Sequence alignment for CL0268

PF14592

F0S763_PEDSD/26-457--------------------------------------------------------------------------------
G0L7T1_ZOBGA/39-464--------------------------------------------------------------------------------
CSLB_PEDHD/28-451--------------------------------------------------------------------------------
A2TXR8_9FLAO/26-451--------------------------------------------------------------------------------
A0M0H6_GRAFK/28-451--------------------------------------------------------------------------------
A3UA26_CROAH/32-454--------------------------------------------------------------------------------
L7W9A4_NONDD/2-423--------------------------------------------------------------------------------
F4AY36_KROS4/8-431--------------------------------------------------------------------------------
T2KLV7_9FLAO/30-455--------------------------------------------------------------------------------
E6XAU2_CELAD/28-451--------------------------------------------------------------------------------

PF16318

E5C6D6_9BACE/316-599--------------------------------------------------------------------------------
D7J093_9BACE/318-599--------------------------------------------------------------------------------
A5FNJ9_FLAJ1/248-520--------------------------------------------------------------------------------
E2NFR1_9BACE/253-527--------------------------------------------------------------------------------
A5ZFT6_9BACE/253-527--------------------------------------------------------------------------------
E4RYT9_LEAB4/243-509--------------------------------------------------------------------------------
C2FSM9_9SPHI/246-519--------------------------------------------------------------------------------
C6Y3U4_PEDHD/247-515--------------------------------------------------------------------------------
D8DZJ8_PREBR/248-514--------------------------------------------------------------------------------
D5ETE2_PRER2/247-519--------------------------------------------------------------------------------
D1PWW5_9BACT/248-521--------------------------------------------------------------------------------
D7IDS3_9BACE/184-486--------------------------------------------------------------------------------
D7JZG1_9BACE/181-476--------------------------------------------------------------------------------
D4VL73_9BACE/180-472--------------------------------------------------------------------------------
E6K656_9BACT/179-459--------------------------------------------------------------------------------
Q8A8Z1_BACTN/189-475--------------------------------------------------------------------------------

PF07971

U7PU00_SPOS1/332-877--------------------------------------------------------------------------------
G2NMH0_9ACTO/619-1147--------------------------------------------------------------------------------
G0FHU2_AMYMS/244-723--------------------------------------------------------------------------------
J4HRZ5_FIBRA/329-845--------------------------------------------------------------------------------
R5AV27_9BACE/238-743--------------------------------------------------------------------------------
R6ZMR2_9BACE/255-763--------------------------------------------------------------------------------
Q5LHF2_BACFN/245-751--------------------------------------------------------------------------------
A1S316_SHEAM/272-763--------------------------------------------------------------------------------
A8L8V7_FRASN/271-746--------------------------------------------------------------------------------
G4ND73_MAGO7/262-774--------------------------------------------------------------------------------
E8V2C0_TERSS/272-764--------------------------------------------------------------------------------
F4CDU4_SPHS2/240-732--------------------------------------------------------------------------------
I6SXV1_ENTHA/204-697--------------------------------------------------------------------------------
M2N2U4_BAUCO/275-769--------------------------------------------------------------------------------
A4AN18_MARSH/251-760--------------------------------------------------------------------------------
R5JRR1_9BACE/250-759--------------------------------------------------------------------------------
D5EVW5_PRER2/246-768--------------------------------------------------------------------------------
Q481A5_COLP3/308-820--------------------------------------------------------------------------------
K2R029_MACPH/268-785--------------------------------------------------------------------------------
R6FAY9_9BACE/252-751--------------------------------------------------------------------------------
M7U9N7_BOTF1/265-776--------------------------------------------------------------------------------
N1PXL6_MYCP1/318-821--------------------------------------------------------------------------------
R5IB22_9PORP/238-730--------------------------------------------------------------------------------
C7M4B4_CAPOD/261-744--------------------------------------------------------------------------------
G8TN43_NIAKG/281-774--------------------------------------------------------------------------------
X5D9C9_9BACT/240-768--------------------------------------------------------------------------------
R7DDV2_9PORP/208-728--------------------------------------------------------------------------------
Q8A193_BACTN/246-735--------------------------------------------------------------------------------
B4EIV1_BURCJ/297-798--------------------------------------------------------------------------------
F4CBM6_SPHS2/266-760--------------------------------------------------------------------------------
R6WZT0_9BACT/248-736--------------------------------------------------------------------------------
G8NSC1_GRAMM/270-787--------------------------------------------------------------------------------
Q1IUD1_KORVE/257-751--------------------------------------------------------------------------------
E5R5G1_LEPMJ/250-756--------------------------------------------------------------------------------
F4CCU7_SPHS2/237-742--------------------------------------------------------------------------------
Q0CFC9_ASPTN/249-747--------------------------------------------------------------------------------
Q5LHF3_BACFN/226-731--------------------------------------------------------------------------------
W8F287_9BACT/269-764--------------------------------------------------------------------------------
R6SN01_9BACE/239-746--------------------------------------------------------------------------------
R5KV09_9BACT/237-726--------------------------------------------------------------------------------
R6XA11_9BACT/239-735--------------------------------------------------------------------------------
R6VVJ6_9BACT/252-740--------------------------------------------------------------------------------
Q9PF36_XYLFA/270-764--------------------------------------------------------------------------------
D8Q3G4_SCHCM/263-790--------------------------------------------------------------------------------
R6D727_9BACE/232-737--------------------------------------------------------------------------------
X5DYF1_9BACT/276-770--------------------------------------------------------------------------------
E2PV07_STRC2/616-1149--------------------------------------------------------------------------------
I3ZBQ9_TERRK/285-776--------------------------------------------------------------------------------
R6MN00_9BACE/215-700--------------------------------------------------------------------------------
D8PPV4_SCHCM/271-763--------------------------------------------------------------------------------
G8TCQ4_NIAKG/237-728--------------------------------------------------------------------------------
I2G215_USTH4/348-881--------------------------------------------------------------------------------
G0AF00_COLFT/383-871--------------------------------------------------------------------------------
M4NBS4_9GAMM/425-960--------------------------------------------------------------------------------
R5PL83_9BACT/257-780--------------------------------------------------------------------------------
L2G5N5_COLGN/293-801--------------------------------------------------------------------------------
G0RIK4_HYPJQ/262-771--------------------------------------------------------------------------------
I3ZE22_TERRK/239-727--------------------------------------------------------------------------------
E9F417_METAR/347-850--------------------------------------------------------------------------------
D2QHT3_SPILD/252-742--------------------------------------------------------------------------------
Q8P357_XANCP/267-799--------------------------------------------------------------------------------
R6MN58_9BACE/244-752--------------------------------------------------------------------------------
R6F0X9_9BACE/239-744--------------------------------------------------------------------------------
B5HEX3_STRPR/279-803--------------------------------------------------------------------------------
C7PRR1_CHIPD/254-759--------------------------------------------------------------------------------
E8RS95_ASTEC/249-745--------------------------------------------------------------------------------
F0RGV3_CELLC/254-736--------------------------------------------------------------------------------
R5LY91_9BACE/242-735--------------------------------------------------------------------------------
A6LGN5_PARD8/295-770--------------------------------------------------------------------------------
R6KI45_9BACE/221-722--------------------------------------------------------------------------------
D1BF94_SANKS/371-884--------------------------------------------------------------------------------
Q0UTF3_PHANO/196-689--------------------------------------------------------------------------------
A6LFI6_PARD8/243-749--------------------------------------------------------------------------------
F2KXB9_PREDF/394-872--------------------------------------------------------------------------------
Q0UGQ6_PHANO/177-697--------------------------------------------------------------------------------
R6CWA8_9BACE/238-728--------------------------------------------------------------------------------
F0SF03_PEDSD/222-742--------------------------------------------------------------------------------
A1CAZ9_ASPCL/248-746--------------------------------------------------------------------------------
B8NXN6_ASPFN/165-672--------------------------------------------------------------------------------
R5GRT6_9BACT/247-730--------------------------------------------------------------------------------
D3PUH5_STANL/243-767--------------------------------------------------------------------------------
R6VFG8_9BACT/269-760--------------------------------------------------------------------------------
R5IRF6_9PORP/210-729--------------------------------------------------------------------------------
Q5LAE2_BACFN/237-726--------------------------------------------------------------------------------
C7PM40_CHIPD/270-749--------------------------------------------------------------------------------
K1VMQ9_TRIAC/329-807--------------------------------------------------------------------------------
F9XLT5_MYCGM/322-825--------------------------------------------------------------------------------
R5GD99_9PORP/263-747--------------------------------------------------------------------------------
V2X6S9_MONRO/259-767--------------------------------------------------------------------------------
Q759D8_ASHGO/338-853--------------------------------------------------------------------------------
A6L7S3_BACV8/260-746--------------------------------------------------------------------------------
Q59VA0_CANAL/267-777--------------------------------------------------------------------------------
G3JDG1_CORMM/239-754--------------------------------------------------------------------------------
R5JG70_9BACE/235-740--------------------------------------------------------------------------------
T5AF87_OPHSC/250-762--------------------------------------------------------------------------------
R5FMY1_9BACT/235-740--------------------------------------------------------------------------------
R7EQ20_9BACE/238-724--------------------------------------------------------------------------------
Q8P6S1_XANCP/269-764--------------------------------------------------------------------------------
R7YLH4_CONA1/246-747--------------------------------------------------------------------------------
A5FHD9_FLAJ1/276-770--------------------------------------------------------------------------------
C1F5Z0_ACIC5/273-764--------------------------------------------------------------------------------
N1JJ74_BLUG1/238-758--------------------------------------------------------------------------------
R5I4F3_9PORP/245-752--------------------------------------------------------------------------------
E5A4R8_LEPMJ/277-783--------------------------------------------------------------------------------
U5VWI8_9ACTO/583-1111--------------------------------------------------------------------------------
G2ND96_9ACTO/286-798--------------------------------------------------------------------------------
M3K288_CANMX/252-757--------------------------------------------------------------------------------
F2KZ10_PREDF/243-748--------------------------------------------------------------------------------
G4NF02_MAGO7/324-842--------------------------------------------------------------------------------
R6F0G4_9BACT/261-751--------------------------------------------------------------------------------
M7SRL0_EUTLA/324-836--------------------------------------------------------------------------------
Q0CS76_ASPTN/248-771--------------------------------------------------------------------------------
K0F0T9_9NOCA/266-746--------------------------------------------------------------------------------
C6Y1K7_PEDHD/382-893--------------------------------------------------------------------------------
M3C6Z1_SPHMS/281-790--------------------------------------------------------------------------------
G8NVE4_GRAMM/274-775--------------------------------------------------------------------------------
F4B1S1_KROS4/238-724--------------------------------------------------------------------------------
R6K5T3_9BACE/244-752--------------------------------------------------------------------------------
F9YPS9_CAPCC/306-792--------------------------------------------------------------------------------
T0M9R2_COLGC/270-789--------------------------------------------------------------------------------
I2FQ04_USTH4/294-814--------------------------------------------------------------------------------
J4KN82_BEAB2/261-780--------------------------------------------------------------------------------
F6GE18_LACS5/239-723--------------------------------------------------------------------------------
S7ZU94_PENO1/250-748--------------------------------------------------------------------------------
S8F5G2_FOMPI/253-775--------------------------------------------------------------------------------
F0XC67_GROCL/1247-1767--------------------------------------------------------------------------------
H1YA33_9SPHI/255-747--------------------------------------------------------------------------------
I3YHM3_ALIFI/277-762--------------------------------------------------------------------------------
F8EA41_RUNSL/302-822--------------------------------------------------------------------------------
F8JRR9_STREN/283-770--------------------------------------------------------------------------------
Q8A113_BACTN/217-734--------------------------------------------------------------------------------
F4CF68_SPHS2/232-735--------------------------------------------------------------------------------
W0ESP1_9PORP/261-749--------------------------------------------------------------------------------
W0EKX8_9PORP/235-730--------------------------------------------------------------------------------
I3ZHR8_TERRK/249-728--------------------------------------------------------------------------------
C1GGA7_PARBD/269-776--------------------------------------------------------------------------------
R5MRY8_9BACE/242-741--------------------------------------------------------------------------------
I3YLR2_ALIFI/244-702--------------------------------------------------------------------------------
R7JIM0_9PORP/267-759--------------------------------------------------------------------------------
R7LIY3_9BACT/48-535--------------------------------------------------------------------------------
H8KZ70_FRAAD/281-774--------------------------------------------------------------------------------
R6TIU0_9BACE/253-761--------------------------------------------------------------------------------
Q8PBN8_XANCP/274-763--------------------------------------------------------------------------------
D5BC60_ZUNPS/246-763--------------------------------------------------------------------------------
I3ZYE3_ORNRL/257-746--------------------------------------------------------------------------------
Q8A325_BACTN/237-729--------------------------------------------------------------------------------
R6TIT6_9BACE/233-738--------------------------------------------------------------------------------
R6WV50_9BACT/248-768--------------------------------------------------------------------------------
E9E5Q1_METAQ/268-792--------------------------------------------------------------------------------
X5E0Z5_9BACT/262-743--------------------------------------------------------------------------------
R6CRV2_9BACE/264-756--------------------------------------------------------------------------------
W0F0W6_9SPHI/235-739--------------------------------------------------------------------------------
F2ICV0_FLUTR/264-760--------------------------------------------------------------------------------
L0G0Y1_ECHVK/248-737--------------------------------------------------------------------------------
R6VPA7_9BACT/239-729--------------------------------------------------------------------------------
R6Y8B5_9PORP/251-743--------------------------------------------------------------------------------
F4KQF8_HALH1/232-734--------------------------------------------------------------------------------
W5WJ40_9PSEU/294-773--------------------------------------------------------------------------------
G8P189_GRAMM/260-741--------------------------------------------------------------------------------
A6LE00_PARD8/236-739--------------------------------------------------------------------------------
F8PL93_SERL3/210-728--------------------------------------------------------------------------------
M3A2E6_MYCFI/226-730--------------------------------------------------------------------------------
F5WRB0_ERYRF/193-683--------------------------------------------------------------------------------
W5WNG1_9PSEU/603-1139--------------------------------------------------------------------------------
E3FCN8_STIAD/235-746--------------------------------------------------------------------------------
R5PP34_9PORP/236-741--------------------------------------------------------------------------------
V6KU68_STRRC/239-757--------------------------------------------------------------------------------
R5P2L7_9BACT/238-729--------------------------------------------------------------------------------
D6D181_9BACE/235-738--------------------------------------------------------------------------------
E9F2Y7_METAR/263-770--------------------------------------------------------------------------------
D6D0Y6_9BACE/235-740--------------------------------------------------------------------------------
R6WSC1_9PORP/258-746--------------------------------------------------------------------------------
R6VUD4_9BACT/261-751--------------------------------------------------------------------------------
A2R7B1_ASPNC/261-757--------------------------------------------------------------------------------
D3IB54_9BACT/265-751--------------------------------------------------------------------------------
A4X9V9_SALTO/597-1142--------------------------------------------------------------------------------
S5VGA2_STRCU/302-788--------------------------------------------------------------------------------
R6VNE2_9BACT/223-708--------------------------------------------------------------------------------
A6RG74_AJECN/257-764--------------------------------------------------------------------------------
F8EMI3_RUNSL/253-745--------------------------------------------------------------------------------
V2XHT4_MONRO/284-804--------------------------------------------------------------------------------
R7LDI0_9BACT/241-733--------------------------------------------------------------------------------
C7PM47_CHIPD/233-736--------------------------------------------------------------------------------
G0FHU3_AMYMS/256-775--------------------------------------------------------------------------------
I4A0R9_ORNRL/236-741--------------------------------------------------------------------------------
C6W4W9_DYAFD/261-752--------------------------------------------------------------------------------
M2NEA8_BAUCO/259-773--------------------------------------------------------------------------------
R5VDA0_9BACE/231-736--------------------------------------------------------------------------------
R7JK19_9PORP/291-764--------------------------------------------------------------------------------
R7JG93_9PORP/262-785--------------------------------------------------------------------------------
F3ZQV4_9BACE/233-738--------------------------------------------------------------------------------
R5UGR2_9BACE/235-712--------------------------------------------------------------------------------
M7TB74_EUTLA/290-803--------------------------------------------------------------------------------
R5M3G3_9BACE/215-735--------------------------------------------------------------------------------
C1F144_ACIC5/258-750--------------------------------------------------------------------------------
B8MW61_ASPFN/262-769--------------------------------------------------------------------------------
G0G534_AMYMS/253-730--------------------------------------------------------------------------------
U5W717_9ACTO/583-1116--------------------------------------------------------------------------------
S8AUX2_PENO1/258-766--------------------------------------------------------------------------------
F8PNH6_SERL3/268-750--------------------------------------------------------------------------------
V5FTD6_BYSSN/268-766--------------------------------------------------------------------------------
M4S534_9SPHN/264-754--------------------------------------------------------------------------------
E8RV90_ASTEC/241-719--------------------------------------------------------------------------------
C7M956_CAPOD/237-705--------------------------------------------------------------------------------
F9D252_PREDD/261-751--------------------------------------------------------------------------------
E8RVN8_ASTEC/277-754--------------------------------------------------------------------------------
Q832K9_ENTFA/198-694--------------------------------------------------------------------------------
G8TEK7_NIAKG/223-742--------------------------------------------------------------------------------
M2YKL8_MYCFI/250-760--------------------------------------------------------------------------------
D2QG27_SPILD/248-753--------------------------------------------------------------------------------
F9XL31_MYCGM/226-731--------------------------------------------------------------------------------
K0KAH3_SACES/258-772--------------------------------------------------------------------------------
C9A6J8_ENTCA/198-694--------------------------------------------------------------------------------
C8VIR9_EMENI/281-803--------------------------------------------------------------------------------
R5IR26_9PORP/200-717--------------------------------------------------------------------------------
R5NWD8_9PORP/218-751--------------------------------------------------------------------------------
M7TSY3_BOTF1/247-758--------------------------------------------------------------------------------
R7DIA9_9PORP/249-756--------------------------------------------------------------------------------
Q15ZP0_PSEA6/275-758--------------------------------------------------------------------------------
K1X3Q1_MARBU/242-750--------------------------------------------------------------------------------
A1S315_SHEAM/323-828--------------------------------------------------------------------------------
B2WBV9_PYRTR/250-740--------------------------------------------------------------------------------
F9Z496_ODOSD/396-891--------------------------------------------------------------------------------
A6LGN2_PARD8/232-705--------------------------------------------------------------------------------
S8ENP9_FOMPI/259-761--------------------------------------------------------------------------------
D5BAF4_ZUNPS/266-745--------------------------------------------------------------------------------
R7DMG2_9PORP/271-757--------------------------------------------------------------------------------
E8X2K1_ACISM/255-750--------------------------------------------------------------------------------
E8UZA2_TERSS/258-753--------------------------------------------------------------------------------
R1GPT3_BOTPV/258-769--------------------------------------------------------------------------------
K4L2L4_SIMAS/261-759--------------------------------------------------------------------------------
F4C7M2_SPHS2/213-733--------------------------------------------------------------------------------
F0SAJ1_PEDSD/251-738--------------------------------------------------------------------------------
T0TUP6_9STRE/215-703--------------------------------------------------------------------------------
R6EZA8_9BACT/225-711--------------------------------------------------------------------------------
F4CBM4_SPHS2/244-748--------------------------------------------------------------------------------
R6X4R5_9BACT/257-730--------------------------------------------------------------------------------
G2WSL9_VERDV/225-751--------------------------------------------------------------------------------
R5IAY0_9PORP/233-734--------------------------------------------------------------------------------
K0K341_SACES/604-1134--------------------------------------------------------------------------------
R5M1V6_9BACE/284-758--------------------------------------------------------------------------------
R4SVV6_AMYOR/591-1127--------------------------------------------------------------------------------
R4LXQ2_9ACTO/236-754--------------------------------------------------------------------------------
D5QHV3_KOMHA/262-756--------------------------------------------------------------------------------
R6VKF5_9BACT/149-627--------------------------------------------------------------------------------
F0R2N2_BACSH/259-747--------------------------------------------------------------------------------
W5W2K6_9PSEU/256-741--------------------------------------------------------------------------------
F4C6P9_SPHS2/291-782--------------------------------------------------------------------------------
G8NTY4_GRAMM/256-747--------------------------------------------------------------------------------
F2SFY7_TRIRC/260-769--------------------------------------------------------------------------------
R5PTZ2_9BACT/224-710--------------------------------------------------------------------------------
M2ZGR3_MYCFI/3-544--------------------------------------------------------------------------------
B6HPH9_PENCW/253-761--------------------------------------------------------------------------------
M2QZJ7_CERS8/285-803--------------------------------------------------------------------------------
W8ETM9_9BACT/226-731--------------------------------------------------------------------------------
E4V245_ARTGP/286-792--------------------------------------------------------------------------------
A5E0Q5_LODEL/277-790--------------------------------------------------------------------------------
A6LCG5_PARD8/260-781--------------------------------------------------------------------------------
R5PE19_9PORP/250-774--------------------------------------------------------------------------------
X5DBU2_9BACT/250-774--------------------------------------------------------------------------------
R7DGR9_9PORP/230-735--------------------------------------------------------------------------------
C7M5Q1_CAPOD/256-758--------------------------------------------------------------------------------
J4KLI3_BEAB2/262-770--------------------------------------------------------------------------------
Q15ZM6_PSEA6/259-746--------------------------------------------------------------------------------
R6YIX3_9BACE/219-738--------------------------------------------------------------------------------
N1PP62_MYCP1/266-780--------------------------------------------------------------------------------
M2RQI9_CERS8/267-748--------------------------------------------------------------------------------
F0R5A0_BACSH/244-743--------------------------------------------------------------------------------
R5W019_9BACE/258-740--------------------------------------------------------------------------------
R7DIY0_9PORP/232-735--------------------------------------------------------------------------------
D3EHM8_GEOS4/212-711--------------------------------------------------------------------------------
A2U4A4_9FLAO/231-717--------------------------------------------------------------------------------
R6TED2_9BACE/216-721--------------------------------------------------------------------------------
R5PXF8_9BACT/232-733--------------------------------------------------------------------------------
B2FTQ4_STRMK/273-765--------------------------------------------------------------------------------
E8X698_ACISM/266-765--------------------------------------------------------------------------------
C5BZR8_BEUC1/381-898--------------------------------------------------------------------------------
H1Y2M1_9SPHI/264-755--------------------------------------------------------------------------------
A4AVQ7_MARSH/259-738--------------------------------------------------------------------------------
G3YEZ1_ASPNA/262-771--------------------------------------------------------------------------------
G2WXK7_VERDV/278-783--------------------------------------------------------------------------------
A5DND2_PICGU/244-741--------------------------------------------------------------------------------
Q63NY9_BURPS/274-757--------------------------------------------------------------------------------
Q8A6K3_BACTN/244-732--------------------------------------------------------------------------------
D5BFU0_ZUNPS/240-745--------------------------------------------------------------------------------
F2KYG1_PREDF/264-750--------------------------------------------------------------------------------
L0JB66_PREDD/629-1139--------------------------------------------------------------------------------
B2HSF1_MYCMM/257-753--------------------------------------------------------------------------------
R5PMH4_9BACT/237-741--------------------------------------------------------------------------------
R5FGS5_9BACT/226-715--------------------------------------------------------------------------------
H2K489_STRHJ/583-1111--------------------------------------------------------------------------------
D2QCX6_SPILD/241-774--------------------------------------------------------------------------------
A6KYE2_BACV8/399-911--------------------------------------------------------------------------------
R6WWU7_9BACT/267-759--------------------------------------------------------------------------------
R5JB76_9BACE/257-740--------------------------------------------------------------------------------
X5DJ68_9BACT/247-739--------------------------------------------------------------------------------
D3Q0N4_STANL/442-977--------------------------------------------------------------------------------
C4JIN1_UNCRE/51-558--------------------------------------------------------------------------------
C8VSU5_EMENI/260-769--------------------------------------------------------------------------------
D6D182_9BACE/231-703--------------------------------------------------------------------------------
Q15ZN6_PSEA6/246-752--------------------------------------------------------------------------------
W0EN75_9PORP/237-739--------------------------------------------------------------------------------
A4AVR0_MARSH/241-753--------------------------------------------------------------------------------
D2Q3X9_KRIFD/619-1154--------------------------------------------------------------------------------
Q9AAR3_CAUCR/279-755--------------------------------------------------------------------------------
R6CE95_9BACE/250-741--------------------------------------------------------------------------------
Q481A4_COLP3/296-787--------------------------------------------------------------------------------
B8NLD2_ASPFN/274-781--------------------------------------------------------------------------------
V2XIK0_MONRO/298-813--------------------------------------------------------------------------------
G8TN43_NIAKG/997-1500--------------------------------------------------------------------------------
J4IB15_FIBRA/277-759--------------------------------------------------------------------------------
A3HRW3_9BACT/234-766--------------------------------------------------------------------------------
D7B4B3_NOCDD/288-795--------------------------------------------------------------------------------
R5PLD1_9PORP/272-764--------------------------------------------------------------------------------
X5E1R5_9BACT/239-745--------------------------------------------------------------------------------
R6KIJ4_9BACE/526-1033--------------------------------------------------------------------------------
R5UP48_9PORP/235-740--------------------------------------------------------------------------------
N1PGL0_MYCP1/246-757--------------------------------------------------------------------------------
Q8A5N9_BACTN/236-740--------------------------------------------------------------------------------
R5NK85_9BACT/252-729--------------------------------------------------------------------------------
G0AF01_COLFT/309-844--------------------------------------------------------------------------------
D5BAF6_ZUNPS/245-733--------------------------------------------------------------------------------
S3CNE2_GLAL2/261-772--------------------------------------------------------------------------------
A6KY22_BACV8/241-733--------------------------------------------------------------------------------
Q2G5L6_NOVAD/250-750--------------------------------------------------------------------------------
D7C6N5_STRBB/602-1134--------------------------------------------------------------------------------
Q826D8_STRAW/244-761--------------------------------------------------------------------------------
E9DYP6_METAQ/261-769--------------------------------------------------------------------------------
A5FIB1_FLAJ1/247-738--------------------------------------------------------------------------------
F8JSP5_STREN/250-764--------------------------------------------------------------------------------
G2QF21_THIHA/223-735--------------------------------------------------------------------------------
C7PCT9_CHIPD/255-744--------------------------------------------------------------------------------
I3YNM9_ALIFI/261-754--------------------------------------------------------------------------------
R4L6G3_9ACTO/276-937--------------------------------------------------------------------------------
R5I8Z8_9PORP/233-723--------------------------------------------------------------------------------
Q8P5J8_XANCP/517-1053--------------------------------------------------------------------------------
W5XCM2_9BACT/247-736--------------------------------------------------------------------------------
D5GHL1_TUBMM/330-843--------------------------------------------------------------------------------
U5W551_9ACTO/251-724--------------------------------------------------------------------------------
H1Y6J5_9SPHI/248-747--------------------------------------------------------------------------------
R6SCI2_9BACE/257-776--------------------------------------------------------------------------------
U7PQB8_SPOS1/249-758--------------------------------------------------------------------------------
M3C4G9_SPHMS/315-827--------------------------------------------------------------------------------
R6T8N5_9BACE/251-774--------------------------------------------------------------------------------
G9NN10_HYPAI/257-763--------------------------------------------------------------------------------
Q8A3K6_BACTN/411-890--------------------------------------------------------------------------------
K2QZK9_MACPH/51-547--------------------------------------------------------------------------------
D5ES81_PRER2/224-726--------------------------------------------------------------------------------
W0F3Z3_9SPHI/265-759--------------------------------------------------------------------------------
I6ZRZ1_MELRP/239-725--------------------------------------------------------------------------------
B6QAQ2_PENMQ/263-763--------------------------------------------------------------------------------
Q1ASW5_RUBXD/246-763--------------------------------------------------------------------------------
Q097W8_STIAD/258-782--------------------------------------------------------------------------------
R6U2T8_9BACE/243-731--------------------------------------------------------------------------------
A1S294_SHEAM/264-750--------------------------------------------------------------------------------
E5A3T8_LEPMJ/371-906--------------------------------------------------------------------------------
R5JSK3_9BACE/263-747--------------------------------------------------------------------------------
I0KEB5_9BACT/239-743--------------------------------------------------------------------------------
F3ZQD9_9BACE/261-749--------------------------------------------------------------------------------
A5FGD4_FLAJ1/234-739--------------------------------------------------------------------------------
B4EPR5_BURCJ/299-861--------------------------------------------------------------------------------
J4UKE8_BEAB2/247-759--------------------------------------------------------------------------------
Q5L991_BACFN/270-762--------------------------------------------------------------------------------
G8TBJ6_NIAKG/234-723--------------------------------------------------------------------------------
E3S2L0_PYRTT/262-771--------------------------------------------------------------------------------
D6D1V6_9BACE/205-725--------------------------------------------------------------------------------
M2TG81_COCH5/264-772--------------------------------------------------------------------------------
R5HXL6_9BACT/227-727--------------------------------------------------------------------------------
F0R289_BACSH/238-732--------------------------------------------------------------------------------
H8KM31_SOLCM/242-739--------------------------------------------------------------------------------
R5JE95_9BACE/216-737--------------------------------------------------------------------------------
G3XPX4_ASPNA/256-770--------------------------------------------------------------------------------
S8E8T9_FOMPI/279-762--------------------------------------------------------------------------------
G2PCH2_STRVO/280-787--------------------------------------------------------------------------------
I0KBV7_9BACT/254-771--------------------------------------------------------------------------------
R5B6I7_9BACE/263-755--------------------------------------------------------------------------------
C6X1W4_FLAB3/262-756--------------------------------------------------------------------------------
D3I9D1_9BACT/233-738--------------------------------------------------------------------------------
Q5LED8_BACFN/263-748--------------------------------------------------------------------------------
K8E6J4_CARML/212-711--------------------------------------------------------------------------------
D8PMG3_SCHCM/282-802--------------------------------------------------------------------------------
E8X5W4_ACISM/234-724--------------------------------------------------------------------------------
H1Y4F5_9SPHI/236-741--------------------------------------------------------------------------------
E8UZF7_TERSS/273-788--------------------------------------------------------------------------------
R6VXX4_9BACT/546-1054--------------------------------------------------------------------------------
V2WSZ4_MONRO/278-798--------------------------------------------------------------------------------
G8TJR4_NIAKG/264-757--------------------------------------------------------------------------------
F4A019_MAHA5/196-716--------------------------------------------------------------------------------
U5Q3W7_9BACT/225-717--------------------------------------------------------------------------------
F9XHL5_MYCGM/252-759--------------------------------------------------------------------------------
F4C4K0_SPHS2/253-778--------------------------------------------------------------------------------
A4APM0_MARSH/256-779--------------------------------------------------------------------------------
Q5LHH6_BACFN/237-741--------------------------------------------------------------------------------
R7L3G4_9BACT/242-737--------------------------------------------------------------------------------
D4IQF8_9BACT/238-742--------------------------------------------------------------------------------
A4AVR4_MARSH/248-738--------------------------------------------------------------------------------
A1S293_SHEAM/256-738--------------------------------------------------------------------------------
Q0CV76_ASPTN/826-1333--------------------------------------------------------------------------------
R7DDE0_9PORP/243-730--------------------------------------------------------------------------------
N1PUA1_MYCP1/277-787--------------------------------------------------------------------------------
A1CUM0_ASPCL/255-764--------------------------------------------------------------------------------
Q8A6V7_BACTN/212-732--------------------------------------------------------------------------------
N1QLN3_SPHMS/224-732--------------------------------------------------------------------------------
M2PK65_CERS8/284-800--------------------------------------------------------------------------------
N1JF10_BLUG1/289-847--------------------------------------------------------------------------------
R5RRS9_9BACE/232-754--------------------------------------------------------------------------------
C7PN00_CHIPD/253-750--------------------------------------------------------------------------------
R6W3J5_9BACT/246-723--------------------------------------------------------------------------------
R6SEB5_9BACE/260-742--------------------------------------------------------------------------------
K0KND0_WICCF/263-761--------------------------------------------------------------------------------
R6VRM0_9BACT/239-753--------------------------------------------------------------------------------
K5WZS2_AGABU/306-803--------------------------------------------------------------------------------
R6YLY3_9BACE/245-719--------------------------------------------------------------------------------
A5FI93_FLAJ1/269-745--------------------------------------------------------------------------------
C5M3L3_CANTT/282-787--------------------------------------------------------------------------------
R5N958_9BACT/218-739--------------------------------------------------------------------------------
I2EXN5_EMTOG/234-767--------------------------------------------------------------------------------
I6NCS8_ERECY/333-848--------------------------------------------------------------------------------
G8SIR1_ACTS5/251-722--------------------------------------------------------------------------------
C6WHL9_ACTMD/608-1138--------------------------------------------------------------------------------
A4APL9_MARSH/550-1058--------------------------------------------------------------------------------
B8MZQ6_ASPFN/286-776--------------------------------------------------------------------------------
G0G342_AMYMS/281-764--------------------------------------------------------------------------------
G4MT72_MAGO7/274-775--------------------------------------------------------------------------------
F2KXB7_PREDF/250-737--------------------------------------------------------------------------------
I3YNN2_ALIFI/250-754--------------------------------------------------------------------------------
R6F8M5_9BACT/250-741--------------------------------------------------------------------------------
R5AYY0_9BACE/227-720--------------------------------------------------------------------------------
K5X7A2_PHACS/167-651--------------------------------------------------------------------------------
R5CB12_9BACE/289-781--------------------------------------------------------------------------------
Q0CPM5_ASPTN/206-716--------------------------------------------------------------------------------
G7DU14_MIXOS/248-766--------------------------------------------------------------------------------
R6YT08_9BACE/232-737--------------------------------------------------------------------------------
R7DGG5_9PORP/274-762--------------------------------------------------------------------------------
U5W074_9ACTO/231-753--------------------------------------------------------------------------------
Q7S947_NEUCR/260-768--------------------------------------------------------------------------------
A4VXP8_STRSY/213-704--------------------------------------------------------------------------------
R6XE16_9PORP/263-758--------------------------------------------------------------------------------
D2PP99_KRIFD/282-783--------------------------------------------------------------------------------
Q099T5_STIAD/275-768--------------------------------------------------------------------------------
Q02D57_SOLUE/234-723--------------------------------------------------------------------------------
G8NVQ7_GRAMM/264-754--------------------------------------------------------------------------------
U1HIK3_ENDPU/219-713--------------------------------------------------------------------------------
R6WZ31_9PORP/235-740--------------------------------------------------------------------------------
R6YV68_9BACE/251-749--------------------------------------------------------------------------------
G8T7Y9_NIAKG/241-748--------------------------------------------------------------------------------
Q094Q3_STIAD/646-1181--------------------------------------------------------------------------------
F4C7I4_SPHS2/291-772--------------------------------------------------------------------------------
F0R7B2_BACSH/258-751--------------------------------------------------------------------------------
R6W152_9BACT/268-760--------------------------------------------------------------------------------
R7JIS0_9PORP/257-745--------------------------------------------------------------------------------
N1PC12_MYCP1/320-862--------------------------------------------------------------------------------
R5PNA6_9BACT/250-744--------------------------------------------------------------------------------
Q8A0E8_BACTN/291-771--------------------------------------------------------------------------------
C7PPX9_CHIPD/272-766--------------------------------------------------------------------------------
C6XXW8_PEDHD/280-772--------------------------------------------------------------------------------
R6X226_9PORP/237-732--------------------------------------------------------------------------------
I3YTY7_AEQSU/235-721--------------------------------------------------------------------------------
C7PXX1_CATAD/359-847--------------------------------------------------------------------------------
R6SWH3_9BACE/254-776--------------------------------------------------------------------------------
R4LBG1_9ACTO/593-1121--------------------------------------------------------------------------------
R5NWJ1_9BACT/290-770--------------------------------------------------------------------------------
E4RQ41_LEAB4/240-734--------------------------------------------------------------------------------
J3P516_GAGT3/275-793--------------------------------------------------------------------------------
Y584_MYCTU/255-752--------------------------------------------------------------------------------
K5VRS2_PHACS/284-803--------------------------------------------------------------------------------
H8KS39_SOLCM/263-757--------------------------------------------------------------------------------
G4N8Y8_MAGO7/274-773--------------------------------------------------------------------------------
G0RA48_HYPJQ/257-757--------------------------------------------------------------------------------
R6VZN3_9BACT/252-743--------------------------------------------------------------------------------
C5BV25_BEUC1/276-762--------------------------------------------------------------------------------
G2R1P2_THITE/259-768--------------------------------------------------------------------------------
J3K060_COCIM/256-765--------------------------------------------------------------------------------
M4G0K2_MAGP6/264-772--------------------------------------------------------------------------------
R5JGM2_9BACE/240-745--------------------------------------------------------------------------------
K5W0L8_PHACS/306-823--------------------------------------------------------------------------------
F9XNM6_MYCGM/267-780--------------------------------------------------------------------------------
M2TSE6_COCH5/345-889--------------------------------------------------------------------------------
A6LCT9_PARD8/267-759--------------------------------------------------------------------------------
B2AN89_PODAN/259-766--------------------------------------------------------------------------------
F3ZHW0_9ACTO/252-769--------------------------------------------------------------------------------
F9ZBX8_ODOSD/244-733--------------------------------------------------------------------------------
R7ECF1_9BACE/246-753--------------------------------------------------------------------------------
R5IMK2_9PORP/254-746--------------------------------------------------------------------------------
M1WGU2_CLAP2/273-809--------------------------------------------------------------------------------
R7NSX4_9BACE/244-750--------------------------------------------------------------------------------
V5GCY0_BYSSN/583-1093--------------------------------------------------------------------------------
K5Y2M0_AGABU/276-805--------------------------------------------------------------------------------
G0G6H4_AMYMS/272-771--------------------------------------------------------------------------------
G0SAP0_CHATD/305-830--------------------------------------------------------------------------------
Q7MVX2_PORGI/243-735--------------------------------------------------------------------------------
E4RWA0_LEAB4/231-734--------------------------------------------------------------------------------
Q7S6N7_NEUCR/308-906--------------------------------------------------------------------------------
R4SVW2_AMYOR/373-889--------------------------------------------------------------------------------
R5Q370_9BACT/269-761--------------------------------------------------------------------------------
L0G543_ECHVK/239-745--------------------------------------------------------------------------------
R6K435_9BACE/400-908--------------------------------------------------------------------------------
F9YRP8_CAPCC/247-731--------------------------------------------------------------------------------
H8KZE1_FRAAD/289-783--------------------------------------------------------------------------------
A6LGS3_PARD8/218-705--------------------------------------------------------------------------------
R6MPC3_9BACE/256-780--------------------------------------------------------------------------------
F3ZTR3_9BACE/259-744--------------------------------------------------------------------------------
Q8A5X5_BACTN/527-1034--------------------------------------------------------------------------------
C7PBJ2_CHIPD/232-713--------------------------------------------------------------------------------
G8BG81_CANPC/252-744--------------------------------------------------------------------------------
R6XA16_9BACT/216-719--------------------------------------------------------------------------------
B5RUQ1_DEBHA/241-738--------------------------------------------------------------------------------
Q7MVS0_PORGI/267-769--------------------------------------------------------------------------------
R5VNB2_9PORP/255-750--------------------------------------------------------------------------------
D3Q7H1_STANL/255-731--------------------------------------------------------------------------------
R5INP1_9PORP/202-720--------------------------------------------------------------------------------
R5KVZ5_9FIRM/664-1196--------------------------------------------------------------------------------
C7M5H0_CAPOD/267-754--------------------------------------------------------------------------------
D5BAG1_ZUNPS/253-742--------------------------------------------------------------------------------
V6KI06_STRNV/537-1069--------------------------------------------------------------------------------
R7DME3_9PORP/241-728--------------------------------------------------------------------------------
R0K5A1_SETT2/223-738--------------------------------------------------------------------------------
F8PWD0_SERL3/284-804--------------------------------------------------------------------------------
B2FPN6_STRMK/265-795--------------------------------------------------------------------------------
A3UBV0_CROAH/234-720--------------------------------------------------------------------------------
G8TLM2_NIAKG/236-741--------------------------------------------------------------------------------
M2TDD4_COCSN/270-780--------------------------------------------------------------------------------
J3NHS8_GAGT3/309-828--------------------------------------------------------------------------------
G0RBQ3_HYPJQ/263-768--------------------------------------------------------------------------------
G9NTU6_HYPAI/281-780--------------------------------------------------------------------------------
R6FR09_9BACT/237-726--------------------------------------------------------------------------------
C7MEN4_BRAFD/398-931--------------------------------------------------------------------------------
L7WBB4_NONDD/240-737--------------------------------------------------------------------------------
F3Z5Q3_9ACTO/256-757--------------------------------------------------------------------------------
R5I4F6_9PORP/262-748--------------------------------------------------------------------------------
F9YRT9_CAPCC/241-748--------------------------------------------------------------------------------
S3CDT6_OPHP1/256-782--------------------------------------------------------------------------------
A6KWP8_BACV8/596-1123--------------------------------------------------------------------------------
D2QFK0_SPILD/265-758--------------------------------------------------------------------------------
H5X5L5_9PSEU/410-921--------------------------------------------------------------------------------
B2FTT2_STRMK/524-1061--------------------------------------------------------------------------------
E3QZM0_COLGM/294-802--------------------------------------------------------------------------------
F2IHY2_FLUTR/251-731--------------------------------------------------------------------------------
K9FZU0_PEND2/316-824--------------------------------------------------------------------------------
E6SVL4_BACT6/249-757--------------------------------------------------------------------------------
C6Y1U7_PEDHD/242-775--------------------------------------------------------------------------------
X5DJ19_9BACT/237-722--------------------------------------------------------------------------------
E8WYV5_ACISM/241-731--------------------------------------------------------------------------------
Q9CFH5_LACLA/201-697--------------------------------------------------------------------------------
R5PZ68_9BACT/295-770--------------------------------------------------------------------------------
R6XF07_9BACT/685-1243--------------------------------------------------------------------------------
B8MB98_TALSN/252-759--------------------------------------------------------------------------------
B6H4A8_PENCW/260-779--------------------------------------------------------------------------------
F8JXU3_STREN/239-755--------------------------------------------------------------------------------
C5DCG1_LACTC/310-833--------------------------------------------------------------------------------
D5ES75_PRER2/226-713--------------------------------------------------------------------------------
D5BAW8_ZUNPS/238-741--------------------------------------------------------------------------------
A6LCF6_PARD8/219-739--------------------------------------------------------------------------------
G2QSP3_THITE/219-733--------------------------------------------------------------------------------
G8UKZ7_TANFA/282-775--------------------------------------------------------------------------------
D4Z5J6_SPHJU/281-771--------------------------------------------------------------------------------
M3CXH6_SPHMS/263-778--------------------------------------------------------------------------------
R6EVC1_9BACT/235-740--------------------------------------------------------------------------------
R6X327_9BACT/273-769--------------------------------------------------------------------------------
D5EX99_PRER2/213-697--------------------------------------------------------------------------------
R7JDH8_9PORP/241-729--------------------------------------------------------------------------------
V6JHL2_STRRC/312-799--------------------------------------------------------------------------------
R6YWL1_9BACE/241-732--------------------------------------------------------------------------------
I2ERB7_EMTOG/234-739--------------------------------------------------------------------------------
A4FBR3_SACEN/259-782--------------------------------------------------------------------------------
A6LCF7_PARD8/249-739--------------------------------------------------------------------------------
B6Q8F4_PENMQ/344-845--------------------------------------------------------------------------------
R7DKN9_9PORP/246-753--------------------------------------------------------------------------------
D6CYS0_9BACE/214-734--------------------------------------------------------------------------------
A6KYE5_BACV8/244-735--------------------------------------------------------------------------------
H8KNH9_SOLCM/229-719--------------------------------------------------------------------------------
G2Y9J9_BOTF4/274-791--------------------------------------------------------------------------------
R5VXR7_9BACE/248-736--------------------------------------------------------------------------------
M2Y3U8_MYCP1/263-777--------------------------------------------------------------------------------
S3CZA3_GLAL2/243-743--------------------------------------------------------------------------------
G8Y985_PICSO/250-747--------------------------------------------------------------------------------
S3CJ02_OPHP1/289-811--------------------------------------------------------------------------------
W0ESN6_9PORP/245-752--------------------------------------------------------------------------------
K0KDA2_SACES/297-777--------------------------------------------------------------------------------
T0JX50_COLGC/248-748--------------------------------------------------------------------------------
U5VS77_9ACTO/287-789--------------------------------------------------------------------------------
A8AZ30_STRGC/200-689--------------------------------------------------------------------------------
I4WZK2_9GAMM/263-752--------------------------------------------------------------------------------
M9M713_PSEA3/352-877--------------------------------------------------------------------------------
V6KVF3_STRRC/271-756--------------------------------------------------------------------------------
C8VGN1_EMENI/270-779--------------------------------------------------------------------------------
X5DYI4_9BACT/236-715--------------------------------------------------------------------------------
V2WYF3_MONRO/231-745--------------------------------------------------------------------------------
M2TXV2_COCH5/273-777--------------------------------------------------------------------------------
G0L6Z0_ZOBGA/237-763--------------------------------------------------------------------------------
R5BAT3_9BACE/236-724--------------------------------------------------------------------------------
G2Y0H1_BOTF4/247-748--------------------------------------------------------------------------------
Q0UBD4_PHANO/209-719--------------------------------------------------------------------------------
G8NZ65_GRAMM/261-740--------------------------------------------------------------------------------
B8NJS3_ASPFN/263-777--------------------------------------------------------------------------------
E4ZUP2_LEPMJ/400-905--------------------------------------------------------------------------------
E3S9H8_PYRTT/265-772--------------------------------------------------------------------------------
I3YTY8_AEQSU/266-760--------------------------------------------------------------------------------
G2WSC5_VERDV/65-568--------------------------------------------------------------------------------
A1S298_SHEAM/253-759--------------------------------------------------------------------------------
H1Y1A2_9SPHI/235-749--------------------------------------------------------------------------------
G0RVA4_HYPJQ/267-785--------------------------------------------------------------------------------
C6W5S0_DYAFD/235-740--------------------------------------------------------------------------------
Q5KC19_CRYNJ/394-906--------------------------------------------------------------------------------
V5XU82_ENTMU/202-696--------------------------------------------------------------------------------
I4A2R7_ORNRL/261-747--------------------------------------------------------------------------------
D5EV06_PRER2/233-738--------------------------------------------------------------------------------
R4LP30_9ACTO/285-771--------------------------------------------------------------------------------
E6SVM9_BACT6/263-748--------------------------------------------------------------------------------
H1Y8C2_9SPHI/251-741--------------------------------------------------------------------------------
H2K488_STRHJ/278-785--------------------------------------------------------------------------------
C5CEA2_KOSOT/244-735--------------------------------------------------------------------------------
G0J3Z4_CYCMS/228-758--------------------------------------------------------------------------------
F8EET3_RUNSL/236-741--------------------------------------------------------------------------------
R6Y942_9BACE/292-766--------------------------------------------------------------------------------
F3ZHF5_9ACTO/291-774--------------------------------------------------------------------------------
R7J4K5_9PORP/107-615--------------------------------------------------------------------------------
R9P496_PSEHS/343-861--------------------------------------------------------------------------------
R7DDY6_9PORP/212-733--------------------------------------------------------------------------------
Q9AAM3_CAUCR/252-730--------------------------------------------------------------------------------
A6KYE4_BACV8/284-757--------------------------------------------------------------------------------
G8UPB2_TANFA/226-731--------------------------------------------------------------------------------
H1XZC8_9SPHI/276-770--------------------------------------------------------------------------------
Q0UBG2_PHANO/4-547--------------------------------------------------------------------------------
J3P1C3_GAGT3/282-816--------------------------------------------------------------------------------
Q01W62_SOLUE/249-753--------------------------------------------------------------------------------
F4C7L7_SPHS2/240-744--------------------------------------------------------------------------------
R7DJ79_9PORP/244-733--------------------------------------------------------------------------------
R6DAV4_9BACE/245-752--------------------------------------------------------------------------------
S3CIA7_OPHP1/264-768--------------------------------------------------------------------------------
R5F4D5_9BACE/237-740--------------------------------------------------------------------------------
A5FF75_FLAJ1/237-767--------------------------------------------------------------------------------
G7XUX9_ASPKW/172-670--------------------------------------------------------------------------------
R6VFA8_9BACT/232-725--------------------------------------------------------------------------------
R6KBU8_9BACE/236-731--------------------------------------------------------------------------------
L0G487_ECHVK/265-759--------------------------------------------------------------------------------
I3YNN1_ALIFI/244-731--------------------------------------------------------------------------------
D5EXZ8_PRER2/238-721--------------------------------------------------------------------------------
H1XSR1_9BACT/243-734--------------------------------------------------------------------------------
C6WEC8_ACTMD/275-780--------------------------------------------------------------------------------
G0FQH4_AMYMS/592-1128--------------------------------------------------------------------------------
R7JAF0_9PORP/29-519--------------------------------------------------------------------------------
Q73SJ7_MYCPA/254-750--------------------------------------------------------------------------------
Q6CNV6_KLULA/306-819--------------------------------------------------------------------------------
F2UPM6_SALR5/297-792--------------------------------------------------------------------------------
H1Y718_9SPHI/236-741--------------------------------------------------------------------------------
G0FQH3_AMYMS/368-895--------------------------------------------------------------------------------
F9D249_PREDD/223-709--------------------------------------------------------------------------------
G8NVG8_GRAMM/262-757--------------------------------------------------------------------------------
Q023I7_SOLUE/230-716--------------------------------------------------------------------------------
C4JL73_UNCRE/255-765--------------------------------------------------------------------------------
A3HZJ9_9BACT/231-714--------------------------------------------------------------------------------
F4C4J4_SPHS2/528-1036--------------------------------------------------------------------------------
R6D9S0_9BACE/252-747--------------------------------------------------------------------------------
M2LV24_BAUCO/278-789--------------------------------------------------------------------------------
G8T7Z2_NIAKG/252-774--------------------------------------------------------------------------------
H1Y4F6_9SPHI/255-746--------------------------------------------------------------------------------
J4WIX0_BEAB2/266-765--------------------------------------------------------------------------------
G8UK11_TANFA/264-748--------------------------------------------------------------------------------
H8KS37_SOLCM/238-743--------------------------------------------------------------------------------
R6VYQ1_9BACT/263-758--------------------------------------------------------------------------------
Q15ZN9_PSEA6/254-740--------------------------------------------------------------------------------
V5FJJ3_BYSSN/325-822--------------------------------------------------------------------------------
R6B5C9_9BACT/676-1194--------------------------------------------------------------------------------
R6W673_9BACT/246-752--------------------------------------------------------------------------------
F3ZH20_9ACTO/292-800--------------------------------------------------------------------------------
R6TFX8_9BACE/274-766--------------------------------------------------------------------------------
N1QGM3_SPHMS/250-760--------------------------------------------------------------------------------
S7ZPF5_PENO1/271-784--------------------------------------------------------------------------------
R6WV75_9BACT/208-715--------------------------------------------------------------------------------
Q5LHE9_BACFN/239-732--------------------------------------------------------------------------------
G4MXA7_MAGO7/248-765--------------------------------------------------------------------------------
Q1ASW2_RUBXD/611-1156--------------------------------------------------------------------------------
C7QF41_CATAD/255-741--------------------------------------------------------------------------------
G9NFV5_HYPAI/276-779--------------------------------------------------------------------------------
G8NT21_GRAMM/264-755--------------------------------------------------------------------------------
G0FZ68_AMYMS/242-765--------------------------------------------------------------------------------
I3YPK4_ALIFI/224-709--------------------------------------------------------------------------------
D5BFU1_ZUNPS/296-790--------------------------------------------------------------------------------
R5IIM1_9PORP/216-736--------------------------------------------------------------------------------
R6FB01_9BACE/260-753--------------------------------------------------------------------------------
S3BSV4_OPHP1/319-858--------------------------------------------------------------------------------
M3A5V7_MYCFI/262-774--------------------------------------------------------------------------------
B8LV53_TALSN/263-772--------------------------------------------------------------------------------
R5W4N0_9BACE/262-755--------------------------------------------------------------------------------
R6W0P6_9BACT/237-741--------------------------------------------------------------------------------
R6KAU3_9BACE/264-757--------------------------------------------------------------------------------
E8V399_TERSS/271-762--------------------------------------------------------------------------------
G8NZ99_GRAMM/263-758--------------------------------------------------------------------------------
R6W2H2_9BACT/221-709--------------------------------------------------------------------------------
F9XJZ4_MYCGM/258-769--------------------------------------------------------------------------------
C4LZ28_ENTHI/211-703--------------------------------------------------------------------------------
B0T313_CAUSK/265-756--------------------------------------------------------------------------------
C6WE78_ACTMD/245-762--------------------------------------------------------------------------------
W8EZC7_9BACT/260-749--------------------------------------------------------------------------------
M4FLW6_MAGP6/252-753--------------------------------------------------------------------------------
R5IJ85_9BACT/268-765--------------------------------------------------------------------------------
F0RGV6_CELLC/241-746--------------------------------------------------------------------------------
M4FSD6_MAGP6/258-774--------------------------------------------------------------------------------
F8JNS7_STREN/258-772--------------------------------------------------------------------------------
A5FGD3_FLAJ1/249-739--------------------------------------------------------------------------------
B6QUE6_PENMQ/228-737--------------------------------------------------------------------------------
G2Z075_FLABF/223-715--------------------------------------------------------------------------------
D5BJC2_ZUNPS/202-723--------------------------------------------------------------------------------
A5FF74_FLAJ1/244-744--------------------------------------------------------------------------------
Q4WT26_ASPFU/261-770--------------------------------------------------------------------------------
Q7MU52_PORGI/214-733--------------------------------------------------------------------------------
M4FWH0_MAGP6/251-753--------------------------------------------------------------------------------
R6Y700_9BACE/243-734--------------------------------------------------------------------------------
K5WLA8_AGABU/293-799--------------------------------------------------------------------------------
R5NRY2_9PORP/243-733--------------------------------------------------------------------------------
U5VWY0_9ACTO/411-919--------------------------------------------------------------------------------
Q8A5Y1_BACTN/523-1040--------------------------------------------------------------------------------
R6ZR28_9BACE/240-724--------------------------------------------------------------------------------
F3ZIF3_9ACTO/644-1176--------------------------------------------------------------------------------
I3ZK24_TERRK/241-733--------------------------------------------------------------------------------
F4C4M8_SPHS2/233-715--------------------------------------------------------------------------------
D5QF63_KOMHA/270-761--------------------------------------------------------------------------------
A6LGN6_PARD8/237-739--------------------------------------------------------------------------------
R5PMC5_9BACT/642-1143--------------------------------------------------------------------------------
R6Y5H0_9PORP/264-755--------------------------------------------------------------------------------
W5W8J6_9PSEU/284-764--------------------------------------------------------------------------------
R5PXP4_9BACT/242-747--------------------------------------------------------------------------------
R5F602_9BACE/359-848--------------------------------------------------------------------------------
R5UUU5_9PORP/265-757--------------------------------------------------------------------------------
M3B4L8_MYCFI/275-789--------------------------------------------------------------------------------
W5WHY7_9PSEU/271-765--------------------------------------------------------------------------------
I3ZB09_TERRK/256-750--------------------------------------------------------------------------------
R6LH54_9BACE/268-773--------------------------------------------------------------------------------
T0K2G4_COLGC/277-787--------------------------------------------------------------------------------
A6LEE3_PARD8/400-911--------------------------------------------------------------------------------
M7UMW1_BOTF1/288-793--------------------------------------------------------------------------------
M3AXL3_MYCFI/139-646--------------------------------------------------------------------------------
E3QRS6_COLGM/296-810--------------------------------------------------------------------------------
W5W3K0_9PSEU/251-733--------------------------------------------------------------------------------
F9YQE4_CAPCC/260-746--------------------------------------------------------------------------------
B6HMT5_PENCW/256-764--------------------------------------------------------------------------------
C1F7W7_ACIC5/298-792--------------------------------------------------------------------------------
W5W9Q6_9PSEU/246-769--------------------------------------------------------------------------------
F5HDD2_PORGI/251-753--------------------------------------------------------------------------------
G9MLE1_HYPVG/265-784--------------------------------------------------------------------------------
G0G0P7_AMYMS/232-748--------------------------------------------------------------------------------
R5C0J2_9BACE/249-739--------------------------------------------------------------------------------
E3QRP8_COLGM/246-753--------------------------------------------------------------------------------

PF13229

A4HFK4_LEIBR/1122-1276--------------------------------------------------------------------------------
A4RWC7_OSTLU/255-410--------------------------------------------------------------------------------
C1MV84_MICPC/432-587--------------------------------------------------------------------------------
A0B575_METTP/145-292--------------------------------------------------------------------------------
B1LZG7_METRJ/126-306--------------------------------------------------------------------------------
B8IPB3_METNO/205-368--------------------------------------------------------------------------------
Q1IR31_KORVE/209-372--------------------------------------------------------------------------------
Q1IJK3_KORVE/204-367--------------------------------------------------------------------------------
D2PZ24_KRIFD/241-418--------------------------------------------------------------------------------
D2PZ28_KRIFD/298-476--------------------------------------------------------------------------------
D1CII1_THET1/254-430--------------------------------------------------------------------------------
Q5KIH2_CRYNJ/125-330--------------------------------------------------------------------------------
A2DQI5_TRIVA/133-313--------------------------------------------------------------------------------
A2GN59_TRIVA/178-358--------------------------------------------------------------------------------
A2DSW4_TRIVA/295-476--------------------------------------------------------------------------------
D2VXU7_NAEGR/1914-2119--------------------------------------------------------------------------------
D3E003_METRM/246-408--------------------------------------------------------------------------------
D2VGY1_NAEGR/119-306--------------------------------------------------------------------------------
A5UJV8_METS3/96-251--------------------------------------------------------------------------------
D7DS12_METV3/546-725--------------------------------------------------------------------------------
D7DT96_METV3/87-251--------------------------------------------------------------------------------
A5UN24_METS3/1015-1205--------------------------------------------------------------------------------
D3DZT1_METRM/1034-1216--------------------------------------------------------------------------------
A5UNL3_METS3/391-540--------------------------------------------------------------------------------
Q2NFB2_METST/846-1038--------------------------------------------------------------------------------
A5UN26_METS3/210-367--------------------------------------------------------------------------------
Q11PH9_CYTH3/3751-3918--------------------------------------------------------------------------------
A2DZP5_TRIVA/237-393--------------------------------------------------------------------------------
A2EWG4_TRIVA/238-392--------------------------------------------------------------------------------
Q2K708_RHIEC/156-330--------------------------------------------------------------------------------
C6X284_FLAB3/105-267--------------------------------------------------------------------------------
B7GKQ0_ANOFW/105-265--------------------------------------------------------------------------------
A5UM93_METS3/570-727--------------------------------------------------------------------------------
B1Y807_LEPCP/135-286--------------------------------------------------------------------------------
C4ZN21_THASP/165-316--------------------------------------------------------------------------------
Q5NZ04_AROAE/165-316--------------------------------------------------------------------------------
A7ZFW4_CAMC1/149-307--------------------------------------------------------------------------------
D4H675_DENA2/149-307--------------------------------------------------------------------------------
A2F6G3_TRIVA/566-720--------------------------------------------------------------------------------
B2A266_NATTJ/667-827--------------------------------------------------------------------------------
D3DZT1_METRM/180-349--------------------------------------------------------------------------------
Q21PK3_SACD2/316-486--------------------------------------------------------------------------------
A8ZSU8_DESOH/610-786--------------------------------------------------------------------------------
Q01V78_SOLUE/318-510--------------------------------------------------------------------------------
B4NKK3_DROWI/907-1062--------------------------------------------------------------------------------
Q1RQ01_CIOIN/615-770--------------------------------------------------------------------------------
Q1RQ01_CIOIN/338-494--------------------------------------------------------------------------------
A8LUC6_DINSH/146-309--------------------------------------------------------------------------------
A9WDN6_CHLAA/503-681--------------------------------------------------------------------------------
Q0W3D6_UNCMA/107-264--------------------------------------------------------------------------------
D2RS85_HALTV/217-421--------------------------------------------------------------------------------
A9B4J4_HERA2/210-386--------------------------------------------------------------------------------
D3F6E1_CONWI/144-334--------------------------------------------------------------------------------
Q4E3J7_TRYCC/564-717--------------------------------------------------------------------------------
Q8ZXB6_PYRAE/124-281--------------------------------------------------------------------------------
B5IFT4_ACIB4/648-827--------------------------------------------------------------------------------
Y1396_METJA/2174-2323--------------------------------------------------------------------------------
A8XCU4_CAEBR/377-555--------------------------------------------------------------------------------
A8XCU4_CAEBR/835-1021--------------------------------------------------------------------------------
B8GIH1_METPE/210-388--------------------------------------------------------------------------------
Q6LZ14_METMP/541-702--------------------------------------------------------------------------------
B8GKS8_METPE/88-248--------------------------------------------------------------------------------
B1L3G7_KORCO/159-312--------------------------------------------------------------------------------
Q8TR94_METAC/114-266--------------------------------------------------------------------------------
Q12Y38_METBU/125-275--------------------------------------------------------------------------------
Q12Z43_METBU/104-256--------------------------------------------------------------------------------
Q8TLY7_METAC/117-269--------------------------------------------------------------------------------
Q8TQN2_METAC/592-749--------------------------------------------------------------------------------
Q8THN3_METAC/410-561--------------------------------------------------------------------------------
Q8TMY7_METAC/1017-1166--------------------------------------------------------------------------------
D2VGW6_NAEGR/142-294--------------------------------------------------------------------------------
A2DG23_TRIVA/257-412--------------------------------------------------------------------------------
Q4E3J7_TRYCC/767-933--------------------------------------------------------------------------------
A2EXK6_TRIVA/265-421--------------------------------------------------------------------------------
A4X252_SALTO/119-272--------------------------------------------------------------------------------
B8GHS2_METPE/296-452--------------------------------------------------------------------------------
A2DG23_TRIVA/493-649--------------------------------------------------------------------------------
A2E713_TRIVA/471-626--------------------------------------------------------------------------------
A2DGW8_TRIVA/182-337--------------------------------------------------------------------------------
A2FYC7_TRIVA/339-494--------------------------------------------------------------------------------
A2FPW6_TRIVA/308-481--------------------------------------------------------------------------------
Q5WHY7_BACSK/106-258--------------------------------------------------------------------------------
A2DIY9_TRIVA/83-240--------------------------------------------------------------------------------
A2EAN8_TRIVA/175-332--------------------------------------------------------------------------------
A2ENP8_TRIVA/245-395--------------------------------------------------------------------------------
A2GD34_TRIVA/590-746--------------------------------------------------------------------------------
A2DQW2_TRIVA/362-515--------------------------------------------------------------------------------
A2FHX0_TRIVA/618-765--------------------------------------------------------------------------------
A2ERI6_TRIVA/309-462--------------------------------------------------------------------------------
B1HXQ4_LYSSC/149-305--------------------------------------------------------------------------------
A2ELJ5_TRIVA/1001-1152--------------------------------------------------------------------------------
A2ENP8_TRIVA/80-239--------------------------------------------------------------------------------
D3BJ88_POLPA/671-831--------------------------------------------------------------------------------
A2EXP7_TRIVA/122-276--------------------------------------------------------------------------------
A2FHX0_TRIVA/309-464--------------------------------------------------------------------------------
A2EYD0_TRIVA/230-382--------------------------------------------------------------------------------
A9V8X4_MONBE/130-296--------------------------------------------------------------------------------
C3Y624_BRAFL/300-474--------------------------------------------------------------------------------
C8W2D1_DESAS/138-297--------------------------------------------------------------------------------
D3TBL1_ACIB4/958-1108--------------------------------------------------------------------------------
G1LPY2_AILME/2243-2418--------------------------------------------------------------------------------
PLYL_DICD3/133-313--------------------------------------------------------------------------------
Q251J0_DESHY/90-272--------------------------------------------------------------------------------
Q2K908_RHIEC/104-274--------------------------------------------------------------------------------
R6P1V8_9CLOT/1010-1182--------------------------------------------------------------------------------

PF01696

Q9W859_ADEP3/86-474--------------------------------------------------------------------------------
E1BL_ADECT/56-441--------------------------------------------------------------------------------
Q64892_ADEM1/37-434--------------------------------------------------------------------------------
Q3ZKW1_9ADEN/107-489--------------------------------------------------------------------------------
Q5GFC6_ADE04/98-480--------------------------------------------------------------------------------
Q9EEG1_ADEB2/14-388--------------------------------------------------------------------------------
Q64844_ADEB3/35-420--------------------------------------------------------------------------------
A0MK44_9ADEN/90-471--------------------------------------------------------------------------------
E1BL_ADET1/2-390--------------------------------------------------------------------------------
E1BL_ADE12/96-479--------------------------------------------------------------------------------
E1U5L8_ADE06/110-492--------------------------------------------------------------------------------
Q695T4_9ADEN/122-506--------------------------------------------------------------------------------
E1BL_ADE40/96-475--------------------------------------------------------------------------------
Q9YL98_ADE09/110-492--------------------------------------------------------------------------------
Q83459_ADEP4/28-410--------------------------------------------------------------------------------

PF12218

ENAN_BPK1E/39-102--------------------------------------------------------------------------------
Q858B1_BPK1F/246-312--------------------------------------------------------------------------------
A5VW57_9CAUD/146-212--------------------------------------------------------------------------------
A1AE04_ECOK1/205-271--------------------------------------------------------------------------------
O80102_9VIRU/167-233--------------------------------------------------------------------------------

PF03211

U4KZB8_PYROM/36-231--------------------------------------------------------------------------------
N4URI8_COLOR/120-318--------------------------------------------------------------------------------
G2YGI6_BOTF4/126-326--------------------------------------------------------------------------------
M7SI60_EUTLA/18-215--------------------------------------------------------------------------------
U5W5Z4_9ACTO/38-237--------------------------------------------------------------------------------
G2YHG4_BOTF4/24-226--------------------------------------------------------------------------------
K1XD07_MARBU/185-384--------------------------------------------------------------------------------
M5BPL9_THACB/50-249--------------------------------------------------------------------------------
C7YTS6_NECH7/7-209--------------------------------------------------------------------------------
M7SJD8_EUTLA/23-220--------------------------------------------------------------------------------
T0M282_COLGC/23-218--------------------------------------------------------------------------------
N4VGC5_COLOR/253-453--------------------------------------------------------------------------------
M5BUQ1_THACB/42-237--------------------------------------------------------------------------------
G4N3X4_MAGO7/18-215--------------------------------------------------------------------------------
B5I637_9ACTO/39-241--------------------------------------------------------------------------------
G2XEV0_VERDV/54-253--------------------------------------------------------------------------------
G2QG74_THIHA/26-225--------------------------------------------------------------------------------
Q829M8_STRAW/47-250--------------------------------------------------------------------------------
A8NTC3_COPC7/28-228--------------------------------------------------------------------------------
C6WMH9_ACTMD/38-241--------------------------------------------------------------------------------
G8S809_ACTS5/262-462--------------------------------------------------------------------------------
F9X162_MYCGM/31-229--------------------------------------------------------------------------------
G0S9D6_CHATD/128-328--------------------------------------------------------------------------------
I1RLQ0_GIBZE/23-220--------------------------------------------------------------------------------
V2XPM5_MONRO/28-226--------------------------------------------------------------------------------
K2RXU6_MACPH/35-230--------------------------------------------------------------------------------
L2FCH6_COLGN/26-225--------------------------------------------------------------------------------
N4V6F8_COLOR/112-311--------------------------------------------------------------------------------
E3EDF5_PAEPS/30-221--------------------------------------------------------------------------------
S8AHU9_DACHA/114-312--------------------------------------------------------------------------------
C7ZI42_NECH7/20-217--------------------------------------------------------------------------------
H3GY48_PHYRM/27-237--------------------------------------------------------------------------------
U4LBE6_PYROM/18-216--------------------------------------------------------------------------------
Q6D881_PECAS/102-322--------------------------------------------------------------------------------
Q7C4I5_PSESM/215-419--------------------------------------------------------------------------------
N4VEF5_COLOR/166-363--------------------------------------------------------------------------------
K2RMN8_MACPH/74-272--------------------------------------------------------------------------------
Q2H8P5_CHAGB/58-258--------------------------------------------------------------------------------
PLYF_ASPTN/22-224--------------------------------------------------------------------------------
PLYC_BACSU/18-214--------------------------------------------------------------------------------
PLYE_ASPFN/39-234--------------------------------------------------------------------------------
C7YXY0_NECH7/23-222--------------------------------------------------------------------------------
PLYG_ASPTN/27-222--------------------------------------------------------------------------------
B3PKE5_CELJU/106-320--------------------------------------------------------------------------------
T0K0R1_COLGC/25-223--------------------------------------------------------------------------------
F2R0Z1_STRVP/47-250--------------------------------------------------------------------------------
H3H676_PHYRM/399-600--------------------------------------------------------------------------------
D8PQN8_SCHCM/23-225--------------------------------------------------------------------------------
PLYD_ASPFU/22-218--------------------------------------------------------------------------------
C9SJ36_VERA1/19-214--------------------------------------------------------------------------------
M5C0K5_THACB/40-238--------------------------------------------------------------------------------
N1RGU5_FUSC4/156-353--------------------------------------------------------------------------------
Q2HHN7_CHAGB/24-222--------------------------------------------------------------------------------
I0HH67_ACTM4/194-394--------------------------------------------------------------------------------
N1QBX5_MYCFI/2-198--------------------------------------------------------------------------------
I0H512_ACTM4/182-378--------------------------------------------------------------------------------
C6WMH1_ACTMD/31-234--------------------------------------------------------------------------------
PLYD_EMENI/42-239--------------------------------------------------------------------------------
Q7S4B7_NEUCR/27-227--------------------------------------------------------------------------------
G4TNX7_PIRID/34-234--------------------------------------------------------------------------------
I0GXB6_ACTM4/290-490--------------------------------------------------------------------------------
K2RTS7_MACPH/22-219--------------------------------------------------------------------------------
K2SGW5_MACPH/29-225--------------------------------------------------------------------------------
M5BX85_THACB/52-251--------------------------------------------------------------------------------
G1WXZ0_ARTOA/97-294--------------------------------------------------------------------------------
E3Q1Z9_COLGM/95-295--------------------------------------------------------------------------------
F2JTB7_MARM1/279-472--------------------------------------------------------------------------------
B2APR3_PODAN/24-223--------------------------------------------------------------------------------
M5BPI1_THACB/35-233--------------------------------------------------------------------------------
D8QKC3_SCHCM/33-233--------------------------------------------------------------------------------
H6NS60_9BACL/19-215--------------------------------------------------------------------------------
D6X7B4_STRPR/40-243--------------------------------------------------------------------------------
D7CEB6_STRBB/44-244--------------------------------------------------------------------------------
C7YZY2_NECH7/19-218--------------------------------------------------------------------------------
K2RAB2_MACPH/20-220--------------------------------------------------------------------------------
K1WSP2_MARBU/22-217--------------------------------------------------------------------------------
M3CJL1_SPHMS/22-219--------------------------------------------------------------------------------
C9SY14_VERA1/23-220--------------------------------------------------------------------------------
C9S8R7_VERA1/23-222--------------------------------------------------------------------------------
M5BYG9_THACB/44-239--------------------------------------------------------------------------------
S8CBN6_DACHA/113-310--------------------------------------------------------------------------------
E0SM75_DICD3/100-319--------------------------------------------------------------------------------
C7ZNK4_NECH7/23-222--------------------------------------------------------------------------------
G2XBC9_VERDV/24-222--------------------------------------------------------------------------------
C7ZB71_NECH7/24-221--------------------------------------------------------------------------------
A8L1K4_FRASN/141-339--------------------------------------------------------------------------------
PLYC_BACLD/19-214--------------------------------------------------------------------------------

PF09251

Q8SCG9_BPSP6/3-550--------------------------------------------------------------------------------
TSPE_BPP22/116-665--------------------------------------------------------------------------------

PF12541

D6DHZ7_CLOSC/2-271--------------------------------------------------------------------------------
R5PWU1_9BURK/2-278--------------------------------------------------------------------------------
A5VMS3_LACRD/2-277--------------------------------------------------------------------------------
R5L1C9_9CLOT/2-273--------------------------------------------------------------------------------
R5GK22_9BACT/2-278--------------------------------------------------------------------------------
R6F061_9BACT/2-278--------------------------------------------------------------------------------
Q6LZ36_METMP/37-311--------------------------------------------------------------------------------
R5A3D5_9CLOT/2-271--------------------------------------------------------------------------------
R5VXN8_9DELT/3-274--------------------------------------------------------------------------------
R7EP62_9FIRM/5-279--------------------------------------------------------------------------------
R6VTW4_9BACT/2-278--------------------------------------------------------------------------------
Q8A7X5_BACTN/2-278--------------------------------------------------------------------------------
R7HQ78_9BACT/2-277--------------------------------------------------------------------------------
D7DSW7_METV3/56-328--------------------------------------------------------------------------------
R6G7J9_9FIRM/8-282--------------------------------------------------------------------------------
R7DGS5_9PORP/2-278--------------------------------------------------------------------------------
R7R6X9_9FIRM/2-276--------------------------------------------------------------------------------
Q5FL14_LACAC/3-277--------------------------------------------------------------------------------
R6JX58_9FIRM/7-281--------------------------------------------------------------------------------
R5YM64_9FIRM/4-278--------------------------------------------------------------------------------
R5R5M3_9FIRM/2-276--------------------------------------------------------------------------------
A7ZFS8_CAMC1/2-276--------------------------------------------------------------------------------
R6XGP3_9FIRM/2-276--------------------------------------------------------------------------------
R7BSW2_9FIRM/8-275--------------------------------------------------------------------------------
R6N8F1_9CLOT/2-271--------------------------------------------------------------------------------
R6CNQ1_9BACT/2-275--------------------------------------------------------------------------------
M1MK35_9CLOT/2-276--------------------------------------------------------------------------------
A2DNE3_TRIVA/4-279--------------------------------------------------------------------------------
R6E1V7_9BACE/2-278--------------------------------------------------------------------------------
R5G5K3_9FIRM/6-274--------------------------------------------------------------------------------
R5YBV7_9BACE/2-278--------------------------------------------------------------------------------
R6X1F7_9BACT/2-278--------------------------------------------------------------------------------
C4Z7J5_EUBE2/13-287--------------------------------------------------------------------------------
A6LAN5_PARD8/2-278--------------------------------------------------------------------------------
E6UH73_RUMA7/2-277--------------------------------------------------------------------------------
J9VZH1_LACBU/2-277--------------------------------------------------------------------------------
A2DXQ6_TRIVA/15-290--------------------------------------------------------------------------------
R7J179_9BACT/4-280--------------------------------------------------------------------------------
R7IJ73_9BURK/2-278--------------------------------------------------------------------------------
R5UHT9_9FIRM/12-285--------------------------------------------------------------------------------
R7C9P6_9CLOT/2-276--------------------------------------------------------------------------------
R7FLD7_9CLOT/4-277--------------------------------------------------------------------------------
R5GYL3_9FIRM/5-279--------------------------------------------------------------------------------
R5PEP4_9BACT/2-278--------------------------------------------------------------------------------
F9URY5_LACPL/2-277--------------------------------------------------------------------------------
R5KIW2_9BACT/2-278--------------------------------------------------------------------------------
D6S309_9LACO/2-277--------------------------------------------------------------------------------
R7ADB3_9FIRM/2-270--------------------------------------------------------------------------------
C4ZDA1_EUBR3/5-279--------------------------------------------------------------------------------
B2UN04_AKKM8/4-280--------------------------------------------------------------------------------
R7BJD2_9FIRM/4-275--------------------------------------------------------------------------------
R5ZSK8_9CLOT/2-276--------------------------------------------------------------------------------
R5P9J9_9CLOT/3-277--------------------------------------------------------------------------------
R7K3P1_9CLOT/2-276--------------------------------------------------------------------------------
R7A2C4_9FIRM/3-270--------------------------------------------------------------------------------
R5EWD8_9GAMM/2-279--------------------------------------------------------------------------------
R6UKR3_9STAP/2-276--------------------------------------------------------------------------------
R5QNY5_9PROT/3-277--------------------------------------------------------------------------------
R6WGE2_9FIRM/2-277--------------------------------------------------------------------------------
R6DEH5_9CLOT/2-276--------------------------------------------------------------------------------
Q74K41_LACJO/2-277--------------------------------------------------------------------------------
R7GEC7_9CLOT/2-271--------------------------------------------------------------------------------
C4LFU5_TOLAT/2-277--------------------------------------------------------------------------------
R5QQP9_9FIRM/2-277--------------------------------------------------------------------------------
R5V321_9FIRM/3-274--------------------------------------------------------------------------------
Q03TK5_LACBA/3-278--------------------------------------------------------------------------------
R5G0S8_9ACTN/11-287--------------------------------------------------------------------------------
R5R960_9FIRM/2-274--------------------------------------------------------------------------------
B8DUR7_BIFA0/2-277--------------------------------------------------------------------------------
R7HU56_9CLOT/5-279--------------------------------------------------------------------------------
L0J7T7_PREDD/11-287--------------------------------------------------------------------------------
D5HFQ7_9FIRM/8-282--------------------------------------------------------------------------------
R6XZ15_9FIRM/2-276--------------------------------------------------------------------------------
D4IWA9_BUTFI/2-277--------------------------------------------------------------------------------
T0T8D2_9STRE/2-277--------------------------------------------------------------------------------
R7FNU4_9CLOT/2-276--------------------------------------------------------------------------------
R6BWW4_9CLOT/5-279--------------------------------------------------------------------------------
R7H8Z4_9FIRM/5-279--------------------------------------------------------------------------------
R5QFI9_9FIRM/2-276--------------------------------------------------------------------------------
R6CSF1_9CLOT/4-277--------------------------------------------------------------------------------
R6TW54_9FIRM/2-276--------------------------------------------------------------------------------
R7N4D9_9FIRM/2-276--------------------------------------------------------------------------------
R7DLF6_9FIRM/2-277--------------------------------------------------------------------------------
R7IW89_9FIRM/9-282--------------------------------------------------------------------------------
I0GVU7_SELRL/2-272--------------------------------------------------------------------------------
R5N9S7_9BACT/2-278--------------------------------------------------------------------------------
D5EVR1_PRER2/2-278--------------------------------------------------------------------------------
A1A134_BIFAA/22-296--------------------------------------------------------------------------------

PF05860

Q9K0S7_NEIMB/78-201--------------------------------------------------------------------------------
Q9CPI1_PASMU/122-258--------------------------------------------------------------------------------
P73032_SYNY3/38-157--------------------------------------------------------------------------------
HXUA1_HAEIN/23-136--------------------------------------------------------------------------------
Q8XYI3_RALSO/66-200--------------------------------------------------------------------------------
Q8YM34_NOSS1/26-139--------------------------------------------------------------------------------
Q8YM26_NOSS1/34-153--------------------------------------------------------------------------------
Q8XSD6_RALSO/71-208--------------------------------------------------------------------------------
Q8YX21_NOSS1/35-151--------------------------------------------------------------------------------
Q9K0T0_NEIMB/84-219--------------------------------------------------------------------------------
Q8YKQ8_NOSS1/28-144--------------------------------------------------------------------------------
Q9AAJ5_CAUCR/22-135--------------------------------------------------------------------------------
Q8YZU0_NOSS1/29-144--------------------------------------------------------------------------------
Q9PEY9_XYLFA/72-207--------------------------------------------------------------------------------
Q9I791_PSEAE/29-168--------------------------------------------------------------------------------
Q8YV10_NOSS1/28-152--------------------------------------------------------------------------------
Q8P9Q5_XANCP/41-176--------------------------------------------------------------------------------
Q8XPV0_RALSO/28-144--------------------------------------------------------------------------------
Q8YM30_NOSS1/29-148--------------------------------------------------------------------------------
Q9HVN6_PSEAE/51-166--------------------------------------------------------------------------------
Q9I5N6_PSEAE/132-249--------------------------------------------------------------------------------
Q8YVR8_NOSS1/44-162--------------------------------------------------------------------------------
Q8YM29_NOSS1/26-145--------------------------------------------------------------------------------
Q9HVG6_PSEAE/40-153--------------------------------------------------------------------------------
Q8YM35_NOSS1/26-137--------------------------------------------------------------------------------
FHAB_BORPE/71-205--------------------------------------------------------------------------------
Q8YNX6_NOSS1/33-149--------------------------------------------------------------------------------
Q8YXM8_NOSS1/29-153--------------------------------------------------------------------------------
Q8YLL8_NOSS1/28-146--------------------------------------------------------------------------------
Q8XQZ5_RALSO/71-206--------------------------------------------------------------------------------
Q9HWU6_PSEAE/51-167--------------------------------------------------------------------------------
Q8XQ42_RALSO/54-167--------------------------------------------------------------------------------
Q8XPU1_RALSO/114-253--------------------------------------------------------------------------------
Q8YM31_NOSS1/26-139--------------------------------------------------------------------------------
Q8YKI4_NOSS1/31-147--------------------------------------------------------------------------------
B4F0Z9_PROMH/33-166--------------------------------------------------------------------------------
C5BBG7_EDWI9/32-166--------------------------------------------------------------------------------
G1UB82_HAEDU/106-235--------------------------------------------------------------------------------
Q6G3H6_BARHE/56-188--------------------------------------------------------------------------------
Q7DDD8_NEIMB/84-217--------------------------------------------------------------------------------
Q7VLE8_HAEDU/114-240--------------------------------------------------------------------------------
Q7VLT6_HAEDU/25-160--------------------------------------------------------------------------------
Q8RI19_FUSNN/27-164--------------------------------------------------------------------------------
Q9CPH9_PASMU/119-250--------------------------------------------------------------------------------

PF05048

A0B5Z3_METTP/119-363--------------------------------------------------------------------------------
A0B8G3_METTP/432-668--------------------------------------------------------------------------------
A0B9A8_METTP/209-441--------------------------------------------------------------------------------
A0M187_GRAFK/155-382--------------------------------------------------------------------------------
A3Q9S9_SHELP/163-403--------------------------------------------------------------------------------
A3QIG9_SHELP/167-406--------------------------------------------------------------------------------
A4CHB0_ROBBH/128-355--------------------------------------------------------------------------------
A6Q5Y3_NITSB/155-390--------------------------------------------------------------------------------
A6QCA8_SULNB/133-366--------------------------------------------------------------------------------
B9LN19_HALLT/206-436--------------------------------------------------------------------------------
O28859_ARCFU/803-1050--------------------------------------------------------------------------------
Q0A9R0_ALKEH/149-394--------------------------------------------------------------------------------
Q0W3C2_UNCMA/236-481--------------------------------------------------------------------------------
Q0W3C3_UNCMA/195-446--------------------------------------------------------------------------------
Q0W3M9_UNCMA/204-442--------------------------------------------------------------------------------
Q12VI3_METBU/415-643--------------------------------------------------------------------------------
Q16A16_ROSDO/136-364--------------------------------------------------------------------------------
Q21TJ4_ALBFT/155-381--------------------------------------------------------------------------------
Q2FLC7_METHJ/579-839--------------------------------------------------------------------------------
Q2FLS3_METHJ/168-426--------------------------------------------------------------------------------
Q2FM56_METHJ/94-353--------------------------------------------------------------------------------
Q2FPE3_METHJ/417-660--------------------------------------------------------------------------------
Q2FQK2_METHJ/621-869--------------------------------------------------------------------------------
Q2FSR9_METHJ/59-324--------------------------------------------------------------------------------
Q3SJ26_THIDA/142-368--------------------------------------------------------------------------------
Q47FR5_DECAR/172-407--------------------------------------------------------------------------------
Q47UZ5_COLP3/153-392--------------------------------------------------------------------------------
Q5LLH6_RUEPO/140-368--------------------------------------------------------------------------------
Q5V4X0_HALMA/184-414--------------------------------------------------------------------------------
Q6LJ10_PHOPR/142-381--------------------------------------------------------------------------------
Q6M0J5_METMP/167-417--------------------------------------------------------------------------------
Q7MRZ6_WOLSU/132-365--------------------------------------------------------------------------------
Q8TI41_METAC/43-307--------------------------------------------------------------------------------
Q8TJK2_METAC/50-308--------------------------------------------------------------------------------
Q8TJW3_METAC/46-306--------------------------------------------------------------------------------
Q8TLA5_METAC/47-287--------------------------------------------------------------------------------
Q8TLD5_METAC/175-426--------------------------------------------------------------------------------
Q8TLD5_METAC/552-811--------------------------------------------------------------------------------
Q8TLY6_METAC/248-494--------------------------------------------------------------------------------
Q8TLY7_METAC/376-620--------------------------------------------------------------------------------
Q8TN36_METAC/103-334--------------------------------------------------------------------------------
Q8TPF2_METAC/96-327--------------------------------------------------------------------------------
Q8TPZ7_METAC/43-292--------------------------------------------------------------------------------
Q8TQ14_METAC/197-463--------------------------------------------------------------------------------
Q8TQM3_METAC/233-470--------------------------------------------------------------------------------
Q8TSE8_METAC/43-302--------------------------------------------------------------------------------
Q8TT51_METAC/53-286--------------------------------------------------------------------------------
Q8TTT9_METAC/43-302--------------------------------------------------------------------------------
Q9K0L5_NEIMB/44-271--------------------------------------------------------------------------------
B2UHW3_RALPJ/148-378--------------------------------------------------------------------------------
M1FI95_9ALTE/142-381--------------------------------------------------------------------------------
Q63UJ4_BURPS/145-366--------------------------------------------------------------------------------
NOSD_PSEAE/144-383--------------------------------------------------------------------------------

PF02415

Q9RB68_CHLPN/182-200--------------------------------------------------------------------------------
Q7USQ0_RHOBA/609-626--------------------------------------------------------------------------------
Q7USQ0_RHOBA/574-600--------------------------------------------------------------------------------
D7DDN5_CHLTD/763-781--------------------------------------------------------------------------------
PMP19_CHLPN/219-236--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1476-1499--------------------------------------------------------------------------------
Q823X6_CHLCV/212-230--------------------------------------------------------------------------------
Q824E7_CHLCV/831-849--------------------------------------------------------------------------------
Q7UYI1_RHOBA/341-359--------------------------------------------------------------------------------
D6YJH1_CHLT0/805-823--------------------------------------------------------------------------------
PMPE_CHLMU/231-248--------------------------------------------------------------------------------
Q823W9_CHLCV/240-262--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2205-2228--------------------------------------------------------------------------------
Q7USQ0_RHOBA/459-477--------------------------------------------------------------------------------
Q823W9_CHLCV/304-325--------------------------------------------------------------------------------
D7DDN6_CHLTD/1040-1077--------------------------------------------------------------------------------
PMP19_CHLPN/181-206--------------------------------------------------------------------------------
PMP10_CHLPN/237-266--------------------------------------------------------------------------------
A0A017MJC9_ECOLX/186-211--------------------------------------------------------------------------------
D7DDN6_CHLTD/166-192--------------------------------------------------------------------------------
D6YJH1_CHLT0/359-377--------------------------------------------------------------------------------
PMPE_CHLMU/197-220--------------------------------------------------------------------------------
PMPF_CHLMU/270-296--------------------------------------------------------------------------------
PMP9_CHLPN/239-260--------------------------------------------------------------------------------
PMPI_CHLMU/192-210--------------------------------------------------------------------------------
Q7UWZ8_RHOBA/3661-3680--------------------------------------------------------------------------------
PMP2_CHLPN/189-207--------------------------------------------------------------------------------
Q7UWZ8_RHOBA/1086-1105--------------------------------------------------------------------------------
PMPB_CHLMU/941-958--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1185-1203--------------------------------------------------------------------------------
PMP14_CHLPN/232-274--------------------------------------------------------------------------------
PMPA_CHLMU/277-295--------------------------------------------------------------------------------
PMPC_CHLMU/644-671--------------------------------------------------------------------------------
Q8VU50_CHLPS/186-204--------------------------------------------------------------------------------
PMPA_CHLMU/360-379--------------------------------------------------------------------------------
PMPD_CHLMU/841-866--------------------------------------------------------------------------------
Q823X1_CHLCV/274-292--------------------------------------------------------------------------------
PMPB_CHLMU/588-607--------------------------------------------------------------------------------
PMP7_CHLPN/218-236--------------------------------------------------------------------------------
PMP6_CHLPN/158-176--------------------------------------------------------------------------------
PMPG_CHLMU/264-281--------------------------------------------------------------------------------
Q824E7_CHLCV/575-593--------------------------------------------------------------------------------
Q823Y0_CHLCV/253-275--------------------------------------------------------------------------------
Q823X5_CHLCV/226-244--------------------------------------------------------------------------------
PMP7_CHLPN/344-360--------------------------------------------------------------------------------
Q9RB71_CHLPN/85-112--------------------------------------------------------------------------------
A0A017MJC9_ECOLX/67-82--------------------------------------------------------------------------------
PMP20_CHLPN/1045-1063--------------------------------------------------------------------------------
D6YJH1_CHLT0/612-641--------------------------------------------------------------------------------
PMP9_CHLPN/276-294--------------------------------------------------------------------------------
PMP1_CHLPN/182-199--------------------------------------------------------------------------------
Q823X6_CHLCV/313-331--------------------------------------------------------------------------------
PMP20_CHLPN/830-848--------------------------------------------------------------------------------
M4UH44_9XANT/369-387--------------------------------------------------------------------------------
Q9RB68_CHLPN/211-229--------------------------------------------------------------------------------
Q7UWZ8_RHOBA/3685-3702--------------------------------------------------------------------------------
Q823Y2_CHLCV/321-338--------------------------------------------------------------------------------
PMP16_CHLPN/208-226--------------------------------------------------------------------------------
D7DDN5_CHLTD/1072-1106--------------------------------------------------------------------------------
Q823Y1_CHLCV/197-218--------------------------------------------------------------------------------
D7DDN5_CHLTD/735-753--------------------------------------------------------------------------------
PMPF_CHLMU/242-259--------------------------------------------------------------------------------
PMPH_CHLMU/292-310--------------------------------------------------------------------------------
PMP18_CHLPN/177-195--------------------------------------------------------------------------------
Q8VU50_CHLPS/154-172--------------------------------------------------------------------------------
L0U0P4_CHLTH/364-382--------------------------------------------------------------------------------
D6YJH1_CHLT0/529-572--------------------------------------------------------------------------------
PMPC_CHLMU/389-407--------------------------------------------------------------------------------
H2VFH2_CHLAB/217-238--------------------------------------------------------------------------------
D6YP19_CHLT1/341-358--------------------------------------------------------------------------------
Q823W9_CHLCV/212-230--------------------------------------------------------------------------------
Q823Y1_CHLCV/168-186--------------------------------------------------------------------------------
PMP20_CHLPN/278-296--------------------------------------------------------------------------------
Q823X2_CHLCV/93-111--------------------------------------------------------------------------------
D7DDN6_CHLTD/138-164--------------------------------------------------------------------------------
Q7UWZ8_RHOBA/1058-1077--------------------------------------------------------------------------------
PMPF_CHLMU/202-231--------------------------------------------------------------------------------
Q823Y2_CHLCV/258-284--------------------------------------------------------------------------------
L0U0P4_CHLTH/304-343--------------------------------------------------------------------------------
D6YJH1_CHLT0/267-286--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1794-1815--------------------------------------------------------------------------------
D7DEY8_CHLTD/297-315--------------------------------------------------------------------------------
Q824E6_CHLCV/333-352--------------------------------------------------------------------------------
Q824E7_CHLCV/420-438--------------------------------------------------------------------------------
PMP6_CHLPN/449-467--------------------------------------------------------------------------------
Q824E7_CHLCV/803-821--------------------------------------------------------------------------------
Q7UYI1_RHOBA/313-332--------------------------------------------------------------------------------
Q7UZ67_RHOBA/447-470--------------------------------------------------------------------------------
Q823X5_CHLCV/347-365--------------------------------------------------------------------------------
PMP10_CHLPN/94-112--------------------------------------------------------------------------------
D7DDN5_CHLTD/1044-1062--------------------------------------------------------------------------------
PMP21_CHLPN/543-572--------------------------------------------------------------------------------
PMP11_CHLPN/180-198--------------------------------------------------------------------------------
D7DDN6_CHLTD/394-412--------------------------------------------------------------------------------
PMP1_CHLPN/307-329--------------------------------------------------------------------------------
PMP20_CHLPN/390-421--------------------------------------------------------------------------------
D7DDN5_CHLTD/456-474--------------------------------------------------------------------------------
Q823Y0_CHLCV/225-242--------------------------------------------------------------------------------
Q9RB68_CHLPN/298-316--------------------------------------------------------------------------------
D7DDN6_CHLTD/515-533--------------------------------------------------------------------------------
Q823X4_CHLCV/217-241--------------------------------------------------------------------------------
PMP20_CHLPN/517-574--------------------------------------------------------------------------------
PMPD_CHLMU/324-348--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2265-2283--------------------------------------------------------------------------------
Q7UYI1_RHOBA/607-625--------------------------------------------------------------------------------
Q821X9_CHLCV/727-745--------------------------------------------------------------------------------
PMP21_CHLPN/750-771--------------------------------------------------------------------------------
PMP21_CHLPN/710-740--------------------------------------------------------------------------------
PMPB_CHLMU/792-820--------------------------------------------------------------------------------
PMP19_CHLPN/248-265--------------------------------------------------------------------------------
PMP15_CHLPN/87-105--------------------------------------------------------------------------------
PMP1_CHLPN/280-298--------------------------------------------------------------------------------
PMP16_CHLPN/179-197--------------------------------------------------------------------------------
L0TRT3_CHLTH/242-260--------------------------------------------------------------------------------
PMPF_CHLMU/173-191--------------------------------------------------------------------------------
Q823Y1_CHLCV/295-313--------------------------------------------------------------------------------
PMP1_CHLPN/154-172--------------------------------------------------------------------------------
PMPF_CHLMU/133-164--------------------------------------------------------------------------------
L0U0P4_CHLTH/169-195--------------------------------------------------------------------------------
Q823X0_CHLCV/153-171--------------------------------------------------------------------------------
PMPG_CHLMU/196-214--------------------------------------------------------------------------------
Q823X5_CHLCV/171-189--------------------------------------------------------------------------------
PMP6_CHLPN/317-335--------------------------------------------------------------------------------
Q821X9_CHLCV/301-320--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1096-1117--------------------------------------------------------------------------------
PMP20_CHLPN/1071-1089--------------------------------------------------------------------------------
PMP13_CHLPN/338-356--------------------------------------------------------------------------------
PMP19_CHLPN/62-80--------------------------------------------------------------------------------
PMP20_CHLPN/489-507--------------------------------------------------------------------------------
Q7USQ0_RHOBA/635-652--------------------------------------------------------------------------------
PMPE_CHLMU/324-342--------------------------------------------------------------------------------
PMP20_CHLPN/716-734--------------------------------------------------------------------------------
PMP6_CHLPN/633-650--------------------------------------------------------------------------------
PMP15_CHLPN/278-296--------------------------------------------------------------------------------
Q7VQA1_CHLPN/185-203--------------------------------------------------------------------------------
D3UTG0_CHLTS/163-181--------------------------------------------------------------------------------
Q824E7_CHLCV/731-748--------------------------------------------------------------------------------
H2VFH0_CHLAB/248-268--------------------------------------------------------------------------------
PMP16_CHLPN/113-131--------------------------------------------------------------------------------
D6YI86_CHLT0/332-350--------------------------------------------------------------------------------
PMP20_CHLPN/1099-1128--------------------------------------------------------------------------------
D7DEY8_CHLTD/159-186--------------------------------------------------------------------------------
PMP13_CHLPN/194-212--------------------------------------------------------------------------------
Q7USQ0_RHOBA/252-270--------------------------------------------------------------------------------
PMPB_CHLMU/867-899--------------------------------------------------------------------------------
Q7USQ0_RHOBA/339-362--------------------------------------------------------------------------------
PMP12_CHLPN/187-205--------------------------------------------------------------------------------
Q823X9_CHLCV/100-118--------------------------------------------------------------------------------
Q7UYI1_RHOBA/474-492--------------------------------------------------------------------------------
PMP13_CHLPN/280-319--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1004-1030--------------------------------------------------------------------------------
PMP16_CHLPN/300-318--------------------------------------------------------------------------------
Q823X3_CHLCV/188-206--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1151-1176--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2527-2545--------------------------------------------------------------------------------
PMP20_CHLPN/776-794--------------------------------------------------------------------------------
Q7UYI1_RHOBA/394-412--------------------------------------------------------------------------------
PMP11_CHLPN/152-170--------------------------------------------------------------------------------
Q823X9_CHLCV/310-327--------------------------------------------------------------------------------
Q823X5_CHLCV/255-280--------------------------------------------------------------------------------
Q823X1_CHLCV/301-322--------------------------------------------------------------------------------
PMP7_CHLPN/187-207--------------------------------------------------------------------------------
PMP8_CHLPN/308-330--------------------------------------------------------------------------------
Q821X9_CHLCV/805-823--------------------------------------------------------------------------------
Q7USQ0_RHOBA/279-304--------------------------------------------------------------------------------
Q7USQ0_RHOBA/313-331--------------------------------------------------------------------------------
Q823X1_CHLCV/238-260--------------------------------------------------------------------------------
Q7VQ06_CHLPN/138-163--------------------------------------------------------------------------------
PMPE_CHLMU/258-286--------------------------------------------------------------------------------
D6YP19_CHLT1/180-198--------------------------------------------------------------------------------
PMP9_CHLPN/182-200--------------------------------------------------------------------------------
PMPB_CHLMU/459-477--------------------------------------------------------------------------------
D6YJH1_CHLT0/679-697--------------------------------------------------------------------------------
Q824E6_CHLCV/279-297--------------------------------------------------------------------------------
Q821X9_CHLCV/422-440--------------------------------------------------------------------------------
PMP8_CHLPN/281-299--------------------------------------------------------------------------------
Q7USQ0_RHOBA/949-970--------------------------------------------------------------------------------
PMPC_CHLMU/242-260--------------------------------------------------------------------------------
Q823X6_CHLCV/107-125--------------------------------------------------------------------------------
PMP9_CHLPN/303-325--------------------------------------------------------------------------------
PMP7_CHLPN/308-331--------------------------------------------------------------------------------
Q7UYI1_RHOBA/555-573--------------------------------------------------------------------------------
PMP19_CHLPN/303-320--------------------------------------------------------------------------------
Q9RB68_CHLPN/154-172--------------------------------------------------------------------------------
Q823Y2_CHLCV/201-220--------------------------------------------------------------------------------
PMP20_CHLPN/221-239--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1647-1668--------------------------------------------------------------------------------
D6YP19_CHLT1/140-171--------------------------------------------------------------------------------
PMPG_CHLMU/225-243--------------------------------------------------------------------------------
Q7USQ0_RHOBA/486-509--------------------------------------------------------------------------------
P71135_CHLAO/277-295--------------------------------------------------------------------------------
PMP14_CHLPN/314-332--------------------------------------------------------------------------------
PMP7_CHLPN/281-299--------------------------------------------------------------------------------
PMP21_CHLPN/952-977--------------------------------------------------------------------------------
D3UTG0_CHLTS/135-153--------------------------------------------------------------------------------
L0TRT3_CHLTH/318-336--------------------------------------------------------------------------------
D3UTG0_CHLTS/281-298--------------------------------------------------------------------------------
D6YJH1_CHLT0/492-518--------------------------------------------------------------------------------
Q823Y2_CHLCV/221-247--------------------------------------------------------------------------------
D6YJH1_CHLT0/176-203--------------------------------------------------------------------------------
D6YI86_CHLT0/304-322--------------------------------------------------------------------------------
PMPB_CHLMU/197-268--------------------------------------------------------------------------------
Q7VQA1_CHLPN/214-232--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2144-2170--------------------------------------------------------------------------------
Q7VQA1_CHLPN/277-295--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1562-1580--------------------------------------------------------------------------------
D3UTG0_CHLTS/219-236--------------------------------------------------------------------------------
PMP13_CHLPN/223-241--------------------------------------------------------------------------------
A0A017MJC9_ECOLX/97-118--------------------------------------------------------------------------------
Q7USQ0_RHOBA/224-245--------------------------------------------------------------------------------
PMPD_CHLMU/529-572--------------------------------------------------------------------------------
D6YJH1_CHLT0/446-482--------------------------------------------------------------------------------
PMPB_CHLMU/54-125--------------------------------------------------------------------------------
PMP20_CHLPN/886-922--------------------------------------------------------------------------------
PMPB_CHLMU/666-684--------------------------------------------------------------------------------
D6YJH1_CHLT0/846-871--------------------------------------------------------------------------------
D7DEY8_CHLTD/231-248--------------------------------------------------------------------------------
PMP10_CHLPN/149-175--------------------------------------------------------------------------------
PMPE_CHLMU/126-159--------------------------------------------------------------------------------
PMP15_CHLPN/143-170--------------------------------------------------------------------------------
Q821X9_CHLCV/889-906--------------------------------------------------------------------------------
PMPD_CHLMU/267-286--------------------------------------------------------------------------------
Q82QS3_STRAW/268-286--------------------------------------------------------------------------------
Q7USQ0_RHOBA/370-391--------------------------------------------------------------------------------
Q82QS3_STRAW/181-198--------------------------------------------------------------------------------
PMP11_CHLPN/270-288--------------------------------------------------------------------------------
Q823Y0_CHLCV/194-215--------------------------------------------------------------------------------
Q7VQA1_CHLPN/234-260--------------------------------------------------------------------------------
D6YJH1_CHLT0/650-668--------------------------------------------------------------------------------
PMP13_CHLPN/93-111--------------------------------------------------------------------------------
PMP9_CHLPN/211-229--------------------------------------------------------------------------------
D6YJH1_CHLT0/297-314--------------------------------------------------------------------------------
L0U0P4_CHLTH/391-408--------------------------------------------------------------------------------
D7DDN6_CHLTD/202-220--------------------------------------------------------------------------------
PMP6_CHLPN/579-597--------------------------------------------------------------------------------
PMP21_CHLPN/501-519--------------------------------------------------------------------------------
Q823Y0_CHLCV/165-183--------------------------------------------------------------------------------
Q823Y0_CHLCV/312-329--------------------------------------------------------------------------------
Q9RB71_CHLPN/57-75--------------------------------------------------------------------------------
PMP14_CHLPN/435-451--------------------------------------------------------------------------------
Q9RB71_CHLPN/154-176--------------------------------------------------------------------------------
Q823X6_CHLCV/277-304--------------------------------------------------------------------------------
PMP11_CHLPN/297-318--------------------------------------------------------------------------------
PMPC_CHLMU/214-232--------------------------------------------------------------------------------
Q824E7_CHLCV/231-249--------------------------------------------------------------------------------
PMP21_CHLPN/840-864--------------------------------------------------------------------------------
Q823Y2_CHLCV/172-190--------------------------------------------------------------------------------
PMPF_CHLMU/307-325--------------------------------------------------------------------------------
PMP18_CHLPN/325-342--------------------------------------------------------------------------------
D7DDN6_CHLTD/884-909--------------------------------------------------------------------------------
PMP16_CHLPN/142-168--------------------------------------------------------------------------------
Q821X9_CHLCV/667-688--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1675-1693--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2553-2570--------------------------------------------------------------------------------
Q7UWZ8_RHOBA/1112-1132--------------------------------------------------------------------------------
Q823X5_CHLCV/290-318--------------------------------------------------------------------------------
P71133_CHLAO/155-173--------------------------------------------------------------------------------
PMPI_CHLMU/136-154--------------------------------------------------------------------------------
PMPE_CHLMU/160-187--------------------------------------------------------------------------------
PMP19_CHLPN/122-138--------------------------------------------------------------------------------
A0A017MJC9_ECOLX/127-145--------------------------------------------------------------------------------
PMP15_CHLPN/305-322--------------------------------------------------------------------------------
PMPA_CHLMU/333-351--------------------------------------------------------------------------------
D6YI86_CHLT0/359-378--------------------------------------------------------------------------------
PMPB_CHLMU/278-296--------------------------------------------------------------------------------
Q824E7_CHLCV/950-977--------------------------------------------------------------------------------
Q7UZ67_RHOBA/529-546--------------------------------------------------------------------------------
PMP15_CHLPN/241-268--------------------------------------------------------------------------------
Q821X9_CHLCV/451-469--------------------------------------------------------------------------------
Q823X0_CHLCV/177-199--------------------------------------------------------------------------------
D6YJH1_CHLT0/378-405--------------------------------------------------------------------------------
PMP6_CHLPN/533-561--------------------------------------------------------------------------------
D7DDN5_CHLTD/158-176--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2353-2376--------------------------------------------------------------------------------
PMP2_CHLPN/216-237--------------------------------------------------------------------------------
Q7UYI1_RHOBA/181-199--------------------------------------------------------------------------------
Q824E6_CHLCV/222-239--------------------------------------------------------------------------------
PMP20_CHLPN/613-631--------------------------------------------------------------------------------
D7DEY8_CHLTD/203-220--------------------------------------------------------------------------------
PMP15_CHLPN/181-202--------------------------------------------------------------------------------
PMP20_CHLPN/803-820--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2500-2517--------------------------------------------------------------------------------
PMP20_CHLPN/250-268--------------------------------------------------------------------------------
H2VFH2_CHLAB/149-175--------------------------------------------------------------------------------
PMP14_CHLPN/286-304--------------------------------------------------------------------------------
D6YP19_CHLT1/250-267--------------------------------------------------------------------------------
PMP16_CHLPN/327-344--------------------------------------------------------------------------------
D7DDN5_CHLTD/857-885--------------------------------------------------------------------------------
PMPD_CHLMU/581-606--------------------------------------------------------------------------------
PMP21_CHLPN/875-893--------------------------------------------------------------------------------
D7DDN6_CHLTD/916-947--------------------------------------------------------------------------------
Q7VQ06_CHLPN/164-191--------------------------------------------------------------------------------
PMP21_CHLPN/472-490--------------------------------------------------------------------------------
PMPG_CHLMU/168-186--------------------------------------------------------------------------------
PMP20_CHLPN/460-478--------------------------------------------------------------------------------
A0A017MJC9_ECOLX/228-246--------------------------------------------------------------------------------
Q823X5_CHLCV/199-216--------------------------------------------------------------------------------
D6YP19_CHLT1/314-332--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1507-1528--------------------------------------------------------------------------------
PMPG_CHLMU/401-421--------------------------------------------------------------------------------
PMP20_CHLPN/1010-1027--------------------------------------------------------------------------------
PMP8_CHLPN/188-206--------------------------------------------------------------------------------
Q824E7_CHLCV/905-939--------------------------------------------------------------------------------
Q9RB71_CHLPN/28-46--------------------------------------------------------------------------------
PMP1_CHLPN/239-261--------------------------------------------------------------------------------
PMP10_CHLPN/305-327--------------------------------------------------------------------------------
Q824E7_CHLCV/203-221--------------------------------------------------------------------------------
PMPD_CHLMU/616-637--------------------------------------------------------------------------------
P71135_CHLAO/183-201--------------------------------------------------------------------------------
D6YI86_CHLT0/247-264--------------------------------------------------------------------------------
PMPG_CHLMU/283-329--------------------------------------------------------------------------------
PMP8_CHLPN/245-266--------------------------------------------------------------------------------
Q7VQA1_CHLPN/157-175--------------------------------------------------------------------------------
Q823X9_CHLCV/250-273--------------------------------------------------------------------------------
PMP14_CHLPN/108-126--------------------------------------------------------------------------------
Q823X4_CHLCV/95-113--------------------------------------------------------------------------------
P71135_CHLAO/240-262--------------------------------------------------------------------------------
P71135_CHLAO/304-325--------------------------------------------------------------------------------
PMP13_CHLPN/166-184--------------------------------------------------------------------------------
PMP15_CHLPN/213-230--------------------------------------------------------------------------------
Q83U05_CHLTH/100-133--------------------------------------------------------------------------------
PMP21_CHLPN/582-608--------------------------------------------------------------------------------
Q7VQ06_CHLPN/202-223--------------------------------------------------------------------------------
Q824E7_CHLCV/260-330--------------------------------------------------------------------------------
M4UH44_9XANT/166-184--------------------------------------------------------------------------------
D6YP19_CHLT1/277-303--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1124-1142--------------------------------------------------------------------------------
D7DDN6_CHLTD/421-439--------------------------------------------------------------------------------
D7DDN5_CHLTD/342-360--------------------------------------------------------------------------------
Q7USQ0_RHOBA/193-216--------------------------------------------------------------------------------
D7DEY8_CHLTD/324-342--------------------------------------------------------------------------------
Q824E7_CHLCV/603-621--------------------------------------------------------------------------------
L0U0P4_CHLTH/205-223--------------------------------------------------------------------------------
Q7USQ0_RHOBA/547-565--------------------------------------------------------------------------------
Q823Y2_CHLCV/294-312--------------------------------------------------------------------------------
PMP11_CHLPN/237-255--------------------------------------------------------------------------------
Q823X6_CHLCV/340-357--------------------------------------------------------------------------------
PMPD_CHLMU/176-203--------------------------------------------------------------------------------
PMP6_CHLPN/375-392--------------------------------------------------------------------------------
D6YJH1_CHLT0/407-433--------------------------------------------------------------------------------
Q7UZ67_RHOBA/477-494--------------------------------------------------------------------------------
PMP7_CHLPN/159-177--------------------------------------------------------------------------------
PMP19_CHLPN/94-112--------------------------------------------------------------------------------
PMP1_CHLPN/210-229--------------------------------------------------------------------------------
A0A017MJC9_ECOLX/159-178--------------------------------------------------------------------------------
Q823X2_CHLCV/182-208--------------------------------------------------------------------------------
Q824E6_CHLCV/150-168--------------------------------------------------------------------------------
Q824E7_CHLCV/859-895--------------------------------------------------------------------------------
Q82QS3_STRAW/231-259--------------------------------------------------------------------------------
PMPF_CHLMU/103-123--------------------------------------------------------------------------------
PMPD_CHLMU/800-818--------------------------------------------------------------------------------
D7DDN5_CHLTD/898-925--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2117-2135--------------------------------------------------------------------------------
PMP15_CHLPN/107-142--------------------------------------------------------------------------------
Q823Y1_CHLCV/322-339--------------------------------------------------------------------------------
PMP6_CHLPN/606-624--------------------------------------------------------------------------------
Q821X9_CHLCV/386-412--------------------------------------------------------------------------------
Q823X2_CHLCV/153-171--------------------------------------------------------------------------------
Q823X9_CHLCV/222-239--------------------------------------------------------------------------------
D7DDN6_CHLTD/355-373--------------------------------------------------------------------------------
Q823X2_CHLCV/217-235--------------------------------------------------------------------------------
PMP18_CHLPN/205-224--------------------------------------------------------------------------------
PMP2_CHLPN/161-179--------------------------------------------------------------------------------
PMPD_CHLMU/297-314--------------------------------------------------------------------------------
Q823Y1_CHLCV/219-245--------------------------------------------------------------------------------
PMP21_CHLPN/780-798--------------------------------------------------------------------------------
D7DDN5_CHLTD/613-631--------------------------------------------------------------------------------
D7DEY8_CHLTD/258-286--------------------------------------------------------------------------------
Q7VQ06_CHLPN/110-128--------------------------------------------------------------------------------
PMP10_CHLPN/276-294--------------------------------------------------------------------------------
Q823Y1_CHLCV/132-158--------------------------------------------------------------------------------
PMPB_CHLMU/560-579--------------------------------------------------------------------------------
Q823X1_CHLCV/210-228--------------------------------------------------------------------------------
Q9RB68_CHLPN/239-260--------------------------------------------------------------------------------
Q7UWZ8_RHOBA/1006-1025--------------------------------------------------------------------------------
PMP8_CHLPN/217-235--------------------------------------------------------------------------------
Q824E7_CHLCV/704-722--------------------------------------------------------------------------------
PMP20_CHLPN/858-884--------------------------------------------------------------------------------
PMP6_CHLPN/186-204--------------------------------------------------------------------------------
PMP20_CHLPN/432-450--------------------------------------------------------------------------------
P71135_CHLAO/212-230--------------------------------------------------------------------------------
PMP6_CHLPN/476-494--------------------------------------------------------------------------------
D7DDN5_CHLTD/932-969--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1039-1057--------------------------------------------------------------------------------
D6YI86_CHLT0/175-193--------------------------------------------------------------------------------
PMP6_CHLPN/272-300--------------------------------------------------------------------------------
Q823X5_CHLCV/374-391--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1450-1468--------------------------------------------------------------------------------
Q7UYI1_RHOBA/234-252--------------------------------------------------------------------------------
P71133_CHLAO/188-206--------------------------------------------------------------------------------
PMP20_CHLPN/585-603--------------------------------------------------------------------------------
PMP14_CHLPN/182-199--------------------------------------------------------------------------------
Q823X3_CHLCV/154-172--------------------------------------------------------------------------------
PMP12_CHLPN/150-168--------------------------------------------------------------------------------
Q824E7_CHLCV/448-466--------------------------------------------------------------------------------
D7DDN6_CHLTD/841-871--------------------------------------------------------------------------------
PMPB_CHLMU/362-420--------------------------------------------------------------------------------
PMP20_CHLPN/642-660--------------------------------------------------------------------------------
Q824E6_CHLCV/251-269--------------------------------------------------------------------------------
D7DDN6_CHLTD/542-560--------------------------------------------------------------------------------
PMP11_CHLPN/209-227--------------------------------------------------------------------------------
PMP18_CHLPN/139-166--------------------------------------------------------------------------------
PMPD_CHLMU/351-377--------------------------------------------------------------------------------
D7DDN5_CHLTD/791-847--------------------------------------------------------------------------------
PMP12_CHLPN/214-236--------------------------------------------------------------------------------
PMPE_CHLMU/297-315--------------------------------------------------------------------------------
D7DDN6_CHLTD/562-588--------------------------------------------------------------------------------
Q823W9_CHLCV/277-295--------------------------------------------------------------------------------
Q7USQ0_RHOBA/432-450--------------------------------------------------------------------------------
D7DDN6_CHLTD/275-316--------------------------------------------------------------------------------
PMP19_CHLPN/275-293--------------------------------------------------------------------------------
Q823Y1_CHLCV/256-285--------------------------------------------------------------------------------
Q823X3_CHLCV/215-233--------------------------------------------------------------------------------
D6YJH1_CHLT0/881-898--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1616-1639--------------------------------------------------------------------------------
Q823X6_CHLCV/182-199--------------------------------------------------------------------------------
D7DEY8_CHLTD/126-158--------------------------------------------------------------------------------
PMP18_CHLPN/262-288--------------------------------------------------------------------------------
Q821X9_CHLCV/757-794--------------------------------------------------------------------------------
D6YP19_CHLT1/110-130--------------------------------------------------------------------------------
Q821X9_CHLCV/628-657--------------------------------------------------------------------------------
D7DDN6_CHLTD/327-345--------------------------------------------------------------------------------
PMP6_CHLPN/344-363--------------------------------------------------------------------------------
D6YI86_CHLT0/276-294--------------------------------------------------------------------------------
Q823Y1_CHLCV/104-122--------------------------------------------------------------------------------
PMP13_CHLPN/365-382--------------------------------------------------------------------------------
Q7USQ0_RHOBA/919-942--------------------------------------------------------------------------------
Q824E7_CHLCV/987-1022--------------------------------------------------------------------------------
L0TRT3_CHLTH/373-390--------------------------------------------------------------------------------
Q823X1_CHLCV/181-199--------------------------------------------------------------------------------
PMP20_CHLPN/743-761--------------------------------------------------------------------------------
D7DDN5_CHLTD/484-502--------------------------------------------------------------------------------
D7DEY8_CHLTD/93-111--------------------------------------------------------------------------------
D3UTG0_CHLTS/254-272--------------------------------------------------------------------------------
PMPD_CHLMU/156-174--------------------------------------------------------------------------------
L0U0P4_CHLTH/277-294--------------------------------------------------------------------------------
PMPC_CHLMU/764-796--------------------------------------------------------------------------------
PMPB_CHLMU/639-657--------------------------------------------------------------------------------
Q822Q5_CHLCV/185-203--------------------------------------------------------------------------------
Q821X9_CHLCV/570-618--------------------------------------------------------------------------------
PMPH_CHLMU/245-280--------------------------------------------------------------------------------
PMPC_CHLMU/571-599--------------------------------------------------------------------------------
PMP6_CHLPN/215-233--------------------------------------------------------------------------------
PMP20_CHLPN/970-1001--------------------------------------------------------------------------------
Q824E7_CHLCV/632-650--------------------------------------------------------------------------------
L0U0P4_CHLTH/234-252--------------------------------------------------------------------------------
Q823X9_CHLCV/283-301--------------------------------------------------------------------------------
Q7UYI1_RHOBA/206-225--------------------------------------------------------------------------------
PMP21_CHLPN/436-462--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2384-2405--------------------------------------------------------------------------------
Q823Y2_CHLCV/105-123--------------------------------------------------------------------------------
D7DDN5_CHLTD/709-726--------------------------------------------------------------------------------
PMP20_CHLPN/933-960--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1589-1607--------------------------------------------------------------------------------
Q823X3_CHLCV/94-112--------------------------------------------------------------------------------
Q9RB71_CHLPN/127-145--------------------------------------------------------------------------------
D3UTG0_CHLTS/191-209--------------------------------------------------------------------------------
PMPH_CHLMU/217-235--------------------------------------------------------------------------------
PMP21_CHLPN/347-366--------------------------------------------------------------------------------
Q823X9_CHLCV/128-153--------------------------------------------------------------------------------
PMP19_CHLPN/330-349--------------------------------------------------------------------------------
PMP18_CHLPN/234-251--------------------------------------------------------------------------------
Q7UWZ8_RHOBA/1032-1051--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2473-2491--------------------------------------------------------------------------------
Q824E6_CHLCV/307-324--------------------------------------------------------------------------------
PMP10_CHLPN/185-206--------------------------------------------------------------------------------
D7DDN5_CHLTD/585-604--------------------------------------------------------------------------------
Q7UZ67_RHOBA/504-522--------------------------------------------------------------------------------
Q821X9_CHLCV/852-879--------------------------------------------------------------------------------
D7DDN5_CHLTD/306-332--------------------------------------------------------------------------------
PMP14_CHLPN/341-358--------------------------------------------------------------------------------
L0U0P4_CHLTH/421-446--------------------------------------------------------------------------------
Q824E7_CHLCV/776-794--------------------------------------------------------------------------------
PMPC_CHLMU/736-754--------------------------------------------------------------------------------
PMP21_CHLPN/810-827--------------------------------------------------------------------------------
Q822Q5_CHLCV/153-171--------------------------------------------------------------------------------
PMP16_CHLPN/264-290--------------------------------------------------------------------------------
PMP13_CHLPN/253-270--------------------------------------------------------------------------------
PMP19_CHLPN/140-166--------------------------------------------------------------------------------
L0TRT3_CHLTH/270-306--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1065-1088--------------------------------------------------------------------------------
PMPD_CHLMU/407-433--------------------------------------------------------------------------------
D6YI86_CHLT0/208-234--------------------------------------------------------------------------------
D6YJH1_CHLT0/324-349--------------------------------------------------------------------------------
Q821X9_CHLCV/533-559--------------------------------------------------------------------------------
PMP6_CHLPN/402-430--------------------------------------------------------------------------------
PMPC_CHLMU/417-435--------------------------------------------------------------------------------
L0U0P4_CHLTH/97-115--------------------------------------------------------------------------------
L0TRT3_CHLTH/345-363--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1212-1229--------------------------------------------------------------------------------
Q9RB68_CHLPN/360-404--------------------------------------------------------------------------------
H2VFH2_CHLAB/190-208--------------------------------------------------------------------------------
D7DDN5_CHLTD/286-304--------------------------------------------------------------------------------
Q823Y2_CHLCV/125-161--------------------------------------------------------------------------------
Q824E6_CHLCV/183-209--------------------------------------------------------------------------------
Q823X6_CHLCV/240-274--------------------------------------------------------------------------------
D7DDN5_CHLTD/130-148--------------------------------------------------------------------------------
D6YP19_CHLT1/209-238--------------------------------------------------------------------------------
PMP12_CHLPN/81-108--------------------------------------------------------------------------------
Q824E7_CHLCV/477-495--------------------------------------------------------------------------------
D7DDN5_CHLTD/513-531--------------------------------------------------------------------------------
P71135_CHLAO/155-173--------------------------------------------------------------------------------
Q7VQA1_CHLPN/305-326--------------------------------------------------------------------------------
PMPD_CHLMU/387-405--------------------------------------------------------------------------------
M4UH44_9XANT/193-210--------------------------------------------------------------------------------
PMP7_CHLPN/246-268--------------------------------------------------------------------------------
Q821X9_CHLCV/496-523--------------------------------------------------------------------------------
Q823X9_CHLCV/191-212--------------------------------------------------------------------------------
Q7UYI1_RHOBA/260-278--------------------------------------------------------------------------------
Q823X1_CHLCV/153-171--------------------------------------------------------------------------------
PMP14_CHLPN/212-230--------------------------------------------------------------------------------
Q823X4_CHLCV/190-208--------------------------------------------------------------------------------
PMPB_CHLMU/141-159--------------------------------------------------------------------------------
Q7UYI1_RHOBA/367-385--------------------------------------------------------------------------------
PMP10_CHLPN/217-235--------------------------------------------------------------------------------
Q823X0_CHLCV/210-228--------------------------------------------------------------------------------
PMP18_CHLPN/298-316--------------------------------------------------------------------------------
PMP1_CHLPN/92-112--------------------------------------------------------------------------------
Q9RB68_CHLPN/326-347--------------------------------------------------------------------------------
Q823X9_CHLCV/162-180--------------------------------------------------------------------------------
Q9RB68_CHLPN/262-288--------------------------------------------------------------------------------
PMP8_CHLPN/157-178--------------------------------------------------------------------------------
Q823Y0_CHLCV/285-303--------------------------------------------------------------------------------
PMPB_CHLMU/722-782--------------------------------------------------------------------------------
PMP16_CHLPN/236-253--------------------------------------------------------------------------------
PMP9_CHLPN/155-173--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2439-2464--------------------------------------------------------------------------------
PMP21_CHLPN/914-942--------------------------------------------------------------------------------

PF08480

Q8TLE9_METAC/305-493--------------------------------------------------------------------------------
Q8TNA9_METAC/274-466--------------------------------------------------------------------------------
Q8THR8_METAC/274-457--------------------------------------------------------------------------------
Q8TKN2_METAC/356-545--------------------------------------------------------------------------------
Q8TNF1_METAC/197-388--------------------------------------------------------------------------------
Q8TRX3_METAC/275-470--------------------------------------------------------------------------------

PF07602

Q8F2E8_LEPIN/52-316--------------------------------------------------------------------------------
Q7NNK7_GLOVI/49-321--------------------------------------------------------------------------------
Q8YX73_NOSS1/82-347--------------------------------------------------------------------------------
Q8F8Y2_LEPIN/64-326--------------------------------------------------------------------------------
Q8F1R3_LEPIN/65-310--------------------------------------------------------------------------------
Q8YWJ6_NOSS1/15-284--------------------------------------------------------------------------------
Q8F0U7_LEPIN/64-323--------------------------------------------------------------------------------

PF05594

Q8P9Q5_XANCP/1557-1633--------------------------------------------------------------------------------
Q9JPJ4_NEIME/637-700--------------------------------------------------------------------------------
Q9I120_PSEAE/2589-2647--------------------------------------------------------------------------------
A0A025G644_ECO57/815-886--------------------------------------------------------------------------------
K0XUF7_PSEAI/595-645--------------------------------------------------------------------------------
Q8P9Q5_XANCP/1172-1235--------------------------------------------------------------------------------
Q9I120_PSEAE/1336-1393--------------------------------------------------------------------------------
G1UB82_HAEDU/627-686--------------------------------------------------------------------------------
Q8P9Q5_XANCP/1040-1116--------------------------------------------------------------------------------
Q8KT64_PHOLU/1243-1335--------------------------------------------------------------------------------
Q9I120_PSEAE/1841-1914--------------------------------------------------------------------------------
Q9I120_PSEAE/215-293--------------------------------------------------------------------------------
A0A025G644_ECO57/919-990--------------------------------------------------------------------------------
Q47955_HAEDC/208-282--------------------------------------------------------------------------------
Q9I120_PSEAE/2670-2751--------------------------------------------------------------------------------
F4LBX3_BORPC/1684-1755--------------------------------------------------------------------------------
O32608_EDWTA/679-758--------------------------------------------------------------------------------
L5QQ82_NEIME/1201-1277--------------------------------------------------------------------------------
A5TVV7_FUSNP/999-1074--------------------------------------------------------------------------------
Q8PLI3_XANAC/426-488--------------------------------------------------------------------------------
Q8KT64_PHOLU/660-719--------------------------------------------------------------------------------
Q9I120_PSEAE/2089-2158--------------------------------------------------------------------------------
Q8P9Q5_XANCP/781-857--------------------------------------------------------------------------------
O32608_EDWTA/409-454--------------------------------------------------------------------------------
E6MYB6_NEIMH/769-825--------------------------------------------------------------------------------
Q9I120_PSEAE/1447-1498--------------------------------------------------------------------------------
F0AAZ9_NEIME/265-346--------------------------------------------------------------------------------
E6MYB6_NEIMH/400-459--------------------------------------------------------------------------------
Q9I120_PSEAE/382-460--------------------------------------------------------------------------------
Q9JP78_BORBO/434-481--------------------------------------------------------------------------------
F4LBX3_BORPC/1233-1308--------------------------------------------------------------------------------
Q9I120_PSEAE/1752-1810--------------------------------------------------------------------------------
Q9PBE8_XYLFA/878-937--------------------------------------------------------------------------------
A0A025G644_ECO57/1075-1143--------------------------------------------------------------------------------
A5TVV7_FUSNP/2900-2961--------------------------------------------------------------------------------
Q9I120_PSEAE/2281-2332--------------------------------------------------------------------------------
Q9JP78_BORBO/1722-1793--------------------------------------------------------------------------------
A0A025G644_ECO57/209-286--------------------------------------------------------------------------------
Q8RGZ3_FUSNN/335-393--------------------------------------------------------------------------------
A5TVV7_FUSNP/868-940--------------------------------------------------------------------------------
Q8PLI3_XANAC/3495-3547--------------------------------------------------------------------------------
Q8XPV0_RALSO/434-523--------------------------------------------------------------------------------
Q8P9Q5_XANCP/224-302--------------------------------------------------------------------------------
F4LBX3_BORPC/613-679--------------------------------------------------------------------------------
Q88MW9_PSEPK/1040-1119--------------------------------------------------------------------------------
F0MJK5_NEIMH/250-326--------------------------------------------------------------------------------
L5QQ82_NEIME/268-358--------------------------------------------------------------------------------
Q9PEY9_XYLFA/2190-2268--------------------------------------------------------------------------------
Q9PBE8_XYLFA/1117-1202--------------------------------------------------------------------------------
Q8PLI3_XANAC/921-986--------------------------------------------------------------------------------
HLYA_PROMI/214-285--------------------------------------------------------------------------------
L5QQ82_NEIME/1708-1775--------------------------------------------------------------------------------
Q9L6B0_PASMD/305-383--------------------------------------------------------------------------------
Q9PEY9_XYLFA/255-333--------------------------------------------------------------------------------
Q8P9Q5_XANCP/641-717--------------------------------------------------------------------------------
Q9PEY9_XYLFA/465-546--------------------------------------------------------------------------------
F4LBX3_BORPC/257-336--------------------------------------------------------------------------------
Q8PLI3_XANAC/611-700--------------------------------------------------------------------------------
O32608_EDWTA/1127-1173--------------------------------------------------------------------------------
K0XUF7_PSEAI/1475-1550--------------------------------------------------------------------------------
G1UB82_HAEDU/884-936--------------------------------------------------------------------------------
Q8P9Q5_XANCP/2538-2612--------------------------------------------------------------------------------
G1UB82_HAEDU/481-539--------------------------------------------------------------------------------
Q8PLI3_XANAC/1452-1504--------------------------------------------------------------------------------
Q9PBE8_XYLFA/1219-1280--------------------------------------------------------------------------------
Q9ZHL3_HAEDC/302-381--------------------------------------------------------------------------------
Q8PLI3_XANAC/2485-2591--------------------------------------------------------------------------------
G1UB82_HAEDU/294-378--------------------------------------------------------------------------------
Q9I120_PSEAE/314-379--------------------------------------------------------------------------------
Q9L6B0_PASMD/576-644--------------------------------------------------------------------------------
Q9CPI1_PASMU/1325-1400--------------------------------------------------------------------------------
Q9CPI1_PASMU/310-387--------------------------------------------------------------------------------
F4LBX3_BORPC/1442-1538--------------------------------------------------------------------------------
Q8KT64_PHOLU/1391-1522--------------------------------------------------------------------------------
A5TVV7_FUSNP/212-286--------------------------------------------------------------------------------
Q8XPV0_RALSO/204-291--------------------------------------------------------------------------------
Q9I120_PSEAE/3353-3428--------------------------------------------------------------------------------
Q8XUK5_RALSO/656-729--------------------------------------------------------------------------------
Q9JPJ4_NEIME/882-953--------------------------------------------------------------------------------
Q8P9Q5_XANCP/345-458--------------------------------------------------------------------------------
HLYA_SERMA/226-296--------------------------------------------------------------------------------
Q8PLI3_XANAC/2321-2395--------------------------------------------------------------------------------
Q7N9K8_PHOLL/217-289--------------------------------------------------------------------------------
Q9I120_PSEAE/2996-3080--------------------------------------------------------------------------------
Q9PEY9_XYLFA/586-685--------------------------------------------------------------------------------
Q8KT64_PHOLU/782-834--------------------------------------------------------------------------------
Q8P9Q5_XANCP/1258-1335--------------------------------------------------------------------------------
Q8KT64_PHOLU/342-422--------------------------------------------------------------------------------
Q9ZHL3_HAEDC/464-521--------------------------------------------------------------------------------
Q9P9U6_XYLFA/773-832--------------------------------------------------------------------------------
Q8PLI3_XANAC/1567-1643--------------------------------------------------------------------------------
A5TVV7_FUSNP/1095-1173--------------------------------------------------------------------------------
Q9I120_PSEAE/3706-3776--------------------------------------------------------------------------------
Q9I120_PSEAE/3221-3335--------------------------------------------------------------------------------
Q9JP78_BORBO/651-717--------------------------------------------------------------------------------
Q8PLI3_XANAC/2019-2068--------------------------------------------------------------------------------
Q8PLI3_XANAC/1182-1245--------------------------------------------------------------------------------
O32608_EDWTA/1021-1083--------------------------------------------------------------------------------
Q8PLI3_XANAC/1050-1126--------------------------------------------------------------------------------
Q9RGD1_BARHN/6-64--------------------------------------------------------------------------------
Q8PLI3_XANAC/1905-1991--------------------------------------------------------------------------------
Q9L6B0_PASMD/1419-1494--------------------------------------------------------------------------------
Q9I120_PSEAE/3496-3558--------------------------------------------------------------------------------
O32608_EDWTA/214-285--------------------------------------------------------------------------------
Q9CPI1_PASMU/559-626--------------------------------------------------------------------------------
Q8KT64_PHOLU/2597-2661--------------------------------------------------------------------------------
E6MYB6_NEIMH/606-662--------------------------------------------------------------------------------
Q8P9Q5_XANCP/2262-2320--------------------------------------------------------------------------------
Q8KT64_PHOLU/440-510--------------------------------------------------------------------------------
Q9I120_PSEAE/617-667--------------------------------------------------------------------------------
Q9ZHL3_HAEDC/651-728--------------------------------------------------------------------------------
HLYA_PROMI/1200-1264--------------------------------------------------------------------------------
Q8PLI3_XANAC/3289-3387--------------------------------------------------------------------------------
L5QQ82_NEIME/930-997--------------------------------------------------------------------------------
Q9I120_PSEAE/2169-2227--------------------------------------------------------------------------------
F4LBX3_BORPC/947-1021--------------------------------------------------------------------------------
Q8KT64_PHOLU/2861-2951--------------------------------------------------------------------------------
Q9PBE8_XYLFA/2062-2138--------------------------------------------------------------------------------
Q9I120_PSEAE/1670-1741--------------------------------------------------------------------------------
A0A025G644_ECO57/354-435--------------------------------------------------------------------------------
Q8PLI3_XANAC/1759-1823--------------------------------------------------------------------------------
L5QQ82_NEIME/361-426--------------------------------------------------------------------------------
Q47955_HAEDC/409-504--------------------------------------------------------------------------------
Q8RGK2_FUSNN/195-268--------------------------------------------------------------------------------
Q88MW9_PSEPK/219-293--------------------------------------------------------------------------------
O32608_EDWTA/1428-1532--------------------------------------------------------------------------------
Q8PLI3_XANAC/989-1047--------------------------------------------------------------------------------
Q9JPJ4_NEIME/527-610--------------------------------------------------------------------------------
Q9PBE8_XYLFA/1297-1360--------------------------------------------------------------------------------
Q8P9Q5_XANCP/1895-1981--------------------------------------------------------------------------------
Q8KT64_PHOLU/2531-2595--------------------------------------------------------------------------------
F4LBX3_BORPC/1560-1635--------------------------------------------------------------------------------
Q8KT64_PHOLU/1662-1732--------------------------------------------------------------------------------
Q9I120_PSEAE/4534-4605--------------------------------------------------------------------------------
Q8PLI0_XANAC/107-201--------------------------------------------------------------------------------
Q8P9Q5_XANCP/919-976--------------------------------------------------------------------------------
Q8P9Q5_XANCP/481-558--------------------------------------------------------------------------------
O32608_EDWTA/494-532--------------------------------------------------------------------------------
Q8PLI3_XANAC/491-568--------------------------------------------------------------------------------
Q9I120_PSEAE/2493-2557--------------------------------------------------------------------------------
K0XUF7_PSEAI/2650-2727--------------------------------------------------------------------------------
Q9ZHL3_HAEDC/759-809--------------------------------------------------------------------------------
Q8KT64_PHOLU/257-334--------------------------------------------------------------------------------
Q9I120_PSEAE/3156-3216--------------------------------------------------------------------------------
G1UB82_HAEDU/773-850--------------------------------------------------------------------------------
Q8P9Q5_XANCP/1816-1892--------------------------------------------------------------------------------
Q8RGZ3_FUSNN/599-673--------------------------------------------------------------------------------
Q88MW9_PSEPK/1135-1205--------------------------------------------------------------------------------
Q9PBE8_XYLFA/1003-1082--------------------------------------------------------------------------------
Q8KT64_PHOLU/565-616--------------------------------------------------------------------------------
Q8RGZ3_FUSNN/22-93--------------------------------------------------------------------------------
Q8P9Q5_XANCP/1431-1493--------------------------------------------------------------------------------
Q8P9Q5_XANCP/720-778--------------------------------------------------------------------------------
F4LBX3_BORPC/491-557--------------------------------------------------------------------------------
A0A025G644_ECO57/697-765--------------------------------------------------------------------------------
E6MYB6_NEIMH/486-548--------------------------------------------------------------------------------
Q9PEY9_XYLFA/711-768--------------------------------------------------------------------------------

PF00544

PLY1_PECAS/71-278--------------------------------------------------------------------------------
E0SAZ3_DICD3/83-313--------------------------------------------------------------------------------
E0SJQ6_DICD3/72-279--------------------------------------------------------------------------------
PLYA_DICD3/85-318--------------------------------------------------------------------------------
Q6D727_PECAS/47-241--------------------------------------------------------------------------------

PF03718

IPUA_ASPNG/7-563LLTLSAAFQVAQAAVTANNSQLLTWWHNTGEINTQTPVADGNVRQSGLYSVKVQTTPASSSLYYDSFVYLAIPGNGMS..
DEXT_PENMI/26-608PGNSHPGTHMGTTNNTHCGADFCTWWHDSGEINTQTPVQPGNVRQSHKYSVQVSLAGT.NN.FHDSFVYESIPRNGNGRI
P77813_ARTGO/20-620AAGQEPAAATEQTGFTASGPELRTWWHNNYEYNATSPTQNGNVRRSSFYEVQVATAAAPET.RYDSFAYMSIPRSGKGKI
DEXT_ARTSD/41-636PGVPA.ALKAERAITTVDNGNLHTWWHDNGVFSPATPTQSSEVRRSSFYDVQVAQANQPQK.LYDAFSYMSIPRSGKGKI

PF13332

D1APU8_SEBTE/1787-1948--------------------------------------------------------------------------------
D1AGZ0_SEBTE/1910-2071--------------------------------------------------------------------------------
D1AS25_SEBTE/1798-1959--------------------------------------------------------------------------------
D1AG88_SEBTE/1784-1945--------------------------------------------------------------------------------
C7LTZ8_DESBD/1999-2170--------------------------------------------------------------------------------
A6X424_OCHA4/234-403--------------------------------------------------------------------------------
D2U945_XANAP/448-623--------------------------------------------------------------------------------
B0UW75_HISS2/318-493--------------------------------------------------------------------------------
Q0K4M6_CUPNH/2024-2201--------------------------------------------------------------------------------
Q6D5C2_PECAS/4139-4306--------------------------------------------------------------------------------
C5BAK2_EDWI9/2863-3032--------------------------------------------------------------------------------
Q9P9U6_XYLFA/2525-2700--------------------------------------------------------------------------------
Q9K0T0_NEIMB/1853-2027--------------------------------------------------------------------------------
Q1LCC6_RALME/2237-2414--------------------------------------------------------------------------------
A9BSR3_DELAS/1302-1471--------------------------------------------------------------------------------
Q8XYI3_RALSO/2318-2490--------------------------------------------------------------------------------
A4G2E3_HERAR/1450-1621--------------------------------------------------------------------------------
A6VN27_ACTSZ/1852-2027--------------------------------------------------------------------------------
D0IXU6_COMT2/433-603--------------------------------------------------------------------------------
Q7N911_PHOLL/3665-3839--------------------------------------------------------------------------------
Q1H434_METFK/1347-1522--------------------------------------------------------------------------------
Q7NU32_CHRVO/3082-3255--------------------------------------------------------------------------------
Q6G3N8_BARHE/1991-2168--------------------------------------------------------------------------------
B2JXD4_BURP8/2246-2424--------------------------------------------------------------------------------
D2RM28_ACIFV/822-989--------------------------------------------------------------------------------
C9LS29_SELS3/1059-1224--------------------------------------------------------------------------------
Q143Z8_BURXL/2299-2473--------------------------------------------------------------------------------
A7ZBF9_CAMC1/1393-1557--------------------------------------------------------------------------------
Q140X1_BURXL/260-438--------------------------------------------------------------------------------
A8ETC6_ARCB4/2319-2486--------------------------------------------------------------------------------
Q140X4_BURXL/2614-2790--------------------------------------------------------------------------------
B2JV25_BURP8/2057-2238--------------------------------------------------------------------------------
D1BMQ3_VEIPT/1399-1572--------------------------------------------------------------------------------
Q6G3U4_BARHE/1979-2157--------------------------------------------------------------------------------
C5AEA6_BURGB/711-883--------------------------------------------------------------------------------
C5D1Z2_VARPS/2965-3139--------------------------------------------------------------------------------
Q6FDM3_ACIAD/2917-3080--------------------------------------------------------------------------------
D1BNY3_VEIPT/1277-1447--------------------------------------------------------------------------------
Q0BRJ1_GRABC/3343-3512--------------------------------------------------------------------------------
A7ZBG3_CAMC1/37-201--------------------------------------------------------------------------------
A8GKD6_SERP5/931-1096--------------------------------------------------------------------------------
A0RNY6_CAMFF/1383-1550--------------------------------------------------------------------------------
Q2KX68_BORA1/1752-1925--------------------------------------------------------------------------------
E6VYY1_DESAO/1086-1253--------------------------------------------------------------------------------
D3VFR2_XENNA/1025-1191--------------------------------------------------------------------------------
D3UYN1_XENBS/1023-1189--------------------------------------------------------------------------------
Q7VVJ2_BORPE/2180-2357--------------------------------------------------------------------------------
Q7NWR2_CHRVO/941-1107--------------------------------------------------------------------------------
D3UFL2_HELM1/1506-1673--------------------------------------------------------------------------------
D3UFL2_HELM1/1687-1845--------------------------------------------------------------------------------
A3N0W9_ACTP2/1886-2054--------------------------------------------------------------------------------
B4F0Z9_PROMH/927-1093--------------------------------------------------------------------------------
C5AJP7_BURGB/2314-2492--------------------------------------------------------------------------------
D2U951_XANAP/1315-1477--------------------------------------------------------------------------------
E0SDG8_DICD3/2492-2661--------------------------------------------------------------------------------
G9AKP5_PANAN/2894-3069--------------------------------------------------------------------------------
M9X2Y4_PASHA/1910-2075--------------------------------------------------------------------------------
FHAB_BORPE/2928-3086--------------------------------------------------------------------------------
Q0WAT6_YERPE/1232-1406--------------------------------------------------------------------------------
Q0WAT6_YERPE/638-798--------------------------------------------------------------------------------
Q0WE34_YERPE/1754-1929--------------------------------------------------------------------------------
Q7DDD8_NEIMB/1460-1630--------------------------------------------------------------------------------
Q7VV06_BORPE/2141-2297--------------------------------------------------------------------------------
Q8RGK3_FUSNN/9-171--------------------------------------------------------------------------------
Q8XQZ5_RALSO/2322-2494--------------------------------------------------------------------------------
Q9CPH9_PASMU/1932-2088--------------------------------------------------------------------------------
Q9JY30_NEIMB/1712-1883--------------------------------------------------------------------------------
W8UEG9_YEREN/1054-1220--------------------------------------------------------------------------------

PF12708

B9J5T0_BACCQ/81-310--------------------------------------------------------------------------------
Q8LE01_ARATH/37-285--------------------------------------------------------------------------------
B9DJC5_STACT/126-337--------------------------------------------------------------------------------
B3VCX0_9CAUD/251-531--------------------------------------------------------------------------------
Q7URR5_RHOBA/63-307--------------------------------------------------------------------------------
C6Y0W6_PEDHD/63-325--------------------------------------------------------------------------------
Q09C01_STIAD/75-328--------------------------------------------------------------------------------
Q87XU1_PSESM/2-255--------------------------------------------------------------------------------
B9XHK8_PEDPL/222-472--------------------------------------------------------------------------------
B6IU75_RHOCS/4-239--------------------------------------------------------------------------------
B6IPQ6_RHOCS/4-238--------------------------------------------------------------------------------
I0UP14_BACLI/12-257--------------------------------------------------------------------------------
Q9K7M8_BACHD/30-252--------------------------------------------------------------------------------
Q1WEL6_9ACTO/177-402--------------------------------------------------------------------------------
C7Q7K8_CATAD/223-454--------------------------------------------------------------------------------
Q4L3X6_STAHJ/137-369--------------------------------------------------------------------------------
Q4ZCD4_9CAUD/137-368--------------------------------------------------------------------------------
B7SSN3_BPNF/103-332--------------------------------------------------------------------------------
B3VMP8_BPPH2/104-333--------------------------------------------------------------------------------
B4ALN0_BACPU/119-349--------------------------------------------------------------------------------
C4L0K4_EXISA/96-329--------------------------------------------------------------------------------
A8U6P9_9LACT/97-331--------------------------------------------------------------------------------
Q2BCD1_9BACI/114-348--------------------------------------------------------------------------------
Q1NEH2_SPHSS/30-265--------------------------------------------------------------------------------
A8ATB1_9CAUD/133-334--------------------------------------------------------------------------------
Q184L0_PEPD6/13-220--------------------------------------------------------------------------------
Q184L1_PEPD6/12-216--------------------------------------------------------------------------------
Q184L3_PEPD6/10-203--------------------------------------------------------------------------------
EXG1_COCCA/423-637--------------------------------------------------------------------------------
B4DBN1_9BACT/49-286--------------------------------------------------------------------------------
B8GG97_METPE/553-766--------------------------------------------------------------------------------
B8GGB4_METPE/99-337--------------------------------------------------------------------------------
C2PN07_BACCE/26-237--------------------------------------------------------------------------------
A6MAC6_9CAUD/1003-1205--------------------------------------------------------------------------------
B6H126_PENCW/211-429--------------------------------------------------------------------------------
Q4WIW4_ASPFU/77-298--------------------------------------------------------------------------------
B8MQM9_TALSN/123-346--------------------------------------------------------------------------------
Q5B3M8_EMENI/219-441--------------------------------------------------------------------------------
B8NUX0_ASPFN/88-302--------------------------------------------------------------------------------
B0XYP2_ASPFC/111-333--------------------------------------------------------------------------------
A2QF38_ASPNC/247-469--------------------------------------------------------------------------------
A9V1W5_MONBE/50-262--------------------------------------------------------------------------------
B2ANL4_PODAN/41-256--------------------------------------------------------------------------------
Q7S3S0_NEUCR/218-448--------------------------------------------------------------------------------
C0RZI6_PARBP/251-482--------------------------------------------------------------------------------
A1DL39_NEOFI/171-403--------------------------------------------------------------------------------
Q5B3Q5_EMENI/170-388--------------------------------------------------------------------------------
A1DK98_NEOFI/13-234--------------------------------------------------------------------------------
Q5ATA0_EMENI/247-460--------------------------------------------------------------------------------
A2RBJ4_ASPNC/164-404--------------------------------------------------------------------------------
C5FIT8_ARTOC/207-432--------------------------------------------------------------------------------
A1CV41_NEOFI/241-464--------------------------------------------------------------------------------
B6QWE5_PENMQ/71-313--------------------------------------------------------------------------------
A1DIT0_NEOFI/146-388--------------------------------------------------------------------------------
Q7S602_NEUCR/168-396--------------------------------------------------------------------------------
B2AQ98_PODAN/93-316--------------------------------------------------------------------------------
Q2GRE2_CHAGB/224-446--------------------------------------------------------------------------------
Q0CRX2_ASPTN/83-312--------------------------------------------------------------------------------
Q2H3L6_CHAGB/41-260--------------------------------------------------------------------------------
Q7SGI7_NEUCR/41-267--------------------------------------------------------------------------------
Q0UIW6_PHANO/70-284--------------------------------------------------------------------------------
EXG1_COCCA/70-295--------------------------------------------------------------------------------
Q4PER8_USTMA/242-464--------------------------------------------------------------------------------
Q5I5C0_9HYPO/64-289--------------------------------------------------------------------------------
Q2Z1W1_PHACH/69-290--------------------------------------------------------------------------------
A8NNP9_COPC7/68-294--------------------------------------------------------------------------------
Q401R8_LENED/64-291--------------------------------------------------------------------------------
Q9P491_HYPAT/66-284--------------------------------------------------------------------------------
Q9P8J3_9PLEO/66-299--------------------------------------------------------------------------------
B2WKN5_PYRTR/68-291--------------------------------------------------------------------------------
Q96V65_BLUGR/60-276--------------------------------------------------------------------------------
C4JXY6_UNCRE/64-288--------------------------------------------------------------------------------
B0XMS4_ASPFC/67-291--------------------------------------------------------------------------------
C1H3L4_PARBA/65-289--------------------------------------------------------------------------------
Q7S324_NEUCR/222-446--------------------------------------------------------------------------------
B2AVA4_PODAN/55-279--------------------------------------------------------------------------------
A9YZW0_9HYPO/60-287--------------------------------------------------------------------------------
Q7S6I5_NEUCR/41-263--------------------------------------------------------------------------------
B2AQV4_PODAN/41-263--------------------------------------------------------------------------------
B6QD92_PENMQ/79-303--------------------------------------------------------------------------------
B0XLY8_ASPFC/92-316--------------------------------------------------------------------------------
B6QUF4_PENMQ/72-296--------------------------------------------------------------------------------
Q4WLX5_ASPFU/93-315--------------------------------------------------------------------------------
B2W2R6_PYRTR/89-320--------------------------------------------------------------------------------
A7EWZ9_SCLS1/45-272--------------------------------------------------------------------------------
A7EV58_SCLS1/85-323--------------------------------------------------------------------------------

PF00295

PGLR1_MAIZE/68-409--------------------------------------------------------------------------------
PGLR_YEAST/43-361--------------------------------------------------------------------------------
PGLR_SOLLC/103-443--------------------------------------------------------------------------------
PGLR1_ASPNC/50-368--------------------------------------------------------------------------------
PGLRB_ASPFN/46-363--------------------------------------------------------------------------------
G3XYE5_ASPNA/45-362--------------------------------------------------------------------------------
M2QZD9_COCSN/45-364--------------------------------------------------------------------------------
M4FG11_BRARP/47-378--------------------------------------------------------------------------------
PGLR1_ASPOR/52-367--------------------------------------------------------------------------------
Q6D880_PECAS/62-401--------------------------------------------------------------------------------
S0EGK1_GIBF5/43-372--------------------------------------------------------------------------------

PF03212

C4ZYR0_ECOBW/1057-1180--------------------------------------------------------------------------------
A0A024L0X6_ECOLX/430-556--------------------------------------------------------------------------------
J7RCG5_BORP1/480-606--------------------------------------------------------------------------------
F4LI63_BORPC/332-450--------------------------------------------------------------------------------
F4LE36_BORPC/583-704--------------------------------------------------------------------------------
PERT_BORPA/444-564--------------------------------------------------------------------------------
TIBA_ECOH1/506-627--------------------------------------------------------------------------------
A0A017IV98_ECOLX/494-616--------------------------------------------------------------------------------

PF01095

PME13_ARATH/301-598--------------------------------------------------------------------------------
PME42_ARATH/215-510--------------------------------------------------------------------------------
PME23_ARATH/257-554--------------------------------------------------------------------------------
PME44_ARATH/212-509--------------------------------------------------------------------------------
PME16_ARATH/213-502--------------------------------------------------------------------------------
PME24_ARATH/255-548--------------------------------------------------------------------------------
PME51_ARATH/240-544--------------------------------------------------------------------------------
PME61_ARATH/273-571--------------------------------------------------------------------------------
PMEU1_SOLLC/272-570--------------------------------------------------------------------------------
PME2_ARATH/276-573--------------------------------------------------------------------------------
PME35_ARATH/228-514--------------------------------------------------------------------------------
PME21_ARATH/255-552--------------------------------------------------------------------------------
PME47_ARATH/307-606--------------------------------------------------------------------------------
PME12_ARATH/237-533--------------------------------------------------------------------------------
PME26_ARATH/660-954--------------------------------------------------------------------------------
PME17_ARATH/206-499--------------------------------------------------------------------------------
PME43_ARATH/391-688--------------------------------------------------------------------------------
PME1_SOLLC/233-531--------------------------------------------------------------------------------
PME58_ARATH/259-556--------------------------------------------------------------------------------
PME46_ARATH/257-550--------------------------------------------------------------------------------
PME34_ARATH/284-583--------------------------------------------------------------------------------
PME22_ARATH/240-525--------------------------------------------------------------------------------
PME32_ARATH/214-511--------------------------------------------------------------------------------
Q9S767_ORYSJ/304-592--------------------------------------------------------------------------------
B4FCY2_MAIZE/251-546--------------------------------------------------------------------------------
B9IKC0_POPTR/283-579--------------------------------------------------------------------------------
K7KZN7_SOYBN/877-1170--------------------------------------------------------------------------------
U5GQ29_POPTR/312-608--------------------------------------------------------------------------------

PF14592

F0S763_PEDSD/26-457-------------------------------------------------------------------VASVKEVYSKVDQ
G0L7T1_ZOBGA/39-464-------------------------------------------------------------------VKNSTELNEAIDQ
CSLB_PEDHD/28-451-------------------------------------------------------------------VASNETLYQVVKE
A2TXR8_9FLAO/26-451-------------------------------------------------------------------VSSNSELEEALSN
A0M0H6_GRAFK/28-451-------------------------------------------------------------------VTNISEFNSAVEK
A3UA26_CROAH/32-454-------------------------------------------------------------------VTNTKELTQAIKD
L7W9A4_NONDD/2-423-------------------------------------------------------------------VSNINELQEAITN
F4AY36_KROS4/8-431-------------------------------------------------------------------VTTPDELKEAIED
T2KLV7_9FLAO/30-455-------------------------------------------------------------------VNNAKELDQAIKA
E6XAU2_CELAD/28-451-------------------------------------------------------------------VSTQAELQEAIFN

PF16318

E5C6D6_9BACE/316-599--------------------------------------------------------------------------------
D7J093_9BACE/318-599--------------------------------------------------------------------------------
A5FNJ9_FLAJ1/248-520--------------------------------------------------------------------------------
E2NFR1_9BACE/253-527--------------------------------------------------------------------------------
A5ZFT6_9BACE/253-527--------------------------------------------------------------------------------
E4RYT9_LEAB4/243-509--------------------------------------------------------------------------------
C2FSM9_9SPHI/246-519--------------------------------------------------------------------------------
C6Y3U4_PEDHD/247-515--------------------------------------------------------------------------------
D8DZJ8_PREBR/248-514--------------------------------------------------------------------------------
D5ETE2_PRER2/247-519--------------------------------------------------------------------------------
D1PWW5_9BACT/248-521--------------------------------------------------------------------------------
D7IDS3_9BACE/184-486--------------------------------------------------------------------------------
D7JZG1_9BACE/181-476--------------------------------------------------------------------------------
D4VL73_9BACE/180-472--------------------------------------------------------------------------------
E6K656_9BACT/179-459--------------------------------------------------------------------------------
Q8A8Z1_BACTN/189-475--------------------------------------------------------------------------------

PF07971

U7PU00_SPOS1/332-877---------------------------------------------------AGAWIQFEP..PAAG..SDHT......IT
G2NMH0_9ACTO/619-1147---------------------------------------------------VTGFFRF.......D.AGKDR...T..VG
G0FHU2_AMYMS/244-723---------------------------------------------------SGGYVTF.........ANLNG...A.QVN
J4HRZ5_FIBRA/329-845---------------------------------------------------SGALFSYA....GEP....SE......IN
R5AV27_9BACE/238-743---------------------------------------------------AGAVVGF......PT.SR.GE...K..VN
R6ZMR2_9BACE/255-763---------------------------------------------------MKALLRF.......DRTQADE...Q..VL
Q5LHF2_BACFN/245-751---------------------------------------------------.KALLHF.......D.TTKDE...Q..VF
A1S316_SHEAM/272-763---------------------------------------------------VKVLARF.......D.NPHQA...P..LL
A8L8V7_FRASN/271-746---------------------------------------------------VGAWLRM.........PPAAD...G.AVM
G4ND73_MAGO7/262-774---------------------------------------------------AGAYVRFK....NAD....KP......IL
E8V2C0_TERSS/272-764---------------------------------------------------FGTYVRF.......PALTQGD...A..VV
F4CDU4_SPHS2/240-732---------------------------------------------------ISAQLVF.......D.EQQK....N..IE
I6SXV1_ENTHA/204-697---------------------------------------------------....IYF.........GDVKK...Q.VI.
M2N2U4_BAUCO/275-769---------------------------------------------------.GGVFSFS.....QS.....K......VA
A4AN18_MARSH/251-760---------------------------------------------------IFSYLSF.......TNLEEDE...P..LL
R5JRR1_9BACE/250-759---------------------------------------------------MGAYVTY.........KTAEN...E.EIL
D5EVW5_PRER2/246-768---------------------------------------------------..MSLNY.........TTRQN...D.QVN
Q481A5_COLP3/308-820---------------------------------------------------SGAWVDL.........DLSQQ...K.TVT
K2R029_MACPH/268-785---------------------------------------------------AGAWVRFEA...PAS...NNQ......IT
R6FAY9_9BACE/252-751---------------------------------------------------TGALLRFE....GDA....TT......LQ
M7U9N7_BOTF1/265-776---------------------------------------------------.GAFVRFQ....SPG....DG......II
N1PXL6_MYCP1/318-821---------------------------------------------------LGAYVRF......GG.S...K...R..VE
R5IB22_9PORP/238-730---------------------------------------------------....FYF.......K.LKKGQ...P..LL
C7M4B4_CAPOD/261-744---------------------------------------------------IGAYFRY.......K.FDKDE...V..VE
G8TN43_NIAKG/281-774---------------------------------------------------LGFFTEF.......A.TKENE...P..VL
X5D9C9_9BACT/240-768---------------------------------------------------.....NL.........GDSVD...E.VL.
R7DDV2_9PORP/208-728---------------------------------------------------SCAVFCF.........DGQ.T...Q..IN
Q8A193_BACTN/246-735---------------------------------------------------VKSVLTF.........GNVKE......VK
B4EIV1_BURCJ/297-798---------------------------------------------------...TLTF.........NVDSK..HP.DVM
F4CBM6_SPHS2/266-760---------------------------------------------------LRMHFDF.......S.TEEGE...K..VK
R6WZT0_9BACT/248-736---------------------------------------------------..ARVDF.......D.MAEGE...Q..LL
G8NSC1_GRAMM/270-787---------------------------------------------------SGAWISF.........DPAQA...K.QVH
Q1IUD1_KORVE/257-751---------------------------------------------------.KLLVHY.......Q.TAAGK...P..IF
E5R5G1_LEPMJ/250-756---------------------------------------------------AGGFLRFQG...PLS....GP......LL
F4CCU7_SPHS2/237-742---------------------------------------------------VGALIHF......KT.SKAGE...Q..IN
Q0CFC9_ASPTN/249-747---------------------------------------------------VGALYTFN.....ES.....V......VT
Q5LHF3_BACFN/226-731---------------------------------------------------TGAIIGF......ST.RK.GE...I..VH
W8F287_9BACT/269-764---------------------------------------------------LRLFFDF.......K.TTAGE...Q..VK
R6SN01_9BACE/239-746---------------------------------------------------CGGFVEF.........DVKKD...E.SVL
R5KV09_9BACT/237-726---------------------------------------------------LKAWLDF.......D.PKGGN...E..LT
R6XA11_9BACT/239-735---------------------------------------------------CGAWFTFNT...NGH....KT......VK
R6VVJ6_9BACT/252-740---------------------------------------------------.KGIVRL.......P.DDTRS......VS
Q9PF36_XYLFA/270-764---------------------------------------------------.KAALHF.......P.DAGEA...P..LL
D8Q3G4_SCHCM/263-790---------------------------------------------------MGAMLTWPA...NPAGE..TS......IL
R6D727_9BACE/232-737---------------------------------------------------VGAVVRF......ST.QR.GE...Q..VQ
X5DYF1_9BACT/276-770---------------------------------------------------IRAYFNF.......D.TAENE...K..LK
E2PV07_STRC2/616-1149---------------------------------------------------VRGHFRF.......D.AGADR...T..VV
I3ZBQ9_TERRK/285-776---------------------------------------------------.IGVFDF.......A.SSRA....P..LL
R6MN00_9BACE/215-700---------------------------------------------------.VALVKF.......INSKGKK...P..LE
D8PPV4_SCHCM/271-763---------------------------------------------------.SAYARFAPEDSDNG.S...L...T..VN
G8TCQ4_NIAKG/237-728---------------------------------------------------SGVFAGF.......K.LKKGE...Q..LR
I2G215_USTH4/348-881---------------------------------------------------.YAFVRFP.....QD.T...I...K..VR
G0AF00_COLFT/383-871---------------------------------------------------GKASVTF.........DASTT...P.AVL
M4NBS4_9GAMM/425-960---------------------------------------------------VAAWFGF.......D.TTQAK...V..VN
R5PL83_9BACT/257-780---------------------------------------------------.MMVLDY.........KTHDR...E.KVD
L2G5N5_COLGN/293-801---------------------------------------------------.GAFVRFK....SAE....QP......IT
G0RIK4_HYPJQ/262-771---------------------------------------------------.GAFIRFA....SAQ....EP......IY
I3ZE22_TERRK/239-727---------------------------------------------------.GAYVEF.......T.P..GA...D..VE
E9F417_METAR/347-850---------------------------------------------------VGAYATFD.....TA.H...D...R..IE
D2QHT3_SPILD/252-742---------------------------------------------------VKGVVNF.......S.TQANE...K..VL
Q8P357_XANCP/267-799---------------------------------------------------.GAWLSF.........PLGKGKNAR.AVT
R6MN58_9BACE/244-752---------------------------------------------------CKVLLSF.......K.TKKDE...Q..VM
R6F0X9_9BACE/239-744---------------------------------------------------ALAMVGF......KT.VR.GQ...V..VN
B5HEX3_STRPR/279-803---------------------------------------------------NGAWVTF.........DAADD...R.DVV
C7PRR1_CHIPD/254-759---------------------------------------------------VGAVIGF......AT.AK.GE...K..VN
E8RS95_ASTEC/249-745---------------------------------------------------LKCALHF.......D.EAGSA...P..LL
F0RGV3_CELLC/254-736---------------------------------------------------IGAYMRY.......N.FKKKT...T..VE
R5LY91_9BACE/242-735---------------------------------------------------.IARFDF.......H.TAAGE...Q..IL
A6LGN5_PARD8/295-770---------------------------------------------------LGFFTEF.......E.TEANE...E..VL
R6KI45_9BACE/221-722---------------------------------------------------SCAYVKF......QL.EA.GE...K..MT
D1BF94_SANKS/371-884---------------------------------------------------..GAVTF.......D....AA...A..AD
Q0UTF3_PHANO/196-689---------------------------------------------------AGGYLRFQG...PVS....GP......IL
A6LFI6_PARD8/243-749---------------------------------------------------.DLKFHY.......KFSEKAQ...P..LY
F2KXB9_PREDF/394-872---------------------------------------------------IGSYFTY.......K....TKKGEA..IY
Q0UGQ6_PHANO/177-697---------------------------------------------------.GGFIRFKT...NPS....EG......VL
R6CWA8_9BACE/238-728---------------------------------------------------..LVLSF.......D.T...D...T..LL
F0SF03_PEDSD/222-742---------------------------------------------------ACLILTF.........GK.ES...N..IR
A1CAZ9_ASPCL/248-746---------------------------------------------------VGGLFTFQ.....ER.....V......VT
B8NXN6_ASPFN/165-672---------------------------------------------------AGTFARFH....TLR...DNT......IT
R5GRT6_9BACT/247-730---------------------------------------------------....ASF.......D.VTTDT...V..VG
D3PUH5_STANL/243-767---------------------------------------------------NGAWIGF.........DASKD...R.EVV
R6VFG8_9BACT/269-760---------------------------------------------------.VMHFDF.......G..DDPA...P..LE
R5IRF6_9PORP/210-729---------------------------------------------------.CIVFHF.........ADAQQ......IN
Q5LAE2_BACFN/237-726---------------------------------------------------.RLIMSF.......D.MKPDE...Q..LL
C7PM40_CHIPD/270-749---------------------------------------------------LGFYTEF.......A.TTANE...K..VL
K1VMQ9_TRIAC/329-807---------------------------------------------------..GWAIFP.....RD.T...K...S..VD
F9XLT5_MYCGM/322-825---------------------------------------------------QGVYARFEN...VKA...TDT......IW
R5GD99_9PORP/263-747---------------------------------------------------VGAYFTF.......D.TEADE...T..IE
V2X6S9_MONRO/259-767---------------------------------------------------..GLVGFPS...NPSKP..SS......IL
Q759D8_ASHGO/338-853---------------------------------------------------FGVLFEF......AE..DVRV......LK
A6L7S3_BACV8/260-746---------------------------------------------------IGVWFTY.......D.TTAEE...V..IE
Q59VA0_CANAL/267-777---------------------------------------------------MGLSFQFN....KQD.LKNNE......LI
G3JDG1_CORMM/239-754---------------------------------------------------AGGWVRFAP..QDGA...SRT......VT
R5JG70_9BACE/235-740---------------------------------------------------AGAIIGF......AT.KN.GE...T..VK
T5AF87_OPHSC/250-762---------------------------------------------------.GAFARFEP...RGP...DAA......VT
R5FMY1_9BACT/235-740---------------------------------------------------AGAIVGF......AT.RR.GE...Q..VL
R7EQ20_9BACE/238-724---------------------------------------------------LQAYLSF.......D.NSDGE...P..VI
Q8P6S1_XANCP/269-764---------------------------------------------------LKAALHY.......P.DASEA...P..LL
R7YLH4_CONA1/246-747---------------------------------------------------LGGVFTFG.....QG.....T......VT
A5FHD9_FLAJ1/276-770---------------------------------------------------LKLFFDF.......D.TNEGE...K..IK
C1F5Z0_ACIC5/273-764---------------------------------------------------VGAYVSW.......PQSSDAQ...T..VT
N1JJ74_BLUG1/238-758---------------------------------------------------.GAFVRFA....PGT....TT......VL
R5I4F3_9PORP/245-752---------------------------------------------------SKALLQF.......A.TENDE...E..VL
E5A4R8_LEPMJ/277-783---------------------------------------------------IGALFQFP.....SN...SSA......VM
U5VWI8_9ACTO/583-1111---------------------------------------------------..RYASF.......A.TKPGQ...E..VL
G2ND96_9ACTO/286-798---------------------------------------------------SGGWVGF.........DTSSD...E.DVR
M3K288_CANMX/252-757---------------------------------------------------IGLIFEFD....QND.LNNGE......LL
F2KZ10_PREDF/243-748---------------------------------------------------AMAVVGF......HT.RR.GE...Q..VN
G4NF02_MAGO7/324-842---------------------------------------------------AGSWVQFDP...PTA...GGA......IV
R6F0G4_9BACT/261-751---------------------------------------------------IGCYMSY.......D.CAEGE...Q..VE
M7SRL0_EUTLA/324-836---------------------------------------------------LGAYVRFR.....SD.T...K...R..VE
Q0CS76_ASPTN/248-771---------------------------------------------------.GTFARFH....APE...DGV......LL
K0F0T9_9NOCA/266-746---------------------------------------------------SGLFLQF.........DS..D...L.PVQ
C6Y1K7_PEDHD/382-893---------------------------------------------------AGVSAKY.........NVKAG...D.EIK
M3C6Z1_SPHMS/281-790---------------------------------------------------VGAVFVWP.....RG.GA.CT......VK
G8NVE4_GRAMM/274-775---------------------------------------------------QVAVVKF.........KS.G....T.RLE
F4B1S1_KROS4/238-724---------------------------------------------------HKAALQF.......D.NPKNE...E..II
R6K5T3_9BACE/244-752---------------------------------------------------AKAVMSF.......RNLPADG...R..VL
F9YPS9_CAPCC/306-792---------------------------------------------------....FFF.......D.NSTGE...E..LV
T0M9R2_COLGC/270-789---------------------------------------------------AGAIVRFKP...SSDQK..GS......II
I2FQ04_USTH4/294-814---------------------------------------------------AGVILTFDQD.KLSSPPYNGN......LP
J4KN82_BEAB2/261-780---------------------------------------------------AGAWVQFE....PPQ...NNQ......IL
F6GE18_LACS5/239-723---------------------------------------------------..IALNF.......I.NPNNE...P..VY
S7ZU94_PENO1/250-748---------------------------------------------------IGALFTFS.....DD.....E......VI
S8F5G2_FOMPI/253-775---------------------------------------------------LGALFTFNP...NPDAT..TS......IL
F0XC67_GROCL/1247-1767---------------------------------------------------AGAWIQFEA...PSG..PGRD......IL
H1YA33_9SPHI/255-747---------------------------------------------------SGAYLGF.......K.LQAGQ...S..IR
I3YHM3_ALIFI/277-762---------------------------------------------------...RFGF.......R.TEENE...R..IT
F8EA41_RUNSL/302-822---------------------------------------------------VGFFVGY.......KTQKDDQ......VT
F8JRR9_STREN/283-770---------------------------------------------------.GVYVSF.........DTVKS...R.TVT
Q8A113_BACTN/217-734---------------------------------------------------...ALYY.........GS.EK...N..LN
F4CF68_SPHS2/232-735---------------------------------------------------KGAYLVF..........KSGA...T..VQ
W0ESP1_9PORP/261-749---------------------------------------------------IGVYFTY.......Q.TQPGE...Q..IQ
W0EKX8_9PORP/235-730---------------------------------------------------.RLVLEF.......K.LKPGE...S..LQ
I3ZHR8_TERRK/249-728---------------------------------------------------VGASFDFNA...RAH....QV......VQ
C1GGA7_PARBD/269-776---------------------------------------------------LGAFVQFR....TPK...DRK......IL
R5MRY8_9BACE/242-741---------------------------------------------------TGALLRFN....SSE....EV......VQ
I3YLR2_ALIFI/244-702---------------------------------------------------PGT........................VL
R7JIM0_9PORP/267-759---------------------------------------------------IVAYFEF.......D.PKASQ...E..LE
R7LIY3_9BACT/48-535---------------------------------------------------IGAWFSF.......D.THEGE...Q..VV
H8KZ70_FRAAD/281-774---------------------------------------------------LEAAFDF.......G.DLKGQ...A..LV
R6TIU0_9BACE/253-761---------------------------------------------------MKALLRF.......APLAGGE...Q..VM
Q8PBN8_XANCP/274-763---------------------------------------------------...VFDV.......A.NDGT....P..LV
D5BC60_ZUNPS/246-763---------------------------------------------------AGLYLKF.........NTEDK...E.EIV
I3ZYE3_ORNRL/257-746---------------------------------------------------..AQAFF.......N.NENK....E..LL
Q8A325_BACTN/237-729---------------------------------------------------LHGCFRF.......G.QLNGK...P..LT
R6TIT6_9BACE/233-738---------------------------------------------------AGAVVGF......RT.AK.GE...Q..VH
R6WV50_9BACT/248-768---------------------------------------------------AGVALRY.........RTSAD...E.RIE
E9E5Q1_METAQ/268-792---------------------------------------------------.GAWVQFH....PPQ...SNQ......IQ
X5E0Z5_9BACT/262-743---------------------------------------------------IGSWFTF.......N.TKANE...E..IL
R6CRV2_9BACE/264-756---------------------------------------------------IVAYLNF.......N.TAKDS...E..LT
W0F0W6_9SPHI/235-739---------------------------------------------------SGAIVGF......KT.AK.GE...K..VH
F2ICV0_FLUTR/264-760---------------------------------------------------LRAFFDF.......D.LDSSK...E..LL
L0G0Y1_ECHVK/248-737---------------------------------------------------VKALMEF.......A.TTADE...K..VL
R6VPA7_9BACT/239-729---------------------------------------------------VKGVVSF.......G.EPIDR......LC
R6Y8B5_9PORP/251-743---------------------------------------------------VGAWIKL.......T.SDKPG...K..IL
F4KQF8_HALH1/232-734---------------------------------------------------VGALVHF......KS.GV..R...T..VN
W5WJ40_9PSEU/294-773---------------------------------------------------SGAYVTF.........DTLKS...A.TVN
G8P189_GRAMM/260-741---------------------------------------------------IGAYAKFK.....TA.E..GE...I..VE
A6LE00_PARD8/236-739---------------------------------------------------AGAIIGF......ET.KA.GE...V..VH
F8PL93_SERL3/210-728---------------------------------------------------.GGLLTFPP..ASNDSSLPTT......IL
M3A2E6_MYCFI/226-730---------------------------------------------------LGAYVKFA.....KG.T...R...Y..VE
F5WRB0_ERYRF/193-683---------------------------------------------------...YVFK.........TDSNH...L.QI.
W5WNG1_9PSEU/603-1139---------------------------------------------------VTGYVGF.......D.TSASK...T..VT
E3FCN8_STIAD/235-746---------------------------------------------------VTSWIRF.......N.TFAGE...K..VT
R5PP34_9PORP/236-741---------------------------------------------------VGALIGF......KT.RR.GE...K..IR
V6KU68_STRRC/239-757---------------------------------------------------GGAYVRF.........DTTKH...R.TVE
R5P2L7_9BACT/238-729---------------------------------------------------LKAVFDF.......G.RQ..D...V..VE
D6D181_9BACE/235-738---------------------------------------------------YGAYIKF..........KKGA...K..VQ
E9F2Y7_METAR/263-770---------------------------------------------------.GAFVRFV....DGN....KP......VY
D6D0Y6_9BACE/235-740---------------------------------------------------VGAAIGF......ST.KK.GE...L..VH
R6WSC1_9PORP/258-746---------------------------------------------------IGVWFKY.......D.TEEDE...V..IE
R6VUD4_9BACT/261-751---------------------------------------------------VGYYFSY.......D.AEEGE...Q..VE
A2R7B1_ASPNC/261-757---------------------------------------------------IGALFSWD.....TE.TD.AQ......IS
D3IB54_9BACT/265-751---------------------------------------------------IGIFIDF.......N.TKQNE...E..VE
A4X9V9_SALTO/597-1142---------------------------------------------------VTGYLAF.......D.TSTAK...V..VT
S5VGA2_STRCU/302-788---------------------------------------------------SNAHVTF.........DTRSN...P.VVQ
R6VNE2_9BACT/223-708---------------------------------------------------.QAVLTF.........APGTT...S..LT
A6RG74_AJECN/257-764---------------------------------------------------LGAFVQFQ....APD...NRE......LI
F8EMI3_RUNSL/253-745---------------------------------------------------VGGYVEF.......E.TNENL...V..VN
V2XHT4_MONRO/284-804---------------------------------------------------SGALFSYK....GTP....KT......IT
R7LDI0_9BACT/241-733---------------------------------------------------..MLVYF.......D.LKPGE...Q..LG
C7PM47_CHIPD/233-736---------------------------------------------------MGAFIRF..........RSGT...K..VQ
G0FHU3_AMYMS/256-775---------------------------------------------------.GAWLTF.........A.GGG...Q..VT
I4A0R9_ORNRL/236-741---------------------------------------------------AGIVVGFN.....KT.KK.GE...K..II
C6W4W9_DYAFD/261-752---------------------------------------------------LGAYVGF.........GDAKQ...V..VT
M2NEA8_BAUCO/259-773---------------------------------------------------AGAWTRFQA..PNNT...SNE......ML
R5VDA0_9BACE/231-736---------------------------------------------------AGAIIGF......AT.RK.GE...K..VH
R7JK19_9PORP/291-764---------------------------------------------------LGFFTEF.......E.TTKDE...V..VL
R7JG93_9PORP/262-785---------------------------------------------------AGAYLTY.........QTKAG...E.TVT
F3ZQV4_9BACE/233-738---------------------------------------------------SGAIVSF......NT.KR.GD...Q..VH
R5UGR2_9BACE/235-712---------------------------------------------------...VLDF.......D.LKKGE...E..LL
M7TB74_EUTLA/290-803---------------------------------------------------AGAWMRFADI.PEEQ...DNT......IT
R5M3G3_9BACE/215-735---------------------------------------------------ACAVMHF.........ADGTK...T..VN
C1F144_ACIC5/258-750---------------------------------------------------AGAYLRF.......V.TTQDE...Q..VL
B8MW61_ASPFN/262-769---------------------------------------------------AGGFARFER...PTN....GS......VS
G0G534_AMYMS/253-730---------------------------------------------------SGGYVTF.........DTSSN...T.TVQ
U5W717_9ACTO/583-1116---------------------------------------------------.TGYLKF.......D.TTTNK...T..VQ
S8AUX2_PENO1/258-766---------------------------------------------------AGGYVTFER...PDD....GV......VT
F8PNH6_SERL3/268-750---------------------------------------------------LSGYVKFE.....SN.L...T...T..VN
V5FTD6_BYSSN/268-766---------------------------------------------------AGSFVSFS....APA...NNV......IM
M4S534_9SPHN/264-754---------------------------------------------------LVARLDF.......G.KLAS....P..LE
E8RV90_ASTEC/241-719---------------------------------------------------LGAWLTF.......KGDPSKP......VL
C7M956_CAPOD/237-705---------------------------------------------------SKIVLRY.......A.TADNE...A..IV
F9D252_PREDD/261-751---------------------------------------------------VGYYFTY.......N.VDEAE...Q..IE
E8RVN8_ASTEC/277-754---------------------------------------------------LGGFMTFDT...TNS....SV......VQ
Q832K9_ENTFA/198-694---------------------------------------------------GKILLSF.........GNIAQ...Q.VV.
G8TEK7_NIAKG/223-742---------------------------------------------------KAWAGFP.........ASAPA...V..IE
M2YKL8_MYCFI/250-760---------------------------------------------------.GAFLRFK.....DK....SP......VT
D2QG27_SPILD/248-753---------------------------------------------------VGAVVSF......KT.EK.GE...Q..VN
F9XL31_MYCGM/226-731---------------------------------------------------LGAYVRFA.....GN.C...K...S..VE
K0KAH3_SACES/258-772---------------------------------------------------..QWLTF...........AEG...P..VT
C9A6J8_ENTCA/198-694---------------------------------------------------AFVVLRF.........GACQT...Q.TI.
C8VIR9_EMENI/281-803---------------------------------------------------VGGIFSWN.....TH.EE.LS......IS
R5IR26_9PORP/200-717---------------------------------------------------.VLCAQF.........GKELE...Q..LG
R5NWD8_9PORP/218-751---------------------------------------------------.NIGGWL.........SADRV...T.EVE
M7TSY3_BOTF1/247-758---------------------------------------------------VGGLYTFN.....TT.....V......VA
R7DIA9_9PORP/249-756---------------------------------------------------AKALLTF.......IPEEAKK...E..VL
Q15ZP0_PSEA6/275-758---------------------------------------------------IGAYMRF.......D.TQANE...Q..VE
K1X3Q1_MARBU/242-750---------------------------------------------------.GTISKFQ....PPG...SDY......VM
A1S315_SHEAM/323-828---------------------------------------------------SGLWLEL.........DTSVQ...Q.KVT
B2WBV9_PYRTR/250-740---------------------------------------------------LGGVFTFS.....ES.....K......VM
F9Z496_ODOSD/396-891---------------------------------------------------....ALH.........RLKKG...E.ELQ
A6LGN2_PARD8/232-705---------------------------------------------------SGVYFTF.........PLKEG..NQ.AVQ
S8ENP9_FOMPI/259-761---------------------------------------------------VGAVYTFA.....DQ.....D......VL
D5BAF4_ZUNPS/266-745---------------------------------------------------IGAYMTY.......D.FATPQ...E..VE
R7DMG2_9PORP/271-757---------------------------------------------------VGAFFTF.......D.TQSGE...Q..IE
E8X2K1_ACISM/255-750---------------------------------------------------LKCVMYF.......K.TKAQE...T..IL
E8UZA2_TERSS/258-753---------------------------------------------------LHAVVHY.......K.TADSE...K..IL
R1GPT3_BOTPV/258-769---------------------------------------------------.GGFVRFDD...PGD....SP......IL
K4L2L4_SIMAS/261-759---------------------------------------------------....FSY.......D.FAEAT...E..IE
F4C7M2_SPHS2/213-733---------------------------------------------------.YFIVQY.........PKGTT...K..IK
F0SAJ1_PEDSD/251-738---------------------------------------------------LGAYVGF.......K.LNKNE...Q..LK
T0TUP6_9STRE/215-703---------------------------------------------------..LFLTF............SS...K.EVT
R6EZA8_9BACT/225-711---------------------------------------------------....VVS.......V.ADNTK...P..LL
F4CBM4_SPHS2/244-748---------------------------------------------------VGAIVGF......SVRGK.TD...Q..VH
R6X4R5_9BACT/257-730---------------------------------------------------....ADF.......H.TTEGE...Q..VM
G2WSL9_VERDV/225-751---------------------------------------------------AGAWLLFD....ETG...PDG......IF
R5IAY0_9PORP/233-734---------------------------------------------------AGGYIKF......PA.A..NK...K..VS
K0K341_SACES/604-1134---------------------------------------------------VAGYLRF.......D.TSTEK...A..VT
R5M1V6_9BACE/284-758---------------------------------------------------LGFYTEF.......P.TRKDE...Q..VQ
R4SVV6_AMYOR/591-1127---------------------------------------------------VLGYLKF.......D.AGADK...T..VN
R4LXQ2_9ACTO/236-754---------------------------------------------------NGAYVSF.........DATQD...R.DVV
D5QHV3_KOMHA/262-756---------------------------------------------------LKAVCHF.......G.RARD.......II
R6VKF5_9BACT/149-627---------------------------------------------------AAVCVSFP.....TE.S..GE...E..VE
F0R2N2_BACSH/259-747---------------------------------------------------IGAWFTF.......D.TEEGE...Q..IE
W5W2K6_9PSEU/256-741---------------------------------------------------.GEYLTF.........DTTAN...Q.VVQ
F4C6P9_SPHS2/291-782---------------------------------------------------SGIYLGF.......F.LKKGE...S..IC
G8NTY4_GRAMM/256-747---------------------------------------------------IGAFVTF.......S.HWEGK...S..LL
F2SFY7_TRIRC/260-769---------------------------------------------------AGTYLQFQG..SSNG...PTR......VS
R5PTZ2_9BACT/224-710---------------------------------------------------....AIF.......S.VEKGE...P..LL
M2ZGR3_MYCFI/3-544---------------------------------------------------IGALFSWKR..TGANASAEHV......IE
B6HPH9_PENCW/253-761---------------------------------------------------AGAFARFH....APK...DNN......IL
M2QZJ7_CERS8/285-803---------------------------------------------------SGALFSYE....GEP....EE......VN
W8ETM9_9BACT/226-731---------------------------------------------------TGAVVGF......KT.HK.GE...Q..VQ
E4V245_ARTGP/286-792---------------------------------------------------VGAVFEFP.....PD...TTT......LK
A5E0Q5_LODEL/277-790---------------------------------------------------FGLIFEF.......S..NLSQ......VQ
A6LCG5_PARD8/260-781---------------------------------------------------AGLYLTF.........RTQDQ...E.SVT
R5PE19_9PORP/250-774---------------------------------------------------AGMSLNY.........KTKAG...E.VID
X5DBU2_9BACT/250-774---------------------------------------------------AGVFLTF.........STKEN...E.AVT
R7DGR9_9PORP/230-735---------------------------------------------------VGAIIGF......KT.RR.GQ...T..VQ
C7M5Q1_CAPOD/256-758---------------------------------------------------TGAVIGF......RT.KK.GE...Q..VT
J4KLI3_BEAB2/262-770---------------------------------------------------.GAFVRFA....DSH....IP......VY
Q15ZM6_PSEA6/259-746---------------------------------------------------SEVVLNF.......G.DIADK...A..LV
R6YIX3_9BACE/219-738---------------------------------------------------..VVWEL.........GNQAK...A..YT
N1PP62_MYCP1/266-780---------------------------------------------------AGAWVRFHP...PHT...NNQ......IL
M2RQI9_CERS8/267-748---------------------------------------------------..GFVRFA.....EG.T...K...Q..VN
F0R5A0_BACSH/244-743---------------------------------------------------TGALLRFA....EGD....SV......VQ
R5W019_9BACE/258-740---------------------------------------------------IGAWFTF.......D.TEENE...Q..IE
R7DIY0_9PORP/232-735---------------------------------------------------VCAYLQF......DV.PE.GE...K..LT
D3EHM8_GEOS4/212-711---------------------------------------------------.HVVIRF.........KDCER...G.TLD
A2U4A4_9FLAO/231-717---------------------------------------------------SKAALKI.......N.NPKNE...T..VF
R6TED2_9BACE/216-721---------------------------------------------------VGFFLSF.........PEESG...ESTVK
R5PXF8_9BACT/232-733---------------------------------------------------SGAIVGF......ST.KR.GE...Q..VN
B2FTQ4_STRMK/273-765---------------------------------------------------LVGTFAF.......G.KLDA....P..LV
E8X698_ACISM/266-765---------------------------------------------------.IGVFDF.......G.EMKG....P..LV
C5BZR8_BEUC1/381-898---------------------------------------------------..AVASF.......S....AP...V..VE
H1Y2M1_9SPHI/264-755---------------------------------------------------LKAALNF.......N.TTDNE...Q..VL
A4AVQ7_MARSH/259-738---------------------------------------------------IGAYMHY.......N.FDKPT...Q..VE
G3YEZ1_ASPNA/262-771---------------------------------------------------AGTFTRFNM...STN...DQA......LM
G2WXK7_VERDV/278-783---------------------------------------------------VGALFTFS.....TN...SST......VT
A5DND2_PICGU/244-741---------------------------------------------------FGFLFTF......PE..GTTS......IS
Q63NY9_BURPS/274-757---------------------------------------------------..AKLAF.........DSGAT......VR
Q8A6K3_BACTN/244-732---------------------------------------------------..IIATF.......D.LKPGD...E..LM
D5BFU0_ZUNPS/240-745---------------------------------------------------AGAIVGF......DT..KDGA...V..VH
F2KYG1_PREDF/264-750---------------------------------------------------IGVWMDY.......D.TEAGD...Q..VE
L0JB66_PREDD/629-1139---------------------------------------------------.VAYVTL.......D.ARAGE...P..VL
B2HSF1_MYCMM/257-753---------------------------------------------------SGAYVEF.........PSGAA......LE
R5PMH4_9BACT/237-741---------------------------------------------------AGVYIKF..........RPGS...K..VQ
R5FGS5_9BACT/226-715---------------------------------------------------...AVYE.......V.SDPSK...P..LV
H2K489_STRHJ/583-1111---------------------------------------------------VKGFLRF.......D.AGADH...T..VT
D2QCX6_SPILD/241-774---------------------------------------------------VGAYLSF.........KTKAG...E.VRK
A6KYE2_BACV8/399-911---------------------------------------------------...SAQY.........QVRRG...E.QVC
R6WWU7_9BACT/267-759---------------------------------------------------LVAWFKF.......A.TSRNP...E..LT
R5JB76_9BACE/257-740---------------------------------------------------MGAYIDFD.....KS.S...P...Q..IQ
X5DJ68_9BACT/247-739---------------------------------------------------IKGLISF.......D.EAPEK......VE
D3Q0N4_STANL/442-977---------------------------------------------------VAGYMRF.......D.AGDDR...T..VT
C4JIN1_UNCRE/51-558---------------------------------------------------IGVLFEFP.....HN...ITK......VR
C8VSU5_EMENI/260-769---------------------------------------------------.GGFVRFNH...RLN....HT......IK
D6D182_9BACE/231-703---------------------------------------------------SGVYFTF.........DVSKK...K.NVQ
Q15ZN6_PSEA6/246-752---------------------------------------------------VGAVIGF......KT.KR.GE...T..VS
W0EN75_9PORP/237-739---------------------------------------------------TGAIVGF......ST.QR.GE...K..VH
A4AVR0_MARSH/241-753---------------------------------------------------VGAIVGF......KT.KR.GQ...Q..VN
D2Q3X9_KRIFD/619-1154---------------------------------------------------VGGYFSF.........GPQTQ...Q..VQ
Q9AAR3_CAUCR/279-755---------------------------------------------------LGAYLTFDT...TAN....RQ......VQ
R6CE95_9BACE/250-741---------------------------------------------------..AKFYY.......N.TTQDE...Q..VL
Q481A4_COLP3/296-787---------------------------------------------------IKVLTHF.......K.DANTE...P..LM
B8NLD2_ASPFN/274-781---------------------------------------------------GGAFARFTP...PQA...NGT......ID
V2XIK0_MONRO/298-813---------------------------------------------------.GALFGWNL...APSGQ..TK......IL
G8TN43_NIAKG/997-1500---------------------------------------------------AGAWLQF..........PKGA...V..VQ
J4IB15_FIBRA/277-759---------------------------------------------------.SAYGRFA.....PG.T...Q...V..VD
A3HRW3_9BACT/234-766---------------------------------------------------SGLIFSF.........DNSSS...E.LL.
D7B4B3_NOCDD/288-795---------------------------------------------------SGGYVSF.........PEGS....D..VG
R5PLD1_9PORP/272-764---------------------------------------------------VVACFDF.......D.FSGGE...T..LE
X5E1R5_9BACT/239-745---------------------------------------------------VGGIVGF......KT.QK.GE...E..VN
R6KIJ4_9BACE/526-1033---------------------------------------------------AGLYVEF.........DTQKQ...S.VIQ
R5UP48_9PORP/235-740---------------------------------------------------VGAIIGF......KT.RR.GE...K..IH
N1PGL0_MYCP1/246-757---------------------------------------------------.GGFVRFM.....NA....SP......VL
Q8A5N9_BACTN/236-740---------------------------------------------------TCAYLKF......DV.PA.GE...K..LT
R5NK85_9BACT/252-729---------------------------------------------------VGGYVEFP.....AG.T...T...W..VD
G0AF01_COLFT/309-844---------------------------------------------------.TLILNF.......DLSQSAA...S.SAL
D5BAF6_ZUNPS/245-733---------------------------------------------------TKIILNY.......E.TTSEE...Q..IV
S3CNE2_GLAL2/261-772---------------------------------------------------..SFVRFTS...PTS....NG......IL
A6KY22_BACV8/241-733---------------------------------------------------..ARFNF.......D.TEKGE...Q..IV
Q2G5L6_NOVAD/250-750---------------------------------------------------LKAVLHY.......D.DAGAA...P..LV
D7C6N5_STRBB/602-1134---------------------------------------------------VTGYFRF.......K.PGADR...T..VT
Q826D8_STRAW/244-761---------------------------------------------------NGAYARF.........DATED...R.TVE
E9DYP6_METAQ/261-769---------------------------------------------------.GGFARFS....PGP...DNT......VT
A5FIB1_FLAJ1/247-738---------------------------------------------------TSAQLFF.......D.PKNSD...Q..LF
F8JSP5_STREN/250-764---------------------------------------------------RGAYLRF.........DTRSD...R.TVT
G2QF21_THIHA/223-735---------------------------------------------------AGAWLQFE....RPA...NNS......LL
C7PCT9_CHIPD/255-744---------------------------------------------------IKGVINF.......D.KAPAE......AM
I3YNM9_ALIFI/261-754---------------------------------------------------VGVWFSY.......D.TTEGE...Q..LE
R4L6G3_9ACTO/276-937---------------------------------------------------SGGYITF.........APGT....T.SVT
R5I8Z8_9PORP/233-723---------------------------------------------------.....LI.......R.FADEK...E..VQ
Q8P5J8_XANCP/517-1053---------------------------------------------------..GWIKF.......A.AGSTR...E..VQ
W5XCM2_9BACT/247-736---------------------------------------------------VKAAINY.......R.TKAGE...P..IL
D5GHL1_TUBMM/330-843---------------------------------------------------VGAVFSFG.....AS..RNITHPLA..VE
U5W551_9ACTO/251-724---------------------------------------------------TGAYVTF.........DTTSN...A.VVN
H1Y6J5_9SPHI/248-747---------------------------------------------------TGVLAYFDD...ASL....QQ......IK
R6SCI2_9BACE/257-776---------------------------------------------------AGMYFTF.........SNEQQ...E.AVT
U7PQB8_SPOS1/249-758---------------------------------------------------LGAVFSFN.....ST..STNT......VT
M3C4G9_SPHMS/315-827---------------------------------------------------LGAYVQFS.....QD.H...K...T..VE
R6T8N5_9BACE/251-774---------------------------------------------------.VLVLNY.........KTSEN...E.QID
G9NN10_HYPAI/257-763---------------------------------------------------...FVRLD....PPS...DGT......AT
Q8A3K6_BACTN/411-890---------------------------------------------------IGGYIRFK.....TG.K..NE...V..IK
K2QZK9_MACPH/51-547---------------------------------------------------LGGVFTFN.....ET.....A......VS
D5ES81_PRER2/224-726---------------------------------------------------AGAIVSF......KT.RR.GE...K..VC
W0F3Z3_9SPHI/265-759---------------------------------------------------IRAHFDF.......K.TSENE...K..LL
I6ZRZ1_MELRP/239-725---------------------------------------------------VKAAFHF.......R.TNPNE...P..VY
B6QAQ2_PENMQ/263-763---------------------------------------------------AGAFIRFK.....AG...TTS......VV
Q1ASW5_RUBXD/246-763---------------------------------------------------AGAYVSF.........GTGGS...R.EVV
Q097W8_STIAD/258-782---------------------------------------------------NGAWVTF.........DATTD...L.DVT
R6U2T8_9BACE/243-731---------------------------------------------------...RIDF.......H.TTEGE...Q..IM
A1S294_SHEAM/264-750---------------------------------------------------..LNFDL.......AQSQSKD...R.SLL
E5A3T8_LEPMJ/371-906---------------------------------------------------ANATFA...........GSAQ......VE
R5JSK3_9BACE/263-747---------------------------------------------------IGAFFSF.......D.TAEGE...Q..IE
I0KEB5_9BACT/239-743---------------------------------------------------AGAVVGF......RT.QK.GE...Q..VH
F3ZQD9_9BACE/261-749---------------------------------------------------IGVYFSF.......D.TEENE...Q..VE
A5FGD4_FLAJ1/234-739---------------------------------------------------AGAVVSF......KT.KK.GE...K..VN
B4EPR5_BURCJ/299-861---------------------------------------------------GAATLQF.......DLT.DAD...K.TVT
J4UKE8_BEAB2/247-759---------------------------------------------------AGGWVRFKT...TGK...DRT......VT
Q5L991_BACFN/270-762---------------------------------------------------LVAYFNF.......D.TRQNP...E..LV
G8TBJ6_NIAKG/234-723---------------------------------------------------MKGVISF.......L.KAPAT......IM
E3S2L0_PYRTT/262-771---------------------------------------------------VGALFTWN.....GT.KAPST......LR
D6D1V6_9BACE/205-725---------------------------------------------------.TVVMKF.........PENDK...R..IN
M2TG81_COCH5/264-772---------------------------------------------------AGGFVRFKG...PLS....GP......LL
R5HXL6_9BACT/227-727---------------------------------------------------.GALVTF.......A.P.GTG...Q..VT
F0R289_BACSH/238-732---------------------------------------------------LIVRFEY.......P.TQEGE...Q..IT
H8KM31_SOLCM/242-739---------------------------------------------------VKGIFRF.......S.TRENE...I..IY
R5JE95_9BACE/216-737---------------------------------------------------TCVVVGW.........DAAPL...S..LN
G3XPX4_ASPNA/256-770---------------------------------------------------AGGFVRFER...PDN....GT......VS
S8E8T9_FOMPI/279-762---------------------------------------------------VGAYARFS.....GT.A...P...V..VD
G2PCH2_STRVO/280-787---------------------------------------------------SGGYLQF.........APGT....R.RVG
I0KBV7_9BACT/254-771---------------------------------------------------AGLFLDY.........ATNAN...E.AIE
R5B6I7_9BACE/263-755---------------------------------------------------IGYWWSY.......RDLKPGE...Q..IE
C6X1W4_FLAB3/262-756---------------------------------------------------IRAYFDF.......A.TEQDE...Q..IL
D3I9D1_9BACT/233-738---------------------------------------------------AGAIVSF......ET.QR.GE...K..IE
Q5LED8_BACFN/263-748---------------------------------------------------IGTWFTF.......D.TDEGE...T..IE
K8E6J4_CARML/212-711---------------------------------------------------..FIIRF.........LDATE...K.TVI
D8PMG3_SCHCM/282-802---------------------------------------------------SGALFSYS....GDA....QE......IT
E8X5W4_ACISM/234-724---------------------------------------------------RGAYAEF.......A.P..GS...S..LL
H1Y4F5_9SPHI/236-741---------------------------------------------------AVAVVNF......KT.TA.GE...Q..VG
E8UZF7_TERSS/273-788---------------------------------------------------SGAWLGF...........GTG...G.DLR
R6VXX4_9BACT/546-1054---------------------------------------------------AGLFAVF.........DPAEN...P.VVQ
V2WSZ4_MONRO/278-798---------------------------------------------------AGALISYK....GTP....QN......IT
G8TJR4_NIAKG/264-757---------------------------------------------------LRMFFNF.......N.TEEGE...K..IK
F4A019_MAHA5/196-716---------------------------------------------------TDLVVDY.........KTEDN...E.CIE
U5Q3W7_9BACT/225-717---------------------------------------------------KKTLLTF.......S.PDKSG...K..IF
F9XHL5_MYCGM/252-759---------------------------------------------------GGAFIRFQD...PTN....GT......VQ
F4C4K0_SPHS2/253-778---------------------------------------------------VGAYLRF.........GTREG...E.QVN
A4APM0_MARSH/256-779---------------------------------------------------NGLYLTF.........NMEKD...S.VLE
Q5LHH6_BACFN/237-741---------------------------------------------------TCAYLRF......NV.PA.GE...K..LT
R7L3G4_9BACT/242-737---------------------------------------------------...AIDF.......G.LKKGD...V..LT
D4IQF8_9BACT/238-742---------------------------------------------------..AAVYF......TT.RR.GE...Q..VT
A4AVR4_MARSH/248-738---------------------------------------------------.GGQFFF.......K.KEIS....Q..VE
A1S293_SHEAM/256-738---------------------------------------------------IGAWLSF.......D.TREQE...A..IE
Q0CV76_ASPTN/826-1333---------------------------------------------------TGAYVRFA.....PS.T...T...R..VE
R7DDE0_9PORP/243-730---------------------------------------------------.KGVARF.......E.KAPSN......VV
N1PUA1_MYCP1/277-787---------------------------------------------------VGAVFSFS.....DS.AA.AT......VK
A1CUM0_ASPCL/255-764---------------------------------------------------AGTFVRFQA...PAD...ASG......IL
Q8A6V7_BACTN/212-732---------------------------------------------------ACAAWRF.........ADGTT...T..VN
N1QLN3_SPHMS/224-732---------------------------------------------------AGAFVRFQK...PGN....GT......MK
M2PK65_CERS8/284-800---------------------------------------------------LGALLTFTP...NSNGT..TT......IL
N1JF10_BLUG1/289-847---------------------------------------------------VGAVFSF.......D...TVN......VK
R5RRS9_9BACE/232-754---------------------------------------------------VGFWFSY.......DNVAENE...Q..IC
C7PN00_CHIPD/253-750---------------------------------------------------AGLFLEF.........ATTDQ...E.VVE
R6W3J5_9BACT/246-723---------------------------------------------------VGGYVRFA.....SD.V...R...T..VE
R6SEB5_9BACE/260-742---------------------------------------------------VGAWFTF.......D.TTEGE...A..IE
K0KND0_WICCF/263-761---------------------------------------------------FGLIFQF......EK..GTH.......VQ
R6VRM0_9BACT/239-753---------------------------------------------------...VLSF.......E.MDGDA...E..LG
K5WZS2_AGABU/306-803---------------------------------------------------..AYVMYHGE.ETKK.P...F...V..VS
R6YLY3_9BACE/245-719---------------------------------------------------AGGYIEFE.....DN.I...R...S..VE
A5FI93_FLAJ1/269-745---------------------------------------------------.GSYFTY.......K.FDKQE...T..VE
C5M3L3_CANTT/282-787---------------------------------------------------MGMIFEFN....KDDLNNNGE......LI
R5N958_9BACT/218-739---------------------------------------------------ICVALSW.........SPALS...S..LN
I2EXN5_EMTOG/234-767---------------------------------------------------IGAYINF.........TTQTG...E.VRK
I6NCS8_ERECY/333-848---------------------------------------------------FGVLFEF......DE..SVKV......LK
G8SIR1_ACTS5/251-722---------------------------------------------------TGAYVTF.........DTSSN...A.VVN
C6WHL9_ACTMD/608-1138---------------------------------------------------VAGYLRF.......D.TSAEK...T..VT
A4APL9_MARSH/550-1058---------------------------------------------------VVAFLEF.........DTKKN...Q.VVQ
B8MZQ6_ASPFN/286-776---------------------------------------------------VGALFSWD.....DV.EE.SQ......IR
G0G342_AMYMS/281-764---------------------------------------------------SGAYLTF.........DP..A...K.PVQ
G4MT72_MAGO7/274-775---------------------------------------------------LGAVFTFD.....AA.....N......VV
F2KXB7_PREDF/250-737---------------------------------------------------IAAFVSF.........GNRKD...R.PVK
I3YNN2_ALIFI/250-754---------------------------------------------------.VAKVHF......PT.RR.GQ...Q..VC
R6F8M5_9BACT/250-741---------------------------------------------------..LVATF.......D.IPRGE...Q..LL
R5AYY0_9BACE/227-720---------------------------------------------------..AWCYF.......N.TAPDE...K..IV
K5X7A2_PHACS/167-651---------------------------------------------------VAGYVKFK.....ED.V...T...T..VD
R5CB12_9BACE/289-781---------------------------------------------------VVAYFNF.......D.TDRQS...E..LV
Q0CPM5_ASPTN/206-716---------------------------------------------------.GGFLRVQR...PDS....GT......VT
G7DU14_MIXOS/248-766---------------------------------------------------SGALLELD....TSA.....Q......HS
R6YT08_9BACE/232-737---------------------------------------------------TGAVIGF......KT.AK.GE...K..VH
R7DGG5_9PORP/274-762---------------------------------------------------MGAYVEFA.....TA.N..KE...Q..VL
U5W074_9ACTO/231-753---------------------------------------------------.GGWVTF.........DTTGD...R.DVV
Q7S947_NEUCR/260-768---------------------------------------------------.GAFVRFK....SGA....KP......IL
A4VXP8_STRSY/213-704---------------------------------------------------.HLRINF............SS...T.SIK
R6XE16_9PORP/263-758---------------------------------------------------LMACLSF.......A.TGEGE...E..VI
D2PP99_KRIFD/282-783---------------------------------------------------SGGYVTF.........APGA....K..VR
Q099T5_STIAD/275-768---------------------------------------------------LVGVFDF.......G.ELKNQ...E..LL
Q02D57_SOLUE/234-723---------------------------------------------------RGAFAEF.......R.P..GE...L..VE
G8NVQ7_GRAMM/264-754---------------------------------------------------LGAYVTL.......A.NNTPQ...S..VI
U1HIK3_ENDPU/219-713---------------------------------------------------VGAVFSFD.....QA.....S......IT
R6WZ31_9PORP/235-740---------------------------------------------------TGAIVGF......ST.RK.GE...I..VH
R6YV68_9BACE/251-749---------------------------------------------------IKALLSF.......E.NECGE......LT
G8T7Y9_NIAKG/241-748---------------------------------------------------MGAFANF.........KTKQN...D.VLL
Q094Q3_STIAD/646-1181---------------------------------------------------VTGYFRF.......TVPAADR...T..VT
F4C7I4_SPHS2/291-772---------------------------------------------------IGFYTTF.......A.TEDQE...Q..VF
F0R7B2_BACSH/258-751---------------------------------------------------IGVYVQF.......A.VTEGE...T..LL
R6W152_9BACT/268-760---------------------------------------------------VVTYFNF.......D.NTDRK...P..IT
R7JIS0_9PORP/257-745---------------------------------------------------VGVWFKY.......D.VAEQE...Q..IE
N1PC12_MYCP1/320-862---------------------------------------------------IGALFSWTR..SGSNSSEESV......IE
R5PNA6_9BACT/250-744---------------------------------------------------.MFTATF.......S.TDADE...V..VT
Q8A0E8_BACTN/291-771---------------------------------------------------LGFFTEF.......P.TKEGE...Q..VE
C7PPX9_CHIPD/272-766---------------------------------------------------IRAWFDF.......K.VQAGE...K..IK
C6XXW8_PEDHD/280-772---------------------------------------------------IRMYFDF.......E.TAEGE...Q..VQ
R6X226_9PORP/237-732---------------------------------------------------.RLILEF.......D.TKPGE...A..VQ
I3YTY7_AEQSU/235-721---------------------------------------------------VKAAFEF.......D.PSVGN...E..LE
C7PXX1_CATAD/359-847---------------------------------------------------.GLYLTF.........DTSSD...Q.VVQ
R6SWH3_9BACE/254-776---------------------------------------------------..MCLNY.........KTKKD...E.IVN
R4LBG1_9ACTO/593-1121---------------------------------------------------..TSATF.......D.LTAGP...T..VT
R5NWJ1_9BACT/290-770---------------------------------------------------LGFYTEF.......P.TREGE...Q..VL
E4RQ41_LEAB4/240-734---------------------------------------------------MKGVIYF.......P.SKLKE......VK
J3P516_GAGT3/275-793---------------------------------------------------AGAIVRFG....ATN....GT......VV
Y584_MYCTU/255-752---------------------------------------------------SGGYVGF.........PAGSV......LE
K5VRS2_PHACS/284-803---------------------------------------------------SGALVSFQ....GTP....ET......IT
H8KS39_SOLCM/263-757---------------------------------------------------LRAYFDF.......K.TEEGE...K..IK
G4N8Y8_MAGO7/274-773---------------------------------------------------MGAVFTFN.....DA.....Q......VI
G0RA48_HYPJQ/257-757---------------------------------------------------LGAVFSFW.....KS.....S......VT
R6VZN3_9BACT/252-743---------------------------------------------------TRCFLDF.......G.AS.SE...P..LI
C5BV25_BEUC1/276-762---------------------------------------------------LAAWVRFP.....AG.T...R...R..VV
G2R1P2_THITE/259-768---------------------------------------------------.GAFVRFN....SAA....EP......IL
J3K060_COCIM/256-765---------------------------------------------------AGTFVRFRA...SNS....TK......VS
M4G0K2_MAGP6/264-772---------------------------------------------------.GAFIRFK....SAD....NP......IL
R5JGM2_9BACE/240-745---------------------------------------------------VGAVLGF......RT.SK.GE...K..IG
K5W0L8_PHACS/306-823---------------------------------------------------LGALFTFAP..KTDNSI..TS......IF
F9XNM6_MYCGM/267-780---------------------------------------------------.GSWVRFNA...PKA...SNQ......IL
M2TSE6_COCH5/345-889---------------------------------------------------LGALFSWSP..TEARVNGTLT......LE
A6LCT9_PARD8/267-759---------------------------------------------------.VARFDF.......N.TKKDE...E..IL
B2AN89_PODAN/259-766---------------------------------------------------.GAFVRFS....SGA....EP......IL
F3ZHW0_9ACTO/252-769---------------------------------------------------NGAYVRF.........DTRKD...R.TVE
F9ZBX8_ODOSD/244-733---------------------------------------------------.YLYVDF.......G.QKTNK......IL
R7ECF1_9BACE/246-753---------------------------------------------------AKALLQF.......Q.TEPNE...E..VL
R5IMK2_9PORP/254-746---------------------------------------------------LKAVFDF.......D.TRHNT...T..VM
M1WGU2_CLAP2/273-809---------------------------------------------------.GAWVQFS....PPK...SNR......IK
R7NSX4_9BACE/244-750---------------------------------------------------.KMLLRF.......D.TAEDE...Q..VM
V5GCY0_BYSSN/583-1093---------------------------------------------------VGALFTWD.....DN.TKTSQ......IS
K5Y2M0_AGABU/276-805---------------------------------------------------LGALFTFSP...APSGK..TT......IL
G0G6H4_AMYMS/272-771---------------------------------------------------SGGYVTF.........APGS....T..VT
G0SAP0_CHATD/305-830---------------------------------------------------AGAWVQFE....RPE...GDE......LL
Q7MVX2_PORGI/243-735---------------------------------------------------.VAHLSF.......L.IAKSD...S.TLT
E4RWA0_LEAB4/231-734---------------------------------------------------..GIIGF......ST.KK.GE...K..VH
Q7S6N7_NEUCR/308-906---------------------------------------------------AGAWIQFEK..PDEE..MKDS......IL
R4SVW2_AMYOR/373-889---------------------------------------------------.TGFLEF.......A....AG...E..VT
R5Q370_9BACT/269-761---------------------------------------------------IVAYFNF.......D.NSDSQ...P..LV
L0G543_ECHVK/239-745---------------------------------------------------AGAVIGF......KT.TK.GE...I..VN
R6K435_9BACE/400-908---------------------------------------------------....AHY.........RVKTG...D.KIC
F9YRP8_CAPCC/247-731---------------------------------------------------....LLF.......P.TASDE...K..IV
H8KZE1_FRAAD/289-783---------------------------------------------------LKCALHF.......S.TRRGE...T..IL
A6LGS3_PARD8/218-705---------------------------------------------------.QAVLTF.......D.TTTGK...P..II
R6MPC3_9BACE/256-780---------------------------------------------------AMMVLNY.........KTSKD...Q.VVD
F3ZTR3_9BACE/259-744---------------------------------------------------......F.......E.TEENE...D..IY
Q8A5X5_BACTN/527-1034---------------------------------------------------FGCYAEF.........DTTDH...P.EVM
C7PBJ2_CHIPD/232-713---------------------------------------------------...IVHL.......A.DGNKG...P..VE
G8BG81_CANPC/252-744---------------------------------------------------FGLIFNF.......G..QDQE......VV
R6XA16_9BACT/216-719---------------------------------------------------..AMVGF......KT.VK.GQ...K..VN
B5RUQ1_DEBHA/241-738---------------------------------------------------VGIVFTF......PS..NQAI......IR
Q7MVS0_PORGI/267-769---------------------------------------------------IGVRFSF.......N.CDQGE...K..IY
R5VNB2_9PORP/255-750---------------------------------------------------LKVWMKF.......K.TETGE...K..VY
D3Q7H1_STANL/255-731---------------------------------------------------TGAYVEF..........GDGG...P.QVN
R5INP1_9PORP/202-720---------------------------------------------------..LIMQF.........KTSDR...E..IK
R5KVZ5_9FIRM/664-1196---------------------------------------------------..SIASF.......N....SN...T..VT
C7M5H0_CAPOD/267-754---------------------------------------------------...QIFF.......D.N.TDE...K..LE
D5BAG1_ZUNPS/253-742---------------------------------------------------TAAQLFF.......D.KKDK....K..LQ
V6KI06_STRNV/537-1069---------------------------------------------------VTGFVRL.......D.AGQDR...T..VN
R7DME3_9PORP/241-728---------------------------------------------------.VARFDF.......G.TKEGE...Q..IL
R0K5A1_SETT2/223-738---------------------------------------------------VGAVFTWK.....NA....TK......VK
F8PWD0_SERL3/284-804---------------------------------------------------SGALFSYD....GTP....EQ......VN
B2FPN6_STRMK/265-795---------------------------------------------------NGAWLSF.........DLAKG...Q.SVT
A3UBV0_CROAH/234-720---------------------------------------------------TKAALKF.......H.NPKNE...P..IY
G8TLM2_NIAKG/236-741---------------------------------------------------TGGIVGF......KT.KK.GE...Q..VH
M2TDD4_COCSN/270-780---------------------------------------------------SGGWVQFEK...PTQ...NKQ......ML
J3NHS8_GAGT3/309-828---------------------------------------------------AGAWVQFEA..PPSG...QAS......LM
G0RBQ3_HYPJQ/263-768---------------------------------------------------VGAYVTFD.....KS.V...Q...R..VE
G9NTU6_HYPAI/281-780---------------------------------------------------VGAVFKFP.....SK...TTV......VK
R6FR09_9BACT/237-726---------------------------------------------------..ARFKF.......A.TEGFD...K..LV
C7MEN4_BRAFD/398-931---------------------------------------------------.GSVLTF.........APGTQ...Q..VT
L7WBB4_NONDD/240-737---------------------------------------------------..IALEF.......D.NPNNE...P..IT
F3Z5Q3_9ACTO/256-757---------------------------------------------------SGAYLTF.........DTSRE...R.RVT
R5I4F6_9PORP/262-748---------------------------------------------------IGLYFSY.......D.TKPGE...Q..IQ
F9YRT9_CAPCC/241-748---------------------------------------------------VGATLSF......ST.EK.GE...K..VT
S3CDT6_OPHP1/256-782---------------------------------------------------AGAWVQYNG...DES...PPE......VI
A6KWP8_BACV8/596-1123---------------------------------------------------AGMAVRF.........KTEKD...E.KVM
D2QFK0_SPILD/265-758---------------------------------------------------IRMYFDF.......D.TEAGE...K..VK
H5X5L5_9PSEU/410-921---------------------------------------------------.TGYATF.......A....EH...E..VT
B2FTT2_STRMK/524-1061---------------------------------------------------..GYIKF.......D.AGSER...R..VT
E3QZM0_COLGM/294-802---------------------------------------------------.GAFVRFK....SAD....KP......II
F2IHY2_FLUTR/251-731---------------------------------------------------..FLMEF.......P...EGV...K.EIS
K9FZU0_PEND2/316-824---------------------------------------------------TSAYVKFA.....DS.T...S...R..VE
E6SVL4_BACT6/249-757---------------------------------------------------.KLLLNF.......A.TTEGE...Q..VL
C6Y1U7_PEDHD/242-775---------------------------------------------------TGVFLRF.........KTAEN...E.VRK
X5DJ19_9BACT/237-722---------------------------------------------------.....EI.......E.FEGNG...E..LL
E8WYV5_ACISM/241-731---------------------------------------------------.GAYVSF.......D.LKPGE...S..VK
Q9CFH5_LACLA/201-697---------------------------------------------------.SVRLDF.........KAAKQ...V.QI.
R5PZ68_9BACT/295-770---------------------------------------------------IGFFADF.......A.TDEDE...A..VT
R6XF07_9BACT/685-1243---------------------------------------------------SGAWLTF.......K.GKAGK...P..IE
B8MB98_TALSN/252-759---------------------------------------------------AGGFVMFDS...LSS....HT......LY
B6H4A8_PENCW/260-779---------------------------------------------------.GGFVRFEP...APD....NT......VL
F8JXU3_STREN/239-755---------------------------------------------------.GAYVRF.........DTRDG..DR.SVV
C5DCG1_LACTC/310-833---------------------------------------------------MGMLFEF......EK..GTKV......LY
D5ES75_PRER2/226-713---------------------------------------------------...MVLT.......F.EDISK...P..VM
D5BAW8_ZUNPS/238-741---------------------------------------------------IGAYIQF..........KDGQ...K..VQ
A6LCF6_PARD8/219-739---------------------------------------------------.AIALSF.........GEDVK...K..LG
G2QSP3_THITE/219-733---------------------------------------------------AGVWLQFA....PPA...NNS......LL
G8UKZ7_TANFA/282-775---------------------------------------------------LTAYFEF.......D.FSDGR...P..LE
D4Z5J6_SPHJU/281-771---------------------------------------------------LEARLDF.......G.RLHG....P..LE
M3CXH6_SPHMS/263-778---------------------------------------------------AGAWTRFEA...PDN...DGQ......IL
R6EVC1_9BACT/235-740---------------------------------------------------AGAIVGF......KT.KR.GE...Q..LN
R6X327_9BACT/273-769---------------------------------------------------LEAVARF.......K.TGADE...S..IF
D5EX99_PRER2/213-697---------------------------------------------------...TIAF......TD....TL......IN
R7JDH8_9PORP/241-729---------------------------------------------------AVARFDF.......K.TKQNE...E..IL
V6JHL2_STRRC/312-799---------------------------------------------------.GMYLTF.........DTSSH...T.TVR
R6YWL1_9BACE/241-732---------------------------------------------------..IVATF.......Q.VQPGE...A..VQ
I2ERB7_EMTOG/234-739---------------------------------------------------AGSIIRF......KT.KT.NE...Q..IN
A4FBR3_SACEN/259-782---------------------------------------------------.GAWLSF...........GDR...Q..VT
A6LCF7_PARD8/249-739---------------------------------------------------VKGVITF.......K.GDAPT......AL
B6Q8F4_PENMQ/344-845---------------------------------------------------VGSLFTFN.....AS.....T......VT
R7DKN9_9PORP/246-753---------------------------------------------------SKVLLHF.......A.TSEGE...K..VL
D6CYS0_9BACE/214-734---------------------------------------------------VGIALLY.........STDIK...T..IK
A6KYE5_BACV8/244-735---------------------------------------------------.CGLFCF.......D.KKWNN...E..LI
H8KNH9_SOLCM/229-719---------------------------------------------------IKASLIF.......K.TQDNE...Q..VL
G2Y9J9_BOTF4/274-791---------------------------------------------------AGAWTQFK....APA...SNQ......IL
R5VXR7_9BACE/248-736---------------------------------------------------.FARVNF.......A.AGNQE...P..VY
M2Y3U8_MYCP1/263-777---------------------------------------------------.GGFVRLQK...PEN....GK......IQ
S3CZA3_GLAL2/243-743---------------------------------------------------.GGLFTFD.....EG.....A......VL
G8Y985_PICSO/250-747---------------------------------------------------IGLVFSF......PS..GTSK......LR
S3CJ02_OPHP1/289-811---------------------------------------------------.GAFVRFT....SGA....QP......IT
W0ESN6_9PORP/245-752---------------------------------------------------KKALLQF.......A.TTQNE...E..VL
K0KDA2_SACES/297-777---------------------------------------------------SGGYVTF.........AD......P.EVT
T0JX50_COLGC/248-748---------------------------------------------------LGAIFTFE.....DT.....A......VK
U5VS77_9ACTO/287-789---------------------------------------------------SGGWVGF.......DTATGG....D..VR
A8AZ30_STRGC/200-689---------------------------------------------------...VLDF............EQ...G.QLQ
I4WZK2_9GAMM/263-752---------------------------------------------------..GVFDF.......G.KLKQ....P..LE
M9M713_PSEA3/352-877---------------------------------------------------.YAYVRFP.....TD.T...T...K..IR
V6KVF3_STRRC/271-756---------------------------------------------------.DGYVTF.........DTTTH...R.AVQ
C8VGN1_EMENI/270-779---------------------------------------------------AGTFVRFNS...VSA...DDV......IS
X5DYI4_9BACT/236-715---------------------------------------------------..ALVSF.......N.ESDEE......LE
V2WYF3_MONRO/231-745---------------------------------------------------AGGLLSFS.....AS.....T......VT
M2TXV2_COCH5/273-777---------------------------------------------------VGAVFTWK.....GN...QTT......VR
G0L6Z0_ZOBGA/237-763---------------------------------------------------GNYLVFL.........KDGVD...E.VL.
R5BAT3_9BACE/236-724---------------------------------------------------...RASF.......A.TDSAE...Q..VL
G2Y0H1_BOTF4/247-748---------------------------------------------------LGAVFSFN.....TT.....T......VV
Q0UBD4_PHANO/209-719---------------------------------------------------AGGWVQFEK...PKK...NNQ......IL
G8NZ65_GRAMM/261-740---------------------------------------------------IGATFDYTT...KAN....QA......IQ
B8NJS3_ASPFN/263-777---------------------------------------------------.GAFVRFNS...LAD....RT......VL
E4ZUP2_LEPMJ/400-905---------------------------------------------------LGGVFTFS.....KP.....N......IT
E3S9H8_PYRTT/265-772---------------------------------------------------AGGFIRFKG...PLS....GP......IL
I3YTY8_AEQSU/266-760---------------------------------------------------IRAYFNF.......D.TKENE...K..IS
G2WSC5_VERDV/65-568---------------------------------------------------LGAIFAFD.....GT.....D......IT
A1S298_SHEAM/253-759---------------------------------------------------VGAIIGF......KT.QR.GE...Q..VH
H1Y1A2_9SPHI/235-749---------------------------------------------------VKMYIQF.......D.SPGE.......VI
G0RVA4_HYPJQ/267-785---------------------------------------------------.GAFVQFN....KPS...NNQ......IL
C6W5S0_DYAFD/235-740---------------------------------------------------AGAVVGF......KT.KR.GE...Q..VG
Q5KC19_CRYNJ/394-906---------------------------------------------------LAGWVSFE.....EE.A...V...T..VD
V5XU82_ENTMU/202-696---------------------------------------------------...ALYF.........GHIKQ...Q.TI.
I4A2R7_ORNRL/261-747---------------------------------------------------IGGFFSY.......N.FKKPT...Q..LE
D5EV06_PRER2/233-738---------------------------------------------------AGAVVGF......QT.VR.GE...T..VT
R4LP30_9ACTO/285-771---------------------------------------------------TGAWLTF.........KQGAK......VV
E6SVM9_BACT6/263-748---------------------------------------------------IGAYLTF.......N.TEEGE...Q..IE
H1Y8C2_9SPHI/251-741---------------------------------------------------VKGVVSF.......E.TLDGE...K..VY
H2K488_STRHJ/278-785---------------------------------------------------AGGYVRF.........APGD....G.PVN
C5CEA2_KOSOT/244-735---------------------------------------------------VGAYVRY......ST.EE.NE...K..II
G0J3Z4_CYCMS/228-758---------------------------------------------------...IVSF.........GKSKG...K.PLQ
F8EET3_RUNSL/236-741---------------------------------------------------VGAVIGF......KT.KK.GE...E..VH
R6Y942_9BACE/292-766---------------------------------------------------IGFFMEF.......D.TEADE...K..VL
F3ZHF5_9ACTO/291-774---------------------------------------------------AGAWLTF.........ARGAK......VT
R7J4K5_9PORP/107-615---------------------------------------------------AGLFLQF.........DVKQN...P.TVQ
R9P496_PSEHS/343-861---------------------------------------------------..GFVRFP.....ID.T...T...R..VR
R7DDY6_9PORP/212-733---------------------------------------------------ACVALYF.........GDKAQ...V..QK
Q9AAM3_CAUCR/252-730---------------------------------------------------LGAWLTF.......KTTPTKP......LL
A6KYE4_BACV8/284-757---------------------------------------------------LGFYTEF.......S.TREGE...Q..AL
G8UPB2_TANFA/226-731---------------------------------------------------TGAVIGF......RT.EK.GE...I..VH
H1XZC8_9SPHI/276-770---------------------------------------------------IRAYFDF.......S.ASEGE...K..IK
Q0UBG2_PHANO/4-547---------------------------------------------------.GALFSWTP..SDQIANGSLT......LE
J3P1C3_GAGT3/282-816---------------------------------------------------IGALFEFP.....AG...ADV......VQ
Q01W62_SOLUE/249-753---------------------------------------------------VGAYAGF......AT.RA.GE...T..VT
F4C7L7_SPHS2/240-744---------------------------------------------------SGAIIGF......AT.AK.GE...Q..VH
R7DJ79_9PORP/244-733---------------------------------------------------VKANVRF.......A.DDVED......VQ
R6DAV4_9BACE/245-752---------------------------------------------------CKMLLKF.......K.SPKVE...E..VL
S3CIA7_OPHP1/264-768---------------------------------------------------LGAVFTFN.....SS..QV.V......VT
R5F4D5_9BACE/237-740---------------------------------------------------AGGIIGF......ST.HK.GE...Q..IH
A5FF75_FLAJ1/237-767---------------------------------------------------..YLIHF.........DKTKE...Q.VL.
G7XUX9_ASPKW/172-670---------------------------------------------------VGGLFTFK.....DS.....V......VT
R6VFA8_9BACT/232-725---------------------------------------------------...YVEY.......RDLKPGE...R..IG
R6KBU8_9BACE/236-731---------------------------------------------------.RLLLSF.......D.LKPGE...N..VQ
L0G487_ECHVK/265-759---------------------------------------------------IRAYFDF.......D.LEDGE...Q..LI
I3YNN1_ALIFI/244-731---------------------------------------------------..ARVEF.......D.TTDGE...P..LY
D5EXZ8_PRER2/238-721---------------------------------------------------..AVVDF.......LNNKGSR...A..LE
H1XSR1_9BACT/243-734---------------------------------------------------IKAYVKY.......K.TGQSE...A..IL
C6WEC8_ACTMD/275-780---------------------------------------------------SGAYLGF.........EPGS....T..VG
G0FQH4_AMYMS/592-1128---------------------------------------------------VTGYLRF.......D.AGAGK...T..VN
R7JAF0_9PORP/29-519---------------------------------------------------VKGVLTF.......K.DAPKE......VK
Q73SJ7_MYCPA/254-750---------------------------------------------------SGGYVEF.........PAGSV......LE
Q6CNV6_KLULA/306-819---------------------------------------------------IGVLFEF......DE..DTTV......LK
F2UPM6_SALR5/297-792---------------------------------------------------VGAILQF.......D.........NPDIE
H1Y718_9SPHI/236-741---------------------------------------------------AGAVIGF......KT.HQ.GE...Q..VH
G0FQH3_AMYMS/368-895---------------------------------------------------VSGYFEF.......D....GP...D..VT
F9D249_PREDD/223-709---------------------------------------------------....TIQ.......V.EDDGK...P..LL
G8NVG8_GRAMM/262-757---------------------------------------------------IQAVLHY.......K.TSAQE...Q..IL
Q023I7_SOLUE/230-716---------------------------------------------------SGVHLTF.........DTSAN...S.TVR
C4JL73_UNCRE/255-765---------------------------------------------------AGAFVRFMP...ANR....TT......IS
A3HZJ9_9BACT/231-714---------------------------------------------------..AVLSL.......S.DQDAG...V..VT
F4C4J4_SPHS2/528-1036---------------------------------------------------AGMFVEF.........DLRKK...H.TVQ
R6D9S0_9BACE/252-747---------------------------------------------------LMAYVSF.......A.TNDGE...A..VT
M2LV24_BAUCO/278-789---------------------------------------------------VGALFTWS.....NA.SV.ST......IK
G8T7Z2_NIAKG/252-774---------------------------------------------------AGLYLTF.........TTSEQ...E.AIT
H1Y4F6_9SPHI/255-746---------------------------------------------------LKAALNF.......S.TTDKE...Q..VL
J4WIX0_BEAB2/266-765---------------------------------------------------VGALFAFN.....QT.....V......VV
G8UK11_TANFA/264-748---------------------------------------------------.....FF.......E.TEDNE...T..VY
H8KS37_SOLCM/238-743---------------------------------------------------VGAVIGF......KT.QK.GE...K..VN
R6VYQ1_9BACT/263-758---------------------------------------------------LKFWVRF.......A.TREEE...Q..VT
Q15ZN9_PSEA6/254-740---------------------------------------------------.EFDFDF.......SEVSSQ....K.LVT
V5FJJ3_BYSSN/325-822---------------------------------------------------VGSLFTFN.....SP.....Q......VV
R6B5C9_9BACT/676-1194---------------------------------------------------IGAWLTF.......K.GQAEK...S..ME
R6W673_9BACT/246-752---------------------------------------------------AVAKVHF......TT.AR.GE...Q..VN
F3ZH20_9ACTO/292-800---------------------------------------------------SGAYVTF.........PKGT....T.EVG
R6TFX8_9BACE/274-766---------------------------------------------------IVAYFEF.......D.TSDGN...E..LE
N1QGM3_SPHMS/250-760---------------------------------------------------.GAFIRFQ.....DS....SP......VT
S7ZPF5_PENO1/271-784---------------------------------------------------...FIRHEA...AAD....RI......VQ
R6WV75_9BACT/208-715---------------------------------------------------TGAYALF.........TTTEG...E.RIT
Q5LHE9_BACFN/239-732---------------------------------------------------.IARFDF.......D.TQKGE...Q..IL
G4MXA7_MAGO7/248-765---------------------------------------------------AGAWVQFE....APE...DNQ......IL
Q1ASW2_RUBXD/611-1156---------------------------------------------------.TAWARF.......E.AGSDR...S..VT
C7QF41_CATAD/255-741---------------------------------------------------..VFLNF.........NTSSN...Q.TVQ
G9NFV5_HYPAI/276-779---------------------------------------------------VGGYVKFN.....KS.V...Q...R..VE
G8NT21_GRAMM/264-755---------------------------------------------------.GAYLDL.......T.TTAGE...Q..VL
G0FZ68_AMYMS/242-765---------------------------------------------------NGAWASF.........DATTD...H.DVV
I3YPK4_ALIFI/224-709---------------------------------------------------.QAVLTF.........APDVR...T..LT
D5BFU1_ZUNPS/296-790---------------------------------------------------IRMYFNF.......D.LEPQE...K..LK
R5IIM1_9PORP/216-736---------------------------------------------------.SIVFRF.........APDQR...K..VK
R6FB01_9BACE/260-753---------------------------------------------------IGAYVEF.......D.VNEGE...N..LL
S3BSV4_OPHP1/319-858---------------------------------------------------AGAWLQFAP..PSASEEKDYS......ID
M3A5V7_MYCFI/262-774---------------------------------------------------.GAIFSWAD..ASYSNST.TT......VK
B8LV53_TALSN/263-772---------------------------------------------------.GAWVRFKP...ETD....ST......VL
R5W4N0_9BACE/262-755---------------------------------------------------IGIYIGF.......H.VENNE...Q..IL
R6W0P6_9BACT/237-741---------------------------------------------------AGAIIGF......KT.RK.GE...V..VN
R6KAU3_9BACE/264-757---------------------------------------------------IGAYVEF.......D.VTEGE...E..VL
E8V399_TERSS/271-762---------------------------------------------------..THLTF.........KD.GV...T.ALD
G8NZ99_GRAMM/263-758---------------------------------------------------LKAVLYF.......K.TKANE...A..IL
R6W2H2_9BACT/221-709---------------------------------------------------..IAVLE.......L.ADATR...P..VL
F9XJZ4_MYCGM/258-769---------------------------------------------------.GAFVRFT.....SG....SS......IT
C4LZ28_ENTHI/211-703---------------------------------------------------.QCYIKL.................NTTTE
B0T313_CAUSK/265-756---------------------------------------------------.VGVFDF.......G.TIDG....P..LV
C6WE78_ACTMD/245-762---------------------------------------------------NGAYATF.........DTTAD...R.DVV
W8EZC7_9BACT/260-749---------------------------------------------------IKGVLTF.......A.TRAGE...R..VQ
M4FLW6_MAGP6/252-753---------------------------------------------------LGAVFTFD.....AA.....A......VS
R5IJ85_9BACT/268-765---------------------------------------------------IAAWFGF.......D.PSEGR...E..LE
F0RGV6_CELLC/241-746---------------------------------------------------VGAAISF......ST.KD.GE...Q..VT
M4FSD6_MAGP6/258-774---------------------------------------------------AGAWVQFQ....APA...NDQ......IL
F8JNS7_STREN/258-772---------------------------------------------------.GGYVRF.........DTRAD...K.VVT
A5FGD3_FLAJ1/249-739---------------------------------------------------IKAVLDF.......K.TLKNK...Q..IL
B6QUE6_PENMQ/228-737---------------------------------------------------IGALFGWG.....NDTTAPRN......II
G2Z075_FLABF/223-715---------------------------------------------------..YHLDF.......D.LAKNK...L..LN
D5BJC2_ZUNPS/202-723---------------------------------------------------ASIVLSF.........SKSQS...N..LE
A5FF74_FLAJ1/244-744---------------------------------------------------TGALLSFGN...SGK....EE......LN
Q4WT26_ASPFU/261-770---------------------------------------------------.GAFVRFKA...ASD....IT......VQ
Q7MU52_PORGI/214-733---------------------------------------------------..LVLNY.........DLAGT...D..LF
M4FWH0_MAGP6/251-753---------------------------------------------------LGAVFTFA.....DS.....A......VS
R6Y700_9BACE/243-734---------------------------------------------------..AQFNF.......D.TQAGD...Q..LV
K5WLA8_AGABU/293-799---------------------------------------------------LGAYVLFAR..PKNQ.P...I...S..FT
R5NRY2_9PORP/243-733---------------------------------------------------CYAWIDF.......G.CKTDK......IL
U5VWY0_9ACTO/411-919---------------------------------------------------ATSWIRF.......A.TTANE...Q..VT
Q8A5Y1_BACTN/523-1040---------------------------------------------------AGIFLDF.........NLNTG...D.DVM
R6ZR28_9BACE/240-724---------------------------------------------------LLAVASF..........GEKK...T..VL
F3ZIF3_9ACTO/644-1176---------------------------------------------------VKGYLRF.......D.AGRDR...T..VT
I3ZK24_TERRK/241-733---------------------------------------------------AGAYVSF.......D.LAGSR...D..VV
F4C4M8_SPHS2/233-715---------------------------------------------------..ALVHL.......T.NESKA...P..VE
D5QF63_KOMHA/270-761---------------------------------------------------VEAVFDF.......G.TLST....P..LG
A6LGN6_PARD8/237-739---------------------------------------------------IGAYVQF..........AKGS...K..VQ
R5PMC5_9BACT/642-1143---------------------------------------------------.VAWLTF.......R.GKTDV...P..ME
R6Y5H0_9PORP/264-755---------------------------------------------------VVSYFEF.......K..EGSA...P..LE
W5W8J6_9PSEU/284-764---------------------------------------------------SGAYLTF.........AQ..D...R.PVN
R5PXP4_9BACT/242-747---------------------------------------------------SGAIVGF......KT.KR.GE...Q..VN
R5F602_9BACE/359-848---------------------------------------------------TGAYFGFHT...TEG....QK......VR
R5UUU5_9PORP/265-757---------------------------------------------------VVAYFDF.......D.LKEGE...A..LE
M3B4L8_MYCFI/275-789---------------------------------------------------AGAWARFKA...PKS...NNQ......IL
W5WHY7_9PSEU/271-765---------------------------------------------------SGGYVSF.........APGS....R..VS
I3ZB09_TERRK/256-750---------------------------------------------------LKAVLYF.......D.TKANE...T..IL
R6LH54_9BACE/268-773---------------------------------------------------AGAIIGF......AT.RK.GE...K..VC
T0K2G4_COLGC/277-787---------------------------------------------------IGGIFSFP.....ST...VST......LT
A6LEE3_PARD8/400-911---------------------------------------------------....CFG.........SFKAG...D.ELL
M7UMW1_BOTF1/288-793---------------------------------------------------AGGFVRFQA...QTN....GT......IS
M3AXL3_MYCFI/139-646---------------------------------------------------AGAFVRFRK...PTN....GV......IQ
E3QRS6_COLGM/296-810---------------------------------------------------AGAWLHFE....RPK...NHQ......IL
W5W3K0_9PSEU/251-733---------------------------------------------------..EYLTF.........DTTGN...Q.VVQ
F9YQE4_CAPCC/260-746---------------------------------------------------IGTYFRY.......K.FEKPE...M..VE
B6HMT5_PENCW/256-764---------------------------------------------------AGGYMIFDR...PYN....GI......VT
C1F7W7_ACIC5/298-792---------------------------------------------------VQ.AIFT.......Q.ADSAD...A..LV
W5W9Q6_9PSEU/246-769---------------------------------------------------NGAWVTF.........DATTQ...R.SVT
F5HDD2_PORGI/251-753---------------------------------------------------AWAACRF..........D.SQ...E..VT
G9MLE1_HYPVG/265-784---------------------------------------------------AGAWAQFH....PPA...NNQ......IL
G0G0P7_AMYMS/232-748---------------------------------------------------TGAWLTF.........GTDSN...Q..VG
R5C0J2_9BACE/249-739---------------------------------------------------VKGVLTF.......K.NNPKN......VQ
E3QRP8_COLGM/246-753---------------------------------------------------.GGFVRFK....ELT...NNT......VT

PF13229

A4HFK4_LEIBR/1122-1276---------------------------------------------------ANI....LLDHFDGAT....HETT.....
A4RWC7_OSTLU/255-410---------------------------------------------------EAI....RIKGDSRV......NAL.....
C1MV84_MICPC/432-587---------------------------------------------------QAI....HVEGGDAV......DAL.....
A0B575_METTP/145-292---------------------------------------------------YGI....RLNGSAI...............
B1LZG7_METRJ/126-306---------------------------------------------------SGF....IIRRGSS.......HVT.....
B8IPB3_METNO/205-368---------------------------------------------------YGA....VQAAAGR.......NWQ.....
Q1IR31_KORVE/209-372---------------------------------------------------GAI....GGDRSGS.......GWT.....
Q1IJK3_KORVE/204-367---------------------------------------------------GAIGGPNGKAEHWY...............
D2PZ24_KRIFD/241-418---------------------------------------------------GGA....VEVGVDW.........R.....
D2PZ28_KRIFD/298-476---------------------------------------------------AGA....VVLSTGW.........K.....
D1CII1_THET1/254-430---------------------------------------------------DGL...GAIANNSHS......WWT.....
Q5KIH2_CRYNJ/125-330---------------------------------------------------ALI....EIGNSES........QT.....
A2DQI5_TRIVA/133-313---------------------------------------------------IGI....LMTGNDN.........M.....
A2GN59_TRIVA/178-358---------------------------------------------------VGI....YILGDNN.........T.....
A2DSW4_TRIVA/295-476---------------------------------------------------NAI....TFSSCND........FT.....
D2VXU7_NAEGR/1914-2119---------------------------------------------------YGL....MIDSSDV.........T.....
D3E003_METRM/246-408---------------------------------------------------SFV....EASDVSD........IS.....
D2VGY1_NAEGR/119-306---------------------------------------------------VGI....AMNDGNAIY....QNNT.....
A5UJV8_METS3/96-251---------------------------------------------------STV....YTSGELS...............
D7DS12_METV3/546-725---------------------------------------------------LGI....FTHGKSN........TN.....
D7DT96_METV3/87-251---------------------------------------------------RII....YVNGQYA...............
A5UN24_METS3/1015-1205---------------------------------------------------SGI....VVNNVKN........TV.....
D3DZT1_METRM/1034-1216---------------------------------------------------YGI....ILNNTKE........AV.....
A5UNL3_METS3/391-540---------------------------------------------------EGI....RVAENNV.........S.....
Q2NFB2_METST/846-1038---------------------------------------------------TGF....IAGLNSI.......NTT.....
A5UN26_METS3/210-367---------------------------------------------------SPVFTIESSKAAGT...............
Q11PH9_CYTH3/3751-3918---------------------------------------------------TGI....NIKTTGFI......YGT.....
A2DZP5_TRIVA/237-393---------------------------------------------------SSI....SIINQFV.......PIK.....
A2EWG4_TRIVA/238-392---------------------------------------------------SAI....SCAASKI.........E.....
Q2K708_RHIEC/156-330---------------------------------------------------DGF....WIEKVEG........VK.....
C6X284_FLAB3/105-267---------------------------------------------------GAI....RLYDSHF........SV.....
B7GKQ0_ANOFW/105-265---------------------------------------------------AGV....LIQKSSH........VT.....
A5UM93_METS3/570-727---------------------------------------------------WGV....NVVDTNQ........VM.....
B1Y807_LEPCP/135-286---------------------------------------------------NGV....QLYNTQG........AR.....
C4ZN21_THASP/165-316---------------------------------------------------NGI....QLYNTQR........AR.....
Q5NZ04_AROAE/165-316---------------------------------------------------NGI....QLYNTTG........AK.....
A7ZFW4_CAMC1/149-307---------------------------------------------------DAV....RLWYSHE........NL.....
D4H675_DENA2/149-307---------------------------------------------------DGI....RLWYSHL.........N.....
A2F6G3_TRIVA/566-720---------------------------------------------------GGV....ILEEGCH........LS.....
B2A266_NATTJ/667-827---------------------------------------------------GGI....LIDGSEA.........M.....
D3DZT1_METRM/180-349---------------------------------------------------HGIFYISPEASGTV...............
Q21PK3_SACD2/316-486---------------------------------------------------SGV...SSFYGNAT...............
A8ZSU8_DESOH/610-786---------------------------------------------------TGA....RIKEVSV.........S.....
Q01V78_SOLUE/318-510---------------------------------------------------YAI....WFGRGSK.......RNQ.....
B4NKK3_DROWI/907-1062---------------------------------------------------SGV....QIRTGSN........PV.....
Q1RQ01_CIOIN/615-770---------------------------------------------------SGV....QIRTGSN........PV.....
Q1RQ01_CIOIN/338-494---------------------------------------------------SAV....SCAGEGA.......NPT.....
A8LUC6_DINSH/146-309---------------------------------------------------DAV....YLRNASD........VL.....
A9WDN6_CHLAA/503-681---------------------------------------------------AAV....LIEPCAS.......GCS.....
Q0W3D6_UNCMA/107-264---------------------------------------------------SAI....LVESSDN.........E.....
D2RS85_HALTV/217-421---------------------------------------------------MAI....SFSRCTN........VQ.....
A9B4J4_HERA2/210-386---------------------------------------------------RGV....VTLGESN........QTLGFVI
D3F6E1_CONWI/144-334---------------------------------------------------NGV....VWYTDGE........YA.....
Q4E3J7_TRYCC/564-717---------------------------------------------------HGV....VVDGEES.......NAV.....
Q8ZXB6_PYRAE/124-281---------------------------------------------------LGI....YIYNSSD........VL.....
B5IFT4_ACIB4/648-827---------------------------------------------------AKI....FGWPGNG........SEDNPYI
Y1396_METJA/2174-2323---------------------------------------------------EGV....YSKNSTL.........E.....
A8XCU4_CAEBR/377-555---------------------------------------------------LGI....FINTDQQ........IN.....
A8XCU4_CAEBR/835-1021---------------------------------------------------SGI...DFMTPTGN........IE.....
B8GIH1_METPE/210-388---------------------------------------------------HGF....NMNANRSTMQ.DGTRVGSGSYA
Q6LZ14_METMP/541-702---------------------------------------------------AGI....LSFQNSN........AD.....
B8GKS8_METPE/88-248---------------------------------------------------TGI....VVNPEGESPTVQLSNVT.....
B1L3G7_KORCO/159-312---------------------------------------------------AGV....NFESSVA........CS.....
Q8TR94_METAC/114-266---------------------------------------------------SGI....YLDNATY........CQ.....
Q12Y38_METBU/125-275---------------------------------------------------PGI....YLDGAHN........SV.....
Q12Z43_METBU/104-256---------------------------------------------------SGI....YLDEVVN........AF.....
Q8TLY7_METAC/117-269---------------------------------------------------AGV....YLVRSGN........CI.....
Q8TQN2_METAC/592-749---------------------------------------------------AGI....FYIGSGG.........I.....
Q8THN3_METAC/410-561---------------------------------------------------VGL....LLLGAGN........CT.....
Q8TMY7_METAC/1017-1166---------------------------------------------------CGI....YLENTRE........AR.....
D2VGW6_NAEGR/142-294---------------------------------------------------NTI....LFNNINI...............
A2DG23_TRIVA/257-412---------------------------------------------------DGI....LLSGASV........AK.....
Q4E3J7_TRYCC/767-933---------------------------------------------------FGV....VVNGPSA.......SVT.....
A2EXK6_TRIVA/265-421---------------------------------------------------NII....IMTQQAQ........AV.....
A4X252_SALTO/119-272---------------------------------------------------PAI....SVADRSE........FT.....
B8GHS2_METPE/296-452---------------------------------------------------EGI....HVGMVSD.........S.....
A2DG23_TRIVA/493-649---------------------------------------------------SGI....QLLCCSG.......EVK.....
A2E713_TRIVA/471-626---------------------------------------------------SGL....EINGVQT.......GFS.....
A2DGW8_TRIVA/182-337---------------------------------------------------RGL....NLRSATT........AF.....
A2FYC7_TRIVA/339-494---------------------------------------------------NGL....IVKARAA........TT.....
A2FPW6_TRIVA/308-481---------------------------------------------------SCV....LVKKDSE........VS.....
Q5WHY7_BACSK/106-258---------------------------------------------------WGI....HVLEDGH........LD.....
A2DIY9_TRIVA/83-240---------------------------------------------------GGI....CTNTASY........IT.....
A2EAN8_TRIVA/175-332---------------------------------------------------CGI....LCTDSAQ........LK.....
A2ENP8_TRIVA/245-395---------------------------------------------------SGV....HAQFNCK........TQ.....
A2GD34_TRIVA/590-746---------------------------------------------------VGL....ELTNVKD........VK.....
A2DQW2_TRIVA/362-515---------------------------------------------------SAV....DISGSSG........VF.....
A2FHX0_TRIVA/618-765---------------------------------------------------THI....NHKNNQM..............H
A2ERI6_TRIVA/309-462---------------------------------------------------AGI....AIDNVFG........FT.....
B1HXQ4_LYSSC/149-305---------------------------------------------------AQI....IAQNCEM.........T.....
A2ELJ5_TRIVA/1001-1152---------------------------------------------------NAV....IVDHGES.........T.....
A2ENP8_TRIVA/80-239---------------------------------------------------QGL...VHCTGEGT........LI.....
D3BJ88_POLPA/671-831---------------------------------------------------GGV....WATQTSL.........T.....
A2EXP7_TRIVA/122-276---------------------------------------------------SAL....LVRDRSK........TE.....
A2FHX0_TRIVA/309-464---------------------------------------------------PCV....FVNAQSS........IL.....
A2EYD0_TRIVA/230-382---------------------------------------------------TSL....FINDSNL.........E.....
A9V8X4_MONBE/130-296---------------------------------------------------LGV....LVEGSRH.........N.....
C3Y624_BRAFL/300-474---------------------------------------------------PGV.......GGERC......TIK.....
C8W2D1_DESAS/138-297---------------------------------------------------FGI....GLWGQNT.......HVK.....
D3TBL1_ACIB4/958-1108---------------------------------------------------SGI....ELWYSSN.........N.....
G1LPY2_AILME/2243-2418---------------------------------------------------.GL....SMSRTMG........LK.....
PLYL_DICD3/133-313---------------------------------------------------YGF....YVTGDYW.........Y.....
Q251J0_DESHY/90-272---------------------------------------------------..V....SIKGDGV.........T.....
Q2K908_RHIEC/104-274---------------------------------------------------DGI....EANNVHH........VQ.....
R6P1V8_9CLOT/1010-1182---------------------------------------------------..I....EAASNYN.........Y.....

PF01696

Q9W859_ADEP3/86-474---------------------------------------------------GGA----GGEGS........GEEAGGSSM
E1BL_ADECT/56-441---------------------------------------------------DPL----YVMQA....LQRDHTLEMPRGQ
Q64892_ADEM1/37-434---------------------------------------------------SGA----RELSL....RVNEEVTEPPYNS
Q3ZKW1_9ADEN/107-489---------------------------------------------------SGN----NSRTE....LALSLMSRRRPET
Q5GFC6_ADE04/98-480---------------------------------------------------DET----NHRIE....LTVGLMSRKRPET
Q9EEG1_ADEB2/14-388---------------------------------------------------SGA----SVRVQRGFHLPFARGNGLEPNK
Q64844_ADEB3/35-420---------------------------------------------------GDS----PPRAS....LEEAEQSSTRFEH
A0MK44_9ADEN/90-471---------------------------------------------------EPR----NFLNE....LTVSLMNRQRPET
E1BL_ADET1/2-390---------------------------------------------------AQN----NSDGV....EGASPAKRRRLDQ
E1BL_ADE12/96-479---------------------------------------------------KEA----AVLSR....LTVNLMSRPRLET
E1U5L8_ADE06/110-492---------------------------------------------------EAT----EEARN....LTFSLMTRHRPEC
Q695T4_9ADEN/122-506---------------------------------------------------ESS----TFLAD....VTVALMAKNRLEV
E1BL_ADE40/96-475---------------------------------------------------EGE----DFLKE....LTLSLMSRRHHES
Q9YL98_ADE09/110-492---------------------------------------------------GNT----GMMTE....LTASLMNRKRPER
Q83459_ADEP4/28-410---------------------------------------------------SLR----VIEDE....LGEMERLGRQSQR

PF12218

ENAN_BPK1E/39-102----------------------------------------------------------AKGDGKT---------------
Q858B1_BPK1F/246-312----------------------------------------------------------AKGDGVT---------------
A5VW57_9CAUD/146-212----------------------------------------------------------AIGDGVH---------------
A1AE04_ECOK1/205-271----------------------------------------------------------AVGDGIN---------------
O80102_9VIRU/167-233----------------------------------------------------------AVGDGVT---------------

PF03211

U4KZB8_PYROM/36-231----------------------------------------------------------------T---------------
N4URI8_COLOR/120-318----------------------------------------------------------------Q---------------
G2YGI6_BOTF4/126-326----------------------------------------------------------------G---------------
M7SI60_EUTLA/18-215----------------------------------------------------------------T---------------
U5W5Z4_9ACTO/38-237----------------------------------------------------------------A---------------
G2YHG4_BOTF4/24-226----------------------------------------------------------------T---------------
K1XD07_MARBU/185-384----------------------------------------------------------------.---------------
M5BPL9_THACB/50-249----------------------------------------------------------------T---------------
C7YTS6_NECH7/7-209----------------------------------------------------------------T---------------
M7SJD8_EUTLA/23-220----------------------------------------------------------------E---------------
T0M282_COLGC/23-218----------------------------------------------------------------.---------------
N4VGC5_COLOR/253-453----------------------------------------------------------------V---------------
M5BUQ1_THACB/42-237----------------------------------------------------------------.---------------
G4N3X4_MAGO7/18-215----------------------------------------------------------------T---------------
B5I637_9ACTO/39-241----------------------------------------------------------------.---------------
G2XEV0_VERDV/54-253----------------------------------------------------------------N---------------
G2QG74_THIHA/26-225----------------------------------------------------------------T---------------
Q829M8_STRAW/47-250----------------------------------------------------------------A---------------
A8NTC3_COPC7/28-228----------------------------------------------------------------T---------------
C6WMH9_ACTMD/38-241----------------------------------------------------------------.---------------
G8S809_ACTS5/262-462----------------------------------------------------------------S---------------
F9X162_MYCGM/31-229----------------------------------------------------------------G---------------
G0S9D6_CHATD/128-328----------------------------------------------------------------T---------------
I1RLQ0_GIBZE/23-220----------------------------------------------------------------T---------------
V2XPM5_MONRO/28-226----------------------------------------------------------------.---------------
K2RXU6_MACPH/35-230----------------------------------------------------------------T---------------
L2FCH6_COLGN/26-225----------------------------------------------------------------.---------------
N4V6F8_COLOR/112-311----------------------------------------------------------------T---------------
E3EDF5_PAEPS/30-221----------------------------------------------------------------.---------------
S8AHU9_DACHA/114-312----------------------------------------------------------------.---------------
C7ZI42_NECH7/20-217----------------------------------------------------------------T---------------
H3GY48_PHYRM/27-237----------------------------------------------------------------.---------------
U4LBE6_PYROM/18-216----------------------------------------------------------------T---------------
Q6D881_PECAS/102-322----------------------------------------------------------------S---------------
Q7C4I5_PSESM/215-419----------------------------------------------------------------A---------------
N4VEF5_COLOR/166-363----------------------------------------------------------------T---------------
K2RMN8_MACPH/74-272----------------------------------------------------------------A---------------
Q2H8P5_CHAGB/58-258----------------------------------------------------------------T---------------
PLYF_ASPTN/22-224----------------------------------------------------------------E---------------
PLYC_BACSU/18-214----------------------------------------------------------------S---------------
PLYE_ASPFN/39-234----------------------------------------------------------------.---------------
C7YXY0_NECH7/23-222----------------------------------------------------------------T---------------
PLYG_ASPTN/27-222----------------------------------------------------------------.---------------
B3PKE5_CELJU/106-320----------------------------------------------------------------S---------------
T0K0R1_COLGC/25-223----------------------------------------------------------------E---------------
F2R0Z1_STRVP/47-250----------------------------------------------------------------L---------------
H3H676_PHYRM/399-600----------------------------------------------------------------.---------------
D8PQN8_SCHCM/23-225----------------------------------------------------------------N---------------
PLYD_ASPFU/22-218----------------------------------------------------------------.---------------
C9SJ36_VERA1/19-214----------------------------------------------------------------T---------------
M5C0K5_THACB/40-238----------------------------------------------------------------S---------------
N1RGU5_FUSC4/156-353----------------------------------------------------------------T---------------
Q2HHN7_CHAGB/24-222----------------------------------------------------------------Q---------------
I0HH67_ACTM4/194-394----------------------------------------------------------------T---------------
N1QBX5_MYCFI/2-198----------------------------------------------------------------.---------------
I0H512_ACTM4/182-378----------------------------------------------------------------.---------------
C6WMH1_ACTMD/31-234----------------------------------------------------------------G---------------
PLYD_EMENI/42-239----------------------------------------------------------------.---------------
Q7S4B7_NEUCR/27-227----------------------------------------------------------------Q---------------
G4TNX7_PIRID/34-234----------------------------------------------------------------S---------------
I0GXB6_ACTM4/290-490----------------------------------------------------------------T---------------
K2RTS7_MACPH/22-219----------------------------------------------------------------.---------------
K2SGW5_MACPH/29-225----------------------------------------------------------------T---------------
M5BX85_THACB/52-251----------------------------------------------------------------S---------------
G1WXZ0_ARTOA/97-294----------------------------------------------------------------T---------------
E3Q1Z9_COLGM/95-295----------------------------------------------------------------G---------------
F2JTB7_MARM1/279-472----------------------------------------------------------------T---------------
B2APR3_PODAN/24-223----------------------------------------------------------------R---------------
M5BPI1_THACB/35-233----------------------------------------------------------------.---------------
D8QKC3_SCHCM/33-233----------------------------------------------------------------S---------------
H6NS60_9BACL/19-215----------------------------------------------------------------V---------------
D6X7B4_STRPR/40-243----------------------------------------------------------------A---------------
D7CEB6_STRBB/44-244----------------------------------------------------------------.---------------
C7YZY2_NECH7/19-218----------------------------------------------------------------T---------------
K2RAB2_MACPH/20-220----------------------------------------------------------------S---------------
K1WSP2_MARBU/22-217----------------------------------------------------------------K---------------
M3CJL1_SPHMS/22-219----------------------------------------------------------------.---------------
C9SY14_VERA1/23-220----------------------------------------------------------------E---------------
C9S8R7_VERA1/23-222----------------------------------------------------------------S---------------
M5BYG9_THACB/44-239----------------------------------------------------------------.---------------
S8CBN6_DACHA/113-310----------------------------------------------------------------T---------------
E0SM75_DICD3/100-319----------------------------------------------------------------S---------------
C7ZNK4_NECH7/23-222----------------------------------------------------------------E---------------
G2XBC9_VERDV/24-222----------------------------------------------------------------T---------------
C7ZB71_NECH7/24-221----------------------------------------------------------------K---------------
A8L1K4_FRASN/141-339----------------------------------------------------------------.---------------
PLYC_BACLD/19-214----------------------------------------------------------------G---------------

PF09251

Q8SCG9_BPSP6/3-550----------------------------------------------------LTKPRCFRKASYL---------------
TSPE_BPP22/116-665----------------------------------------------------IEADKKFKYSVKL---------------

PF12541

D6DHZ7_CLOSC/2-271---------------------------------------------------KTIENKTFDEERAL---------------
R5PWU1_9BURK/2-278---------------------------------------------------QILQNVEYGGERPL---------------
A5VMS3_LACRD/2-277---------------------------------------------------EEIKEAYYDGERPL---------------
R5L1C9_9CLOT/2-273---------------------------------------------------KTFENEQFDEERAL---------------
R5GK22_9BACT/2-278---------------------------------------------------ETIKNTEFEGERPL---------------
R6F061_9BACT/2-278---------------------------------------------------EKISNKVFGGERPL---------------
Q6LZ36_METMP/37-311---------------------------------------------------..YNELNLDEERAL---------------
R5A3D5_9CLOT/2-271---------------------------------------------------ETIQNKTFDEERAL---------------
R5VXN8_9DELT/3-274---------------------------------------------------K.IQNKKFDEERAL---------------
R7EP62_9FIRM/5-279---------------------------------------------------KVIKAEFLVGERAL---------------
R6VTW4_9BACT/2-278---------------------------------------------------NLIKDKEFGGERPL---------------
Q8A7X5_BACTN/2-278---------------------------------------------------KQIKNTHYEGERPL---------------
R7HQ78_9BACT/2-277---------------------------------------------------ELIKDKEFGGERPL---------------
D7DSW7_METV3/56-328---------------------------------------------------KTYDNLKLDEERAL---------------
R6G7J9_9FIRM/8-282---------------------------------------------------KEIHQEFLTGERAL---------------
R7DGS5_9PORP/2-278---------------------------------------------------KTISNAEFGGERPL---------------
R7R6X9_9FIRM/2-276---------------------------------------------------EEITRGYFTGERAL---------------
Q5FL14_LACAC/3-277---------------------------------------------------E.YKNNYFEGERII---------------
R6JX58_9FIRM/7-281---------------------------------------------------EKISNKYYTGERPL---------------
R5YM64_9FIRM/4-278---------------------------------------------------KVIQQEYLTGERAL---------------
R5R5M3_9FIRM/2-276---------------------------------------------------EIIKQKYLSGERAL---------------
A7ZFS8_CAMC1/2-276---------------------------------------------------QERNAEIFTGERAM---------------
R6XGP3_9FIRM/2-276---------------------------------------------------DIIKNKVLVGERAL---------------
R7BSW2_9FIRM/8-275---------------------------------------------------..VENKTFDEERAF---------------
R6N8F1_9CLOT/2-271---------------------------------------------------AVIENQTFDAERAL---------------
R6CNQ1_9BACT/2-275---------------------------------------------------ELIKNKSFGGERPL---------------
M1MK35_9CLOT/2-276---------------------------------------------------KIIEQELLTGERAL---------------
A2DNE3_TRIVA/4-279---------------------------------------------------.TVEGKTFDEERAL---------------
R6E1V7_9BACE/2-278---------------------------------------------------EKIIGQEFIGERPL---------------
R5G5K3_9FIRM/6-274---------------------------------------------------..VKDITTDLERAF---------------
R5YBV7_9BACE/2-278---------------------------------------------------EQIKNTEFEGERPL---------------
R6X1F7_9BACT/2-278---------------------------------------------------EKIINQEFGGERPL---------------
C4Z7J5_EUBE2/13-287---------------------------------------------------KLVKQQLLTGERAL---------------
A6LAN5_PARD8/2-278---------------------------------------------------QQIKDMEFSGERPL---------------
E6UH73_RUMA7/2-277---------------------------------------------------NSIENKTFDKERAL---------------
J9VZH1_LACBU/2-277---------------------------------------------------KQYTNQYFDGERPL---------------
A2DXQ6_TRIVA/15-290---------------------------------------------------.IIDGKTYDEERAL---------------
R7J179_9BACT/4-280---------------------------------------------------TKIENKEYGGERPL---------------
R7IJ73_9BURK/2-278---------------------------------------------------QLITNQTFGGERSL---------------
R5UHT9_9FIRM/12-285---------------------------------------------------.VLRQQKLTGERAL---------------
R7C9P6_9CLOT/2-276---------------------------------------------------KEIRQQFLTGERAL---------------
R7FLD7_9CLOT/4-277---------------------------------------------------.KVIQELLVGERAL---------------
R5GYL3_9FIRM/5-279---------------------------------------------------KELRQEYLTGERAL---------------
R5PEP4_9BACT/2-278---------------------------------------------------ETIKDRSFGGERPL---------------
F9URY5_LACPL/2-277---------------------------------------------------KTITQQYLTGERAL---------------
R5KIW2_9BACT/2-278---------------------------------------------------KLIANTEFGGERPL---------------
D6S309_9LACO/2-277---------------------------------------------------KLIKEAYYEGERPL---------------
R7ADB3_9FIRM/2-270---------------------------------------------------.KIENKSFDEERAF---------------
C4ZDA1_EUBR3/5-279---------------------------------------------------KQIHQEFLTGERAL---------------
B2UN04_AKKM8/4-280---------------------------------------------------RMIKNASYEGERPL---------------
R7BJD2_9FIRM/4-275---------------------------------------------------...IQQTFTEERAL---------------
R5ZSK8_9CLOT/2-276---------------------------------------------------EVINNRIFEGERAL---------------
R5P9J9_9CLOT/3-277---------------------------------------------------KQIRQTYFEGERPL---------------
R7K3P1_9CLOT/2-276---------------------------------------------------QVIREERLTGERAL---------------
R7A2C4_9FIRM/3-270---------------------------------------------------..IENQTFDEERAL---------------
R5EWD8_9GAMM/2-279---------------------------------------------------NIIKDKEFQGERPL---------------
R6UKR3_9STAP/2-276---------------------------------------------------NNINNLILDEERAL---------------
R5QNY5_9PROT/3-277---------------------------------------------------..YENLFLDQERAL---------------
R6WGE2_9FIRM/2-277---------------------------------------------------QTINGKNFDEERAL---------------
R6DEH5_9CLOT/2-276---------------------------------------------------KKYTEQRFTGERAL---------------
Q74K41_LACJO/2-277---------------------------------------------------QEIKEKYFEGERAL---------------
R7GEC7_9CLOT/2-271---------------------------------------------------NRINNQALTGERAL---------------
C4LFU5_TOLAT/2-277---------------------------------------------------NIIKNTFYEGERPL---------------
R5QQP9_9FIRM/2-277---------------------------------------------------ELVKQAYLKGERAL---------------
R5V321_9FIRM/3-274---------------------------------------------------QKIENQIFGEERAL---------------
Q03TK5_LACBA/3-278---------------------------------------------------TEINQQTLTGERAL---------------
R5G0S8_9ACTN/11-287---------------------------------------------------QVIENQTFDEERAL---------------
R5R960_9FIRM/2-274---------------------------------------------------KKIENGTFDEERAF---------------
B8DUR7_BIFA0/2-277---------------------------------------------------QAITQQLLSGERAL---------------
R7HU56_9CLOT/5-279---------------------------------------------------ETITQELLTGERAL---------------
L0J7T7_PREDD/11-287---------------------------------------------------EIIKDKKYGGERPL---------------
D5HFQ7_9FIRM/8-282---------------------------------------------------KIIRQEFLTGERAL---------------
R6XZ15_9FIRM/2-276---------------------------------------------------KKLEQGLFVGERAL---------------
D4IWA9_BUTFI/2-277---------------------------------------------------KEYRQQFFKGERAL---------------
T0T8D2_9STRE/2-277---------------------------------------------------KIINQELLTGERAC---------------
R7FNU4_9CLOT/2-276---------------------------------------------------EKIKNLTFKGNRVL---------------
R6BWW4_9CLOT/5-279---------------------------------------------------KEVSRAFLTGERAL---------------
R7H8Z4_9FIRM/5-279---------------------------------------------------RQINQEYLTGERPL---------------
R5QFI9_9FIRM/2-276---------------------------------------------------NQYTQQKFVGERAL---------------
R6CSF1_9CLOT/4-277---------------------------------------------------.KIIGQTFDQERAL---------------
R6TW54_9FIRM/2-276---------------------------------------------------KEIKRQNFSGERAL---------------
R7N4D9_9FIRM/2-276---------------------------------------------------EEMKQQFLTGERAL---------------
R7DLF6_9FIRM/2-277---------------------------------------------------EHVKGGLFVGERAL---------------
R7IW89_9FIRM/9-282---------------------------------------------------.RISRGHYTGERPL---------------
I0GVU7_SELRL/2-272---------------------------------------------------EEYREQTFDEERAL---------------
R5N9S7_9BACT/2-278---------------------------------------------------QLIKDMEFGGERPL---------------
D5EVR1_PRER2/2-278---------------------------------------------------ELIRGKEFGGERPL---------------
A1A134_BIFAA/22-296---------------------------------------------------SETRQAFLTGERAE---------------

PF05860

Q9K0S7_NEIMB/78-201----------------------------------------------------------------D---------------
Q9CPI1_PASMU/122-258----------------------------------------------------------------A---------------
P73032_SYNY3/38-157----------------------------------------------------------------A---------------
HXUA1_HAEIN/23-136----------------------------------------------------------------A---------------
Q8XYI3_RALSO/66-200----------------------------------------------------------------D---------------
Q8YM34_NOSS1/26-139----------------------------------------------------------------A---------------
Q8YM26_NOSS1/34-153----------------------------------------------------------------A---------------
Q8XSD6_RALSO/71-208----------------------------------------------------------------A---------------
Q8YX21_NOSS1/35-151----------------------------------------------------------------T---------------
Q9K0T0_NEIMB/84-219----------------------------------------------------------------D---------------
Q8YKQ8_NOSS1/28-144----------------------------------------------------------------A---------------
Q9AAJ5_CAUCR/22-135----------------------------------------------------------------S---------------
Q8YZU0_NOSS1/29-144----------------------------------------------------------------A---------------
Q9PEY9_XYLFA/72-207----------------------------------------------------------------D---------------
Q9I791_PSEAE/29-168----------------------------------------------------------------A---------------
Q8YV10_NOSS1/28-152----------------------------------------------------------------A---------------
Q8P9Q5_XANCP/41-176----------------------------------------------------------------P---------------
Q8XPV0_RALSO/28-144----------------------------------------------------------------A---------------
Q8YM30_NOSS1/29-148----------------------------------------------------------------A---------------
Q9HVN6_PSEAE/51-166----------------------------------------------------------------A---------------
Q9I5N6_PSEAE/132-249----------------------------------------------------------------D---------------
Q8YVR8_NOSS1/44-162----------------------------------------------------------------P---------------
Q8YM29_NOSS1/26-145----------------------------------------------------------------A---------------
Q9HVG6_PSEAE/40-153----------------------------------------------------------------A---------------
Q8YM35_NOSS1/26-137----------------------------------------------------------------A---------------
FHAB_BORPE/71-205----------------------------------------------------------------A---------------
Q8YNX6_NOSS1/33-149----------------------------------------------------------------D---------------
Q8YXM8_NOSS1/29-153----------------------------------------------------------------T---------------
Q8YLL8_NOSS1/28-146----------------------------------------------------------------A---------------
Q8XQZ5_RALSO/71-206----------------------------------------------------------------D---------------
Q9HWU6_PSEAE/51-167----------------------------------------------------------------A---------------
Q8XQ42_RALSO/54-167----------------------------------------------------------------A---------------
Q8XPU1_RALSO/114-253----------------------------------------------------------------D---------------
Q8YM31_NOSS1/26-139----------------------------------------------------------------A---------------
Q8YKI4_NOSS1/31-147----------------------------------------------------------------A---------------
B4F0Z9_PROMH/33-166----------------------------------------------------------------.---------------
C5BBG7_EDWI9/32-166----------------------------------------------------------------.---------------
G1UB82_HAEDU/106-235----------------------------------------------------------------.---------------
Q6G3H6_BARHE/56-188----------------------------------------------------------------.---------------
Q7DDD8_NEIMB/84-217----------------------------------------------------------------.---------------
Q7VLE8_HAEDU/114-240----------------------------------------------------------------.---------------
Q7VLT6_HAEDU/25-160----------------------------------------------------------------.---------------
Q8RI19_FUSNN/27-164----------------------------------------------------------------.---------------
Q9CPH9_PASMU/119-250----------------------------------------------------------------.---------------

PF05048

A0B5Z3_METTP/119-363----------------------------------------------------------MDCQVSG---------------
A0B8G3_METTP/432-668----------------------------------------------------------EGNIIRQ---------------
A0B9A8_METTP/209-441----------------------------------------------------------ISTEMID---------------
A0M187_GRAFK/155-382----------------------------------------------------------FNNTIIG---------------
A3Q9S9_SHELP/163-403----------------------------------------------------------KDNQIEG---------------
A3QIG9_SHELP/167-406----------------------------------------------------------HHNRIQG---------------
A4CHB0_ROBBH/128-355----------------------------------------------------------RGNQISG---------------
A6Q5Y3_NITSB/155-390----------------------------------------------------------IGNYITS---------------
A6QCA8_SULNB/133-366----------------------------------------------------------NDNYIES---------------
B9LN19_HALLT/206-436----------------------------------------------------------ADSRIEG---------------
O28859_ARCFU/803-1050----------------------------------------------------------KNLGLSS---------------
Q0A9R0_ALKEH/149-394----------------------------------------------------------IANRISG---------------
Q0W3C2_UNCMA/236-481----------------------------------------------------------SDNLMQL---------------
Q0W3C3_UNCMA/195-446----------------------------------------------------------SDNTMKQ---------------
Q0W3M9_UNCMA/204-442----------------------------------------------------------FNISITN---------------
Q12VI3_METBU/415-643----------------------------------------------------------TKNNVSD---------------
Q16A16_ROSDO/136-364----------------------------------------------------------ARNVIEG---------------
Q21TJ4_ALBFT/155-381----------------------------------------------------------IGNRITG---------------
Q2FLC7_METHJ/579-839----------------------------------------------------------INTAPPG---------------
Q2FLS3_METHJ/168-426----------------------------------------------------------FNTVEDT---------------
Q2FM56_METHJ/94-353----------------------------------------------------------FGGSITN---------------
Q2FPE3_METHJ/417-660----------------------------------------------------------CNNLHAE---------------
Q2FQK2_METHJ/621-869----------------------------------------------------------EDNQITK---------------
Q2FSR9_METHJ/59-324----------------------------------------------------------VGVIITS---------------
Q3SJ26_THIDA/142-368----------------------------------------------------------ENNLITG---------------
Q47FR5_DECAR/172-407----------------------------------------------------------RGNSIRS---------------
Q47UZ5_COLP3/153-392----------------------------------------------------------SHNRVKG---------------
Q5LLH6_RUEPO/140-368----------------------------------------------------------KGNRIEG---------------
Q5V4X0_HALMA/184-414----------------------------------------------------------QNNTIVG---------------
Q6LJ10_PHOPR/142-381----------------------------------------------------------EGNEIEG---------------
Q6M0J5_METMP/167-417----------------------------------------------------------SENLVYE---------------
Q7MRZ6_WOLSU/132-365----------------------------------------------------------SRNHITS---------------
Q8TI41_METAC/43-307----------------------------------------------------------LHATSVG---------------
Q8TJK2_METAC/50-308----------------------------------------------------------VNAASPG---------------
Q8TJW3_METAC/46-306----------------------------------------------------------VNGASTG---------------
Q8TLA5_METAC/47-287----------------------------------------------------------LDNAVDG---------------
Q8TLD5_METAC/175-426----------------------------------------------------------SNNTVSS---------------
Q8TLD5_METAC/552-811----------------------------------------------------------LNNSMSS---------------
Q8TLY6_METAC/248-494----------------------------------------------------------SINNASQ---------------
Q8TLY7_METAC/376-620----------------------------------------------------------LNNNAVK---------------
Q8TN36_METAC/103-334----------------------------------------------------------NSNSVTI---------------
Q8TPF2_METAC/96-327----------------------------------------------------------NSSNVTI---------------
Q8TPZ7_METAC/43-292----------------------------------------------------------VNSASSG---------------
Q8TQ14_METAC/197-463----------------------------------------------------------LNGSIGV---------------
Q8TQM3_METAC/233-470----------------------------------------------------------SENNFSR---------------
Q8TSE8_METAC/43-302----------------------------------------------------------VNSASSG---------------
Q8TT51_METAC/53-286----------------------------------------------------------VDAANDG---------------
Q8TTT9_METAC/43-302----------------------------------------------------------VDNASSG---------------
Q9K0L5_NEIMB/44-271----------------------------------------------------------RENKIVG---------------
B2UHW3_RALPJ/148-378----------------------------------------------------------.ANTITG---------------
M1FI95_9ALTE/142-381----------------------------------------------------------.GNVIRG---------------
Q63UJ4_BURPS/145-366----------------------------------------------------------.GNVIVG---------------
NOSD_PSEAE/144-383----------------------------------------------------------.DNRIEG---------------

PF02415

Q9RB68_CHLPN/182-200--------------------------------------------------------------------------------
Q7USQ0_RHOBA/609-626--------------------------------------------------------------------------------
Q7USQ0_RHOBA/574-600--------------------------------------------------------------------------------
D7DDN5_CHLTD/763-781--------------------------------------------------------------------------------
PMP19_CHLPN/219-236--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1476-1499--------------------------------------------------------------------------------
Q823X6_CHLCV/212-230--------------------------------------------------------------------------------
Q824E7_CHLCV/831-849--------------------------------------------------------------------------------
Q7UYI1_RHOBA/341-359--------------------------------------------------------------------------------
D6YJH1_CHLT0/805-823--------------------------------------------------------------------------------
PMPE_CHLMU/231-248--------------------------------------------------------------------------------
Q823W9_CHLCV/240-262--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2205-2228--------------------------------------------------------------------------------
Q7USQ0_RHOBA/459-477--------------------------------------------------------------------------------
Q823W9_CHLCV/304-325--------------------------------------------------------------------------------
D7DDN6_CHLTD/1040-1077--------------------------------------------------------------------------------
PMP19_CHLPN/181-206--------------------------------------------------------------------------------
PMP10_CHLPN/237-266--------------------------------------------------------------------------------
A0A017MJC9_ECOLX/186-211--------------------------------------------------------------------------------
D7DDN6_CHLTD/166-192--------------------------------------------------------------------------------
D6YJH1_CHLT0/359-377--------------------------------------------------------------------------------
PMPE_CHLMU/197-220--------------------------------------------------------------------------------
PMPF_CHLMU/270-296--------------------------------------------------------------------------------
PMP9_CHLPN/239-260--------------------------------------------------------------------------------
PMPI_CHLMU/192-210--------------------------------------------------------------------------------
Q7UWZ8_RHOBA/3661-3680--------------------------------------------------------------------------------
PMP2_CHLPN/189-207--------------------------------------------------------------------------------
Q7UWZ8_RHOBA/1086-1105--------------------------------------------------------------------------------
PMPB_CHLMU/941-958--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1185-1203--------------------------------------------------------------------------------
PMP14_CHLPN/232-274--------------------------------------------------------------------------------
PMPA_CHLMU/277-295--------------------------------------------------------------------------------
PMPC_CHLMU/644-671--------------------------------------------------------------------------------
Q8VU50_CHLPS/186-204--------------------------------------------------------------------------------
PMPA_CHLMU/360-379--------------------------------------------------------------------------------
PMPD_CHLMU/841-866--------------------------------------------------------------------------------
Q823X1_CHLCV/274-292--------------------------------------------------------------------------------
PMPB_CHLMU/588-607--------------------------------------------------------------------------------
PMP7_CHLPN/218-236--------------------------------------------------------------------------------
PMP6_CHLPN/158-176--------------------------------------------------------------------------------
PMPG_CHLMU/264-281--------------------------------------------------------------------------------
Q824E7_CHLCV/575-593--------------------------------------------------------------------------------
Q823Y0_CHLCV/253-275--------------------------------------------------------------------------------
Q823X5_CHLCV/226-244--------------------------------------------------------------------------------
PMP7_CHLPN/344-360--------------------------------------------------------------------------------
Q9RB71_CHLPN/85-112--------------------------------------------------------------------------------
A0A017MJC9_ECOLX/67-82--------------------------------------------------------------------------------
PMP20_CHLPN/1045-1063--------------------------------------------------------------------------------
D6YJH1_CHLT0/612-641--------------------------------------------------------------------------------
PMP9_CHLPN/276-294--------------------------------------------------------------------------------
PMP1_CHLPN/182-199--------------------------------------------------------------------------------
Q823X6_CHLCV/313-331--------------------------------------------------------------------------------
PMP20_CHLPN/830-848--------------------------------------------------------------------------------
M4UH44_9XANT/369-387--------------------------------------------------------------------------------
Q9RB68_CHLPN/211-229--------------------------------------------------------------------------------
Q7UWZ8_RHOBA/3685-3702--------------------------------------------------------------------------------
Q823Y2_CHLCV/321-338--------------------------------------------------------------------------------
PMP16_CHLPN/208-226--------------------------------------------------------------------------------
D7DDN5_CHLTD/1072-1106--------------------------------------------------------------------------------
Q823Y1_CHLCV/197-218--------------------------------------------------------------------------------
D7DDN5_CHLTD/735-753--------------------------------------------------------------------------------
PMPF_CHLMU/242-259--------------------------------------------------------------------------------
PMPH_CHLMU/292-310--------------------------------------------------------------------------------
PMP18_CHLPN/177-195--------------------------------------------------------------------------------
Q8VU50_CHLPS/154-172--------------------------------------------------------------------------------
L0U0P4_CHLTH/364-382--------------------------------------------------------------------------------
D6YJH1_CHLT0/529-572--------------------------------------------------------------------------------
PMPC_CHLMU/389-407--------------------------------------------------------------------------------
H2VFH2_CHLAB/217-238--------------------------------------------------------------------------------
D6YP19_CHLT1/341-358--------------------------------------------------------------------------------
Q823W9_CHLCV/212-230--------------------------------------------------------------------------------
Q823Y1_CHLCV/168-186--------------------------------------------------------------------------------
PMP20_CHLPN/278-296--------------------------------------------------------------------------------
Q823X2_CHLCV/93-111--------------------------------------------------------------------------------
D7DDN6_CHLTD/138-164--------------------------------------------------------------------------------
Q7UWZ8_RHOBA/1058-1077--------------------------------------------------------------------------------
PMPF_CHLMU/202-231--------------------------------------------------------------------------------
Q823Y2_CHLCV/258-284--------------------------------------------------------------------------------
L0U0P4_CHLTH/304-343--------------------------------------------------------------------------------
D6YJH1_CHLT0/267-286--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1794-1815--------------------------------------------------------------------------------
D7DEY8_CHLTD/297-315--------------------------------------------------------------------------------
Q824E6_CHLCV/333-352--------------------------------------------------------------------------------
Q824E7_CHLCV/420-438--------------------------------------------------------------------------------
PMP6_CHLPN/449-467--------------------------------------------------------------------------------
Q824E7_CHLCV/803-821--------------------------------------------------------------------------------
Q7UYI1_RHOBA/313-332--------------------------------------------------------------------------------
Q7UZ67_RHOBA/447-470--------------------------------------------------------------------------------
Q823X5_CHLCV/347-365--------------------------------------------------------------------------------
PMP10_CHLPN/94-112--------------------------------------------------------------------------------
D7DDN5_CHLTD/1044-1062--------------------------------------------------------------------------------
PMP21_CHLPN/543-572--------------------------------------------------------------------------------
PMP11_CHLPN/180-198--------------------------------------------------------------------------------
D7DDN6_CHLTD/394-412--------------------------------------------------------------------------------
PMP1_CHLPN/307-329--------------------------------------------------------------------------------
PMP20_CHLPN/390-421--------------------------------------------------------------------------------
D7DDN5_CHLTD/456-474--------------------------------------------------------------------------------
Q823Y0_CHLCV/225-242--------------------------------------------------------------------------------
Q9RB68_CHLPN/298-316--------------------------------------------------------------------------------
D7DDN6_CHLTD/515-533--------------------------------------------------------------------------------
Q823X4_CHLCV/217-241--------------------------------------------------------------------------------
PMP20_CHLPN/517-574--------------------------------------------------------------------------------
PMPD_CHLMU/324-348--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2265-2283--------------------------------------------------------------------------------
Q7UYI1_RHOBA/607-625--------------------------------------------------------------------------------
Q821X9_CHLCV/727-745--------------------------------------------------------------------------------
PMP21_CHLPN/750-771--------------------------------------------------------------------------------
PMP21_CHLPN/710-740--------------------------------------------------------------------------------
PMPB_CHLMU/792-820--------------------------------------------------------------------------------
PMP19_CHLPN/248-265--------------------------------------------------------------------------------
PMP15_CHLPN/87-105--------------------------------------------------------------------------------
PMP1_CHLPN/280-298--------------------------------------------------------------------------------
PMP16_CHLPN/179-197--------------------------------------------------------------------------------
L0TRT3_CHLTH/242-260--------------------------------------------------------------------------------
PMPF_CHLMU/173-191--------------------------------------------------------------------------------
Q823Y1_CHLCV/295-313--------------------------------------------------------------------------------
PMP1_CHLPN/154-172--------------------------------------------------------------------------------
PMPF_CHLMU/133-164--------------------------------------------------------------------------------
L0U0P4_CHLTH/169-195--------------------------------------------------------------------------------
Q823X0_CHLCV/153-171--------------------------------------------------------------------------------
PMPG_CHLMU/196-214--------------------------------------------------------------------------------
Q823X5_CHLCV/171-189--------------------------------------------------------------------------------
PMP6_CHLPN/317-335--------------------------------------------------------------------------------
Q821X9_CHLCV/301-320--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1096-1117--------------------------------------------------------------------------------
PMP20_CHLPN/1071-1089--------------------------------------------------------------------------------
PMP13_CHLPN/338-356--------------------------------------------------------------------------------
PMP19_CHLPN/62-80--------------------------------------------------------------------------------
PMP20_CHLPN/489-507--------------------------------------------------------------------------------
Q7USQ0_RHOBA/635-652--------------------------------------------------------------------------------
PMPE_CHLMU/324-342--------------------------------------------------------------------------------
PMP20_CHLPN/716-734--------------------------------------------------------------------------------
PMP6_CHLPN/633-650--------------------------------------------------------------------------------
PMP15_CHLPN/278-296--------------------------------------------------------------------------------
Q7VQA1_CHLPN/185-203--------------------------------------------------------------------------------
D3UTG0_CHLTS/163-181--------------------------------------------------------------------------------
Q824E7_CHLCV/731-748--------------------------------------------------------------------------------
H2VFH0_CHLAB/248-268--------------------------------------------------------------------------------
PMP16_CHLPN/113-131--------------------------------------------------------------------------------
D6YI86_CHLT0/332-350--------------------------------------------------------------------------------
PMP20_CHLPN/1099-1128--------------------------------------------------------------------------------
D7DEY8_CHLTD/159-186--------------------------------------------------------------------------------
PMP13_CHLPN/194-212--------------------------------------------------------------------------------
Q7USQ0_RHOBA/252-270--------------------------------------------------------------------------------
PMPB_CHLMU/867-899--------------------------------------------------------------------------------
Q7USQ0_RHOBA/339-362--------------------------------------------------------------------------------
PMP12_CHLPN/187-205--------------------------------------------------------------------------------
Q823X9_CHLCV/100-118--------------------------------------------------------------------------------
Q7UYI1_RHOBA/474-492--------------------------------------------------------------------------------
PMP13_CHLPN/280-319--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1004-1030--------------------------------------------------------------------------------
PMP16_CHLPN/300-318--------------------------------------------------------------------------------
Q823X3_CHLCV/188-206--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1151-1176--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2527-2545--------------------------------------------------------------------------------
PMP20_CHLPN/776-794--------------------------------------------------------------------------------
Q7UYI1_RHOBA/394-412--------------------------------------------------------------------------------
PMP11_CHLPN/152-170--------------------------------------------------------------------------------
Q823X9_CHLCV/310-327--------------------------------------------------------------------------------
Q823X5_CHLCV/255-280--------------------------------------------------------------------------------
Q823X1_CHLCV/301-322--------------------------------------------------------------------------------
PMP7_CHLPN/187-207--------------------------------------------------------------------------------
PMP8_CHLPN/308-330--------------------------------------------------------------------------------
Q821X9_CHLCV/805-823--------------------------------------------------------------------------------
Q7USQ0_RHOBA/279-304--------------------------------------------------------------------------------
Q7USQ0_RHOBA/313-331--------------------------------------------------------------------------------
Q823X1_CHLCV/238-260--------------------------------------------------------------------------------
Q7VQ06_CHLPN/138-163--------------------------------------------------------------------------------
PMPE_CHLMU/258-286--------------------------------------------------------------------------------
D6YP19_CHLT1/180-198--------------------------------------------------------------------------------
PMP9_CHLPN/182-200--------------------------------------------------------------------------------
PMPB_CHLMU/459-477--------------------------------------------------------------------------------
D6YJH1_CHLT0/679-697--------------------------------------------------------------------------------
Q824E6_CHLCV/279-297--------------------------------------------------------------------------------
Q821X9_CHLCV/422-440--------------------------------------------------------------------------------
PMP8_CHLPN/281-299--------------------------------------------------------------------------------
Q7USQ0_RHOBA/949-970--------------------------------------------------------------------------------
PMPC_CHLMU/242-260--------------------------------------------------------------------------------
Q823X6_CHLCV/107-125--------------------------------------------------------------------------------
PMP9_CHLPN/303-325--------------------------------------------------------------------------------
PMP7_CHLPN/308-331--------------------------------------------------------------------------------
Q7UYI1_RHOBA/555-573--------------------------------------------------------------------------------
PMP19_CHLPN/303-320--------------------------------------------------------------------------------
Q9RB68_CHLPN/154-172--------------------------------------------------------------------------------
Q823Y2_CHLCV/201-220--------------------------------------------------------------------------------
PMP20_CHLPN/221-239--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1647-1668--------------------------------------------------------------------------------
D6YP19_CHLT1/140-171--------------------------------------------------------------------------------
PMPG_CHLMU/225-243--------------------------------------------------------------------------------
Q7USQ0_RHOBA/486-509--------------------------------------------------------------------------------
P71135_CHLAO/277-295--------------------------------------------------------------------------------
PMP14_CHLPN/314-332--------------------------------------------------------------------------------
PMP7_CHLPN/281-299--------------------------------------------------------------------------------
PMP21_CHLPN/952-977--------------------------------------------------------------------------------
D3UTG0_CHLTS/135-153--------------------------------------------------------------------------------
L0TRT3_CHLTH/318-336--------------------------------------------------------------------------------
D3UTG0_CHLTS/281-298--------------------------------------------------------------------------------
D6YJH1_CHLT0/492-518--------------------------------------------------------------------------------
Q823Y2_CHLCV/221-247--------------------------------------------------------------------------------
D6YJH1_CHLT0/176-203--------------------------------------------------------------------------------
D6YI86_CHLT0/304-322--------------------------------------------------------------------------------
PMPB_CHLMU/197-268--------------------------------------------------------------------------------
Q7VQA1_CHLPN/214-232--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2144-2170--------------------------------------------------------------------------------
Q7VQA1_CHLPN/277-295--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1562-1580--------------------------------------------------------------------------------
D3UTG0_CHLTS/219-236--------------------------------------------------------------------------------
PMP13_CHLPN/223-241--------------------------------------------------------------------------------
A0A017MJC9_ECOLX/97-118--------------------------------------------------------------------------------
Q7USQ0_RHOBA/224-245--------------------------------------------------------------------------------
PMPD_CHLMU/529-572--------------------------------------------------------------------------------
D6YJH1_CHLT0/446-482--------------------------------------------------------------------------------
PMPB_CHLMU/54-125--------------------------------------------------------------------------------
PMP20_CHLPN/886-922--------------------------------------------------------------------------------
PMPB_CHLMU/666-684--------------------------------------------------------------------------------
D6YJH1_CHLT0/846-871--------------------------------------------------------------------------------
D7DEY8_CHLTD/231-248--------------------------------------------------------------------------------
PMP10_CHLPN/149-175--------------------------------------------------------------------------------
PMPE_CHLMU/126-159--------------------------------------------------------------------------------
PMP15_CHLPN/143-170--------------------------------------------------------------------------------
Q821X9_CHLCV/889-906--------------------------------------------------------------------------------
PMPD_CHLMU/267-286--------------------------------------------------------------------------------
Q82QS3_STRAW/268-286--------------------------------------------------------------------------------
Q7USQ0_RHOBA/370-391--------------------------------------------------------------------------------
Q82QS3_STRAW/181-198--------------------------------------------------------------------------------
PMP11_CHLPN/270-288--------------------------------------------------------------------------------
Q823Y0_CHLCV/194-215--------------------------------------------------------------------------------
Q7VQA1_CHLPN/234-260--------------------------------------------------------------------------------
D6YJH1_CHLT0/650-668--------------------------------------------------------------------------------
PMP13_CHLPN/93-111--------------------------------------------------------------------------------
PMP9_CHLPN/211-229--------------------------------------------------------------------------------
D6YJH1_CHLT0/297-314--------------------------------------------------------------------------------
L0U0P4_CHLTH/391-408--------------------------------------------------------------------------------
D7DDN6_CHLTD/202-220--------------------------------------------------------------------------------
PMP6_CHLPN/579-597--------------------------------------------------------------------------------
PMP21_CHLPN/501-519--------------------------------------------------------------------------------
Q823Y0_CHLCV/165-183--------------------------------------------------------------------------------
Q823Y0_CHLCV/312-329--------------------------------------------------------------------------------
Q9RB71_CHLPN/57-75--------------------------------------------------------------------------------
PMP14_CHLPN/435-451--------------------------------------------------------------------------------
Q9RB71_CHLPN/154-176--------------------------------------------------------------------------------
Q823X6_CHLCV/277-304--------------------------------------------------------------------------------
PMP11_CHLPN/297-318--------------------------------------------------------------------------------
PMPC_CHLMU/214-232--------------------------------------------------------------------------------
Q824E7_CHLCV/231-249--------------------------------------------------------------------------------
PMP21_CHLPN/840-864--------------------------------------------------------------------------------
Q823Y2_CHLCV/172-190--------------------------------------------------------------------------------
PMPF_CHLMU/307-325--------------------------------------------------------------------------------
PMP18_CHLPN/325-342--------------------------------------------------------------------------------
D7DDN6_CHLTD/884-909--------------------------------------------------------------------------------
PMP16_CHLPN/142-168--------------------------------------------------------------------------------
Q821X9_CHLCV/667-688--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1675-1693--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2553-2570--------------------------------------------------------------------------------
Q7UWZ8_RHOBA/1112-1132--------------------------------------------------------------------------------
Q823X5_CHLCV/290-318--------------------------------------------------------------------------------
P71133_CHLAO/155-173--------------------------------------------------------------------------------
PMPI_CHLMU/136-154--------------------------------------------------------------------------------
PMPE_CHLMU/160-187--------------------------------------------------------------------------------
PMP19_CHLPN/122-138--------------------------------------------------------------------------------
A0A017MJC9_ECOLX/127-145--------------------------------------------------------------------------------
PMP15_CHLPN/305-322--------------------------------------------------------------------------------
PMPA_CHLMU/333-351--------------------------------------------------------------------------------
D6YI86_CHLT0/359-378--------------------------------------------------------------------------------
PMPB_CHLMU/278-296--------------------------------------------------------------------------------
Q824E7_CHLCV/950-977--------------------------------------------------------------------------------
Q7UZ67_RHOBA/529-546--------------------------------------------------------------------------------
PMP15_CHLPN/241-268--------------------------------------------------------------------------------
Q821X9_CHLCV/451-469--------------------------------------------------------------------------------
Q823X0_CHLCV/177-199--------------------------------------------------------------------------------
D6YJH1_CHLT0/378-405--------------------------------------------------------------------------------
PMP6_CHLPN/533-561--------------------------------------------------------------------------------
D7DDN5_CHLTD/158-176--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2353-2376--------------------------------------------------------------------------------
PMP2_CHLPN/216-237--------------------------------------------------------------------------------
Q7UYI1_RHOBA/181-199--------------------------------------------------------------------------------
Q824E6_CHLCV/222-239--------------------------------------------------------------------------------
PMP20_CHLPN/613-631--------------------------------------------------------------------------------
D7DEY8_CHLTD/203-220--------------------------------------------------------------------------------
PMP15_CHLPN/181-202--------------------------------------------------------------------------------
PMP20_CHLPN/803-820--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2500-2517--------------------------------------------------------------------------------
PMP20_CHLPN/250-268--------------------------------------------------------------------------------
H2VFH2_CHLAB/149-175--------------------------------------------------------------------------------
PMP14_CHLPN/286-304--------------------------------------------------------------------------------
D6YP19_CHLT1/250-267--------------------------------------------------------------------------------
PMP16_CHLPN/327-344--------------------------------------------------------------------------------
D7DDN5_CHLTD/857-885--------------------------------------------------------------------------------
PMPD_CHLMU/581-606--------------------------------------------------------------------------------
PMP21_CHLPN/875-893--------------------------------------------------------------------------------
D7DDN6_CHLTD/916-947--------------------------------------------------------------------------------
Q7VQ06_CHLPN/164-191--------------------------------------------------------------------------------
PMP21_CHLPN/472-490--------------------------------------------------------------------------------
PMPG_CHLMU/168-186--------------------------------------------------------------------------------
PMP20_CHLPN/460-478--------------------------------------------------------------------------------
A0A017MJC9_ECOLX/228-246--------------------------------------------------------------------------------
Q823X5_CHLCV/199-216--------------------------------------------------------------------------------
D6YP19_CHLT1/314-332--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1507-1528--------------------------------------------------------------------------------
PMPG_CHLMU/401-421--------------------------------------------------------------------------------
PMP20_CHLPN/1010-1027--------------------------------------------------------------------------------
PMP8_CHLPN/188-206--------------------------------------------------------------------------------
Q824E7_CHLCV/905-939--------------------------------------------------------------------------------
Q9RB71_CHLPN/28-46--------------------------------------------------------------------------------
PMP1_CHLPN/239-261--------------------------------------------------------------------------------
PMP10_CHLPN/305-327--------------------------------------------------------------------------------
Q824E7_CHLCV/203-221--------------------------------------------------------------------------------
PMPD_CHLMU/616-637--------------------------------------------------------------------------------
P71135_CHLAO/183-201--------------------------------------------------------------------------------
D6YI86_CHLT0/247-264--------------------------------------------------------------------------------
PMPG_CHLMU/283-329--------------------------------------------------------------------------------
PMP8_CHLPN/245-266--------------------------------------------------------------------------------
Q7VQA1_CHLPN/157-175--------------------------------------------------------------------------------
Q823X9_CHLCV/250-273--------------------------------------------------------------------------------
PMP14_CHLPN/108-126--------------------------------------------------------------------------------
Q823X4_CHLCV/95-113--------------------------------------------------------------------------------
P71135_CHLAO/240-262--------------------------------------------------------------------------------
P71135_CHLAO/304-325--------------------------------------------------------------------------------
PMP13_CHLPN/166-184--------------------------------------------------------------------------------
PMP15_CHLPN/213-230--------------------------------------------------------------------------------
Q83U05_CHLTH/100-133--------------------------------------------------------------------------------
PMP21_CHLPN/582-608--------------------------------------------------------------------------------
Q7VQ06_CHLPN/202-223--------------------------------------------------------------------------------
Q824E7_CHLCV/260-330--------------------------------------------------------------------------------
M4UH44_9XANT/166-184--------------------------------------------------------------------------------
D6YP19_CHLT1/277-303--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1124-1142--------------------------------------------------------------------------------
D7DDN6_CHLTD/421-439--------------------------------------------------------------------------------
D7DDN5_CHLTD/342-360--------------------------------------------------------------------------------
Q7USQ0_RHOBA/193-216--------------------------------------------------------------------------------
D7DEY8_CHLTD/324-342--------------------------------------------------------------------------------
Q824E7_CHLCV/603-621--------------------------------------------------------------------------------
L0U0P4_CHLTH/205-223--------------------------------------------------------------------------------
Q7USQ0_RHOBA/547-565--------------------------------------------------------------------------------
Q823Y2_CHLCV/294-312--------------------------------------------------------------------------------
PMP11_CHLPN/237-255--------------------------------------------------------------------------------
Q823X6_CHLCV/340-357--------------------------------------------------------------------------------
PMPD_CHLMU/176-203--------------------------------------------------------------------------------
PMP6_CHLPN/375-392--------------------------------------------------------------------------------
D6YJH1_CHLT0/407-433--------------------------------------------------------------------------------
Q7UZ67_RHOBA/477-494--------------------------------------------------------------------------------
PMP7_CHLPN/159-177--------------------------------------------------------------------------------
PMP19_CHLPN/94-112--------------------------------------------------------------------------------
PMP1_CHLPN/210-229--------------------------------------------------------------------------------
A0A017MJC9_ECOLX/159-178--------------------------------------------------------------------------------
Q823X2_CHLCV/182-208--------------------------------------------------------------------------------
Q824E6_CHLCV/150-168--------------------------------------------------------------------------------
Q824E7_CHLCV/859-895--------------------------------------------------------------------------------
Q82QS3_STRAW/231-259--------------------------------------------------------------------------------
PMPF_CHLMU/103-123--------------------------------------------------------------------------------
PMPD_CHLMU/800-818--------------------------------------------------------------------------------
D7DDN5_CHLTD/898-925--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2117-2135--------------------------------------------------------------------------------
PMP15_CHLPN/107-142--------------------------------------------------------------------------------
Q823Y1_CHLCV/322-339--------------------------------------------------------------------------------
PMP6_CHLPN/606-624--------------------------------------------------------------------------------
Q821X9_CHLCV/386-412--------------------------------------------------------------------------------
Q823X2_CHLCV/153-171--------------------------------------------------------------------------------
Q823X9_CHLCV/222-239--------------------------------------------------------------------------------
D7DDN6_CHLTD/355-373--------------------------------------------------------------------------------
Q823X2_CHLCV/217-235--------------------------------------------------------------------------------
PMP18_CHLPN/205-224--------------------------------------------------------------------------------
PMP2_CHLPN/161-179--------------------------------------------------------------------------------
PMPD_CHLMU/297-314--------------------------------------------------------------------------------
Q823Y1_CHLCV/219-245--------------------------------------------------------------------------------
PMP21_CHLPN/780-798--------------------------------------------------------------------------------
D7DDN5_CHLTD/613-631--------------------------------------------------------------------------------
D7DEY8_CHLTD/258-286--------------------------------------------------------------------------------
Q7VQ06_CHLPN/110-128--------------------------------------------------------------------------------
PMP10_CHLPN/276-294--------------------------------------------------------------------------------
Q823Y1_CHLCV/132-158--------------------------------------------------------------------------------
PMPB_CHLMU/560-579--------------------------------------------------------------------------------
Q823X1_CHLCV/210-228--------------------------------------------------------------------------------
Q9RB68_CHLPN/239-260--------------------------------------------------------------------------------
Q7UWZ8_RHOBA/1006-1025--------------------------------------------------------------------------------
PMP8_CHLPN/217-235--------------------------------------------------------------------------------
Q824E7_CHLCV/704-722--------------------------------------------------------------------------------
PMP20_CHLPN/858-884--------------------------------------------------------------------------------
PMP6_CHLPN/186-204--------------------------------------------------------------------------------
PMP20_CHLPN/432-450--------------------------------------------------------------------------------
P71135_CHLAO/212-230--------------------------------------------------------------------------------
PMP6_CHLPN/476-494--------------------------------------------------------------------------------
D7DDN5_CHLTD/932-969--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1039-1057--------------------------------------------------------------------------------
D6YI86_CHLT0/175-193--------------------------------------------------------------------------------
PMP6_CHLPN/272-300--------------------------------------------------------------------------------
Q823X5_CHLCV/374-391--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1450-1468--------------------------------------------------------------------------------
Q7UYI1_RHOBA/234-252--------------------------------------------------------------------------------
P71133_CHLAO/188-206--------------------------------------------------------------------------------
PMP20_CHLPN/585-603--------------------------------------------------------------------------------
PMP14_CHLPN/182-199--------------------------------------------------------------------------------
Q823X3_CHLCV/154-172--------------------------------------------------------------------------------
PMP12_CHLPN/150-168--------------------------------------------------------------------------------
Q824E7_CHLCV/448-466--------------------------------------------------------------------------------
D7DDN6_CHLTD/841-871--------------------------------------------------------------------------------
PMPB_CHLMU/362-420--------------------------------------------------------------------------------
PMP20_CHLPN/642-660--------------------------------------------------------------------------------
Q824E6_CHLCV/251-269--------------------------------------------------------------------------------
D7DDN6_CHLTD/542-560--------------------------------------------------------------------------------
PMP11_CHLPN/209-227--------------------------------------------------------------------------------
PMP18_CHLPN/139-166--------------------------------------------------------------------------------
PMPD_CHLMU/351-377--------------------------------------------------------------------------------
D7DDN5_CHLTD/791-847--------------------------------------------------------------------------------
PMP12_CHLPN/214-236--------------------------------------------------------------------------------
PMPE_CHLMU/297-315--------------------------------------------------------------------------------
D7DDN6_CHLTD/562-588--------------------------------------------------------------------------------
Q823W9_CHLCV/277-295--------------------------------------------------------------------------------
Q7USQ0_RHOBA/432-450--------------------------------------------------------------------------------
D7DDN6_CHLTD/275-316--------------------------------------------------------------------------------
PMP19_CHLPN/275-293--------------------------------------------------------------------------------
Q823Y1_CHLCV/256-285--------------------------------------------------------------------------------
Q823X3_CHLCV/215-233--------------------------------------------------------------------------------
D6YJH1_CHLT0/881-898--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1616-1639--------------------------------------------------------------------------------
Q823X6_CHLCV/182-199--------------------------------------------------------------------------------
D7DEY8_CHLTD/126-158--------------------------------------------------------------------------------
PMP18_CHLPN/262-288--------------------------------------------------------------------------------
Q821X9_CHLCV/757-794--------------------------------------------------------------------------------
D6YP19_CHLT1/110-130--------------------------------------------------------------------------------
Q821X9_CHLCV/628-657--------------------------------------------------------------------------------
D7DDN6_CHLTD/327-345--------------------------------------------------------------------------------
PMP6_CHLPN/344-363--------------------------------------------------------------------------------
D6YI86_CHLT0/276-294--------------------------------------------------------------------------------
Q823Y1_CHLCV/104-122--------------------------------------------------------------------------------
PMP13_CHLPN/365-382--------------------------------------------------------------------------------
Q7USQ0_RHOBA/919-942--------------------------------------------------------------------------------
Q824E7_CHLCV/987-1022--------------------------------------------------------------------------------
L0TRT3_CHLTH/373-390--------------------------------------------------------------------------------
Q823X1_CHLCV/181-199--------------------------------------------------------------------------------
PMP20_CHLPN/743-761--------------------------------------------------------------------------------
D7DDN5_CHLTD/484-502--------------------------------------------------------------------------------
D7DEY8_CHLTD/93-111--------------------------------------------------------------------------------
D3UTG0_CHLTS/254-272--------------------------------------------------------------------------------
PMPD_CHLMU/156-174--------------------------------------------------------------------------------
L0U0P4_CHLTH/277-294--------------------------------------------------------------------------------
PMPC_CHLMU/764-796--------------------------------------------------------------------------------
PMPB_CHLMU/639-657--------------------------------------------------------------------------------
Q822Q5_CHLCV/185-203--------------------------------------------------------------------------------
Q821X9_CHLCV/570-618--------------------------------------------------------------------------------
PMPH_CHLMU/245-280--------------------------------------------------------------------------------
PMPC_CHLMU/571-599--------------------------------------------------------------------------------
PMP6_CHLPN/215-233--------------------------------------------------------------------------------
PMP20_CHLPN/970-1001--------------------------------------------------------------------------------
Q824E7_CHLCV/632-650--------------------------------------------------------------------------------
L0U0P4_CHLTH/234-252--------------------------------------------------------------------------------
Q823X9_CHLCV/283-301--------------------------------------------------------------------------------
Q7UYI1_RHOBA/206-225--------------------------------------------------------------------------------
PMP21_CHLPN/436-462--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2384-2405--------------------------------------------------------------------------------
Q823Y2_CHLCV/105-123--------------------------------------------------------------------------------
D7DDN5_CHLTD/709-726--------------------------------------------------------------------------------
PMP20_CHLPN/933-960--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1589-1607--------------------------------------------------------------------------------
Q823X3_CHLCV/94-112--------------------------------------------------------------------------------
Q9RB71_CHLPN/127-145--------------------------------------------------------------------------------
D3UTG0_CHLTS/191-209--------------------------------------------------------------------------------
PMPH_CHLMU/217-235--------------------------------------------------------------------------------
PMP21_CHLPN/347-366--------------------------------------------------------------------------------
Q823X9_CHLCV/128-153--------------------------------------------------------------------------------
PMP19_CHLPN/330-349--------------------------------------------------------------------------------
PMP18_CHLPN/234-251--------------------------------------------------------------------------------
Q7UWZ8_RHOBA/1032-1051--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2473-2491--------------------------------------------------------------------------------
Q824E6_CHLCV/307-324--------------------------------------------------------------------------------
PMP10_CHLPN/185-206--------------------------------------------------------------------------------
D7DDN5_CHLTD/585-604--------------------------------------------------------------------------------
Q7UZ67_RHOBA/504-522--------------------------------------------------------------------------------
Q821X9_CHLCV/852-879--------------------------------------------------------------------------------
D7DDN5_CHLTD/306-332--------------------------------------------------------------------------------
PMP14_CHLPN/341-358--------------------------------------------------------------------------------
L0U0P4_CHLTH/421-446--------------------------------------------------------------------------------
Q824E7_CHLCV/776-794--------------------------------------------------------------------------------
PMPC_CHLMU/736-754--------------------------------------------------------------------------------
PMP21_CHLPN/810-827--------------------------------------------------------------------------------
Q822Q5_CHLCV/153-171--------------------------------------------------------------------------------
PMP16_CHLPN/264-290--------------------------------------------------------------------------------
PMP13_CHLPN/253-270--------------------------------------------------------------------------------
PMP19_CHLPN/140-166--------------------------------------------------------------------------------
L0TRT3_CHLTH/270-306--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1065-1088--------------------------------------------------------------------------------
PMPD_CHLMU/407-433--------------------------------------------------------------------------------
D6YI86_CHLT0/208-234--------------------------------------------------------------------------------
D6YJH1_CHLT0/324-349--------------------------------------------------------------------------------
Q821X9_CHLCV/533-559--------------------------------------------------------------------------------
PMP6_CHLPN/402-430--------------------------------------------------------------------------------
PMPC_CHLMU/417-435--------------------------------------------------------------------------------
L0U0P4_CHLTH/97-115--------------------------------------------------------------------------------
L0TRT3_CHLTH/345-363--------------------------------------------------------------------------------
Q7USQ0_RHOBA/1212-1229--------------------------------------------------------------------------------
Q9RB68_CHLPN/360-404--------------------------------------------------------------------------------
H2VFH2_CHLAB/190-208--------------------------------------------------------------------------------
D7DDN5_CHLTD/286-304--------------------------------------------------------------------------------
Q823Y2_CHLCV/125-161--------------------------------------------------------------------------------
Q824E6_CHLCV/183-209--------------------------------------------------------------------------------
Q823X6_CHLCV/240-274--------------------------------------------------------------------------------
D7DDN5_CHLTD/130-148--------------------------------------------------------------------------------
D6YP19_CHLT1/209-238--------------------------------------------------------------------------------
PMP12_CHLPN/81-108--------------------------------------------------------------------------------
Q824E7_CHLCV/477-495--------------------------------------------------------------------------------
D7DDN5_CHLTD/513-531--------------------------------------------------------------------------------
P71135_CHLAO/155-173--------------------------------------------------------------------------------
Q7VQA1_CHLPN/305-326--------------------------------------------------------------------------------
PMPD_CHLMU/387-405--------------------------------------------------------------------------------
M4UH44_9XANT/193-210--------------------------------------------------------------------------------
PMP7_CHLPN/246-268--------------------------------------------------------------------------------
Q821X9_CHLCV/496-523--------------------------------------------------------------------------------
Q823X9_CHLCV/191-212--------------------------------------------------------------------------------
Q7UYI1_RHOBA/260-278--------------------------------------------------------------------------------
Q823X1_CHLCV/153-171--------------------------------------------------------------------------------
PMP14_CHLPN/212-230--------------------------------------------------------------------------------
Q823X4_CHLCV/190-208--------------------------------------------------------------------------------
PMPB_CHLMU/141-159--------------------------------------------------------------------------------
Q7UYI1_RHOBA/367-385--------------------------------------------------------------------------------
PMP10_CHLPN/217-235--------------------------------------------------------------------------------
Q823X0_CHLCV/210-228--------------------------------------------------------------------------------
PMP18_CHLPN/298-316--------------------------------------------------------------------------------
PMP1_CHLPN/92-112--------------------------------------------------------------------------------
Q9RB68_CHLPN/326-347--------------------------------------------------------------------------------
Q823X9_CHLCV/162-180--------------------------------------------------------------------------------
Q9RB68_CHLPN/262-288--------------------------------------------------------------------------------
PMP8_CHLPN/157-178--------------------------------------------------------------------------------
Q823Y0_CHLCV/285-303--------------------------------------------------------------------------------
PMPB_CHLMU/722-782--------------------------------------------------------------------------------
PMP16_CHLPN/236-253--------------------------------------------------------------------------------
PMP9_CHLPN/155-173--------------------------------------------------------------------------------
Q7USQ0_RHOBA/2439-2464--------------------------------------------------------------------------------
PMP21_CHLPN/914-942--------------------------------------------------------------------------------

PF08480

Q8TLE9_METAC/305-493---------------------------------------------------MNDI-------------------------
Q8TNA9_METAC/274-466---------------------------------------------------MDDI-------------------------
Q8THR8_METAC/274-457---------------------------------------------------MNDI-------------------------
Q8TKN2_METAC/356-545---------------------------------------------------MNDI-------------------------
Q8TNF1_METAC/197-388---------------------------------------------------MDDI-------------------------
Q8TRX3_METAC/275-470---------------------------------------------------MDDI-------------------------

PF07602

Q8F2E8_LEPIN/52-316---------------------------------------------------ISGN-------------------------
Q7NNK7_GLOVI/49-321---------------------------------------------------VNGD-------------------------
Q8YX73_NOSS1/82-347---------------------------------------------------TAGN-------------------------
Q8F8Y2_LEPIN/64-326---------------------------------------------------ISGN-------------------------
Q8F1R3_LEPIN/65-310---------------------------------------------------VIGN-------------------------
Q8YWJ6_NOSS1/15-284---------------------------------------------------ATGN-------------------------
Q8F0U7_LEPIN/64-323---------------------------------------------------VGGM-------------------------

PF05594

Q8P9Q5_XANCP/1557-1633---------------------------------------------------QSGG-------------------------
Q9JPJ4_NEIME/637-700---------------------------------------------------AEV.-------------------------
Q9I120_PSEAE/2589-2647---------------------------------------------------VSQG-------------------------
A0A025G644_ECO57/815-886---------------------------------------------------VINA-------------------------
K0XUF7_PSEAI/595-645---------------------------------------------------VTVG-------------------------
Q8P9Q5_XANCP/1172-1235---------------------------------------------------TITG-------------------------
Q9I120_PSEAE/1336-1393---------------------------------------------------TTQG-------------------------
G1UB82_HAEDU/627-686---------------------------------------------------LAAN-------------------------
Q8P9Q5_XANCP/1040-1116---------------------------------------------------QAGR-------------------------
Q8KT64_PHOLU/1243-1335---------------------------------------------------ISQG-------------------------
Q9I120_PSEAE/1841-1914---------------------------------------------------RLNG-------------------------
Q9I120_PSEAE/215-293---------------------------------------------------IVTG-------------------------
A0A025G644_ECO57/919-990---------------------------------------------------ALT.-------------------------
Q47955_HAEDC/208-282---------------------------------------------------IITG-------------------------
Q9I120_PSEAE/2670-2751---------------------------------------------------VLAG-------------------------
F4LBX3_BORPC/1684-1755---------------------------------------------------VAEG-------------------------
O32608_EDWTA/679-758---------------------------------------------------QAGG-------------------------
L5QQ82_NEIME/1201-1277---------------------------------------------------DIVW-------------------------
A5TVV7_FUSNP/999-1074---------------------------------------------------IIGN-------------------------
Q8PLI3_XANAC/426-488---------------------------------------------------ALSG-------------------------
Q8KT64_PHOLU/660-719---------------------------------------------------VSQG-------------------------
Q9I120_PSEAE/2089-2158---------------------------------------------------SASG-------------------------
Q8P9Q5_XANCP/781-857---------------------------------------------------SAGG-------------------------
O32608_EDWTA/409-454---------------------------------------------------AVAG-------------------------
E6MYB6_NEIMH/769-825---------------------------------------------------QSAG-------------------------
Q9I120_PSEAE/1447-1498---------------------------------------------------TLDG-------------------------
F0AAZ9_NEIME/265-346---------------------------------------------------VVSG-------------------------
E6MYB6_NEIMH/400-459---------------------------------------------------LSS.-------------------------
Q9I120_PSEAE/382-460---------------------------------------------------VASR-------------------------
Q9JP78_BORBO/434-481---------------------------------------------------SAT.-------------------------
F4LBX3_BORPC/1233-1308---------------------------------------------------VEAG-------------------------
Q9I120_PSEAE/1752-1810---------------------------------------------------SSEG-------------------------
Q9PBE8_XYLFA/878-937---------------------------------------------------TTTG-------------------------
A0A025G644_ECO57/1075-1143---------------------------------------------------YSAG-------------------------
A5TVV7_FUSNP/2900-2961---------------------------------------------------VSAN-------------------------
Q9I120_PSEAE/2281-2332---------------------------------------------------TLSG-------------------------
Q9JP78_BORBO/1722-1793---------------------------------------------------VAEG-------------------------
A0A025G644_ECO57/209-286---------------------------------------------------VVAG-------------------------
Q8RGZ3_FUSNN/335-393---------------------------------------------------DIKN-------------------------
A5TVV7_FUSNP/868-940---------------------------------------------------IASG-------------------------
Q8PLI3_XANAC/3495-3547---------------------------------------------------TAG.-------------------------
Q8XPV0_RALSO/434-523---------------------------------------------------DGTG-------------------------
Q8P9Q5_XANCP/224-302---------------------------------------------------ATAG-------------------------
F4LBX3_BORPC/613-679---------------------------------------------------SAH.-------------------------
Q88MW9_PSEPK/1040-1119---------------------------------------------------HSA.-------------------------
F0MJK5_NEIMH/250-326---------------------------------------------------VSTG-------------------------
L5QQ82_NEIME/268-358---------------------------------------------------VVAG-------------------------
Q9PEY9_XYLFA/2190-2268---------------------------------------------------GTDG-------------------------
Q9PBE8_XYLFA/1117-1202---------------------------------------------------RLTG-------------------------
Q8PLI3_XANAC/921-986---------------------------------------------------ALTF-------------------------
HLYA_PROMI/214-285---------------------------------------------------AFTG-------------------------
L5QQ82_NEIME/1708-1775---------------------------------------------------ITYG-------------------------
Q9L6B0_PASMD/305-383---------------------------------------------------LIAG-------------------------
Q9PEY9_XYLFA/255-333---------------------------------------------------ATTG-------------------------
Q8P9Q5_XANCP/641-717---------------------------------------------------TSSG-------------------------
Q9PEY9_XYLFA/465-546---------------------------------------------------LAAG-------------------------
F4LBX3_BORPC/257-336---------------------------------------------------VVAG-------------------------
Q8PLI3_XANAC/611-700---------------------------------------------------VAGG-------------------------
O32608_EDWTA/1127-1173---------------------------------------------------TQAH-------------------------
K0XUF7_PSEAI/1475-1550---------------------------------------------------ISAG-------------------------
G1UB82_HAEDU/884-936---------------------------------------------------VAEG-------------------------
Q8P9Q5_XANCP/2538-2612---------------------------------------------------TATR-------------------------
G1UB82_HAEDU/481-539---------------------------------------------------VLAH-------------------------
Q8PLI3_XANAC/1452-1504---------------------------------------------------ASL.-------------------------
Q9PBE8_XYLFA/1219-1280---------------------------------------------------TATG-------------------------
Q9ZHL3_HAEDC/302-381---------------------------------------------------FAAG-------------------------
Q8PLI3_XANAC/2485-2591---------------------------------------------------VIGG-------------------------
G1UB82_HAEDU/294-378---------------------------------------------------FAAG-------------------------
Q9I120_PSEAE/314-379---------------------------------------------------YAGG-------------------------
Q9L6B0_PASMD/576-644---------------------------------------------------LTEG-------------------------
Q9CPI1_PASMU/1325-1400---------------------------------------------------DIVW-------------------------
Q9CPI1_PASMU/310-387---------------------------------------------------FVAG-------------------------
F4LBX3_BORPC/1442-1538---------------------------------------------------RLMG-------------------------
Q8KT64_PHOLU/1391-1522---------------------------------------------------ASSG-------------------------
A5TVV7_FUSNP/212-286---------------------------------------------------VVTG-------------------------
Q8XPV0_RALSO/204-291---------------------------------------------------IVAG-------------------------
Q9I120_PSEAE/3353-3428---------------------------------------------------ISAG-------------------------
Q8XUK5_RALSO/656-729---------------------------------------------------TIS.-------------------------
Q9JPJ4_NEIME/882-953---------------------------------------------------VSA.-------------------------
Q8P9Q5_XANCP/345-458---------------------------------------------------VAAG-------------------------
HLYA_SERMA/226-296---------------------------------------------------AISG-------------------------
Q8PLI3_XANAC/2321-2395---------------------------------------------------TARG-------------------------
Q7N9K8_PHOLL/217-289---------------------------------------------------AISG-------------------------
Q9I120_PSEAE/2996-3080---------------------------------------------------VATG-------------------------
Q9PEY9_XYLFA/586-685---------------------------------------------------ASAG-------------------------
Q8KT64_PHOLU/782-834---------------------------------------------------IAQG-------------------------
Q8P9Q5_XANCP/1258-1335---------------------------------------------------VAAR-------------------------
Q8KT64_PHOLU/342-422---------------------------------------------------QASG-------------------------
Q9ZHL3_HAEDC/464-521---------------------------------------------------VSAG-------------------------
Q9P9U6_XYLFA/773-832---------------------------------------------------TATG-------------------------
Q8PLI3_XANAC/1567-1643---------------------------------------------------QSSG-------------------------
A5TVV7_FUSNP/1095-1173---------------------------------------------------AAAG-------------------------
Q9I120_PSEAE/3706-3776---------------------------------------------------ASNG-------------------------
Q9I120_PSEAE/3221-3335---------------------------------------------------VSKG-------------------------
Q9JP78_BORBO/651-717---------------------------------------------------AAR.-------------------------
Q8PLI3_XANAC/2019-2068---------------------------------------------------VAD.-------------------------
Q8PLI3_XANAC/1182-1245---------------------------------------------------ALNG-------------------------
O32608_EDWTA/1021-1083---------------------------------------------------AARG-------------------------
Q8PLI3_XANAC/1050-1126---------------------------------------------------QAAG-------------------------
Q9RGD1_BARHN/6-64---------------------------------------------------DITG-------------------------
Q8PLI3_XANAC/1905-1991---------------------------------------------------ASAG-------------------------
Q9L6B0_PASMD/1419-1494---------------------------------------------------DIVW-------------------------
Q9I120_PSEAE/3496-3558---------------------------------------------------ALGG-------------------------
O32608_EDWTA/214-285---------------------------------------------------AVSG-------------------------
Q9CPI1_PASMU/559-626---------------------------------------------------VTEG-------------------------
Q8KT64_PHOLU/2597-2661---------------------------------------------------IRAD-------------------------
E6MYB6_NEIMH/606-662---------------------------------------------------IAA.-------------------------
Q8P9Q5_XANCP/2262-2320---------------------------------------------------GVGG-------------------------
Q8KT64_PHOLU/440-510---------------------------------------------------VTGH-------------------------
Q9I120_PSEAE/617-667---------------------------------------------------SLAG-------------------------
Q9ZHL3_HAEDC/651-728---------------------------------------------------ILHG-------------------------
HLYA_PROMI/1200-1264---------------------------------------------------SVNG-------------------------
Q8PLI3_XANAC/3289-3387---------------------------------------------------LVAG-------------------------
L5QQ82_NEIME/930-997---------------------------------------------------GAAH-------------------------
Q9I120_PSEAE/2169-2227---------------------------------------------------ASQG-------------------------
F4LBX3_BORPC/947-1021---------------------------------------------------AAVG-------------------------
Q8KT64_PHOLU/2861-2951---------------------------------------------------VVAY-------------------------
Q9PBE8_XYLFA/2062-2138---------------------------------------------------LAAA-------------------------
Q9I120_PSEAE/1670-1741---------------------------------------------------VLSG-------------------------
A0A025G644_ECO57/354-435---------------------------------------------------AAAG-------------------------
Q8PLI3_XANAC/1759-1823---------------------------------------------------AVAG-------------------------
L5QQ82_NEIME/361-426---------------------------------------------------AAA.-------------------------
Q47955_HAEDC/409-504---------------------------------------------------TLYG-------------------------
Q8RGK2_FUSNN/195-268---------------------------------------------------PIYG-------------------------
Q88MW9_PSEPK/219-293---------------------------------------------------ITVG-------------------------
O32608_EDWTA/1428-1532---------------------------------------------------DTTG-------------------------
Q8PLI3_XANAC/989-1047---------------------------------------------------QGSG-------------------------
Q9JPJ4_NEIME/527-610---------------------------------------------------NASG-------------------------
Q9PBE8_XYLFA/1297-1360---------------------------------------------------TATG-------------------------
Q8P9Q5_XANCP/1895-1981---------------------------------------------------AAAG-------------------------
Q8KT64_PHOLU/2531-2595---------------------------------------------------TATG-------------------------
F4LBX3_BORPC/1560-1635---------------------------------------------------DAKH-------------------------
Q8KT64_PHOLU/1662-1732---------------------------------------------------ISQG-------------------------
Q9I120_PSEAE/4534-4605---------------------------------------------------DIVW-------------------------
Q8PLI0_XANAC/107-201---------------------------------------------------AAAG-------------------------
Q8P9Q5_XANCP/919-976---------------------------------------------------AVGG-------------------------
Q8P9Q5_XANCP/481-558---------------------------------------------------VAGN-------------------------
O32608_EDWTA/494-532---------------------------------------------------RAG.-------------------------
Q8PLI3_XANAC/491-568---------------------------------------------------IAAD-------------------------
Q9I120_PSEAE/2493-2557---------------------------------------------------RIAK-------------------------
K0XUF7_PSEAI/2650-2727---------------------------------------------------VSAG-------------------------
Q9ZHL3_HAEDC/759-809---------------------------------------------------DIYG-------------------------
Q8KT64_PHOLU/257-334---------------------------------------------------VVAG-------------------------
Q9I120_PSEAE/3156-3216---------------------------------------------------ISAG-------------------------
G1UB82_HAEDU/773-850---------------------------------------------------TLIG-------------------------
Q8P9Q5_XANCP/1816-1892---------------------------------------------------RAGN-------------------------
Q8RGZ3_FUSNN/599-673---------------------------------------------------TGTG-------------------------
Q88MW9_PSEPK/1135-1205---------------------------------------------------QSG.-------------------------
Q9PBE8_XYLFA/1003-1082---------------------------------------------------TAAG-------------------------
Q8KT64_PHOLU/565-616---------------------------------------------------RVSG-------------------------
Q8RGZ3_FUSNN/22-93---------------------------------------------------VVTN-------------------------
Q8P9Q5_XANCP/1431-1493---------------------------------------------------RISG-------------------------
Q8P9Q5_XANCP/720-778---------------------------------------------------QSAG-------------------------
F4LBX3_BORPC/491-557---------------------------------------------------ASDG-------------------------
A0A025G644_ECO57/697-765---------------------------------------------------WSAG-------------------------
E6MYB6_NEIMH/486-548---------------------------------------------------TGSG-------------------------
Q9PEY9_XYLFA/711-768---------------------------------------------------TATG-------------------------

PF00544

PLY1_PECAS/71-278--------FPLVITYNGNEDALIKAAEANICGQWSKDPRGVEIKEFTKGITILGT-------------------------
E0SAZ3_DICD3/83-313--------DPKIIQVTGAIDISGGKAYTSFDDQKARSQISVPSNTTIIG...IGS-------------------------
E0SJQ6_DICD3/72-279--------YPLVITYTGNEDSLINAAAANICGQWSKDARGVEIKEFTKGITIIGA-------------------------
PLYA_DICD3/85-318--------.AKIIQITGTVDISGGTPYKDFADQKARSQINIPANTTVIG...IGT-------------------------
Q6D727_PECAS/47-241--------TIVVLGASLKAS..............ALTKVVFGSNKTIVG..SFGG-------------------------

PF03718

IPUA_ASPNG/7-563.................DQLQYTQGYNQTQAWTSFLYSHDATVKIS.RNGSSANS-------------------------
DEXT_PENMI/26-608YAPTDPPNSNTLDSSVDDGISIEPSIGLNMAWSQFEYSHDVDVKILATDGSSLGS-------------------------
P77813_ARTGO/20-620............GYTEPDGAEFSSSANLSMSWSSFEYSTAVWVDVKLTTGQTITS-------------------------
DEXT_ARTSD/41-636............GYTEEDGAEFSSDARLTMSWSSFEYAKDVWVEVSLRTGQTISS-------------------------

PF13332

D1APU8_SEBTE/1787-1948---------------------------------------------------LSFS-------------------------
D1AGZ0_SEBTE/1910-2071---------------------------------------------------ASYS-------------------------
D1AS25_SEBTE/1798-1959---------------------------------------------------ASYN-------------------------
D1AG88_SEBTE/1784-1945---------------------------------------------------VSAN-------------------------
C7LTZ8_DESBD/1999-2170---------------------------------------------------AGAS-------------------------
A6X424_OCHA4/234-403---------------------------------------------------IGFQ-------------------------
D2U945_XANAP/448-623---------------------------------------------------VGGS-------------------------
B0UW75_HISS2/318-493---------------------------------------------------ITYG-------------------------
Q0K4M6_CUPNH/2024-2201---------------------------------------------------LSFG-------------------------
Q6D5C2_PECAS/4139-4306---------------------------------------------------VGGG-------------------------
C5BAK2_EDWI9/2863-3032---------------------------------------------------VTLG-------------------------
Q9P9U6_XYLFA/2525-2700---------------------------------------------------VGRS-------------------------
Q9K0T0_NEIMB/1853-2027---------------------------------------------------ITYG-------------------------
Q1LCC6_RALME/2237-2414---------------------------------------------------LSFG-------------------------
A9BSR3_DELAS/1302-1471---------------------------------------------------LGKS-------------------------
Q8XYI3_RALSO/2318-2490---------------------------------------------------WGST-------------------------
A4G2E3_HERAR/1450-1621---------------------------------------------------IGAS-------------------------
A6VN27_ACTSZ/1852-2027---------------------------------------------------LTYG-------------------------
D0IXU6_COMT2/433-603---------------------------------------------------LGSS-------------------------
Q7N911_PHOLL/3665-3839---------------------------------------------------YGRQ-------------------------
Q1H434_METFK/1347-1522---------------------------------------------------IGTS-------------------------
Q7NU32_CHRVO/3082-3255---------------------------------------------------VGGS-------------------------
Q6G3N8_BARHE/1991-2168---------------------------------------------------VDFK-------------------------
B2JXD4_BURP8/2246-2424---------------------------------------------------LSWG-------------------------
D2RM28_ACIFV/822-989---------------------------------------------------LGMG-------------------------
C9LS29_SELS3/1059-1224---------------------------------------------------LGTS-------------------------
Q143Z8_BURXL/2299-2473---------------------------------------------------LSYG-------------------------
A7ZBF9_CAMC1/1393-1557---------------------------------------------------ASVN-------------------------
Q140X1_BURXL/260-438---------------------------------------------------LSYG-------------------------
A8ETC6_ARCB4/2319-2486---------------------------------------------------LDVN-------------------------
Q140X4_BURXL/2614-2790---------------------------------------------------YGTS-------------------------
B2JV25_BURP8/2057-2238---------------------------------------------------VGSS-------------------------
D1BMQ3_VEIPT/1399-1572---------------------------------------------------IGSS-------------------------
Q6G3U4_BARHE/1979-2157---------------------------------------------------AVFN-------------------------
C5AEA6_BURGB/711-883---------------------------------------------------FGSS-------------------------
C5D1Z2_VARPS/2965-3139---------------------------------------------------ASRN-------------------------
Q6FDM3_ACIAD/2917-3080---------------------------------------------------IGAN-------------------------
D1BNY3_VEIPT/1277-1447---------------------------------------------------IGST-------------------------
Q0BRJ1_GRABC/3343-3512---------------------------------------------------VGGS-------------------------
A7ZBG3_CAMC1/37-201---------------------------------------------------ADLA-------------------------
A8GKD6_SERP5/931-1096---------------------------------------------------ISAN-------------------------
A0RNY6_CAMFF/1383-1550---------------------------------------------------IGFK-------------------------
Q2KX68_BORA1/1752-1925---------------------------------------------------LSAG-------------------------
E6VYY1_DESAO/1086-1253---------------------------------------------------VSYS-------------------------
D3VFR2_XENNA/1025-1191---------------------------------------------------GKGN-------------------------
D3UYN1_XENBS/1023-1189---------------------------------------------------GKGD-------------------------
Q7VVJ2_BORPE/2180-2357---------------------------------------------------LSAS-------------------------
Q7NWR2_CHRVO/941-1107---------------------------------------------------ISAT-------------------------
D3UFL2_HELM1/1506-1673---------------------------------------------------FSYQ-------------------------
D3UFL2_HELM1/1687-1845---------------------------------------------------LSGG-------------------------
A3N0W9_ACTP2/1886-2054---------------------------------------------------...Q-------------------------
B4F0Z9_PROMH/927-1093---------------------------------------------------VGIK-------------------------
C5AJP7_BURGB/2314-2492---------------------------------------------------IGSN-------------------------
D2U951_XANAP/1315-1477---------------------------------------------------IGAS-------------------------
E0SDG8_DICD3/2492-2661---------------------------------------------------LGAQ-------------------------
G9AKP5_PANAN/2894-3069---------------------------------------------------LSTQ-------------------------
M9X2Y4_PASHA/1910-2075---------------------------------------------------LGTQ-------------------------
FHAB_BORPE/2928-3086---------------------------------------------------....-------------------------
Q0WAT6_YERPE/1232-1406---------------------------------------------------AGAE-------------------------
Q0WAT6_YERPE/638-798---------------------------------------------------..IT-------------------------
Q0WE34_YERPE/1754-1929---------------------------------------------------LGSQ-------------------------
Q7DDD8_NEIMB/1460-1630---------------------------------------------------.GEQ-------------------------
Q7VV06_BORPE/2141-2297---------------------------------------------------....-------------------------
Q8RGK3_FUSNN/9-171---------------------------------------------------ISYN-------------------------
Q8XQZ5_RALSO/2322-2494---------------------------------------------------VGGS-------------------------
Q9CPH9_PASMU/1932-2088---------------------------------------------------....-------------------------
Q9JY30_NEIMB/1712-1883---------------------------------------------------..EQ-------------------------
W8UEG9_YEREN/1054-1220---------------------------------------------------.GFD-------------------------

PF12708

B9J5T0_BACCQ/81-310---------------------------------------------------YVNL.DD.......---------------
Q8LE01_ARATH/37-285---------------------------------------------------SVSI.LE.......---------------
B9DJC5_STACT/126-337---------------------------------------------------SINI.DE.......---------------
B3VCX0_9CAUD/251-531---------------------------------------------------IINI.RD.......---------------
Q7URR5_RHOBA/63-307---------------------------------------------------SINA.TH.......---------------
C6Y0W6_PEDHD/63-325---------------------------------------------------IFKV.DD.......---------------
Q09C01_STIAD/75-328---------------------------------------------------IIDVTQA.......---------------
Q87XU1_PSESM/2-255---------------------------------------------------IFNT.KD.......---------------
B9XHK8_PEDPL/222-472---------------------------------------------------SLSI.VT.......---------------
B6IU75_RHOCS/4-239---------------------------------------------------QVSI.TD.......---------------
B6IPQ6_RHOCS/4-238---------------------------------------------------YVSI.TD.......---------------
I0UP14_BACLI/12-257---------------------------------------------------VVDA.TK.......---------------
Q9K7M8_BACHD/30-252---------------------------------------------------VVNA.RD.......---------------
Q1WEL6_9ACTO/177-402---------------------------------------------------SVSV.TS.......---------------
C7Q7K8_CATAD/223-454---------------------------------------------------SVSV.VT.......---------------
Q4L3X6_STAHJ/137-369---------------------------------------------------IVNV.DD.......---------------
Q4ZCD4_9CAUD/137-368---------------------------------------------------VVNV.DE.......---------------
B7SSN3_BPNF/103-332---------------------------------------------------GVSV.KT.......---------------
B3VMP8_BPPH2/104-333---------------------------------------------------GVSV.KT.......---------------
B4ALN0_BACPU/119-349---------------------------------------------------EVHV.DD.......---------------
C4L0K4_EXISA/96-329---------------------------------------------------RVDV.TD.......---------------
A8U6P9_9LACT/97-331---------------------------------------------------TVSV.LD.......---------------
Q2BCD1_9BACI/114-348---------------------------------------------------EVCV.KE.......---------------
Q1NEH2_SPHSS/30-265---------------------------------------------------QFDV.RD.......---------------
A8ATB1_9CAUD/133-334---------------------------------------------------ITNV.KL.......---------------
Q184L0_PEPD6/13-220---------------------------------------------------WINV.LD.......---------------
Q184L1_PEPD6/12-216---------------------------------------------------WINV.VE.......---------------
Q184L3_PEPD6/10-203---------------------------------------------------WINV.LE.......---------------
EXG1_COCCA/423-637---------------------------------------------------FISA.RG.......---------------
B4DBN1_9BACT/49-286---------------------------------------------------WINVVSSINPATGL---------------
B8GG97_METPE/553-766---------------------------------------------------ATNV.RS.......---------------
B8GGB4_METPE/99-337---------------------------------------------------ATNV.RS.......---------------
C2PN07_BACCE/26-237---------------------------------------------------TYNV.QK.......---------------
A6MAC6_9CAUD/1003-1205---------------------------------------------------GVNV.KW.......---------------
B6H126_PENCW/211-429---------------------------------------------------YRNV.MD.......---------------
Q4WIW4_ASPFU/77-298---------------------------------------------------FRNVVTD.......---------------
B8MQM9_TALSN/123-346---------------------------------------------------FRNVVTD.......---------------
Q5B3M8_EMENI/219-441---------------------------------------------------FRNVVTD.......---------------
B8NUX0_ASPFN/88-302---------------------------------------------------FRNVVSD.......---------------
B0XYP2_ASPFC/111-333---------------------------------------------------FRNVVKD.......---------------
A2QF38_ASPNC/247-469---------------------------------------------------FRNVVKD.......---------------
A9V1W5_MONBE/50-262---------------------------------------------------FRNA.KD.......---------------
B2ANL4_PODAN/41-256---------------------------------------------------FRNV.RD.......---------------
Q7S3S0_NEUCR/218-448---------------------------------------------------FRNV.LD.......---------------
C0RZI6_PARBP/251-482---------------------------------------------------FRNV.KD.......---------------
A1DL39_NEOFI/171-403---------------------------------------------------FRHVVND.......---------------
Q5B3Q5_EMENI/170-388---------------------------------------------------FRNVVTD.......---------------
A1DK98_NEOFI/13-234---------------------------------------------------WRNV.VS.......---------------
Q5ATA0_EMENI/247-460---------------------------------------------------WRNV.RD.......---------------
A2RBJ4_ASPNC/164-404---------------------------------------------------WRNV.RD.......---------------
C5FIT8_ARTOC/207-432---------------------------------------------------FRNV.KD.......---------------
A1CV41_NEOFI/241-464---------------------------------------------------WRNI.KD.......---------------
B6QWE5_PENMQ/71-313---------------------------------------------------FRNV.KD.......---------------
A1DIT0_NEOFI/146-388---------------------------------------------------FRNV.KD.......---------------
Q7S602_NEUCR/168-396---------------------------------------------------FRSV.KD.......---------------
B2AQ98_PODAN/93-316---------------------------------------------------WRNV.KD.......---------------
Q2GRE2_CHAGB/224-446---------------------------------------------------FRNV.KD.......---------------
Q0CRX2_ASPTN/83-312---------------------------------------------------FRNV.KD.......---------------
Q2H3L6_CHAGB/41-260---------------------------------------------------FRNV.KK.......---------------
Q7SGI7_NEUCR/41-267---------------------------------------------------FRNV.KD.......---------------
Q0UIW6_PHANO/70-284---------------------------------------------------FRNV.KD.......---------------
EXG1_COCCA/70-295---------------------------------------------------FRNV.KD.......---------------
Q4PER8_USTMA/242-464---------------------------------------------------FRNV.KD.......---------------
Q5I5C0_9HYPO/64-289---------------------------------------------------FRNV.KD.......---------------
Q2Z1W1_PHACH/69-290---------------------------------------------------FRNV.KN.......---------------
A8NNP9_COPC7/68-294---------------------------------------------------FRNV.KD.......---------------
Q401R8_LENED/64-291---------------------------------------------------FRNV.KD.......---------------
Q9P491_HYPAT/66-284---------------------------------------------------YRNV.QT.......---------------
Q9P8J3_9PLEO/66-299---------------------------------------------------YRNV.KD.......---------------
B2WKN5_PYRTR/68-291---------------------------------------------------FRNV.KD.......---------------
Q96V65_BLUGR/60-276---------------------------------------------------FRNV.KD.......---------------
C4JXY6_UNCRE/64-288---------------------------------------------------FRNV.KE.......---------------
B0XMS4_ASPFC/67-291---------------------------------------------------YRNV.KD.......---------------
C1H3L4_PARBA/65-289---------------------------------------------------YRKV.TD.......---------------
Q7S324_NEUCR/222-446---------------------------------------------------FRNV.RD.......---------------
B2AVA4_PODAN/55-279---------------------------------------------------FRNV.QD.......---------------
A9YZW0_9HYPO/60-287---------------------------------------------------FRNV.KD.......---------------
Q7S6I5_NEUCR/41-263---------------------------------------------------FRNV.KD.......---------------
B2AQV4_PODAN/41-263---------------------------------------------------FRNV.RD.......---------------
B6QD92_PENMQ/79-303---------------------------------------------------FRNV.RD.......---------------
B0XLY8_ASPFC/92-316---------------------------------------------------FRNV.KD.......---------------
B6QUF4_PENMQ/72-296---------------------------------------------------FRNV.KD.......---------------
Q4WLX5_ASPFU/93-315---------------------------------------------------FRNV.KD.......---------------
B2W2R6_PYRTR/89-320---------------------------------------------------FRNV.KD.......---------------
A7EWZ9_SCLS1/45-272---------------------------------------------------FRNV.KD.......---------------
A7EV58_SCLS1/85-323---------------------------------------------------FRNV.KD.......---------------

PF00295

PGLR1_MAIZE/68-409---------------------------------------------------CGGTGKQTILIPK.---------------
PGLR_YEAST/43-361---------------------------------------------------CSSIVIKDLTVPA.---------------
PGLR_SOLLC/103-443---------------------------------------------------CSSRTPVQFVVPKN---------------
PGLR1_ASPNC/50-368---------------------------------------------------CSDVVLSSIEVPA.---------------
PGLRB_ASPFN/46-363---------------------------------------------------CSTITLSNIEVPA.---------------
G3XYE5_ASPNA/45-362---------------------------------------------------CSTITLNNIEVPA.---------------
M2QZD9_COCSN/45-364---------------------------------------------------CTDIVISGMTVPA.---------------
M4FG11_BRARP/47-378---------------------------------------------------CQAPAPSQVLIPK.---------------
PGLR1_ASPOR/52-367---------------------------------------------------...IVLKNIAVPA.---------------
Q6D880_PECAS/62-401---------------------------------------------------CGQGKAVRLSAGSS---------------
S0EGK1_GIBF5/43-372---------------------------------------------------CTNIVLAGFQVPT.---------------

PF03212

C4ZYR0_ECOBW/1057-1180---------------------------------------------------VNSL-------------------------
A0A024L0X6_ECOLX/430-556---------------------------------------------------LANL-------------------------
J7RCG5_BORP1/480-606---------------------------------------------------VAEV-------------------------
F4LI63_BORPC/332-450---------------------------------------------------VNSL-------------------------
F4LE36_BORPC/583-704---------------------------------------------------VQDM-------------------------
PERT_BORPA/444-564---------------------------------------------------VGAL-------------------------
TIBA_ECOH1/506-627---------------------------------------------------VGAL-------------------------
A0A017IV98_ECOLX/494-616---------------------------------------------------LDTL-------------------------

PF01095

PME13_ARATH/301-598---------------------------------------------------NATV-------------------------
PME42_ARATH/215-510---------------------------------------------------DVVV-------------------------
PME23_ARATH/257-554---------------------------------------------------NAVV-------------------------
PME44_ARATH/212-509---------------------------------------------------DVSV-------------------------
PME16_ARATH/213-502---------------------------------------------------DAVV-------------------------
PME24_ARATH/255-548---------------------------------------------------DIVV-------------------------
PME51_ARATH/240-544---------------------------------------------------DVTV-------------------------
PME61_ARATH/273-571---------------------------------------------------DITV-------------------------
PMEU1_SOLLC/272-570---------------------------------------------------DVVV-------------------------
PME2_ARATH/276-573---------------------------------------------------DATV-------------------------
PME35_ARATH/228-514---------------------------------------------------HAVV-------------------------
PME21_ARATH/255-552---------------------------------------------------DIVV-------------------------
PME47_ARATH/307-606---------------------------------------------------AVTV-------------------------
PME12_ARATH/237-533---------------------------------------------------SLVV-------------------------
PME26_ARATH/660-954---------------------------------------------------HVTV-------------------------
PME17_ARATH/206-499---------------------------------------------------NAVV-------------------------
PME43_ARATH/391-688---------------------------------------------------NVVV-------------------------
PME1_SOLLC/233-531---------------------------------------------------NAVV-------------------------
PME58_ARATH/259-556---------------------------------------------------NVVV-------------------------
PME46_ARATH/257-550---------------------------------------------------TIVV-------------------------
PME34_ARATH/284-583---------------------------------------------------DIIV-------------------------
PME22_ARATH/240-525---------------------------------------------------NTVV-------------------------
PME32_ARATH/214-511---------------------------------------------------DAVV-------------------------
Q9S767_ORYSJ/304-592---------------------------------------------------DVVV-------------------------
B4FCY2_MAIZE/251-546---------------------------------------------------NAIV-------------------------
B9IKC0_POPTR/283-579---------------------------------------------------NVTV-------------------------
K7KZN7_SOYBN/877-1170---------------------------------------------------DAVV-------------------------
U5GQ29_POPTR/312-608---------------------------------------------------DVVV-------------------------

PF14592

F0S763_PEDSD/26-457LKAGDTLLLKD---GIYKDIQLVV-------------------------KRSGS--KEKPIVIAAQNG---GKV------
G0L7T1_ZOBGA/39-464ANPGDEIIMAN---GDWNDVQIRF-------------------------LGYGK--EGQPITLKAETP---GKV------
CSLB_PEDHD/28-451VKPGGLVQIAD---GTYKDVQLIV-------------------------SNSGK--SGLPITIKALNP---GKV------
A2TXR8_9FLAO/26-451AKKGDNIVLKN---GTYKDVNIKF-------------------------IGEGT--ENEPITLSAETA---GEV------
A0M0H6_GRAFK/28-451AGPGDVITLAN---GVWKDAELIF-------------------------KGNGT--KDQPITLNVESK---GKV------
A3UA26_CROAH/32-454CVAGDEIVLKN---GVWNNVQIDF-------------------------YGEGT--EQKPIILRAETA---GKV------
L7W9A4_NONDD/2-423SEPGDVITMKN---GVWNNSQIKF-------------------------HATGT--QNRPITLRAETP---GEV------
F4AY36_KROS4/8-431AEPGDVISLKD---GVWKDLAIKF-------------------------YGEGT--EANPITLKAENA---GKV------
T2KLV7_9FLAO/30-455AKPGDHLVMAN---GVWTDIIIKF-------------------------KGVGT--EAQPIVLEAETP---GKV------
E6XAU2_CELAD/28-451AKAGSEIIMKN---GVWNDIQIKF-------------------------YGEGT--KENPIILRAETA---GKV------

PF16318

E5C6D6_9BACE/316-599---ATYKLGTQ---.......TEI--------------------------------.PKALYIMGQAPGDGEEL------
D7J093_9BACE/318-599---TTYELGR.---.......LEI--------------------------------.KKPLSILGQEPSTGETR------
A5FNJ9_FLAJ1/248-520---GVYSTTGE---.......IIV--------------------------------.NKTLIFRGVRP..ENKP------
E2NFR1_9BACE/253-527---GEYTLTSA---K......LQI--------------------------------.NNNVTIAAQNS..GNLP------
A5ZFT6_9BACE/253-527---GEYVLTAA---K......LQI--------------------------------.NNNVVIAAKNS..AEPP------
E4RYT9_LEAB4/243-509---GTYT.SGD---.......ITI--------------------------------.SKSISIKGARP..NDKP------
C2FSM9_9SPHI/246-519---GNYDFVGA---TGVS...LAL--------------------------------.SKPVAIVAARV..SEKP------
C6Y3U4_PEDHD/247-515---GNFDFAGA---T......IAV--------------------------------.TKSISVVAFQA..TERP------
D8DZJ8_PREBR/248-514---GTYVIANE---EGLASS.TTI--------------------------------.SKNISIKSVKS..GDRA------
D5ETE2_PRER2/247-519---GTYGIATD---EAAFGGSVTV--------------------------------.SKNLTIKGLRQ..NDHP------
D1PWW5_9BACT/248-521---GEYKVLSD---EGSTTS.LNI--------------------------------.TKNVTIKSLRS..YDRA------
D7IDS3_9BACE/184-486---GVYEMDGN---.......IDL--------------------------------GTTTLTIRGDKV.NHAKL------
D7JZG1_9BACE/181-476---GTYYISGD---.......LNF--------------------------------GVNNVQLRGNKTRGNANV------
D4VL73_9BACE/180-472---GSYTISGD---.......LNL--------------------------------GVNNVQLRGNKV.NHAKV------
E6K656_9BACT/179-459---GNYTLSGV---.......LDF--------------------------------GANTVQLRSIDKAKPANV------
Q8A8Z1_BACTN/189-475---GEYTISGP---.......IDF--------------------------------GARKVTIRGNKI.NHSKI------

PF07971

U7PU00_SPOS1/332-877ARVGMSFISTD...QACANAEAEIP........DWD................FD..GTVHAAQNAWRDKL.SPI......
G2NMH0_9ACTO/619-1147LRLATSLISVD...QAKKNLAAELP.........AK..............HSFE..RVRKDAQKAWDKIL.GKV......
G0FHU2_AMYMS/244-723VQVGLSFVSVD...GAKANLKAEN...........T.............GKSFD..TVAAGARKAWNAQL.GKI......
J4HRZ5_FIBRA/329-845IRVGISFVSAE...QACLNAETEVG........SAT................FD..EIITQSQTLWNEQL.SKV......
R5AV27_9BACE/238-743VKVASSFISPE...QALLNI.KEV...........E.............GKSFE..QLVQEGKTEWNSVL.GRV......
R6ZMR2_9BACE/255-763VKVGLSSVDAA...GAKANVETEI...........P.............DWNFD..KVRQAAHEAWNKEL.AAI......
Q5LHF2_BACFN/245-751VKVGISAVDIE...GARKNVETEI...........P.............DWDFD..GVRKDARKAWNETL.SKI......
A1S316_SHEAM/272-763VKVGISAVDKS...NALDNLTSEL...........P.............HWDFD..KVRSDANAAWQTEL.ERM......
A8L8V7_FRASN/271-746LRAAVSYTSVE...GARANLEAEY...........P..............SSVE..AVASATRAEWNRRL.STV......
G4ND73_MAGO7/262-774ARTATSFISTD...QACRNAEQEMP........KFD................FE..SAQEAAVAAWRKKL.SVV......
E8V2C0_TERSS/272-764ARIGTSFVSVE...EARKNLHAEI...........P.............TWSFD..TVRDQAKAAWNKAL.GAI......
F4CDU4_SPHS2/240-732IKVALSMTDEN...KALQALGEI............G.............DWNFA..RVKNEAADKWEHEL.QKV......
I6SXV1_ENTHA/204-697.RFGTSFISSE...QALFNLEQEL...........H..............QTPD..DYLLNSSQQWQNYF.DRI......
M2N2U4_BAUCO/275-769SRVGISFISSA...QACQNIASEIPP.......NTS................IQ..TLVSRAQTRWNQQVFSRV......
A4AN18_MARSH/251-760IKVSISSVDQE...GAKKNMTTEL...........P.............HWNFE..EVKEKVATTWQKEL.ERV......
R5JRR1_9BACE/250-759IQTGLSLVSIE...GARQNLEKEM...........IRP..........FRWDFE..ACVNNARQTWNSLL.GKI......
D5EVW5_PRER2/246-768VKIGLSYTSIA...NAKLNLETEA...........K.............NLTFD..EALAATTQKWHKAL.NRI......
Q481A5_COLP3/308-820MTVGISYVSLA...NARENLAKEQ...........TETLVN...SSQTKEKYFE..EVRKEAYQTWNKTL.EKV......
K2R029_MACPH/268-785ARVGMSFIGVE...KACQNAESEIP........GYD................FE..AVHTAAEDAWRHKL.SVV......
R6FAY9_9BACE/252-751LKVGISFLSCL...RAEANAHSEIP........HWS................FD..EVHRQLLDKWETLF.SKI......
M7U9N7_BOTF1/265-776ARVGVSYISSD...QACANAEAEIP........GFD................FA..AVQSAAETTWRNKI.SPI......
N1PXL6_MYCP1/318-821VRTGVSFVSVE...QARRNIEIES...........PA............SKSFD..DAVEELKEAWVEKL.GRV......
R5IB22_9PORP/238-730AKVAFSTVSID...NAKENMMSEI...........S.............HWDFE..QIKSDTENAWEDLL.TRI......
C7M4B4_CAPOD/261-744LKVGISYVNIA...NARENLEKEI..........GN..............RTFD..EVYTTTRQTWNDAL.R.A......
G8TN43_NIAKG/281-774MKAGISFTDVA...HAKMNLEHEI...........T.............GWDFD..KVHNSARALWNQAL.EKI......
X5D9C9_9BACT/240-768MKAGISYTSVE...NAEVNIQEEL...........P.............DWNFN..SCVARANEEWNSML.GRI......
R7DDV2_9PORP/208-728ARYGISFISIE...QAKKNLQNEI...........P.............DFNFD..KTKNNGRKIWNEAL.GKI......
Q8A193_BACTN/246-735IKVAISSVSCD...NAAMNLQAEL...........S.............HWDFD..KVVKMSSDRWNKQL.DKM......
B4EIV1_BURCJ/297-798MKLGISFVSEA...NAKANLRAEN...........PATDA.....RGERNWRFD..KVRRAASAAWNARL.NAI......
F4CBM6_SPHS2/266-760IKFAISPVSMQ...NALANMQAEI...........P.............HWDFD..RVKHHGQQLWEKEL.QKI......
R6WZT0_9BACT/248-736MKVALSPVSIE...GAEANLEAEL...........P.............GWNFE..ATRLAADKAWNDEL.SKV......
G8NSC1_GRAMM/270-787VRVGISYVSEA...DARENLKAEN...........PE............GTTFE..ALREKAQAAWNQKL.SQI......
Q1IUD1_KORVE/257-751VKTALSGVSTE...GALKNLESEI...........P.............SWDFD..GVRRTAHESWRKSL.ARI......
E5R5G1_LEPMJ/250-756ARMGLSFTNTE...QACGNAEREIPG......PDFH................FE..PLVTAAESAWRKKI.DPI......
F4CCU7_SPHS2/237-742IKVASSFISHE...QATLNL.KEI...........G.............NKSFE..TLKQEGKDVWNEAL.SRV......
Q0CFC9_ASPTN/249-747SRVGISWLSTE...KACQNVASEIPA.......DTE................LE..SVVSDAQDEWDERVLSKI......
Q5LHF3_BACFN/226-731ARIASSFISFE...QAAQNL.KEL...........G.............NDSFE..QLAQKGNDAWNNVL.GKI......
W8F287_9BACT/269-764VKMALSGVSTE...GALRNMRAEV...........P.............GWDFE..AVKRAGQALWQQEL.SKV......
R6SN01_9BACE/239-746VQVSLSLVDQQ...GCKNNYEAEL...........KP...........YGWDFD..AVHQAAKQEWNTLL.SKI......
R5KV09_9BACT/237-726VKVALSTTSIE...NARLNMQREA...........A.............SWSFD..GYAAQADKAWDDVL.GHI......
R6XA11_9BACT/239-735VKVGISYMGYG...KAKENIR.ELG........SWD................IE..DARKKAVDTWNGIL.SKI......
R6VVJ6_9BACT/252-740VKVGISPVSMS...GADRNIESEL...........P.............GWDFE..ETVRRTARKWEREL.DKV......
Q9PF36_XYLFA/270-764VKVGLSAVSAA...NALANLDAEL...........P.............DFDFA..RVHAEAVAAWENAL.ARA......
D8Q3G4_SCHCM/263-790ARVGVSLISSE...QACQNAEEEIP........DFD................FE..RVYEEGRAEWNELL.GRI......
R6D727_9BACE/232-737ARVASSFISFE...QAELNL.KEL...........G.............GRSLE..QLKDDGEKKWNDVL.GRI......
X5DYF1_9BACT/276-770VKFALSPVSMA...GALKNMAAEI...........P.............HWDFE..KVKAETQQKWNNEL.AKI......
E2PV07_STRC2/616-1149LRIATSLISVD...QARKNLADEIP.........PG..............TPFE..EVKERAQDAWDALL.GRV......
I3ZBQ9_TERRK/285-776VKVALSSVSED...SAIANMDAEV...........P.............AFDFE..STHTAAVAEWEKAL.SAA......
R6MN00_9BACE/215-700LKIGFSFVSIE...NAKMNLEYEM..........FH..............KDFA..QVAREADYTWEKLL.SKI......
D8PPV4_SCHCM/271-763VRVGVSFISTE...QACKNVDNEI...........PD............GTTLE..DTARKTRSAWAEKL.GRI......
G8TCQ4_NIAKG/237-728IRIGTSFSSVA...EARKNLLAEI...........T.............TWNFA..SVQSNAKKAWQQAL.SQI......
I2G215_USTH4/348-881VRLGMSLISEE...QARYNLDVEM...........HN............GTSVE..VVVDELIDVWRTKT.DRI......
G0AF00_COLFT/383-871MKVGLSYVSSD...NARKNLEQEN...........P.............GWDFN..AVRDAADNAWNTRL.NTI......
M4NBS4_9GAMM/425-960LRIASSLISLE...QARRNLALEIA.........PH..............ESFD..EVRERAQRQWDKQL.GIV......
R5PL83_9BACT/257-780FKIGLSYTSIE...NARHNLEKEA...........S.............GVTFE..KARTLAKNKWNEAL.SRI......
L2G5N5_COLGN/293-801ARVATSFHSTE...RACAHATAEIP........DYN................VE..RVYKEAKRAWKKKL.SPI......
G0RIK4_HYPJQ/262-771ARTGISFISSA...QACSNAEKEIT........EWD................VD..KYASEAADVWREKL.SPI......
I3ZE22_TERRK/239-727MRVGTSFLSID...QARENLQHEI...........P.............TWDFT..AAQRKLRAQWNDKL.QRL......
E9F417_METAR/347-850VRTGVSFISVE...QARKNLDIEI...........PD............SHSFE..STVEQTKKAWLDKL.GRI......
D2QHT3_SPILD/252-742LKVGISPVSSA...NALGNIRAEL...........P.............HWNFA..KVAQEADAAWNREL.SKI......
Q8P357_XANCP/267-799VVSAISHVDAE...GARTNLRADG...........MQG.........GTLLGLE..QMRQRAQQTWRTEL.ASV......
R6MN58_9BACE/244-752VKMGISAVDTE...GAKKNLDAEI...........P.............AWDFE..KVRSDARQAWNDYL.SKI......
R6F0X9_9BACE/239-744LRVASSFISID...QAHLNL.REV...........E.............GKSFD..AVKNACRDSWNAAL.GRI......
B5HEX3_STRPR/279-803VKVGLSYTGIE...GARKNLAAE............TG...........DSYDFD..ATRAGLRATWQRQL.RSV......
C7PRR1_CHIPD/254-759VKVASSFISPE...QAELNLQKEI...........G.............NSSFD..QIKEKAKSAWNTEL.GRI......
E8RS95_ASTEC/249-745VKVGISAVDIE...GALKNLEAEQ...........P.............GFDFE..GTRRAAHLAWQDEL.SRI......
F0RGV3_CELLC/254-736VKIGVSYVSIE...NARENLEKET..........AN..............KNFD..DVYATTKAAWNKTL.STV......
R5LY91_9BACE/242-735VTTAISGVSME...GAARNLAAEA...........P.............DDDFD..KYLATTQKNWNEQL.SKI......
A6LGN5_PARD8/295-770FKAGISFVSLE...GAEKNLKAEI...........K.............DWDFD..AVRSRARSLWDTAL.AKM......
R6KI45_9BACE/221-722VRTASSFISHD...QACLNFNREV...........A.............GRSLA..EVSAEAKKIWNDQL.GRI......
D1BF94_SANKS/371-884VLIGVSTIDAA...QARDN....VS.........RA..............GGVD..DMLRTAADAWRRVL.STV......
Q0UTF3_PHANO/196-689ARMGLSFISTE...QACQNAEREIPG......PEFD................FD..GLVTAAEQAWHKKF.TPI......
A6LFI6_PARD8/243-749VKVALSVVDPE...GAEKNLEAEL...........P.............GWDFD..KTREESTHIWNEAL.NLI......
F2KXB9_PREDF/394-872MKIAISFKSIE...QARKYLAKEIP........AWD................FA..AVQKNGLRRWNSIL.SDI......
Q0UGQ6_PHANO/177-697ARIAVSLISSE...QACQSAESEIS........DFD................FD..KTRKTAENAWREKL.SPI......
R6CWA8_9BACE/238-728VKVGLSTVSVE...GALQSLKKEN...........S.............QWNFD..NVRNENQAEWNKQL.SVI......
F0SF03_PEDSD/222-742LKYGISFIDEN...QAKANLAREI...........K.............DFDVA..RVQNKGKEVWNESL.GKI......
A1CAZ9_ASPCL/248-746SRVGISWISTD...RACQNVQDEIPH.......GTK................FA..SVVEETKEEWNSVVLSKI......
B8NXN6_ASPFN/165-672ARVGVSFMSVE...QACSNAETELP........NFD................FA..NTVSAAESAWRDKL.NVI......
R5GRT6_9BACT/247-730VRMALSSVSLA...GAMANLDSES...........A.............GRSFE..QVKTSADSVWNAAL.SRV......
D3PUH5_STANL/243-767AKVGLSYTGMD...GARKNLDAE............TG...........DSYDFD..AVREQLHDDWVDKL.NSI......
R6VFG8_9BACT/269-760VRVALSAVGTQ...GARANLEAET...........A.............GRTFD..ELVAEARGRWSDEM.ALI......
R5IRF6_9PORP/210-729IRYGVSFISEE...QAKNNLIREI...........P.............DYNID..KIIEQGRNIWNEAL.GKI......
Q5LAE2_BACFN/237-726MKVAISTVGVD...GAHKNMEKEL...........A.............DWDFD..GTRQKAKDSWNSYL.SRI......
C7PM40_CHIPD/270-749MKAGISFVSID...GAKANLQAEI...........K.............GWDFD..GVQQHTTALWNQAL.GKI......
K1VMQ9_TRIAC/329-807VRIGVSFISIE...QARRNIDLEI...........PD............GQSLA..KTSRQTREAWAEKL.DRL......
F9XLT5_MYCGM/322-825VRYGLSWLSIE...RACENAENEVG........DWN................FE..RLRRESEKAWRKKL.API......
R5GD99_9PORP/263-747VQMGVSFVSIE...NARENLRQEV..........SG..............KNFD..EVRREAENLWEKDL.SRI......
V2X6S9_MONRO/259-767ARVGVSLISTE...QACWNAEKEIP........DWD................FE..RVVKESEGAWRDIL.VRV......
Q759D8_ASHGO/338-853SHVGISFNKDDGVEVAKWNIVRDIPPE.....HKFD................LS..WSVENALKRWDEEVFSKT......
A6L7S3_BACV8/260-746VSMGVSFVSIE...NARLNLEKEQP.........FG..............TTFD..KLRAEARKKWNDDL.SRI......
Q59VA0_CANAL/267-777SRVGISFISTD...KACANI..EDE........NFD................FD..SMVQQNQQQWKNEVFQKF......
G3JDG1_CORMM/239-754ARVGLSFKSSE...QACHSAETEIGR......PLED................FD..RLVGEAQDKWREKL.SPI......
R5JG70_9BACE/235-740VRVASSFISFD...QAELNL.QEL...........G.............NLSFE..QLQAKGKKRWNEVL.SKV......
T5AF87_OPHSC/250-762ARVGISFRSAE...QACRSAEAEIPD......PLGG................FD..GLVETARDQWRQKL.SPI......
R5FMY1_9BACT/235-740VRVASSFISPE...QAEVNL.KEL...........G.............QRSFE..EVKQAGRQRWNEVL.GRI......
R7EQ20_9BACE/238-724AKVGLSIVSEK...NARENLEAEV...........T.............GFDFD..AVRSAARSAWEQAL.SVI......
Q8P6S1_XANCP/269-764IKVGISAVSAD...NALANLDAEL...........P.............DFDFA..RVHAQAVAAWEKEL.GRV......
R7YLH4_CONA1/246-747SRVGISFISTA...KACQNVNNEIPP.......GTE................LP..ALVSRAVDRWNTDVFSKV......
A5FHD9_FLAJ1/276-770IKMALSPVSSA...GALENMKKET...........P.............NWDFE..QVKKQSQEVWNKEL.NKI......
C1F5Z0_ACIC5/273-764AKIGISYVDLK...GAEGNLKAEA...........A.............GKSFA..QIRQEETAAWNRAL.GVI......
N1JJ74_BLUG1/238-758ARVGVSFISSE...RACTSAETEIP........EYD................FT..STLTAAENMWRDKM.SPI......
R5I4F3_9PORP/245-752VKVGISAVDIN...GARQNVEKEI...........P.............SWNFD..SIATAAQNEWNNYL.KTI......
E5A4R8_LEPMJ/277-783SKVGVSWISAD...KACQFI.DEIP........HWD................LN..ATVQAAKDRWNQEVLSKM......
U5VWI8_9ACTO/583-1111LRLATSFISLD...QAHRNLDLEV..........TG..............KSFS..AVNRAAAVAWNDRL.DVI......
G2ND96_9ACTO/286-798MRIGISYVSQA...GAEANLRQEI...........AP............RAGVD..DVARAGARAWDREL.GSV......
M3K288_CANMX/252-757SRVGISFISTD...QACSNI..EDK........NFD................FD..AMVQQNQQNWKNEVFDKF......
F2KZ10_PREDF/243-748VQIASSFISDE...QALRNL.KEV...........E.............GRSFD..EVKEAGRTEWNRVL.GRI......
G4NF02_MAGO7/324-842ARVGVSFMSVD...QACANAEAEIP........TFD................FD..GTFRAAQDSWREKL.SVV......
R6F0G4_9BACT/261-751VQVGVSFVSID...NARENLNAEQ..........NG..............FEFE..KVVKEGHDEWARTL.DRV......
M7SRL0_EUTLA/324-836VRTGVSFVSVE...QARKNLDIEV...........PD............GTSFE..DTVEHVKSTWLEKL.GRV......
Q0CS76_ASPTN/248-771ARVGVSFMSVD...QACANAENEQP........DFD................FP..ATVAAAESAWRKKL.SPI......
K0F0T9_9NOCA/266-746MRTAISYVSVE...GARRNLAAEV...........G.............AKDFD..TVRAEAHAAWQRRL.DQI......
C6Y1K7_PEDHD/382-893MKVALSYTNIA...NARKNMDTEC...........P.............GWDFD..AVRQDSRKVWNEWL.GKI......
M3C6Z1_SPHMS/281-790SRIGISFISTE...KACFNMNEEIA........SWD................LN..VTVAAAVEEWNRDVFSKI......
G8NVE4_GRAMM/274-775ARIGTSFISFE...QALFNLREEV...........G.............ERSQS..AVKEATEKHWSEML.ERI......
F4B1S1_KROS4/238-724IKIGISAVDEA...GARKNLETEI...........G.............NKTFD..QVKQEAQSTWESQL.EKI......
R6K5T3_9BACE/244-752AKVGISSVDEE...GARLNVEAEI...........P.............NWDFE..GVMKQANTAWNEAL.GKI......
F9YPS9_CAPCC/306-792VRVAVSSVSEE...NALANLDLY............D.............KRTFA..EVRQKAHDTWEKHL.SSI......
T0M9R2_COLGC/270-789VRRGVSYTSTD...VACKNMKRELP........DTD................FN..KVVAASNAMWEDKL.GRI......
I2FQ04_USTH4/294-814VRMAISWVSTE...AACKFAASEIPAF....LFPTA................LS..TTASSTHQRWNNLLGDSL......
J4KN82_BEAB2/261-780VRVGLSFISAD...QACKNAEKEIP........NFG................FR..KTRDQAEAAWRSKL.NVI......
F6GE18_LACS5/239-723VKVGISAVDIE...GAKENLKAEI...........G.............NQTFN..QVKKTAQDFWEKQL.QKI......
S7ZU94_PENO1/250-748SRVGISWISSD...QACRNVNNEIPS.......GTE................FA..AVVSDAVAEWNAKVLSKI......
S8F5G2_FOMPI/253-775VRAGISFISTE...QACANAEEEIP........TFD................FD..GVQAAARAEWNELL.GRI......
F0XC67_GROCL/1247-1767ARVGVSFLSSD...QACTNAESEIP........EWD................FD..GTILAAQDAWREKL.ASI......
H1YA33_9SPHI/255-747VKVGTSFSSIE...GARKNLQAEI...........P.............GWDFE..AIAAQSKATWEKSL.SQI......
I3YHM3_ALIFI/277-762VKVGLSAVSAE...NARRNMQAEC...........P.............GWDFE..AVREATRRAWNGEL.SKI......
F8EA41_RUNSL/302-822VKVAISHVSVE...GARKNLQAEV...........S.............HWDFD..KVKNDARNTWNEEL.KRV......
F8JRR9_STREN/283-770AAVGISYTTDA...AAGLNLAKEI...........R.............GFDFA..KVRKANHDAWNAVL.RRV......
Q8A113_BACTN/217-734LRYGISFISAE...QAKKNLQRDI...........T.............TYDVK..AVADAGRRIWNKTL.GKI......
F4CF68_SPHS2/232-735VKVASSYISQE...QAELNLDREL...........GD............DKKLE..VTKNRAATIWNKHL.GRI......
W0ESP1_9PORP/261-749VQIGVSFVSTE...NARQNLDNEQ..........QG..............FQFD..RVAHQARQQWNDIL.SRV......
W0EKX8_9PORP/235-730TKVALSTVGVE...GAQSALLTES...........P.............NWDFE..TVKTESQNLWRKYL.SKV......
I3ZHR8_TERRK/249-728AKVGISFISAE...QAKKSIQVEIP........GWS................FE..AVRHANNKLWNAEL.EKL......
C1GGA7_PARBD/269-776VRVGTSFINTD...RACSNAEREQP........DFD................FD..RTMSAARDAWAKKF.EVI......
R5MRY8_9BACE/242-741LKVGISFLSSL...KARQNAHSDIP........HWS................FE..TAHQQLLTQWEDLL.QRI......
I3YLR2_ALIFI/244-702LKIAVSLRSES...NARKFLAEQIP........GHD................FE..KVKAAARETWNRRL.NSI......
R7JIM0_9PORP/267-759VKVALSGVSTA...GALKNLQAEA...........A.............SAGFD..ELASRASNTWNKAL.SVI......
R7LIY3_9BACT/48-535VRMGVSFVSIE...NARENLEAEQ..........RG..............RSFD..ELRTEARKRWNDDL.GRI......
H8KZ70_FRAAD/281-774VEVAISDVDEA...GAIANLHAEA...........P.............DFDFD..RIRRQAEQTWRHQL.ARV......
R6TIU0_9BACE/253-761VKTGLSAVDME...GARANVEQEI...........P.............GWDFD..GVRRAAAAAWNREL.SRI......
Q8PBN8_XANCP/274-763VTVALSPVSED...SAIANLAAEV...........P.............GFDFD..RVRADARAQWTQAL.SAI......
D5BC60_ZUNPS/246-763IKTGFSYTSIE...NARLNFAKEA...........K.............DLDFS..TAKNRAEKIWAEEL.SKI......
I3ZYE3_ORNRL/257-746VKVALSSVSTD...NALQNMA.T............E.............GEGFPFDEIRDKAKLAWNEAL.ESI......
Q8A325_BACTN/237-729CKVALSSVSME...NARQNMEQEA...........P.............HWDFD..RYVAAADADWEKQL.GKI......
R6TIT6_9BACE/233-738VRVASSFISPE...QAELNL.KEL...........G.............DAGLE..ELAQQGRDRWNEVL.GRV......
R6WV50_9BACT/248-768LRIGLSYTSVE...NARANLRAEA...........D.............GLDFD..DVRRRTAAKWDEGL.GRI......
E9E5Q1_METAQ/268-792ARVGLSFISTE...RACNNAEAEIP........DFN................FK..NVTRAAEKAWRTKL.NVV......
X5E0Z5_9BACT/262-743VEVGISYVSIE...NARLNLNFES..........QN..............FDFE..ATRKQAEEKWNEAL.STI......
R6CRV2_9BACE/264-756VKVALSPVSMD...GALKNLRAEA...........S.............GRDFN..QIAEAVRTDWNDEL.KRF......
W0F0W6_9SPHI/235-739MRMATSFISFE...QAELNLKREL...........A.............KDGFD..QTMVKAKKLWNERL.GKV......
F2ICV0_FLUTR/264-760LKVSLSSVSME...GAVENMKYET...........P.............DWNFD..QYRKAGESLWEKEL.NKF......
L0G0Y1_ECHVK/248-737LKVGISPVSVV...NAMDNLKEEI...........P.............HWDFK..RTVADAKSNWNHEL.NKI......
R6VPA7_9BACT/239-729IKVAISSVSEE...NALENLRREI...........P.............HWNFE..QVAEQARAAWEKEL.GRV......
R6Y8B5_9PORP/251-743VKVATSFTSID...NARKNLAAEI...........P.............GWNFN..EVRQASSDIWNQAL.GQI......
F4KQF8_HALH1/232-734VKLASSFISHE...QAELNLQREI...........G.............ADAFE..VTKEKARLAWEKIL.GRV......
W5WJ40_9PSEU/294-773VKVGVSFVSVD...GAKANLKSEN...........S.............TKSFD..QVATAARKAWNDRL.NQI......
G8P189_GRAMM/260-741ARVGTSFISIE...QARENLKLEI...........P.............DWDFK..AVQLKLRQTWNEKL.ERV......
A6LE00_PARD8/236-739ANVASSFISTE...QAELNL.REV...........G.............DTGFD..QLVTKGKEIWNREL.GKI......
F8PL93_SERL3/210-728ARVGVSFISPE...QACANAEDEIP........DFD................FD..GTVQQSRAAWNDIL.TRV......
M3A2E6_MYCFI/226-730VRTGVSFVSIE...QARANLEIEA...........PA............RVTFA..QAVDDLKNAWLEKL.GRV......
F5WRB0_ERYRF/193-683.HASFSHQSLE...QAHRNQSRES...........D...............DFD..TMYNHAFTLWSQNL.GRI......
W5WNG1_9PSEU/603-1139MRIATSLLSTE...QAKRNLEQEVS.........AA..............DTFD..TVRARAQKAWDDAL.HVI......
E3FCN8_STIAD/235-746MSIATSFISVA...QAQSNLAQEI..........GT..............KSFD..TVKQEAQSAWDSVL.GKI......
R5PP34_9PORP/236-741ARVASSFISYE...QAERNL.KEL...........E.............NKTFE..EVKAEGQKVWNKIL.GVF......
V6KU68_STRRC/239-757ATTAMSYVDAR...GAAGNLGAE............GG............RS.FD..AVRERAREEWEKRL.ADV......
R5P2L7_9BACT/238-729CKLAISPVSIE...NARLNLRTEA...........D.............GKSFD..AIKSQAYEAWNKEL.GKM......
D6D181_9BACE/235-738AKAASSYISAE...QAVITLNDEL...........GK............DKNLE..ATKARGYKTWNELL.NRI......
E9F2Y7_METAR/263-770ARVGLSFMSSE...QACANAEDEMP........EFD................FD..KHARDAQDAWRKKL.SPI......
D6D0Y6_9BACE/235-740AKVASSFISPE...QAELNL.KEI...........G.............NKTFE..QTKEAGRKAWNNVL.GRI......
R6WSC1_9PORP/258-746VKMGVSFVSIE...NARLNMNTEQ..........PD..............FNFD..KVRAAAGKMWNDDL.SRV......
R6VUD4_9BACT/261-751VQIGVSFVSIA...NARENLDHEQ..........QG..............FQFD..KVRAEARKRWAETL.NTI......
A2R7B1_ASPNC/261-757SRVGISFISTE...KARSYITSEIP........SWT................LN..DTVQAAVDEWNQDVFSKT......
D3IB54_9BACT/265-751VLMGVSFVSME...NARLNAEKEL..........TQ..............TTFE..SLRLRAEEAWNNDL.SKI......
A4X9V9_SALTO/597-1142LRIATSLISLD...QARKNLALEIA.........EN..............DTFD..SVRARAQDLWDDKL.KVI......
S5VGA2_STRCU/302-788AKVGISYVSAA...DAVANRTAEN...........P.............GWNFT..DVRTAAHTAWDNTL.GRV......
R6VNE2_9BACT/223-708AAVGLSAVSAE...NARENALEEV...........P.............ELDFD..TVRARAEELWREVL.GRI......
A6RG74_AJECN/257-764ARVGLSFMSID...QACSNAEREQP........FFD................FD..ATVSAAEEVWAQKL.GVI......
F8EMI3_RUNSL/253-745VRVGSSFTDTE...GARRNLVAEL...........P.............HWDFD..RVVKSAEQAWNQEL.GKV......
V2XHT4_MONRO/284-804LRVGVSFLSTE...QACANAESEVG........SSS................FE..DIVAKSKVLWNERL.SKI......
R7LDI0_9BACT/241-733VKIAISSASVE...GAAQNLQAEC...........K.............HWDFD..AATRQARNAWNHLL.GRI......
C7PM47_CHIPD/233-736ARVASSYISTE...QAELTWQKEL...........AG............FKNLE..QTRAAANKTWSTLF.NRV......
G0FHU3_AMYMS/256-775ATTAISQVDAA...GARGNLASEH...........I..............RSFD..AAKADVQRAWRREL.STV......
I4A0R9_ORNRL/236-741CRVASSFISLE...QAEQNLKAEL...........G.............SKSLA..QVKEEGKKEWNEVL.SKV......
C6W4W9_DYAFD/261-752VRIGTSFTSIE...GARANLEKEM...........G.............DKSFE..VVQKLSRDTWNASL.GKV......
M2NEA8_BAUCO/259-773ARVGVSFISVE...KACSNAVSEIP........TFD................FE..SVHAAAVQAWTDKL.GVI......
R5VDA0_9BACE/231-736ARVASSFISQA...QALENL.KEL...........G.............NDSFD..VLVEKGKTAWNEAL.GRI......
R7JK19_9PORP/291-764MKAGISFVCEE...NARENLETEI...........A.............DWDFE..RVLQSNQQAWNEAL.SKV......
R7JG93_9PORP/262-785AKVGLSYTSVE...NARLNREEETN.........QD.............QLTFD..EARSASHQTWEEYL.GRI......
F3ZQV4_9BACE/233-738VRIASSFISIE...QAELNL.AEL...........G.............DFTLE..ELKEQSREQWNEVL.GKL......
R5UGR2_9BACE/235-712VKVALSSVSIE...GAKRNLETEL...........P.............GWDFN..AVKQVAHKEWHKFL.SRI......
M7TB74_EUTLA/290-803ARVGISFISAE...QACNRATDEIPD......ALGD................FD..RLTQEAEAAWRAQL.SPV......
R5M3G3_9BACE/215-735LRYGISFISEE...QAKKNLQREL...........A.............DYNLQ..ALAEKGRQIWDKAL.SDI......
C1F144_ACIC5/258-750VKVATG.VSYE...QAEQRLTQED...........P.............SWDFN..RVHAAARAAWASKL.NRV......
B8MW61_ASPFN/262-769VRVGISYISTD...RACENARREIPH......PLED................FE..DIRRRAESAWREKL.SPI......
G0G534_AMYMS/253-730AKVGISFVSLA...NAQANLAAEN...........P.............GFDFA..GVRAAADTSWNTIL.NRV......
U5W717_9ACTO/583-1116MRIATSLISVA...QAKKNLDLEIA.........AD..............ATLA..SVRDKAQSLWDAKM.HTV......
S8AUX2_PENO1/258-766VRVGVSYLSSQ...QACANAEAEVPD......PIPD................FG..RLEREAIDAWAEKL.RPI......
F8PNH6_SERL3/268-750VRVGVSFISID...QARKNLEAEI...........PD............GTTLE..ETAKVTRVAWAEKL.DRI......
V5FTD6_BYSSN/268-766ARAGVSFISVD...KACANSENEIP........DYD................FD..SLVSNAEIAWRQKL.EVI......
M4S534_9SPHN/264-754VKVAISSVDED...AAIANLESE............A..............GDFD..AIRARTRAAWEQAL.GAV......
E8RV90_ASTEC/241-719VKLAVSFTSAE...TAEALLDQEI..........PD..............WDFD..AVRQQTQVAWNAQL.SKI......
C7M956_CAPOD/237-705VKTALSMHSIA...EAYKNMEVEA...........P.............HFTFD..DYRETARNLWEKQL.QKI......
F9D252_PREDD/261-751VQVAVSFVSVD...NARRNLAHEQ..........QG..............CDFE..KVRQEARRAWEKTL.GVV......
E8RVN8_ASTEC/277-754MKLAVSFISVE...KAKANLAAELP........GWD................FD..AQHERARDLWNGAL.SKI......
Q832K9_ENTFA/198-694.HFSSSFISEK...QAQLNLAREI...........S..............LRST..EMLQQGIADWHNYF.DRL......
G8TEK7_NIAKG/223-742FKYAISYVSAA...QAKKNYDNEL...........A.............NTGFE..QLQQLGETAWNKVM.GQI......
M2YKL8_MYCFI/250-760VRMAYSFVSSE...QACKLAETEIA........NFD................FA..GTQEKATAAWKEKM.SAI......
D2QG27_SPILD/248-753ARVASSFISPE...QAERNL.AEI...........G.............NDSFD..TVKDKAKSVWNTEL.GRV......
F9XL31_MYCGM/226-731VRTGVSFVSVE...QARKNLDLEA...........PS............SVTFD..QAVENLKDAWLEKI.GRV......
K0KAH3_SACES/258-772AATAISHVDPA...GATKNLAE.............AR............DQTFD..DLRTATQALWRDEL.GSI......
C9A6J8_ENTCA/198-694.RFATSFLSRE...QACLNLQREQ...........Q..............WAPA..DYLASVQQQWNHFL.QKI......
C8VIR9_EMENI/281-803SRVGISFISSE...KAHSYIRNEIP........SWR................LN..DTVDAALEEWNNDVFSKI......
R5IR26_9PORP/200-717IRYGISYISVE...QAKKNLNKEI...........N.............DYNLQ..ALAQTARAAWNKAL.GKI......
R5NWD8_9PORP/218-751ARVGISFISVE...QARQNLEKET...........G.............NKTFA..AIREDSRQIWEKAL.GRI......
M7TSY3_BOTF1/247-758SRVGISWISKE...KACQNVNNEIPD.......DTT................FS..NAVSDTKSVWNDEVLSRI......