Sequence alignment for CL0269

PF02545

Y022_CHLPN/3-195LPLVLGSSSPRRKFILEKFR..VPFTVIPS---NFDESK..VSYSGDPIAYTQELAAQKAYA.VSELHSPC.........
YHDE_ECOLI/3-192S.LYLASGSPRRQELLAQLG..VTFERIVT---GIEEQR..QPQES.AQQYVVRLAREKARAGVAQTAKD..........
YO111_YEAST/19-231YDIILASTSPRRYEILHDIMGITDLKTMVS---TFEENLDKMNYSTDPIGYVCDTSWHKAQNIIEILTDYEDENPNEIDK
Y905_SYNY3/3-195PTFVLASASPARKRLLEMAG..ISPLVAVS---HFDE......SSLAADNT.VALVEALAKAKAGTVASKF........A
Y1161_HELPJ/1-189MELILGSQSSARANLLKEHG..IKFEQKAL---YFDEES...LKTTDPREF.VYLACKGKLEKAKELLANN.........
YCEF_SHIFL/2-192PKLILASTSPWRRALLEKLQ..ISFECAAP---EVDETP..RSDES.PRQLVLRLAQEKAQS.LASRYPD..........
Y815_RICPR/8-212LPIILASGSLARVELLDRIK.IIPTQIIPA---YIDETP..NLREL.PAPLAIRLAYEKAIKVASQIETS..........
MAF_BACSU/3-188KPLILASQSPRRKELLDLLQ..LPYSIIVS---EVEEKL..NRNFS.PEENVQWLAKQKAKA.VADLHPH..........
Y3282_MYCTU/3-210R.LVLGSASPGRLKVLRDAG..IEPLVIAS---HVDEDV..VIAALGPDAVPSDVVCVLAAAKAAQVATTLTGTQRIVAA
Y1941_PYRHO/2-186M.IILASSSPRRREILGRF...FEIKVYPA---NVEERS..TVKD..SREKSLDIARKKALS.VSSKFPG..........
Y349_CHLTR/3-195ARLVLGSSSERRKAVLESFR..IPFICVSP---DFDERS..IVYSGDPFEYTKELAWNKANV.VRS.QGFS.........
Y1718_AQUAE/1-189MRVILASTSPRRSQILSLLG..IEFEVIPA---KVEEEV..IPGK..PVLTARKLAKEKALS.VWRENRD..........

PF01931

NCPP_PYRKO/6-175-----GSTNPAKVEAVR-----EVFLGIYG...DVEVVPIEVDSGVPDQPVGLEETVKGAINRAKQAI------------
Q1V5V7_VIBAL/9-172-----ASLNPAKINAVQ-----SAFRNAFPHQ.EFNFVGISVPSEVADQPMTNEETHRGALNRVKNAK------------
NCPP_METJA/12-176-----GSTNPVKIEAVK-----EGFEKVLG...AVEVIGVDVISGVSSHPIGLEETYLGALNRAKNAF------------
NCPP_PHOLL/7-170-----ATTNPAKIKAIS-----LAFDDVFGPG.TYRIEDINVDSSVPQQPIGNTETRTGARQRVMAAR------------
NCPP_YERPS/7-170-----ATTNPAKINAIT-----LAFDDVYGPG.QYRIEGVNVDSGVPLQPIGSTETRIGARQRVKNAR------------
Q4Q6A0_LEIMA/7-177-----GTTNRAKAESVV-----TVVNRCFPNE.THEVRLCSVSSAVSDQPMSAEETQRGALNRAKAAL------------
NCPP_ARCFU/2-167-----GSKNPTKIEGAR-----RAFEQYFD...DVEIVGVEVSTSAPPQPFD.AETVRGAIERAKKAY------------
Q554M4_DICDI/9-185-----GSENKAKIRATQ-----MGFDLAFKEKCEVTVVGVKANSLVSDQPMSDSECIVGAINRAKEAL------------
NCPP_ERWCT/7-170-----ATTNPAKIKAIS-----LAFIDVFGAE.NCRIEGVDVDSGVPRQPLGSIETRTGARNRVMMAR------------
NCPP_METTH/13-178-----GSGNPVKVRATE-----NVLGLIYG...NVEVRGVEVESGVPDQPVGLEETVRGAVNRARRAF------------
Q6M081_METMP/51-215-----GSTNPVKVSAVE-----KAIEKTVG...TMLVSSVDTKSGVSDQPQGFEETFKGAYNRAKGAF------------
Q4CSY5_TRYCC/7-177-----GTTNKAKLDSVD-----TAVRMCFPSY.QHDVRPVAVLSIVRAQPISAEESQQGAQHRAHEAL------------
NCPP_VIBF1/6-169-----ASQNPAKIAAVE-----SAFNLAFPND.TFSFEGVSVKSGVPDQPMSCEETKQGAMNRINNAK------------
Q1Z330_PHOPR/7-170-----ASTNPAKISAVS-----SAFSQAFPEQ.SFTVEGISVASEVRDQPLCADETLLGARNRVKNAR------------
Q1ZJY8_PHOAS/7-170-----ASTNPAKVAAVR-----DAFSLAFPML.SFNVEGIAAQSGVRDQPLTNDETLLGARNRVKHCR------------
NCPP_VIBCH/16-179-----ASQNPAKVNAVR-----SAFSTVFPDQ.EWEFIGVSVPSEVADQPMSDEETKQGALNRVRNAK------------
NCPP_ECOLI/7-170-----ATTNPAKIQAIL-----QAFHEIFGEG.SCHIASVAVESGVPEQPFGSEETRAGARNRVANAR------------
Q583F1_TRYB2/7-177-----GTTNKAKLNSVA-----LVVNKCFPDQ.QHDIRPVEVSSAVRAQPMSAGESQEGAQHRAREAL------------
Q3IFY8_PSEHT/10-176-----GSKNPVKINAAK-----CIFSMYFPER.DIDCQGVNAPSGVPDQPIGEEQTRIGAQNRVNYCK------------
NCPP_VIBVU/14-177-----ASLNPAKITAVE-----SAFTSAFPNG.TFEFVGVNVPSEVADQPMSDSETHLGALNRVRNAK------------

PF02545

Y022_CHLPN/3-195DCIILTGDTIVSYD.GRIFTKPQDKADAIQMLKTLRNQT...HDVVTSIAVLHKGK----LLTGS.....ETSQISLTM.
YHDE_ECOLI/3-192.LPVLGADTIVILN.GEVLEKPRDAEHAAQMLRKLSGQT...HQVMTAVALADSQH----ILDCL.....VVTDVTFRT.
YO111_YEAST/19-231PKLIICADTIIIDKSGRIYEKPKTKEVQKKFLMKFCYEDDEPVNVVTAVTLIKWYG----RENFELVPFRDETKVYFDNK
Y905_SYNY3/3-195DALVLGCDSLLLVN.GQTYGKPESPAVAIARWQTMRGQV...GELYTGHALIDRTQ----NRCLC...QTGLTKVHFAD.
Y1161_HELPJ/1-189.CAIVVADSVVSVG.NRMQRKAKNKREALEFLKRQNGNE...IEVLTCSALISPVL----EWLDL.....SVFRARLKA.
YCEF_SHIFL/2-192.HLIIGSDQVCVLD.GEITGKPLTEENARLQLRKASGNI...VTFYTGLALFNSAN----GHLQT...EVEPFDVHFRH.
Y815_RICPR/8-212.SIIIAADTVTAVG.RRILPKATTYEEVKHCIKMVSGRR...HRVYTGLCIIKKEN----NQLTFR.QKIVQTIIKFKK.
MAF_BACSU/3-188.AIVIGADTMVCLD.GECLGKPQDQEEAASMLRRLSGRS...HSVITAVSIQAENH----SETFY.....DKTEVAFWS.
Y3282_MYCTU/3-210DCVVVACDSMLYIE.GRLLGKPASIDEAREQWRSMAGRA...GQLYTGHGVIRLQD----NKTVYRAAETAITTVYFGT.
Y1941_PYRHO/2-186.ATIVAADTMVIFR.GKTLGKPRNAEEARKMLRALSGNV...HKVITGYCIIHNGR----IIEGV.....EETEVKFRE.
Y349_CHLTR/3-195DALIITADTVVVYK.GEVFNKPESEEHAVEMLRTLSGSS...HSVITTLVLMQNEK----VLSAS.....ENTQVSFID.
Y1718_AQUAE/1-189.AVVIGADTLVFLG.NEIIGKPKDEKDAVNILKKLSGKW...HSVVTALCVYSPEK----VFLTH.....DIAKVKFRE.

PF01931

NCPP_PYRKO/6-175-EKTD.ADFGVGIE-AGLYRVPETIT----------------GYMDVQFCAVVDRE...GRITLG-----HGPGFEYPPG
Q1V5V7_VIBAL/9-172-VEMPNADYYVGLE-AGIE....A..----------------.NVTFAWMVVESET....HRGES-----RSASLMLPPK
NCPP_METJA/12-176-EKVQ.CTYAVGIE-AGLIKVGEH..----------------.YIDIHICVVFDGV....NETVG-----LSQGFEYPKI
NCPP_PHOLL/7-170-QVRPEADFWVGVE-AGIE....D..----------------.DMTFAWMVVEYQQ....IRGES-----RSASLMLPEK
NCPP_YERPS/7-170-QVRPEADFWVGIE-AGIE....D..----------------.NMTFAWMVIEHLQ....ARGES-----RSASLMLPDI
Q4Q6A0_LEIMA/7-177-EVTSDADYGVGLE-GGIEHIAGR..----------------.WFECGWMVILERK..TGKCGIG-----SSARFEMSET
NCPP_ARCFU/2-167-S.PD.FDFSVGIE-AGLFRSECTIT----------------GYLDFQVAAVYDGE....RCTIG-----FGPGFEYPKL
Q554M4_DICDI/9-185-SKCPDAEYGIGME-GGVHNIKEPID----------------RWYECGWIAVVKKGEPDSNVGVA-----STARFELPPK
NCPP_ERWCT/7-170-QVRPEANFWVGVE-AGIE....E..----------------.SMTFAWMVIENAN....LRGES-----RSASLVLPES
NCPP_METTH/13-178-R..D.CELSVGIE-SGLHRVPETIT----------------GFVDLQWCAIYDGE....HITLG-----VSAGFEYPPM
Q6M081_METMP/51-215-EKVN.CVYGIGIE-AGIVEIGEK..----------------.KLDIHICVVYNGL....DYSVG-----TSQAFQIPKD
Q4CSY5_TRYCC/7-177-RLVPEAHYGVGLE-GGLEKISDR..----------------.WFECGWMYVIERS..TGRCGIG-----SSARFEMSQK
NCPP_VIBF1/6-169-IKLPNCDYYVGLE-AGIE....G..----------------.NSTFAWMIIDNGL....TVGES-----RSSSLPLPPQ
Q1Z330_PHOPR/7-170-KLQADADFYVGLE-AGID....G..----------------.NSTFAWMVIENHK....QRGEA-----RSASLPLPPI
Q1ZJY8_PHOAS/7-170-EQYPEADYIVGLE-AGID....D..----------------.KFTFAWMVIEHDG....QYSES-----RSASLPLPPL
NCPP_VIBCH/16-179-QRHPGAEYYVGLE-AGIE....E..----------------.NKTFAWMIVESDQ....QRGES-----RSACLMLPPL
NCPP_ECOLI/7-170-RLLPEADFWVAIE-AGID....G..----------------.DSTFSWVVIENAS....QRGEA-----RSATLPLPAV
Q583F1_TRYB2/7-177-RHIPDAHYGVGME-GGLEKIGDR..----------------.WFECGWMHVIERS..SGREGTG-----SSGRFEMSQK
Q3IFY8_PSEHT/10-176-EHYQ.AHYYVAME-GGAEQFSYG..----------------.AATFAYVVIDNAV....NQVVG-----RSSNLPLPQI
NCPP_VIBVU/14-177-ACRADGAFYVGLE-AGID....G..----------------.NVTFAWTVIESHT....HRGES-----RSASLMLPPN

PF02545

Y022_CHLPN/3-195IPDHRIESYIDTVGTLNNCGAYDVCHGG.LILKKVHG.CVYNVQGLPIQTLKYLLEELNI........DLWDYS
YHDE_ECOLI/3-192LTDEDIAGYVASDEPLDKAGAYGIQGLGGCFVRKING.SYHAVVGLPLVETYELLSNFNA.........LREKR
YO111_YEAST/19-231IPLRILEEYVESGDGLEVGGGFKIQGQGAILIEKIEG.DYYNVVGLPLNKTFKGLYAEAN.............S
Y905_SYNY3/3-195VDDDTIQAYVGSGEPLQCAGAFALEGKGGMLINKLDG.CSSNVIGLSLPILRSLLQRLGY........SLKDFW
Y1161_HELPJ/1-189FDCSEIEKYLESGLWQGSAGCVRLEDFHKPYIKSSSK.NLSVGLGLNVEGLLGALK.LG..........VKLSL
YCEF_SHIFL/2-192LSEAEIDNYVRKEHPLHCAGSFKSEGFGITLFERLEGRDPNTLVGLPLIALCQMLRREG...........KNPL
Y815_RICPR/8-212LSDEEINFYSSLDEGIDKAGGCKISGYAEAFVSFISG.SYSNIMGLPLFETVNALTSLGFRYSNNTPNVYKDPS
MAF_BACSU/3-188LSEEEIWTYIETKEPMDKAGAYGIQGRGALFVKKIDG.DYYSVMGLPISKTMRALRHFDI.............R
Y3282_MYCTU/3-210PSASDLEAYLASGESLRVAGGFTLDGLGGWFIDGVQG.NPSNVIGLSLPLLRSLVQRCGL........SVAALW
Y1941_PYRHO/2-186IGDELLEWYISTGEWKDKAGAYGIQGYASIFVEWIKG.DYYNVVGLPIKVVVELTK.LG..........FKPKR
Y349_CHLTR/3-195IPPQHLKTYVRSFSSLKRCGGYCVQDGGGLIIKQIEG.CVYNIQGLPIKTLNQLLMEFNI........SLWDYL
Y1718_AQUAE/1-189LSKEEIISYVKSGEPMDKAGAYGVQGFGATIVERIHG.NFYTVMGLPIVKLYKILRELNL.........LAGTF

PF01931

NCPP_PYRKO/6-175VIRRVFEEGVEVGIAMGELVNDPELKRKIGAIGVLTH-GMLVRKELNKLAVLMALVPR-----------LNPEW
Q1V5V7_VIBAL/9-172VLEKLK.DANELGDVMDEVFGTDNIKQKGGAISLLTQ-NQLTRSSVYHQALILALIPF-----------TNPEH
NCPP_METJA/12-176VAEKVL.EGIEGGKIAEEISGIKDIGKNIGLIGYLTD-NNITRKDLCRESVIMALIPR-----------MIKNA
NCPP_PHOLL/7-170ILDGIR.EGRELGHEMAYLTGIDNINQKEGAIGFFTD-GILTRTSVYHQALILALVPV-----------HHEIY
NCPP_YERPS/7-170ILQGIR.QGRELGDEMAVLSGISNVKQQGGAIGIFTQ-GKLTRTSVYHQALLLALVPF-----------HNEIY
Q4Q6A0_LEIMA/7-177IMRPILNEGKELAEVIDNLTGEEDVRSGLGAMGVLTA-GRLGRAAAYEHGLVFALAPF-----------LSDSK
NCPP_ARCFU/2-167VVEEVL.KGKEVGEVMEKVSGIKNLGKKVGAVHYLSK-GAISRTDLSRISVTMALIPF-----------INREM
Q554M4_DICDI/9-185VIYEIVENKKELAQIMDELTNKSDVRSNEGAMGIYTN-SILHRDHIYSHGLIFALSRF-----------ISPKE
NCPP_ERWCT/7-170ILHGIR.EGRELGDEMERLTGVQNIKHKGGAIGVFTD-GKLSRTSVYHQALLLALVPF-----------HNPIY
NCPP_METTH/13-178VVEEVL.AGREVGDVMDELTGVDELGRKRGAVSFLSG-GLLDRTGNTEQCVLMAMIPR-----------MNPSL
Q6M081_METMP/51-215ISDMIN.EGYECSKIAEETYRVKNIGQKNGIIGVLTD-NNILREQLCIDSVVMAMIPK-----------YRRNS
Q4CSY5_TRYCC/7-177LMSKILDEGKELAEVMDEMTGQTDVRSGQGAMGVLTA-GYLNRTESYSHGLIFALAPF-----------LSDHK
NCPP_VIBF1/6-169VIDEVK.KGKELGDVMDEQFNTDNIKQKGGAIGLLTN-NLLTRTSVYQQALILALIPF-----------LHPTR
Q1Z330_PHOPR/7-170ALEKIQ.QGIELGDVMDDMFNQQNVKQKGGAIAMLTN-HTLSRSSVYQQALILALIPF-----------MNEQW
Q1ZJY8_PHOAS/7-170ALEKIQ.QGMELGDVMDEMFNQQNVKQKGGAIAMLTN-HLLTRSSVYQQALILALIPF-----------LNPQL
NCPP_VIBCH/16-179VLERLR.QAKELGDVMDEVFGTENIKQKGGAIGLLTR-HHLTRSTVYHQALILALIPF-----------INPEH
NCPP_ECOLI/7-170ILEKVR.EGEALGPVMSRYTGIDEIGRKEGAIGVFTA-GKLTRASVYHQAVILALSPF-----------HNAVY
Q583F1_TRYB2/7-177LMQKILNEGKELAEIMDEMTGEKDVRSGQGAMGVLTA-GHLNRAESYTHGLIYALAPF-----------LSSRT
Q3IFY8_PSEHT/10-176LYNALL.NGAELGDVMDKAFNTTNIKQQGGAIGLLTN-NHATRESTYTQALTLAMAPF-----------LHSAL
NCPP_VIBVU/14-177VIAKLA.NANELGDVMDEVFGTENIKQKGGAISLLTQ-NQLTRSSVYHQALILALIPF-----------TNPEH

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window