-177.-------------------------------------------------.AEGAEVVFGVK------------------
E4RYT9_LEAB4/243-375R-------------------------------------------------PNDKPVL.....------------------
Q8A8Z1_BACTN/189-338N-------------------------------------------------KINHSKI....T------------------
R5CUG9_9BACT/252-392Y-------------------------------------------------PTNLPTI.....------------------
A5FNJ9_FLAJ1/248-389R-------------------------------------------------PENKPKLTVKFT------------------
R6WLV0_9BACT/178-330S-------------------------------------------------ISNHAKL....K------------------
Q8A8Y7_BACTN/184-327D-------------------------------------------------KVNHAKL....T------------------
W0F9F3_9SPHI/258-400S-------------------------------------------------DPLVSAKAKIGI------------------
R5CWT1_9BACT/177-332N-------------------------------------------------DQKRPTI....T------------------
D5ETE2_PRER2/247-384R-------------------------------------------------QNDHPVI.....------------------
R6DD72_9BACE/316-461T-------------------------------------------------PGDGEEP...AY------------------
R7CWS4_9BACE/178-324N-------------------------------------------------KVKHPMV....T------------------
R5C4L0_9BACE/248-386R-------------------------------------------------PSDRPII.....------------------
R6E5N3_9BACE/182-333D-------------------------------------------------KLGHANI....T------------------
C6Y3U4_PEDHD/247-381Q-------------------------------------------------ATERPVL.....------------------
R5UTT0_9BACE/253-386N-------------------------------------------------SAEPPVI.....------------------

PF03211

U4KZB8_PYROM/36-231--------------------------------------------------------------------------------
N4URI8_COLOR/120-318--------------------------------------------------------------------------------
G2YGI6_BOTF4/126-326--------------------------------------------------------------------------------
M7SI60_EUTLA/18-215--------------------------------------------------------------------------------
U5W5Z4_9ACTN/38-237--------------------------------------------------------------------------------
G2YHG4_BOTF4/24-226--------------------------------------------------------------------------------
K1XD07_MARBU/185-384--------------------------------------------------------------------------------
M5BPL9_THACB/50-249--------------------------------------------------------------------------------
C7YTS6_NECH7/7-209--------------------------------------------------------------------------------
M7SJD8_EUTLA/23-220--------------------------------------------------------------------------------
T0M282_COLGC/23-218--------------------------------------------------------------------------------
N4VGC5_COLOR/253-453--------------------------------------------------------------------------------
M5BUQ1_THACB/42-237--------------------------------------------------------------------------------
G4N3X4_MAGO7/18-215--------------------------------------------------------------------------------
B5I637_9ACTN/39-241--------------------------------------------------------------------------------
G2XEV0_VERDV/54-253--------------------------------------------------------------------------------
G2QG74_THIHA/26-225--------------------------------------------------------------------------------
Q829M8_STRAW/47-250--------------------------------------------------------------------------------
A8NTC3_COPC7/28-228--------------------------------------------------------------------------------
C6WMH9_ACTMD/38-241--------------------------------------------------------------------------------
G8S809_ACTS5/262-462--------------------------------------------------------------------------------
F9X162_ZYMTI/31-229--------------------------------------------------------------------------------
G0S9D6_CHATD/128-328--------------------------------------------------------------------------------
I1RLQ0_GIBZE/23-220--------------------------------------------------------------------------------
V2XPM5_MONRO/28-226--------------------------------------------------------------------------------
K2RXU6_MACPH/35-230--------------------------------------------------------------------------------
L2FCH6_COLGN/26-225--------------------------------------------------------------------------------
N4V6F8_COLOR/112-311--------------------------------------------------------------------------------
E3EDF5_PAEPS/30-221--------------------------------------------------------------------------------
S8AHU9_DACHA/114-312--------------------------------------------------------------------------------
C7ZI42_NECH7/20-217--------------------------------------------------------------------------------
H3GY48_PHYRM/27-237--------------------------------------------------------------------------------
U4LBE6_PYROM/18-216--------------------------------------------------------------------------------
Q6D881_PECAS/102-322--------------------------------------------------------------------------------
Q7C4I5_PSESM/215-419--------------------------------------------------------------------------------
N4VEF5_COLOR/166-363--------------------------------------------------------------------------------
K2RMN8_MACPH/74-272--------------------------------------------------------------------------------
Q2H8P5_CHAGB/58-258--------------------------------------------------------------------------------
PLYF_ASPTN/22-224--------------------------------------------------------------------------------
PLYC_BACSU/18-214--------------------------------------------------------------------------------
PLYE_ASPFN/39-234--------------------------------------------------------------------------------
C7YXY0_NECH7/23-222--------------------------------------------------------------------------------
PLYG_ASPTN/27-222--------------------------------------------------------------------------------
B3PKE5_CELJU/106-320--------------------------------------------------------------------------------
T0K0R1_COLGC/25-223--------------------------------------------------------------------------------
F2R0Z1_STRVP/47-250--------------------------------------------------------------------------------
H3H676_PHYRM/399-600--------------------------------------------------------------------------------
D8PQN8_SCHCM/23-225--------------------------------------------------------------------------------
PLYD_ASPFU/22-218--------------------------------------------------------------------------------
C9SJ36_VERA1/19-214--------------------------------------------------------------------------------
M5C0K5_THACB/40-238--------------------------------------------------------------------------------
N1RGU5_FUSC4/156-353--------------------------------------------------------------------------------
Q2HHN7_CHAGB/24-222--------------------------------------------------------------------------------
I0HH67_ACTM4/194-394--------------------------------------------------------------------------------
N1QBX5_PSEFD/2-198--------------------------------------------------------------------------------
I0H512_ACTM4/182-378--------------------------------------------------------------------------------
C6WMH1_ACTMD/31-234--------------------------------------------------------------------------------
PLYD_EMENI/42-239--------------------------------------------------------------------------------
Q7S4B7_NEUCR/27-227--------------------------------------------------------------------------------
G4TNX7_PIRID/34-234--------------------------------------------------------------------------------
I0GXB6_ACTM4/290-490--------------------------------------------------------------------------------
K2RTS7_MACPH/22-219--------------------------------------------------------------------------------
K2SGW5_MACPH/29-225--------------------------------------------------------------------------------
M5BX85_THACB/52-251--------------------------------------------------------------------------------
G1WXZ0_ARTOA/97-294--------------------------------------------------------------------------------
E3Q1Z9_COLGM/95-295--------------------------------------------------------------------------------
F2JTB7_MARM1/279-472--------------------------------------------------------------------------------
B2APR3_PODAN/24-223--------------------------------------------------------------------------------
M5BPI1_THACB/35-233--------------------------------------------------------------------------------
D8QKC3_SCHCM/33-233--------------------------------------------------------------------------------
H6NS60_9BACL/19-215--------------------------------------------------------------------------------
D6X7B4_STRPR/40-243--------------------------------------------------------------------------------
D7CEB6_STRBB/44-244--------------------------------------------------------------------------------
C7YZY2_NECH7/19-218--------------------------------------------------------------------------------
K2RAB2_MACPH/20-220--------------------------------------------------------------------------------
K1WSP2_MARBU/22-217--------------------------------------------------------------------------------
M3CJL1_SPHMS/22-219--------------------------------------------------------------------------------
C9SY14_VERA1/23-220--------------------------------------------------------------------------------
C9S8R7_VERA1/23-222--------------------------------------------------------------------------------
M5BYG9_THACB/44-239--------------------------------------------------------------------------------
S8CBN6_DACHA/113-310--------------------------------------------------------------------------------
E0SM75_DICD3/100-319--------------------------------------------------------------------------------
C7ZNK4_NECH7/23-222--------------------------------------------------------------------------------
G2XBC9_VERDV/24-222--------------------------------------------------------------------------------
C7ZB71_NECH7/24-221--------------------------------------------------------------------------------
A8L1K4_FRASN/141-339--------------------------------------------------------------------------------
PLYC_BACLD/19-214--------------------------------------------------------------------------------

PF14592

F0S763_PSESL/26-457L-------------------------------------------------LKDGIYKDIQLV------------------
G0L7T1_ZOBGA/39-464I-------------------------------------------------MANGDWNDVQIR------------------
CSLB_PEDHD/28-451Q-------------------------------------------------IADGTYKDVQLI------------------
A2TXR8_9FLAO/26-451V-------------------------------------------------LKNGTYKDVNIK------------------
A0M0H6_GRAFK/28-451T-------------------------------------------------LANGVWKDAELI------------------
A3UA26_CROAH/32-454V-------------------------------------------------LKNGVWNNVQID------------------
L7W9A4_NONDD/2-423T-------------------------------------------------MKNGVWNNSQIK------------------
F4AY36_DOKS4/8-431S-------------------------------------------------LKDGVWKDLAIK------------------
T2KLV7_9FLAO/30-455V-------------------------------------------------MANGVWTDIIIK------------------
E6XAU2_CELAD/28-451I-------------------------------------------------MKNGVWNDIQIK------------------

PF05048

A0B5Z3_METTP/119-363A-------------------------------------------------EASSEAGM...L------------------
A0B8G3_METTP/432-668T-------------------------------------------------FDGVPRAI...T------------------
A0B9A8_METTP/209-441A-------------------------------------------------VNNTHAGL...F------------------
A0M187_GRAFK/155-382K-------------------------------------------------VQGVRDGI...Y------------------
A3Q9S9_SHELP/163-403R-------------------------------------------------IKTVRDGI...Y------------------
A3QIG9_SHELP/167-406E-------------------------------------------------VNQTRDGI...Y------------------
A4CHB0_ROBBH/128-355R-------------------------------------------------IEGVRDGI...Y------------------
A6Q5Y3_NITSB/155-390H-------------------------------------------------LYKSRDFV....------------------
A6QCA8_SULNB/133-366H-------------------------------------------------LYKSRDFV....------------------
B9LN19_HALLT/206-436E-------------------------------------------------ITDVRDGI...Y------------------
O28859_ARCFU/803-1050S-------------------------------------------------VGAYYNHLAGLA------------------
Q0A9R0_ALKEH/149-394E-------------------------------------------------IWEARDGI...Y------------------
Q0W3C2_METAR/236-481V-------------------------------------------------MIDDHYAV...W------------------
Q0W3C3_METAR/195-446V-------------------------------------------------MIDDHYAV...W------------------
Q0W3M9_METAR/204-442E-------------------------------------------------VTTVNTSAMGIA------------------
Q12VI3_METBU/415-643I-------------------------------------------------INNSNYGI...Y------------------
Q16A16_ROSDO/136-364D-------------------------------------------------IRWGRDGI...F------------------
Q21TJ4_RHOFT/155-381E-------------------------------------------------ISFARDGI...Y------------------
Q2FLC7_METHJ/579-839P-------------------------------------------------VSITAAGV....------------------
Q2FLS3_METHJ/168-426Y-------------------------------------------------VFRGRNGI....------------------
Q2FM56_METHJ/94-353D-------------------------------------------------IIDCPTGI...H------------------
Q2FPE3_METHJ/417-660Y-------------------------------------------------GQESPSGI....------------------
Q2FQK2_METHJ/621-869V-------------------------------------------------TDNYYDGI...K------------------
Q2FSR9_METHJ/59-324K-------------------------------------------------TGDPSVGIW.VT------------------
Q3SJ26_THIDA/142-368R-------------------------------------------------IGFVRDAI...Y------------------
Q47FR5_DECAR/172-407Q-------------------------------------------------IIDSRDMV....------------------
Q47UZ5_COLP3/153-392E-------------------------------------------------VSETRDGV...Y------------------
Q5LLH6_RUEPO/140-368D-------------------------------------------------IQYGRDGI...F------------------
Q5V4X0_HALMA/184-414D-------------------------------------------------ITTVRDGL...Y------------------
Q6LJ10_PHOPR/142-381T-------------------------------------------------VSKTRDGL...Y------------------
Q6M0J5_METMP/167-417V-------------------------------------------------NNNIYNGI...E------------------
Q7MRZ6_WOLSU/132-365T-------------------------------------------------IQESRDFV....------------------
Q8TI41_METAC/43-307M-------------------------------------------------LVGEGADVVTID------------------
Q8TJK2_METAC/50-308T-------------------------------------------------AKNSNDHV...F------------------
Q8TJW3_METAC/46-306P-------------------------------------------------GENPKIAI....------------------
Q8TLA5_METAC/47-287I-------------------------------------------------EVNRQSQI....------------------
Q8TLD5_METAC/175-426K-------------------------------------------------VSSNSGTG..IC------------------
Q8TLD5_METAC/552-811V-------------------------------------------------EIGSSSNAGTVY------------------
Q8TLY6_METAC/248-494I-------------------------------------------------VNSNTGSGIMLE------------------
Q8TLY7_METAC/376-620D-------------------------------------------------VSESEDHGIVLE------------------
Q8TN36_METAC/103-334T-------------------------------------------------LVFNGQGI...L------------------
Q8TPF2_METAC/96-327A-------------------------------------------------LIMNDVGI...S------------------
Q8TPZ7_METAC/43-292G-------------------------------------------------IIDIPQTA....------------------
Q8TQ14_METAC/197-463Y-------------------------------------------------ISNGMDNGYGIL------------------
Q8TQM3_METAC/233-470N-------------------------------------------------II.........I------------------
Q8TSE8_METAC/43-302S-------------------------------------------------SIYLPEGS...S------------------
Q8TT51_METAC/53-286D-------------------------------------------------SRNPENTIVKAA------------------
Q8TTT9_METAC/43-302T-------------------------------------------------IIKAKSSTDNAT------------------
Q9K0L5_NEIMB/44-271D-------------------------------------------------ISKGRDGI...F------------------
B2UHW3_RALPJ/148-378N-------------------------------------------------ISFVRDAL...Y------------------
M1FI95_9ALTE/142-381D-------------------------------------------------IRQTRDGI...Y------------------
Q63UJ4_BURPS/145-366T-------------------------------------------------ISYTRDGI...Y------------------
NOSD_PSEAE/144-383R-------------------------------------------------VSHTRDGV...Y------------------

PF08480

Q8TLE9_METAC/305-493--------------------------------------------------------------------------------
Q8TNA9_METAC/274-466--------------------------------------------------------------------------------
Q8THR8_METAC/274-457--------------------------------------------------------------------------------
Q8TKN2_METAC/356-545--------------------------------------------------------------------------------
Q8TNF1_METAC/197-388--------------------------------------------------------------------------------
Q8TRX3_METAC/275-470--------------------------------------------------------------------------------

PF07602

Q8F2E8_LEPIN/52-316--------------------------------------------------------------------------------
Q7NNK7_GLOVI/49-321--------------------------------------------------------------------------------
Q8YX73_NOSS1/82-347--------------------------------------------------------------------------------
Q8F8Y2_LEPIN/64-326--------------------------------------------------------------------------------
Q8F1R3_LEPIN/65-310--------------------------------------------------------------------------------
Q8YWJ6_NOSS1/15-284--------------------------------------------------------------------------------
Q8F0U7_LEPIN/64-323--------------------------------------------------------------------------------

PF00544

PLY1_PECAS/71-278--------------------------------------------------------------------------------
E0SAZ3_DICD3/83-313--------------------------------------------------------------------------------
E0SJQ6_DICD3/72-279--------------------------------------------------------------------------------
PLYA_DICD3/85-318--------------------------------------------------------------------------------
Q6D727_PECAS/47-241--------------------------------------------------------------------------------

PF00295

PGLR1_MAIZE/68-409.-------------------------------------------------TDLSQYKDHGNW------------------
PGLR_YEAST/43-361.-------------------------------------------------YKEWSGP..LIS------------------
PGLR_SOLLC/103-443.-------------------------------------------------SKISDYKDRRLW------------------
PGLR1_ASPNC/50-368.-------------------------------------------------YKEWKGP..LIR------------------
PGLRB_ASPFN/46-363.-------------------------------------------------YKEWEGP..LIS------------------
G3XYE5_ASPNA/45-362.-------------------------------------------------YEEWAGP..LIS------------------
M2QZD9_COCSN/45-364.-------------------------------------------------YKEWAGP..LIS------------------
M4FG11_BRARP/47-378.-------------------------------------------------GGSTQGK..DRW------------------
PGLR1_ASPOR/52-367.-------------------------------------------------YKEWKGP..LIR------------------
Q6D880_PECAS/62-401G-------------------------------------------------VVDKNGKGCDAF------------------
S0EGK1_GIBF5/43-372.-------------------------------------------------TTADNDFD.PIV------------------

PF01696

Q9W859_ADEP3/86-474--------------------------------------------------------------------------------
E1BL_ADECT/56-441--------------------------------------------------------------------------------
Q64892_ADEM1/37-434--------------------------------------------------------------------------------
Q3ZKW1_9ADEN/107-489--------------------------------------------------------------------------------
Q5GFC6_ADE04/98-480--------------------------------------------------------------------------------
Q9EEG1_ADEB2/14-388--------------------------------------------------------------------------------
Q64844_ADEB3/35-420--------------------------------------------------------------------------------
A0MK44_9ADEN/90-471--------------------------------------------------------------------------------
E1BL_ADET1/2-390--------------------------------------------------------------------------------
E1BL_ADE12/96-479--------------------------------------------------------------------------------
E1U5L8_ADE06/110-492--------------------------------------------------------------------------------
Q695T4_9ADEN/122-506--------------------------------------------------------------------------------
E1BL_ADE40/96-475--------------------------------------------------------------------------------
Q9YL98_ADE09/110-492--------------------------------------------------------------------------------
Q83459_ADEP4/28-410--------------------------------------------------------------------------------

PF12541

D6DHZ7_CLOSC/2-271--------------------------------------------------------------------------------
R5PWU1_9BURK/2-278--------------------------------------------------------------------------------
A5VMS3_LACRD/2-277--------------------------------------------------------------------------------
R5L1C9_9CLOT/2-273--------------------------------------------------------------------------------
R5GK22_9BACT/2-278--------------------------------------------------------------------------------
R6F061_9BACT/2-278--------------------------------------------------------------------------------
Q6LZ36_METMP/37-311--------------------------------------------------------------------------------
R5A3D5_9CLOT/2-271--------------------------------------------------------------------------------
R5VXN8_9DELT/3-274--------------------------------------------------------------------------------
R7EP62_9FIRM/5-279--------------------------------------------------------------------------------
R6VTW4_9BACT/2-278--------------------------------------------------------------------------------
Q8A7X5_BACTN/2-278--------------------------------------------------------------------------------
R7HQ78_9BACT/2-277--------------------------------------------------------------------------------
D7DSW7_METV3/56-328--------------------------------------------------------------------------------
R6G7J9_9FIRM/8-282--------------------------------------------------------------------------------
R7DGS5_9PORP/2-278--------------------------------------------------------------------------------
R7R6X9_9FIRM/2-276--------------------------------------------------------------------------------
Q5FL14_LACAC/3-277--------------------------------------------------------------------------------
R6JX58_9FIRM/7-281--------------------------------------------------------------------------------
R5YM64_9FIRM/4-278--------------------------------------------------------------------------------
R5R5M3_9FIRM/2-276--------------------------------------------------------------------------------
A7ZFS8_CAMC1/2-276--------------------------------------------------------------------------------
R6XGP3_9FIRM/2-276--------------------------------------------------------------------------------
R7BSW2_9FIRM/8-275--------------------------------------------------------------------------------
R6N8F1_9CLOT/2-271--------------------------------------------------------------------------------
R6CNQ1_9BACT/2-275--------------------------------------------------------------------------------
M1MK35_9CLOT/2-276--------------------------------------------------------------------------------
A2DNE3_TRIVA/4-279--------------------------------------------------------------------------------
R6E1V7_9BACE/2-278--------------------------------------------------------------------------------
R5G5K3_9FIRM/6-274--------------------------------------------------------------------------------
R5YBV7_9BACE/2-278--------------------------------------------------------------------------------
R6X1F7_9BACT/2-278--------------------------------------------------------------------------------
C4Z7J5_EUBE2/13-287--------------------------------------------------------------------------------
A6LAN5_PARD8/2-278--------------------------------------------------------------------------------
E6UH73_RUMA7/2-277--------------------------------------------------------------------------------
J9VZH1_LACBU/2-277--------------------------------------------------------------------------------
A2DXQ6_TRIVA/15-290--------------------------------------------------------------------------------
R7J179_9BACT/4-280--------------------------------------------------------------------------------
R7IJ73_9BURK/2-278--------------------------------------------------------------------------------
R5UHT9_9FIRM/12-285--------------------------------------------------------------------------------
R7C9P6_9CLOT/2-276--------------------------------------------------------------------------------
R7FLD7_9CLOT/4-277--------------------------------------------------------------------------------
R5GYL3_9FIRM/5-279--------------------------------------------------------------------------------
R5PEP4_9BACT/2-278--------------------------------------------------------------------------------
F9URY5_LACPL/2-277--------------------------------------------------------------------------------
R5KIW2_9BACT/2-278--------------------------------------------------------------------------------
D6S309_9LACO/2-277--------------------------------------------------------------------------------
R7ADB3_9FIRM/2-270--------------------------------------------------------------------------------
C4ZDA1_EUBR3/5-279--------------------------------------------------------------------------------
B2UN04_AKKM8/4-280--------------------------------------------------------------------------------
R7BJD2_9FIRM/4-275--------------------------------------------------------------------------------
R5ZSK8_9CLOT/2-276--------------------------------------------------------------------------------
R5P9J9_9CLOT/3-277--------------------------------------------------------------------------------
R7K3P1_9CLOT/2-276--------------------------------------------------------------------------------
R7A2C4_9FIRM/3-270--------------------------------------------------------------------------------
R5EWD8_9GAMM/2-279--------------------------------------------------------------------------------
R6UKR3_9STAP/2-276--------------------------------------------------------------------------------
R5QNY5_9PROT/3-277--------------------------------------------------------------------------------
R6WGE2_9FIRM/2-277--------------------------------------------------------------------------------
R6DEH5_9CLOT/2-276--------------------------------------------------------------------------------
Q74K41_LACJO/2-277--------------------------------------------------------------------------------
R7GEC7_9CLOT/2-271--------------------------------------------------------------------------------
C4LFU5_TOLAT/2-277--------------------------------------------------------------------------------
R5QQP9_9FIRM/2-277--------------------------------------------------------------------------------
R5V321_9FIRM/3-274--------------------------------------------------------------------------------
Q03TK5_LACBA/3-278--------------------------------------------------------------------------------
R5G0S8_9ACTN/11-287--------------------------------------------------------------------------------
R5R960_9FIRM/2-274--------------------------------------------------------------------------------
B8DUR7_BIFA0/2-277--------------------------------------------------------------------------------
R7HU56_9CLOT/5-279--------------------------------------------------------------------------------
L0J7T7_PREDD/11-287--------------------------------------------------------------------------------
D5HFQ7_9FIRM/8-282--------------------------------------------------------------------------------
R6XZ15_9FIRM/2-276--------------------------------------------------------------------------------
D4IWA9_BUTFI/2-277--------------------------------------------------------------------------------
T0T8D2_9STRE/2-277--------------------------------------------------------------------------------
R7FNU4_9CLOT/2-276--------------------------------------------------------------------------------
R6BWW4_9CLOT/5-279--------------------------------------------------------------------------------
R7H8Z4_9FIRM/5-279--------------------------------------------------------------------------------
R5QFI9_9FIRM/2-276--------------------------------------------------------------------------------
R6CSF1_9CLOT/4-277--------------------------------------------------------------------------------
R6TW54_9FIRM/2-276--------------------------------------------------------------------------------
R7N4D9_9FIRM/2-276--------------------------------------------------------------------------------
R7DLF6_9FIRM/2-277--------------------------------------------------------------------------------
R7IW89_9FIRM/9-282--------------------------------------------------------------------------------
I0GVU7_SELRL/2-272--------------------------------------------------------------------------------
R5N9S7_9BACT/2-278--------------------------------------------------------------------------------
D5EVR1_PRER2/2-278--------------------------------------------------------------------------------
A1A134_BIFAA/22-296--------------------------------------------------------------------------------

PF09251

Q8SCG9_BPSP6/3-550R-------------------------------------------------FIGDGALIFTNM------------------
FIBER_BPP22/116-665K-------------------------------------------------FIGDGNLIFTKL------------------

PF03212

YPJA_ECOLI/1057-1180--------------------------------------------------------------------------------
YEJO_ECOLI/430-556--------------------------------------------------------------------------------
J7RCG5_BORP1/480-606--------------------------------------------------------------------------------
O86044_BORPT/332-450--------------------------------------------------------------------------------
BRKA_BORPE/583-704--------------------------------------------------------------------------------
PERT_BORPA/444-564--------------------------------------------------------------------------------
TIBA_ECOH1/506-627--------------------------------------------------------------------------------
YCGV_ECOLI/494-616--------------------------------------------------------------------------------

PF12218

ENAN_BPK1E/39-102----------TN--DQD-----------A---------------------------------------------------
Q858B1_BPK1F/246-312----------TD--DTA-----------A---------------------------------------------------
A5VW57_9CAUD/146-212----------HD--DTS-----------A---------------------------------------------------
O80102_9VIRU/167-233----------TD--DTQ-----------S---------------------------------------------------

PF12708

B9DJC5_STACT/126-337----------TD--VSD-----------Y---------------------------------------------------
Q7URR5_RHOBA/63-307----------AD--QSI-----------A---------------------------------------------------
C6Y0W6_PEDHD/63-325----------QF--DDM-----------A---------------------------------------------------
Q09C01_STIAD/75-328----------AD--VTA-----------I---------------------------------------------------
Q87XU1_PSESM/2-255----------TN--DTA-----------A---------------------------------------------------
B6IU75_RHOCS/4-239----------TD--NKV-----------A---------------------------------------------------
B6IPQ6_RHOCS/4-238----------TD--NRA-----------A---------------------------------------------------
Q9K7M8_BACHD/30-252----------TS--QTN-----------A---------------------------------------------------
C7Q7K8_CATAD/223-454----------ND--SSN-----------A---------------------------------------------------
B3VMP8_BPPH2/104-333----------TD--DIR-----------A---------------------------------------------------
C4L0K4_EXISA/96-329----------TD--CTL-----------A---------------------------------------------------
Q184L0_PEPD6/13-220----------KD--VSF-----------K---------------------------------------------------
Q184L1_PEPD6/12-216----------YN--IGP-----------A---------------------------------------------------
Q184L3_PEPD6/10-203----------YD--VSN-----------M---------------------------------------------------
B8GG97_METPE/553-766----------TD--DTA-----------A---------------------------------------------------
B8GGB4_METPE/99-337----------TD--DTA-----------A---------------------------------------------------
B6H126_PENCW/211-429----------GN--QTP-----------K---------------------------------------------------
Q4WIW4_ASPFU/77-298----------KD--ASA-----------A---------------------------------------------------
B8MQM9_TALSN/123-346----------TD--ASA-----------A---------------------------------------------------
Q5B3M8_EMENI/219-441----------SD--ASS-----------A---------------------------------------------------
B8NUX0_ASPFN/88-302----------QD--SAP-----------A---------------------------------------------------
A2QF38_ASPNC/247-469----------KD--AAA-----------A---------------------------------------------------
A9V1W5_MONBE/50-262----------TD--DTA-----------A---------------------------------------------------
B2ANL4_PODAN/41-256----------TD--DTA-----------A---------------------------------------------------
Q7S3S0_NEUCR/218-448----------TD--DTK-----------A---------------------------------------------------
Q5B3Q5_EMENI/170-388----------SD--STA-----------A---------------------------------------------------
Q5ATA0_EMENI/247-460----------TD--DTE-----------A---------------------------------------------------
A2RBJ4_ASPNC/164-404----------TD--DTA-----------A---------------------------------------------------
C5FIT8_ARTOC/207-432----------TD--DTA-----------A---------------------------------------------------
B6QWE5_PENMQ/71-313----------MD--DTA-----------A---------------------------------------------------
Q7S602_NEUCR/168-396----------ND--DTD-----------A---------------------------------------------------
B2AQ98_PODAN/93-316----------AD--DTA-----------A---------------------------------------------------
Q2GRE2_CHAGB/224-446----------SD--DTD-----------A---------------------------------------------------
Q0CRX2_ASPTN/83-312----------TD--DTA-----------A---------------------------------------------------
Q2H3L6_CHAGB/41-260----------I.--...-----------.---------------------------------------------------
Q7SGI7_NEUCR/41-267----------TD--DTI-----------A---------------------------------------------------
Q0UIW6_PHANO/70-284----------..--...-----------.---------------------------------------------------
A8NNP9_COPC7/68-294----------HD--DTR-----------A---------------------------------------------------
B2WKN5_PYRTR/68-291----------TD--DTD-----------V---------------------------------------------------
C4JXY6_UNCRE/64-288----------TD--DTE-----------A---------------------------------------------------
C1H3L4_PARBA/65-289----------TD--DTE-----------A---------------------------------------------------
Q7S324_NEUCR/222-446----------SD--DTE-----------A---------------------------------------------------
B2AVA4_PODAN/55-279----------TD--DTE-----------A---------------------------------------------------
Q7S6I5_NEUCR/41-263----------TD--DTI-----------A---------------------------------------------------
B2AQV4_PODAN/41-263----------TD--DTA-----------A---------------------------------------------------
B6QD92_PENMQ/79-303----------TD--DTA-----------A---------------------------------------------------
B6QUF4_PENMQ/72-296----------TD--DTL-----------A---------------------------------------------------
Q4WLX5_ASPFU/93-315----------TD--DTA-----------A---------------------------------------------------
B2W2R6_PYRTR/89-320----------TD--DTA-----------A---------------------------------------------------
A7EWZ9_SCLS1/45-272----------TD--DTA-----------A---------------------------------------------------
A7EV58_SCLS1/85-323----------TD--DTA-----------A---------------------------------------------------

PF01095

PME13_ARATH/301-598----------FT--TIN-----------D---------------------------------------------------
PME42_ARATH/215-510----------YN--TVN-----------A---------------------------------------------------
PME23_ARATH/257-554----------FK--TIT-----------D---------------------------------------------------
PME44_ARATH/212-509----------FT--KIM-----------D---------------------------------------------------
PME16_ARATH/213-502----------HK--TIG-----------E---------------------------------------------------
PME24_ARATH/255-548----------YR--TIK-----------R---------------------------------------------------
PME51_ARATH/240-544----------YK--TVQ-----------D---------------------------------------------------
PME61_ARATH/273-571----------FK--TIA-----------E---------------------------------------------------
PMEU1_SOLLC/272-570----------YK--TVS-----------E---------------------------------------------------
PME2_ARATH/276-573----------FT--TVA-----------A---------------------------------------------------
PME35_ARATH/228-514----------HM--SVA-----------E---------------------------------------------------
PME21_ARATH/255-552----------YK--TIN-----------E---------------------------------------------------
PME47_ARATH/307-606----------FP--TIT-----------E---------------------------------------------------
PME12_ARATH/237-533----------FS--TIN-----------E---------------------------------------------------
PME26_ARATH/660-954----------VR--TVN-----------E---------------------------------------------------
PME17_ARATH/206-499----------FK--TIK-----------E---------------------------------------------------
PME43_ARATH/391-688----------CK--TIA-----------Q---------------------------------------------------
PME1_SOLLC/233-531----------YQ--TLA-----------E---------------------------------------------------
PME58_ARATH/259-556----------YK--TIN-----------E---------------------------------------------------
PME46_ARATH/257-550----------YR--TIG-----------E---------------------------------------------------
PME34_ARATH/284-583----------CK--TIS-----------E---------------------------------------------------
PME22_ARATH/240-525----------YR--TIN-----------E---------------------------------------------------
PME32_ARATH/214-511----------FT--TIS-----------D---------------------------------------------------
Q9S767_ORYSJ/304-592----------WR--TVS-----------E---------------------------------------------------
B4FCY2_MAIZE/251-546----------FK--SIQ-----------Q---------------------------------------------------
B9IKC0_POPTR/283-579----------FK--TIS-----------E---------------------------------------------------
K7KZN7_SOYBN/877-1170----------FR--TIG-----------E---------------------------------------------------
U5GQ29_POPTR/312-608----------YS--TVS-----------A---------------------------------------------------

PF03718

IPUA_ASPNG/7-563----------..--NVV-----------IRPTSLNFPVRY.DNQSVYITVPYSPTGYRFSVEFDDDLISLAPS.......
DEXT_PENMI/26-608----------PS--DVV-----------IRPVSISYAISQSDDGGIVIRVPADANGRKFSVEFKTDLYTFLSD..GNE..
P77813_ARTGO/20-620----------VD--QVS-----------IRPSKYTFEKHLVDANTVRIKVPYSLSGYRFSVEFEPQNFTAYNDMSGTAGV
DEXT_ARTSD/41-636----------AD--QVQ-----------IRPSSYNFEKQLVDADTVRIKVPYSDAGYRFSVEFEPQLYTAYNDMSGDSGK

PF07971

R6CE95_9BACE/252-740......DD..FD..KYL-----------A---------------------------------------------------
Q8A6K3_BACTN/246-733......WN..FD..GVK-----------L---------------------------------------------------
C6XXW8_PEDHD/284-772......WD..FD..KLK-----------Q---------------------------------------------------
B8LV53_TALSN/266-771.......D..FD..GIH-----------S---------------------------------------------------
W5WJ40_9PSEU/298-772......KS..FD..QVA-----------T---------------------------------------------------
A4VXP8_STRSY/216-705..........FL..QAQ-----------K---------------------------------------------------
F8EET3_RUNSL/240-740......DS..FT..ATM-----------Q---------------------------------------------------
K4L2L4_SIMAS/261-762......KS..FA..QIR-----------Q---------------------------------------------------
R6VKF5_9BACT/153-626......KS..FE..QLL-----------S---------------------------------------------------
Q8A5N9_BACTN/240-739......AD..VQ..LIS-----------G---------------------------------------------------
A6KYE2_BACV8/400-910......WD..FD..KVR-----------R---------------------------------------------------
F4CBM4_SPHS2/248-748......DS..FD..QIA-----------S---------------------------------------------------
R6VZN3_9BACT/256-743......WS..FE..AVQ-----------Q---------------------------------------------------
M2ZGR3_PSEFD/7-543.......T..FE..DAV-----------A---------------------------------------------------
R7L3G4_9BACT/243-737......WD..FD..AVR-----------D---------------------------------------------------
Q8A113_BACTN/217-733......YD..VK..AVA-----------D---------------------------------------------------
G8TLM2_NIAKG/240-740......DS..FE..ATC-----------K---------------------------------------------------
D3PUH5_STANL/247-764......YD..FD..AVR-----------E---------------------------------------------------
B2FTT2_STRMK/526-1060.......T..LE..SVA-----------G---------------------------------------------------
R6D727_9BACE/236-736......RS..LE..QLK-----------D---------------------------------------------------
E8UZA2_TERSS/262-752......WA..FD..QTR-----------L---------------------------------------------------
R6X4R5_9BACT/257-729......WD..FE..ATV-----------D---------------------------------------------------
B6HPH9_PENCW/257-760.......D..FE..GTV-----------S---------------------------------------------------
W8F287_9BACT/273-763......WD..FE..AVK-----------R---------------------------------------------------
D2PP99_KRIFD/286-782......AT..AD..RLA-----------A---------------------------------------------------
Q9AAM3_CAUCR/256-729......WD..FE..RVR-----------R---------------------------------------------------
F4C4J4_SPHS2/532-1035....FGWS..FD..KAV-----------A---------------------------------------------------
N1QLN3_SPHMS/228-731.......D..FD..RVR-----------S---------------------------------------------------
F9Z496_ODOSD/396-890......WD..F