Sequence alignment for CL0270

PF02504

PLSX_SYNY3/6-328--------------------------------------------------------------------------------
PLSX_HELPY/1-317--------------------------------------------------------------------------------
PLSX_CHLTR/3-311--------------------------------------------------------------------------------
PLSX_ECOLI/4-331--------------------------------------------------------------------------------
PLSX_BACSU/1-321--------------------------------------------------------------------------------
PLSX_AQUAE/2-322--------------------------------------------------------------------------------
D5AUL6_RHOCB/12-337--------------------------------------------------------------------------------
I3VW60_THESW/1-316--------------------------------------------------------------------------------
W8T1H7_EUBAC/28-365--------------------------------------------------------------------------------

PF01515

PTAS_BACSU/3-319--------------------------------------------------------------------------------
EUTD_ECOLI/1-320--------------------------------------------------------------------------------
PTAS_CLOTH/2-324--------------------------------------------------------------------------------
MAO1_RHIME/441-763--------------------------------------------------------------------------------
PTAS_CORGL/5-322--------------------------------------------------------------------------------
PTA_SYNY3/374-693--------------------------------------------------------------------------------
PTB_CLOB8/4-295--------------------------------------------------------------------------------
PTAS_BORBU/10-350--------------------------------------------------------------------------------
PTAS_MYCPN/2-315--------------------------------------------------------------------------------
MAO2_HAEIN/429-750--------------------------------------------------------------------------------
PTAS_CLOAB/2-326--------------------------------------------------------------------------------
MAO2_RHIME/438-756--------------------------------------------------------------------------------
A1B2J3_PARDP/4-314--------------------------------------------------------------------------------
I3VW55_THESW/3-324--------------------------------------------------------------------------------
PTB_CLOAB/4-295--------------------------------------------------------------------------------
PTA_MYCTU/365-682--------------------------------------------------------------------------------
Q32DP2_SHIDS/392-707--------------------------------------------------------------------------------
Q6MTX6_MYCMS/5-317--------------------------------------------------------------------------------
Q8TK18_METAC/4-325--------------------------------------------------------------------------------

PF04166

F9D1K6_PREDD/35-324--------------------------------------------------------------------------------
D7BZZ5_STRBB/44-335--------------------------------------------------------------------------------
K9XHU5_9CHRO/45-341--------------------------------------------------------------------------------
K9Z747_CYAAP/38-335--------------------------------------------------------------------------------
F3ZVB4_MAHA5/32-323--------------------------------------------------------------------------------
D4G8G2_RIEPU/43-336--------------------------------------------------------------------------------
E3I1T8_RHOVT/40-335--------------------------------------------------------------------------------
F0R264_BACSH/34-324--------------------------------------------------------------------------------
Q1LSS1_BAUCH/32-325--------------------------------------------------------------------------------
D5WYG1_THIK1/23-322--------------------------------------------------------------------------------
Q10ZN5_TRIEI/41-337--------------------------------------------------------------------------------
Q7MTA8_PORGI/34-326--------------------------------------------------------------------------------
G2TI06_BACCO/34-325--------------------------------------------------------------------------------
Q3V872_LEGPH/26-315--------------------------------------------------------------------------------
B1ZNR3_OPITP/35-329--------------------------------------------------------------------------------
K9SRP6_9SYNE/31-333--------------------------------------------------------------------------------
Q3B5B9_CHLL7/30-323--------------------------------------------------------------------------------
R6EJC4_9BACE/37-325--------------------------------------------------------------------------------
PDXA1_BRADU/37-333--------------------------------------------------------------------------------
PDXA_XANP2/36-328--------------------------------------------------------------------------------
D3EPC7_ATETH/40-355--------------------------------------------------------------------------------
X2H9I6_9NEIS/29-319--------------------------------------------------------------------------------
L0ETE9_LIBCB/39-331--------------------------------------------------------------------------------
B4F2I1_PROMH/31-324--------------------------------------------------------------------------------
V5UBQ7_9BURK/58-340--------------------------------------------------------------------------------
A6VU54_MARMS/37-327--------------------------------------------------------------------------------
M7SPY7_EUTLA/39-323--------------------------------------------------------------------------------
Q0K4Q7_CUPNH/34-327--------------------------------------------------------------------------------
D4J4Q1_9FIRM/33-335--------------------------------------------------------------------------------
A0JTQ9_ARTS2/490-781--------------------------------------------------------------------------------
G4RBH1_PELHB/33-315--------------------------------------------------------------------------------
D2R6V9_PIRSD/43-337--------------------------------------------------------------------------------
G7Z7B0_AZOL4/38-329--------------------------------------------------------------------------------
I7HG37_9HELI/28-302--------------------------------------------------------------------------------
R6SBC2_9BACE/34-324--------------------------------------------------------------------------------
D9RAU4_CLOSW/32-323--------------------------------------------------------------------------------
F0NYL8_WEEVC/36-325--------------------------------------------------------------------------------
F2IC16_FLUTR/45-335--------------------------------------------------------------------------------
M1PE68_DESSD/26-315--------------------------------------------------------------------------------
H1Z8Q7_MYROD/36-324--------------------------------------------------------------------------------
PDXA_BACHD/33-324--------------------------------------------------------------------------------
Q3SGF8_THIDA/30-317--------------------------------------------------------------------------------
R5KK03_9BACT/34-324--------------------------------------------------------------------------------
B8IWD3_METNO/40-332--------------------------------------------------------------------------------
K9TXI9_9CYAN/42-377--------------------------------------------------------------------------------
PDXA_SYNJB/34-331--------------------------------------------------------------------------------
Q1QSM0_CHRSD/42-333--------------------------------------------------------------------------------
K9SMQ8_9CYAN/47-343--------------------------------------------------------------------------------
PDXA_PROAC/35-325--------------------------------------------------------------------------------
L0DWB4_THIND/35-324--------------------------------------------------------------------------------
H8GMF2_METAL/35-325--------------------------------------------------------------------------------
PDXA_GEOMG/34-325--------------------------------------------------------------------------------
R4I106_9GAMM/29-321--------------------------------------------------------------------------------
E1SLK8_FERBD/27-319--------------------------------------------------------------------------------
A1AU02_PELPD/36-329--------------------------------------------------------------------------------
PDXA_RALSO/37-328--------------------------------------------------------------------------------
PDXA_THISH/31-321--------------------------------------------------------------------------------
Q3V808_SINFN/34-320--------------------------------------------------------------------------------
D3VCQ4_XENNA/32-324--------------------------------------------------------------------------------
PDXA_AGRFC/37-329--------------------------------------------------------------------------------
G7URF7_PSEUP/27-304--------------------------------------------------------------------------------
G0IUL6_CYCMS/36-326--------------------------------------------------------------------------------
R7J8E6_9PORP/34-325--------------------------------------------------------------------------------
J3Z564_9ENTR/29-321--------------------------------------------------------------------------------
I1F0R6_AMPQE/348-642--------------------------------------------------------------------------------
K7AU99_9ALTE/28-319--------------------------------------------------------------------------------
PDXA_SYNY3/35-336--------------------------------------------------------------------------------
E1VLH2_9GAMM/30-317--------------------------------------------------------------------------------
R4KFZ8_CLOPA/32-323--------------------------------------------------------------------------------
R5Y392_9BACE/33-324--------------------------------------------------------------------------------
W0PFJ8_9BURK/36-327--------------------------------------------------------------------------------
R6YA75_9BACT/37-327--------------------------------------------------------------------------------
R5TI46_9CLOT/31-334--------------------------------------------------------------------------------
A5FXM2_ACICJ/38-335--------------------------------------------------------------------------------
PDXA_RHOBA/37-349--------------------------------------------------------------------------------
R6W392_9BACT/35-320--------------------------------------------------------------------------------
K9QGD1_9NOSO/46-349--------------------------------------------------------------------------------
PDXA_XYLFA/29-316--------------------------------------------------------------------------------
F2LWP1_HIPMA/33-327--------------------------------------------------------------------------------
PDXA_CAUCR/30-324--------------------------------------------------------------------------------
F5YGA4_TREAZ/37-343--------------------------------------------------------------------------------
K9RH38_9CYAN/45-348--------------------------------------------------------------------------------
R5P2E5_9BACT/33-319--------------------------------------------------------------------------------
D2QDF7_SPILD/236-527--------------------------------------------------------------------------------
C4LDY8_TOLAT/35-322--------------------------------------------------------------------------------
K9T599_9CYAN/41-347--------------------------------------------------------------------------------
PDXA_WIGBR/31-321--------------------------------------------------------------------------------
F4LQ79_TREBD/32-322--------------------------------------------------------------------------------
E6WQK3_PSEUU/29-316--------------------------------------------------------------------------------
I3Y835_THIV6/27-318--------------------------------------------------------------------------------
PDXA2_BRADU/38-337--------------------------------------------------------------------------------
Q12FB7_POLSJ/51-359--------------------------------------------------------------------------------
G4L110_OSCVS/33-352--------------------------------------------------------------------------------
K9UJS8_9CYAN/31-336--------------------------------------------------------------------------------
H8KWR5_SOLCM/37-327--------------------------------------------------------------------------------
F2K4J5_MARM1/33-323--------------------------------------------------------------------------------
S6BVY4_9GAMM/29-317--------------------------------------------------------------------------------
A7I3Y6_CAMHC/27-298--------------------------------------------------------------------------------
F0SPW7_RUBBR/43-344--------------------------------------------------------------------------------
D5MIQ8_9BACT/37-328--------------------------------------------------------------------------------
F2NDA2_DESAR/37-329--------------------------------------------------------------------------------
A4CID9_ROBBH/38-321--------------------------------------------------------------------------------
B3PKV3_CELJU/31-323--------------------------------------------------------------------------------
Q2YBP4_NITMU/30-318--------------------------------------------------------------------------------
Q145L2_BURXL/43-326--------------------------------------------------------------------------------
C7PP38_CHIPD/38-328--------------------------------------------------------------------------------
D5BRI0_PUNMI/31-320--------------------------------------------------------------------------------
K0C9N5_ALCDB/29-316--------------------------------------------------------------------------------
F6ACQ2_PSEF1/33-324--------------------------------------------------------------------------------
W8WYV9_CASDE/45-334--------------------------------------------------------------------------------
A1BHC0_CHLPD/30-323--------------------------------------------------------------------------------
L0FWR6_ECHVK/32-334--------------------------------------------------------------------------------
F7YI45_VIBA7/28-321--------------------------------------------------------------------------------
Q2W0V4_MAGSA/33-323--------------------------------------------------------------------------------
Q11UL9_CYTH3/38-329--------------------------------------------------------------------------------
D7A738_STAND/37-327--------------------------------------------------------------------------------
W0ERT9_9PORP/33-324--------------------------------------------------------------------------------
R6ZD40_9FIRM/33-335--------------------------------------------------------------------------------
Q0VMV3_ALCBS/33-325--------------------------------------------------------------------------------
M1LX07_9CLOT/31-321--------------------------------------------------------------------------------
Q6LV40_PHOPR/30-323--------------------------------------------------------------------------------
I4WVN0_9GAMM/31-318--------------------------------------------------------------------------------
R5AZH6_9BACE/43-334--------------------------------------------------------------------------------
A8ESJ0_ARCB4/32-303--------------------------------------------------------------------------------
D5C4K3_NITHN/29-320--------------------------------------------------------------------------------
D4LRH6_9FIRM/31-357--------------------------------------------------------------------------------
PDXA_DESAH/34-326--------------------------------------------------------------------------------
Q7VHV2_HELHP/28-304--------------------------------------------------------------------------------
C5BPB7_TERTT/27-316--------------------------------------------------------------------------------
K0C3B1_CYCSP/29-319--------------------------------------------------------------------------------
PDXA_AQUAE/29-313--------------------------------------------------------------------------------
F0S0E1_DESTD/33-310--------------------------------------------------------------------------------
Q31F25_THICR/26-318--------------------------------------------------------------------------------
D5A6D6_ARTPN/31-330--------------------------------------------------------------------------------
Q1LRA2_CUPMC/46-333--------------------------------------------------------------------------------
A4FFA9_SACEN/36-326--------------------------------------------------------------------------------
PDXA_CHRVO/29-318--------------------------------------------------------------------------------
R6FKU7_9BACE/34-324--------------------------------------------------------------------------------
K9V9D2_9CYAN/37-340--------------------------------------------------------------------------------
R6XPS3_9BACT/34-324--------------------------------------------------------------------------------
K9YBG1_HALP7/36-336--------------------------------------------------------------------------------
A1STS2_PSYIN/28-319--------------------------------------------------------------------------------
A1WLE5_VEREI/41-335--------------------------------------------------------------------------------
R6F0Q9_9BACT/34-321--------------------------------------------------------------------------------
PDXA_RHOPA/35-328--------------------------------------------------------------------------------
PDXA_DESOH/33-325--------------------------------------------------------------------------------
G2PNX1_MURRD/35-323--------------------------------------------------------------------------------
G7UQC7_PSEUP/28-315--------------------------------------------------------------------------------
PDXA_SACD2/29-320--------------------------------------------------------------------------------
E6VTD1_DESAO/30-339--------------------------------------------------------------------------------
Q24RU8_DESHY/36-320--------------------------------------------------------------------------------
R5L6M7_9SPIR/33-320--------------------------------------------------------------------------------
K9TNE7_9CYAN/53-349--------------------------------------------------------------------------------
D3IAQ7_9BACT/34-319--------------------------------------------------------------------------------
D5BDL9_ZUNPS/47-332--------------------------------------------------------------------------------
Q2IHP1_ANADE/33-321--------------------------------------------------------------------------------
R6CJV8_9BACT/34-324--------------------------------------------------------------------------------
R6WB32_9FIRM/32-323--------------------------------------------------------------------------------
E4RQ40_LEAB4/33-324--------------------------------------------------------------------------------
Q11HH0_CHESB/29-325--------------------------------------------------------------------------------
E6SJ78_THEM7/43-331--------------------------------------------------------------------------------
F9ZZH4_METMM/31-322--------------------------------------------------------------------------------
L7W827_NONDD/35-323--------------------------------------------------------------------------------
F3ZNL8_9BACE/34-324--------------------------------------------------------------------------------
R7HMN9_9BACT/35-323--------------------------------------------------------------------------------
W0JF83_DESAE/33-320--------------------------------------------------------------------------------
PDXA_RUEST/31-317--------------------------------------------------------------------------------
Q0AC81_ALKEH/31-319--------------------------------------------------------------------------------
PDXA_DESAA/33-325--------------------------------------------------------------------------------
A4YT91_BRASO/34-325--------------------------------------------------------------------------------
K4KQ47_SIMAS/25-316--------------------------------------------------------------------------------
F9YQW3_CAPCC/34-322--------------------------------------------------------------------------------
D5V304_ARCNC/38-309--------------------------------------------------------------------------------
D4MSX7_9FIRM/33-348--------------------------------------------------------------------------------
M5DPJ7_9GAMM/27-319--------------------------------------------------------------------------------
A6TJU5_ALKMQ/33-334--------------------------------------------------------------------------------
E0URZ3_SULAO/30-300--------------------------------------------------------------------------------
N0BC98_9RHIZ/43-337--------------------------------------------------------------------------------
PDXA_XANCP/28-315--------------------------------------------------------------------------------
F2NA55_CORGP/35-342--------------------------------------------------------------------------------
B4RBS3_PHEZH/33-326--------------------------------------------------------------------------------
K0NNW0_DESTT/36-328--------------------------------------------------------------------------------
M1FJA7_9ALTE/30-319--------------------------------------------------------------------------------
C0ZNI3_RHOE4/384-675--------------------------------------------------------------------------------
Q65VM2_MANSM/32-323--------------------------------------------------------------------------------
A6H263_FLAPJ/36-324--------------------------------------------------------------------------------
B5YL57_THEYD/32-311--------------------------------------------------------------------------------
PDXA_PROA2/35-326--------------------------------------------------------------------------------
B1WU75_CYAA5/40-358--------------------------------------------------------------------------------
I0IQ54_LEPFC/42-330--------------------------------------------------------------------------------
B7K1J6_CYAP8/40-344--------------------------------------------------------------------------------
K9VBC1_9CYAN/53-351--------------------------------------------------------------------------------
C6VZ75_DYAFD/37-328--------------------------------------------------------------------------------
A3DDY3_CLOTH/32-324--------------------------------------------------------------------------------
B0UIV0_METS4/30-326--------------------------------------------------------------------------------
K8GJQ6_9CYAN/32-348--------------------------------------------------------------------------------
F6ILZ0_9SPHN/44-324--------------------------------------------------------------------------------
A2TY27_9FLAO/35-323--------------------------------------------------------------------------------
PDXA_OCEIH/33-325--------------------------------------------------------------------------------
D2UFS9_XANAP/28-315--------------------------------------------------------------------------------
E6X8R2_CELAD/35-320--------------------------------------------------------------------------------
PDXA_SYMTH/33-323--------------------------------------------------------------------------------
B5Y706_COPPD/31-322--------------------------------------------------------------------------------
F8EQB4_RUNSL/37-328--------------------------------------------------------------------------------
I3YUG2_AEQSU/35-321--------------------------------------------------------------------------------
B8ET21_METSB/41-335--------------------------------------------------------------------------------
F8GL31_NITSI/33-321--------------------------------------------------------------------------------
PDXA_GEOLS/34-329--------------------------------------------------------------------------------
Q5WKA6_BACSK/32-321--------------------------------------------------------------------------------
C1D5J7_LARHH/29-317--------------------------------------------------------------------------------
F4B1R1_DOKS4/36-321--------------------------------------------------------------------------------
D6Z2T8_DESAT/51-341--------------------------------------------------------------------------------
C9LXC2_SELS3/37-327--------------------------------------------------------------------------------
G4QFQ7_GLANF/29-320--------------------------------------------------------------------------------
PDXA2_PSEAE/35-329--------------------------------------------------------------------------------
Q0RWE6_RHOJR/36-321--------------------------------------------------------------------------------
PDXA_CYAP7/30-337--------------------------------------------------------------------------------
R7G4X4_9FIRM/35-326--------------------------------------------------------------------------------
D3RQF4_ALLVD/35-326--------------------------------------------------------------------------------
D8JA34_HALJB/30-324--------------------------------------------------------------------------------
D3SLG0_THEAH/28-312--------------------------------------------------------------------------------
F0SBZ7_PSESL/33-323--------------------------------------------------------------------------------
D3SBX0_THISK/44-331--------------------------------------------------------------------------------
A8IH54_AZOC5/35-332--------------------------------------------------------------------------------
F8KS88_HELBC/29-303--------------------------------------------------------------------------------
U5RZ60_9CLOT/33-326--------------------------------------------------------------------------------
B0SWM5_CAUSK/34-324--------------------------------------------------------------------------------
PDXA_SULSY/29-314--------------------------------------------------------------------------------
V4LB68_9GAMM/33-335--------------------------------------------------------------------------------
B3ENY2_CHLPB/30-323--------------------------------------------------------------------------------
R5Q2C0_9BACT/34-312--------------------------------------------------------------------------------
G2Z4E3_FLABF/35-323--------------------------------------------------------------------------------
C6XKP9_HIRBI/31-329--------------------------------------------------------------------------------
Q0K4F5_CUPNH/34-323--------------------------------------------------------------------------------
W0BBF6_9GAMM/27-315--------------------------------------------------------------------------------
K9XSR0_STAC7/33-337--------------------------------------------------------------------------------
B6JGM3_OLICO/32-326--------------------------------------------------------------------------------
D5SV98_PLAL2/38-331--------------------------------------------------------------------------------
PDXA_SERP5/29-321--------------------------------------------------------------------------------
C7RNL8_ACCPU/39-326--------------------------------------------------------------------------------
R6WFT1_9BACT/34-321--------------------------------------------------------------------------------
PDXA_PSEA6/27-318--------------------------------------------------------------------------------
J7Q941_METSZ/35-329--------------------------------------------------------------------------------
PDXA_METCA/29-318--------------------------------------------------------------------------------
R5FA16_9BACT/34-322--------------------------------------------------------------------------------
PDXA_AZOSB/30-318--------------------------------------------------------------------------------
D3HPI6_LEGLN/27-314--------------------------------------------------------------------------------
C6D3S5_PAESJ/31-322--------------------------------------------------------------------------------
C4ZNQ2_THASP/34-328--------------------------------------------------------------------------------
Q1ART0_RUBXD/32-322--------------------------------------------------------------------------------
A0KGT9_AERHH/28-320--------------------------------------------------------------------------------
PDXA_PASMU/32-326--------------------------------------------------------------------------------
Q5QVN8_IDILO/29-320--------------------------------------------------------------------------------
I2F8G1_9BACT/47-340--------------------------------------------------------------------------------
D7DN38_METV0/32-322--------------------------------------------------------------------------------
K4IU70_PSYTT/35-320--------------------------------------------------------------------------------
D9QLJ7_BRESC/29-321--------------------------------------------------------------------------------
B0BZ85_ACAM1/36-343--------------------------------------------------------------------------------
Q8KEU1_CHLTE/31-322--------------------------------------------------------------------------------
A5G9E3_GEOUR/36-328--------------------------------------------------------------------------------
F0RGS0_CELLC/35-323--------------------------------------------------------------------------------
Q2G9Z1_NOVAD/34-325--------------------------------------------------------------------------------
Q3IWS4_RHOS4/37-320--------------------------------------------------------------------------------
E4RPK4_HALHG/32-334--------------------------------------------------------------------------------
Q82W16_NITEU/32-321--------------------------------------------------------------------------------
D5QAY7_KOMHA/32-316--------------------------------------------------------------------------------
R5CC16_9BACE/34-324--------------------------------------------------------------------------------
R5P6P7_9BACT/34-321--------------------------------------------------------------------------------
A4FIE2_SACEN/34-325--------------------------------------------------------------------------------
B9LZ80_GEODF/35-326--------------------------------------------------------------------------------
A3U5N8_CROAH/35-320--------------------------------------------------------------------------------
PDXA_CAMJE/28-357--------------------------------------------------------------------------------
R5GSB3_9BACT/34-324--------------------------------------------------------------------------------
Q479U5_DECAR/29-319--------------------------------------------------------------------------------
R6AA64_9BACT/49-340--------------------------------------------------------------------------------
PDXA_NEIMB/28-321--------------------------------------------------------------------------------
D1B2K3_SULD5/28-299--------------------------------------------------------------------------------
K9PX21_9CYAN/31-332--------------------------------------------------------------------------------
B4EGN0_BURCJ/39-337--------------------------------------------------------------------------------
M1WYQ3_DESPC/31-331--------------------------------------------------------------------------------
E8V3H9_TERSS/35-313--------------------------------------------------------------------------------
E7ABT4_HELFC/29-301--------------------------------------------------------------------------------
PDXA3_RHIME/42-334--------------------------------------------------------------------------------
E6WY24_NITSE/28-307--------------------------------------------------------------------------------
C6XUZ6_PEDHD/33-321--------------------------------------------------------------------------------
B4SF48_PELPB/31-318--------------------------------------------------------------------------------
I5B2I7_9DELT/36-328--------------------------------------------------------------------------------
Q65EJ5_BACLD/32-325--------------------------------------------------------------------------------
D3QBQ2_STANL/35-328--------------------------------------------------------------------------------
I6ZML4_MELRP/28-311--------------------------------------------------------------------------------
Q5LKY3_RUEPO/32-322--------------------------------------------------------------------------------
Q2RKJ4_MOOTA/32-333--------------------------------------------------------------------------------
R5EF26_9GAMM/29-323--------------------------------------------------------------------------------
W0E2J5_MARPU/29-320--------------------------------------------------------------------------------
H1Y4I7_9SPHI/33-321--------------------------------------------------------------------------------
E3GDT1_EUBLK/31-337--------------------------------------------------------------------------------
E0WS58_9ENTR/33-325--------------------------------------------------------------------------------
W8F8Y2_9BACT/31-322--------------------------------------------------------------------------------
B3QV85_CHLT3/26-321--------------------------------------------------------------------------------
A8LS85_DINSH/31-321--------------------------------------------------------------------------------
A0Q399_CLONN/32-323--------------------------------------------------------------------------------
R7EVF6_9BACT/42-333--------------------------------------------------------------------------------
I3Z6X6_BELBD/36-323--------------------------------------------------------------------------------
PDXA_HYDS0/28-302--------------------------------------------------------------------------------
W0EZ35_9BACT/35-325--------------------------------------------------------------------------------
D5CTH9_SIDLE/30-349--------------------------------------------------------------------------------
R7LG84_9BACT/48-339--------------------------------------------------------------------------------
D3E9G4_GEOS4/31-324--------------------------------------------------------------------------------
E3FNJ1_STIAD/27-308--------------------------------------------------------------------------------
X5D8G7_9BACT/35-325--------------------------------------------------------------------------------
G8PQZ0_PSEUV/36-329--------------------------------------------------------------------------------
L0DE58_SINAD/36-336--------------------------------------------------------------------------------
G8QYY1_SPHPG/33-336--------------------------------------------------------------------------------
W8KS11_HALHR/35-325--------------------------------------------------------------------------------
G8TP28_NIAKG/36-322--------------------------------------------------------------------------------
PDXA_VIBCH/28-321--------------------------------------------------------------------------------
T2KID2_9FLAO/35-320--------------------------------------------------------------------------------
U5LJV8_9BACI/34-327--------------------------------------------------------------------------------
PDXA_PERMH/27-312--------------------------------------------------------------------------------
PDXA_RHILO/36-329--------------------------------------------------------------------------------
Q89M19_BRADU/33-325--------------------------------------------------------------------------------
K9VZP3_9CYAN/50-362--------------------------------------------------------------------------------
PDXA_FUSNN/31-321--------------------------------------------------------------------------------
E0SNM5_IGNAA/34-327--------------------------------------------------------------------------------
G0AAS4_COLFT/40-342--------------------------------------------------------------------------------
A6Q3Y7_NITSB/29-300--------------------------------------------------------------------------------
A7HYG3_PARL1/38-330--------------------------------------------------------------------------------
G4STZ3_META2/32-323--------------------------------------------------------------------------------
R4W4P1_9EURY/25-318--------------------------------------------------------------------------------
E4TVA5_MARTH/35-325--------------------------------------------------------------------------------
R5IKT1_9CLOT/33-336--------------------------------------------------------------------------------
R7CXE5_9BACE/34-324--------------------------------------------------------------------------------
G8QPR5_DECSP/28-330--------------------------------------------------------------------------------
PDXA_HERAR/30-332--------------------------------------------------------------------------------
Q7VQK2_BLOFL/37-330--------------------------------------------------------------------------------
C7M3J3_CAPOD/34-323--------------------------------------------------------------------------------
R6TUF4_9FIRM/17-307--------------------------------------------------------------------------------
D1CHU7_THET1/34-324--------------------------------------------------------------------------------
PDXA_CAMFF/30-301--------------------------------------------------------------------------------
I4BXC4_ANAMD/32-320--------------------------------------------------------------------------------
E1R632_SPISS/37-339--------------------------------------------------------------------------------
C4ZHF2_AGARV/32-338--------------------------------------------------------------------------------
B8I6T9_CLOCE/32-323--------------------------------------------------------------------------------
F4CNN9_PSEUX/26-309--------------------------------------------------------------------------------
C5B7P2_EDWI9/30-321--------------------------------------------------------------------------------
PDXA_SYNFM/34-329--------------------------------------------------------------------------------
F2I3R8_PELSM/32-321--------------------------------------------------------------------------------
K7VXY6_9NOST/36-337--------------------------------------------------------------------------------
R5D0H0_9BACT/34-324--------------------------------------------------------------------------------
H6L3Q9_SAPGL/32-322--------------------------------------------------------------------------------
R6F1V4_9BACT/34-322--------------------------------------------------------------------------------
Q2S3U3_SALRD/96-387--------------------------------------------------------------------------------
H2FZ12_OCESG/28-320--------------------------------------------------------------------------------
L0K3J5_9EURY/33-327--------------------------------------------------------------------------------
G8R4P5_OWEHD/35-324--------------------------------------------------------------------------------
I1YL39_METFJ/29-320--------------------------------------------------------------------------------
PDXA_COLP3/27-319--------------------------------------------------------------------------------
Q215S3_RHOPB/38-329--------------------------------------------------------------------------------
D3DGU5_HYDTT/29-313--------------------------------------------------------------------------------
C6X2C9_FLAB3/36-324--------------------------------------------------------------------------------
Q02C14_SOLUE/41-313--------------------------------------------------------------------------------
G0G667_AMYMS/33-323--------------------------------------------------------------------------------
A9GKN1_SORC5/15-317--------------------------------------------------------------------------------
Q1QKW1_NITHX/32-325--------------------------------------------------------------------------------
H1XYD5_9BACT/33-325--------------------------------------------------------------------------------
D4GUQ8_HALVD/34-328--------------------------------------------------------------------------------
PDXA_BEII9/33-322--------------------------------------------------------------------------------
F9Z465_ODOSD/33-319--------------------------------------------------------------------------------
A6VPP4_ACTSZ/32-327--------------------------------------------------------------------------------
I0KFB6_9BACT/263-588--------------------------------------------------------------------------------
B5E8C6_GEOBB/32-324--------------------------------------------------------------------------------
Q4FMQ9_PELUB/32-317--------------------------------------------------------------------------------
A5FM92_FLAJ1/36-324--------------------------------------------------------------------------------
E3H6A7_ILYPC/32-321--------------------------------------------------------------------------------
A6QAX9_SULNB/28-306--------------------------------------------------------------------------------
A9BT55_DELAS/23-315--------------------------------------------------------------------------------
C3M9C3_SINFN/34-330--------------------------------------------------------------------------------
Q5LQN1_RUEPO/27-312--------------------------------------------------------------------------------
E8UEJ0_TAYEM/35-326--------------------------------------------------------------------------------
R5UVJ1_9BACT/33-321--------------------------------------------------------------------------------
PDXA_ERYLH/36-326--------------------------------------------------------------------------------
I0IDK7_PHYMF/40-342--------------------------------------------------------------------------------
A8MJU3_ALKOO/32-323--------------------------------------------------------------------------------
R6WM45_9PORP/34-325--------------------------------------------------------------------------------
Q3ARA5_CHLCH/34-329--------------------------------------------------------------------------------
G8X7V7_FLACA/36-324--------------------------------------------------------------------------------
D3UFK7_HELM1/31-300--------------------------------------------------------------------------------
D9SID5_GALCS/30-319--------------------------------------------------------------------------------
K9WP18_9CYAN/130-441--------------------------------------------------------------------------------
PDXA_PSEHT/27-319--------------------------------------------------------------------------------
A1AWJ1_RUTMC/26-312--------------------------------------------------------------------------------
PDXA_STRMK/28-315--------------------------------------------------------------------------------
Q3V8D3_GEOSL/34-325--------------------------------------------------------------------------------
B6IN68_RHOCS/40-329--------------------------------------------------------------------------------
D4M806_9BACT/32-348--------------------------------------------------------------------------------
I4A0Q6_ORNRL/35-323--------------------------------------------------------------------------------
V4JCI5_9DELT/37-338--------------------------------------------------------------------------------
I1XKV7_METNJ/29-321--------------------------------------------------------------------------------
U6B4X5_9RHIZ/39-331--------------------------------------------------------------------------------
G8UPW0_TANFA/30-320--------------------------------------------------------------------------------
B0TBI8_HELMI/32-323--------------------------------------------------------------------------------
F4HD17_GALAU/31-322--------------------------------------------------------------------------------
J9QT86_RIEAN/36-321--------------------------------------------------------------------------------
PDXA1_PSEAE/27-320--------------------------------------------------------------------------------
F4KTC5_HALH1/42-332--------------------------------------------------------------------------------
V9VUT8_9RHOB/30-316--------------------------------------------------------------------------------
A1WVT6_HALHL/30-323--------------------------------------------------------------------------------
A8FHA9_BACP2/32-324--------------------------------------------------------------------------------
I4AG95_FLELS/65-362--------------------------------------------------------------------------------
F6GFQ1_LACS5/35-322--------------------------------------------------------------------------------
D9S1Z9_THEOJ/31-320--------------------------------------------------------------------------------
U3U9G2_9GAMM/29-322--------------------------------------------------------------------------------
C5ZY06_9HELI/27-295--------------------------------------------------------------------------------
W0HX00_9GAMM/29-321--------------------------------------------------------------------------------
L0KAL8_HALHC/32-321--------------------------------------------------------------------------------
F9ZTS3_ACICS/32-320--------------------------------------------------------------------------------
W0PD12_9BURK/38-333--------------------------------------------------------------------------------
I2EZC0_EMTOG/35-326--------------------------------------------------------------------------------
R7PD86_9BACT/34-324--------------------------------------------------------------------------------
Q2S9C2_HAHCH/25-319--------------------------------------------------------------------------------
R7DEZ6_9PORP/35-326--------------------------------------------------------------------------------
D0L089_HALNC/37-327--------------------------------------------------------------------------------
K9WWL5_9NOST/42-342--------------------------------------------------------------------------------
E1V6Y8_HALED/34-339--------------------------------------------------------------------------------
D7AYM9_NOCDD/33-324--------------------------------------------------------------------------------
G8M1K4_CLOCD/32-322--------------------------------------------------------------------------------
Q13RP4_BURXL/47-338--------------------------------------------------------------------------------
B1XQD4_SYNP2/31-333--------------------------------------------------------------------------------
K9PRQ4_9CYAN/33-337--------------------------------------------------------------------------------
B2JVC5_PARP8/44-333--------------------------------------------------------------------------------
E6U0H3_BACCJ/33-324--------------------------------------------------------------------------------
I3TLQ2_TISMK/41-330--------------------------------------------------------------------------------
U3U6Y7_9ENTR/31-323--------------------------------------------------------------------------------
D8PAQ2_9BACT/40-332--------------------------------------------------------------------------------
A6WG90_KINRD/420-711--------------------------------------------------------------------------------
Q6AJE3_DESPS/35-321--------------------------------------------------------------------------------
D8IZA6_HERSS/29-330--------------------------------------------------------------------------------
PDXA_HELPY/30-306--------------------------------------------------------------------------------
E0UJK2_CYAP2/32-338--------------------------------------------------------------------------------
H6LGK9_ACEWD/32-322--------------------------------------------------------------------------------
E4T4J1_PALPW/35-325--------------------------------------------------------------------------------
I1YT17_PREI7/35-321--------------------------------------------------------------------------------
Q1GZB9_METFK/29-319--------------------------------------------------------------------------------
W0DQ96_9GAMM/30-322--------------------------------------------------------------------------------
S6ADC8_9PROT/41-329--------------------------------------------------------------------------------
Q3ACP1_CARHZ/32-323--------------------------------------------------------------------------------
C4K4L0_HAMD5/30-322--------------------------------------------------------------------------------
PDXA_ECOLI/29-321--------------------------------------------------------------------------------
F4LW28_TEPAE/34-336--------------------------------------------------------------------------------
R5A8A6_9CLOT/34-337--------------------------------------------------------------------------------
V5SD81_9RHIZ/47-343--------------------------------------------------------------------------------
D0MJ80_RHOM4/43-335--------------------------------------------------------------------------------
M9WW13_MANHA/31-320--------------------------------------------------------------------------------
PDXA_SULDN/30-300--------------------------------------------------------------------------------
M4UJW4_9GAMM/32-323--------------------------------------------------------------------------------
A9IK05_BORPD/40-331--------------------------------------------------------------------------------
Q5E864_VIBF1/34-327--------------------------------------------------------------------------------
H8XRP0_FLAIG/36-322--------------------------------------------------------------------------------
K1WRA1_MARBU/43-327--------------------------------------------------------------------------------
PDXA_SHEDO/27-319--------------------------------------------------------------------------------

PF00180

LEU3_BACSU/4-352--------------------------------------------------------------------------------
LEU3_ECOLI/6-355--------------------------------------------------------------------------------
IDHC_SOYBN/8-403--------------------------------------------------------------------------------
LEU3_AGRFC/5-361--------------------------------------------------------------------------------
IDH3A_BOVIN/33-358--------------------------------------------------------------------------------
LEU3_SCHPO/5-363--------------------------------------------------------------------------------
LEU3_LEPIN/3-354--------------------------------------------------------------------------------
LEU3_NEUCR/5-358--------------------------------------------------------------------------------
LEU3_LACLA/4-340--------------------------------------------------------------------------------
IDH_THET8/21-351--------------------------------------------------------------------------------
LEU3_YARLI/14-367--------------------------------------------------------------------------------
IDH2_YEAST/38-365--------------------------------------------------------------------------------
IDH_BACSU/21-418--------------------------------------------------------------------------------
LYS12_YEAST/25-367--------------------------------------------------------------------------------
D5A186_ARTPN/6-352--------------------------------------------------------------------------------
G2TK86_BACCO/4-350--------------------------------------------------------------------------------
M4CW66_BRARP/45-394--------------------------------------------------------------------------------
Q480C2_COLP3/29-412--------------------------------------------------------------------------------
LEU3_THET8/2-339--------------------------------------------------------------------------------
R4KBV6_CLOPA/5-353--------------------------------------------------------------------------------

PF03971

D5CQ42_SIDLE/5-737KIIYTLTDEAPSLATYSLLHIIQAFTKAAGVTVETSDISLAGRILANFPEHLS.....AAQKVTDGLAELGALTLKPEAN
A6Q387_NITSB/6-736.IVWTKIDEAPALATYSLLPIVKAFTKDSGVEIELRDISLAGRVIAEFSDRLP.....EDKKQADELAYMGELVLKPEAN
I6WPR8_PROPF/3-733KIIYTLTDEAPRLATCSLLPVLQAYGRLAGIGIEGRDISLAARILARFPDFLP.....DDKRVSDTLDELGELTRDPLAN
D9SIT7_GALCS/5-738KIIYTMVDEAPALATYSLLPIVQAFTKAAGVAVETRDISLAGRILANFPDKLT.....PEQKIADELSELGQLALKDEAN
D5V1Z1_ARCNC/3-729KIIYTKVDEAPALATYSFLPIIKAFTKSSGIEMVTKDISLAGRILANFPENLK.....EDQKIGDHLAELGKLTQDPTVN
D1B1Z3_SULD5/7-741KIIYTQVDEAPALATYSLLPIIKAFVKRSSIKIETRDISLSGRILAHFSDYLT.....NEQRVNDDLAYLGTLANTPEAN
K7SLX7_PROA4/3-736TIVWTKVDEAPALASYSLLPIIRGFLTGTGVDITTSDISLAARILAQFPERLA.....ADQRVDDNLAELGRLTGDPQAC
A3U876_CROAH/5-738TIKYTKTDEAPMLATHSFLPIVQRFTKTSNITIDVEDISLAGRIIATFSDRLT.....EEQKQYDALAALGELAKQPEAN
A1S7A8_SHEAM/7-739TIIYTETDEAPALATLSLLPILQTFAEPAGVKIETRDISLSGRVIATFPEKLT.....DAQRIGDHLAELGELATKPEAN
L0FYJ1_ECHVK/23-756KILYTLTDEAPALATYSLLPIIKSFTDSAGVVVETRDISLSGRIIANFPEYLK.....EDQRIGDALAELGEIAKTPEAN
F6FT01_ISOV2/6-736TIIYTHTDEAPLLATYSFLPIVQAYAAKAGVNVETRDISLAGRILAQFPEHLT.....DEQRVGDALAELGQLATTPEAN
F2II47_FLUTR/7-740TILYTLTDEAPALATYSFLPIVKAFASTAGIEVESRDISLAARILASFPESLT.....DAQRVPDSLSELGKLATAPEAN
V9VSX7_9RHOB/9-736.ILYTIVDEAPELASASFLPIIRKFASAAGVTVGTKDISLAGRIIAAFPENLT.....EDQRQSDDLAELGQLVKTPDAN
Q9I0L4_PSEAE/6-738KITYTFTDEAPALATYSLLPIVKAFAASAGIDVETSDISLAGRILANFADRLE.....ADQRIEDDLARLAVLATSPDAN
A1R425_ARTAT/3-735KIIYTHTDEAPMLATYSFLPIVEAYASTAGVEVETRDISLAGRIIAVFGDFLT.....EEQRTGNALAELGELAKQPEAN
B1VF46_CORU7/3-734KIIYTRTDEAPLLATYSLKPIVEAFASTCGVDVETRDISLAGRILAAFNDKLP.....KEQQVNDALKELGELTQSPEAN
A7HAP6_ANADF/7-741TIIWTEIDEAPALATYSLLPIVQAFTKGTGVSVETRDISLAGRIIANFPENLT.....ESQRIPDYLAQLGELARTPEAN
F2LTW4_HIPMA/7-743TIVWTKTDEAPYLASFSLLPIVKGFVKHADVDVEVRDISLAGRILATFPEYLK.....EDQRINDDLAYLGELVNKPEAN
D2UG49_XANAP/6-738KILYTLTDEAPYLATQSLLPIVAAFAGTAGIAVETRDISLAGRLIAQFPESLR.....EDQRIADDLAELGQLATTPEAN
B0BZF4_ACAM1/9-741.IIYTHTDEAPALATYSFLPIVEVFTQVAGIEVETRDISLAGRIIASFPEKLT.....ADQQQLDNLAYLGDLAKTPEAI
E1STT1_FERBD/3-736KIIYTHTDEAPALATQSLLPIIEAFTGAANIDIETRDISLSGRIIANFPENLT.....EAQRMNDALAELGELAKTPDAN
Q0A9L5_ALKEH/8-739TIYYTLTDEAPALATRSLLPVVQTFTGAAGIDVKLSDISLAGRILSAFPERLS.....DDQKVEDGLAFLGDLTQDPNAN
B3QVP5_CHLT3/7-740KIIWTEVDEAPALATYSLLPIVNAFTGVAGVPVETRDISLSGRIIANFPENLT.....DEQKIPDELTALGELAKTPEAN
H8XU75_FLAIG/5-736KIIYTLTDEAPMLATHSLLPIIQAYTKTAGIKVETRDISLAGRILANFSEYLK.....EEQKINDALAELGQLATTPEAN
A5WH85_PSYWF/3-737KIIYTKTDEAPALATLSLLPIVEAFTKTAGISVETSDISVAARILAEFPDYLT.....EEQRVPDNLAELGRLTQDPNTN
D7BKH3_ARCHD/4-733.MIYTYTDEAPMLASASFLPIAQAFVRTAGIDLVSRDISLSGRIIAAFSDLLP.....TSLRQPDALADLGKLTLEPDAN
A3QD82_SHELP/6-738TIIYTETDEAPALATLSLLPIIKHFTAAAGVGVETRDISLSGRVIANFPEFLK.....PEQQISDALAELGELATKPEAN
Q31GM7_THICR/4-737KIIYTLTDEAPALATYSLLPIVEAFTKAAGVSVETRDISLAGRILANVPDKLS.....EAQKVGDALTELGNLAKTPEAN
C7M412_CAPOD/4-735.IIYTITDESPYLATHSLLPIIKRFCASSGINFEAKDISLAGRILATFPDFLT.....AEQRVPDALSELGALATCPEAN
E1V4K9_HALED/6-739KIIYTLTDEAPALATRSLLPIIDAYTDSAGITVETRDISLAGRIISQFPDRLS.....DAQQLGDHLAELGELAKTPEAN
Q88FS1_PSEPK/6-739KIIYTFTDEAPALATYSLLPIIEAFTASADIAVETRDISLAGRILAAFPEQLG.....AEKQVGDHLAELGQLATTPEAN
K4KV52_SIMAS/7-739KIIYTLTDEAPALATYSLLPIVNAFAAAAGIEVETSDISLAARILAHFPECLT.....FEQRVPDALAELGALTQDPNAN
F2JWD6_MARM1/5-737TIYYTLTDEAPALATASLLPIFQAFAKEADINLQLTDISLAARVLSLFTDRLP.....EDKQVEDGLSFLGELTADPDAN
F0S094_DESTD/6-733TIIWTKVDEAPALATYSLLPIMRAFVKHADVDIEVRDISLAGRILAQFG............YVPDDLAYLGELVWKPEAN
D3UGP7_HELM1/2-738KITYTLTDESPALATYSFLPIVRAFLHTAGIEVESADISLAGRILAQFPQHLT.....PSQRIPNALEALGELVKHKDAN
W0J5H7_9BACT/9-742.IIYTKTDEAPALATYSLLPIIQAFTKHSGISVEPRDISLAGRILAAFADLLP.....PSQKTHDALAELGALTLKPEAN
B9L5J0_NAUPA/5-736TIVWTKIDEAPYLATFSLLPIMEAFTKDANINWELRDISLAGRVIAEFSDMLP.....ENLRQFDELAYLGELVKKPEAN
T2KNT3_9FLAO/6-739KIIYTKTDEAPALATYSFLPIVQAFLNPSGINVETRDISLAGRIIANFSDFLS.....EEQQLPDALTELGELAKKPEAN
A0LZ01_GRAFK/6-739KIIYTKTDEAPMLATYSFLPIIEAFTKAAGVSLETRDISLAGRILSQFPDYLN.....EDQKVKDDLAELGELAKKPEAN
C7MEJ9_BRAFD/4-740.IIYTHTDEAPMLATASFLPILDAFSDTAGIEVTTRDISLAGRIVAAFSELLP.....EDQREADALAELGELAKTPEAN
A8EUE7_ARCB4/3-729KIIYTKVDEAPALATYSFLPIIQSFTKSSGIEMVQKDISLAGRIIAAFPENLT.....DEQKIGDALAELGEMTQDPNAN
M1MV91_9CORY/3-734KIIWTRTDEAPLLATYSFKPVVEAFAGTAGIDVETRDISLAGRILAQFPDKLT.....DEQRVDDALAELGELAKTPEAN
Q21K35_SACD2/7-740KIIYTETDEAPALATYSLFPIVKKYAAAAGVELEMRDISLAGRILAVFPEFLA.....EDQRQSDALAELGELAKQPSAN
A0L819_MAGMM/7-741.IIYTIVDEAPELASGSFLPIIQAFTKPAGISVGTKDISLSGRIIAAFNDKLP.....AEQRIPDALAELGEMVKTPGAN
E6X675_CELAD/3-737KIIYTKTDEAPALATQSFLPIVKAFTKTSGINIETKDISLAGRIIATFPDFLK.....EDQRIADDLTELGELAKNPDAN
D5EP32_CORAD/6-738KILYTITDEAPALATHSLLPIISAYTAAAGVSVETRDISLSGRILANFPDYLT.....EDQQISDALAELGELAKTPEAN
D8IWJ4_HERSS/7-740TIIYTLTDEAPYLATHSLLPIVKKFTAAAGIDVVESDISVAARILAEFPEYLT.....DEQKVPDNLAALGALTQSPDAN
Q480C1_COLP3/7-740KIIYTITDEAPALATYSLLPIIQAYTASSGINVETRDISLAARILANFPKYLT.....KEQRVDDALSELGKLAKTPEAN
J9R9T1_RIEAN/5-736KIYYTLTDEAPMLATHSFLPIVKAFTKSADIQIEVPDISLSGRILANFPEVLT.....EEQRILDALTQLGELATKPEAN
I1XFF5_METNJ/3-736KIIYTKVDESPAAATFSLLPIITAFIKAAEISFEISDISLAGRIIATFPDNLT.....DDQKIPDHLAELGNLTQDPATI
H9UIG1_SPIAZ/5-737.IVYTQTDEAPALATHSFLPVIKTFADAVGVAVETRDISLAGRILAQFPERLS.....DAQRVSDDLAELGELVHQPDAN
C1N5W5_MICPC/17-758KIWWTLTDEAPALATHAFLPVVRRFCGGVGVSVESADISLASRVLAAFPERLT.....PAQRKTDVLAKLGELATTERAN
D8PBJ4_9BACT/7-740KIIYTKTDEAPMFATYSLLPIINAFSKAAGVSVELRDISLAGRILAVFPEYLT.....PEQRQPDALSELGELAKKPEAN
H1Z8C0_MYROD/6-737KILYTFTDEAPMLATYSFLPIVQAFAQTAGIDVETRDISLAGRILANFPEYLK.....EEQRIGDALAELGELAKSPEAN
E1WXB0_HALMS/7-740KIIYTKTDEAPALATESLLPIVKAFTATAGIEVETRDISLAGRVLANFPENLK.....DDQKISDALTELGELAKTPEAN
Q9KSW5_VIBCH/7-740TIIYTITDEAPALATYSLLPIIQSFTASSGINVETRDISLAGRILANFPEHLT.....EEQRISDALTELGELAKTPEAN
I3YS17_AEQSU/6-739KIIYTKTDEAPALATHSFLPIVEAFTAPANIELESKDISLATRILAVFPEFLK.....EEQRVNDDLAELGELAKKPEAN
A1STK8_PSYIN/7-740KIIYTQTDEAPALATYSLLPIVSAFTQAADITVETRDISLAARILATFPDNLS.....AEQKQADALTELGELAQQPQAN
D7WAL0_9CORY/3-734KIIWTQTDEAPLLATYSLKPIVEAFASNAGVDVETCDISLAGRILAQFPDYLD.....EDQRVNDDLAKLGELAETPEAN
B2GKD0_KOCRD/3-733KIIYTETDEAPMLATYSFKPMVEAFASTAGVEVETRDISLAARILAQFPDRLT.....DAQRVPDTLGELGELAKTPEAN
M4U620_9GAMM/7-740KIIYTLTDEAPALATYSLLPIVNAFTNVADIVVETRDISLATRILSQFSHYLS.....TKQQRPDALAELGVLVKDASAN
A1K4K8_AZOSB/7-741TIIYTITDEAPMLATAAFLPVIRSFTKPAGIQIEEADISLAGRILAEFPDFLS.....DAQKVPNTLAELGALTLKPEAN
C5BIJ2_TERTT/8-740.IIYTETDEAPALATYSLLPIVQAFAKAAGISVETKDISLSGRVIANFSDYLT.....ADQQQEDALALLGELATKPEAN
E4PIW6_MARAH/7-740KIVYTLTDEAPALATRSLLPILETYAKPAGIEFETSDISLAARILANFPDYLE.....EDQRVPDALAELGEYTKDPDAN
E4RUN8_LEAB4/17-750KIIYTITDEAPALATYSFLPIVEAFTKPAGVEIETRDISLSGRILANFSEFLT.....DEQKVSDDLAYLGKLAVEPEAN
F8JJ69_STREN/5-736TIIYTHTDEAPALATYSFLPVVEAYASKAGVTVETRDISLAGRILAVFPEYLE.....EGQRIDDALAELGELAKTPGAN
C7NKD1_KYTSD/3-736KISWTRTDEAPLLATYSLKPIVEAFATTADIDVETRDISLAGRILAQFPEQLS.....EDQRVEDALGNLGDLAKTPEAN
Q9JZS1_NEIMB/6-739TIVYTHTDEAPALATQSLLPIVQAFARHADIDVKTSDISLSGRILAAFPEYLT.....EAQRVPDALAELGELVKQPDAN
C5ZYN4_9HELI/2-724KITYTLTDESPALATYSFLPIVKAFLKKAEIEVETSDISLAARILAQFP..........ENGYKDELALLGNLVEKPDAN
C1DL01_AZOVD/5-737KIIYTLTDEAPALATYSLLPIIKAFTGSSGIAVETRDISLAGRLIATFPEYLT.....DTQKISDDLAELGKLATTPDAN
E6S9C5_INTC7/5-731KIIYTYTDEAPALATASLLPIVQAFASKAGVDVETRDISLAGRILAAF............GLADDALAELGALAKRPEAN
Q2SHA1_HAHCH/6-738KIVYTLTDEAPLLATYSFLPIIKKFASAAGVDVETSDISLAARVLANFPECLS.....EEQKVPDALAELGELVKQADAN
C4LKD9_CORK4/3-734TIIYTRTDEAPLMATYSLKPVVEAFASTAGVDVETRDISLAARTLAAFNDVLP.....EDQRVNDALAELGALAKTPDAN
F8E409_FLESM/8-745.IIWTEIDEAPALASYSLLPIVRKFLESAGIDVEAVDISLAGRIIANFPDYLK.....EDQRIPDYLSQLGELALKPEAN
W8S0Q0_9RHOB/9-733.IIYTKVDEAPELASASLLPIIQRFADAAGVSVGTRDISLAGRIIAAFPETLT.....EEQRQSDDLADLGELVKTPEAN
W0JIX7_DESAE/6-742KIYWTKVDEAPYLATFSLLPAVERFLKAAGIDVEIKDISVAGRILANFPEYLK.....EDQRVPDDLGELAELVKLPDTN
B3E9R4_GEOLS/7-740KIIWSKIDEAPALATYSLLPIVNAFTKAAGVVVETRDISVAGRIIANFPDYLT.....PEQRMPDYLAELGELTQKPEAN
M1E507_9FIRM/6-743KVIWTITDEAPYLATFSLLPIVKKFFDVSDIEIDIKDISLSSRILANFSDFLT.....QDQRVSDDLSILGELVNKPDTI
Q0PAY5_CAMJE/3-729.ITYTLTDESPALATYSFLPIVKAFLSRAHIGVKTSDISLSGRILATFSEYLK.....EEQRCEDALELLGELVKRSDAN
A3HX33_9BACT/7-740KILYTLTDEAPALATYSLLPIVQAFTSSAGVQVETRDISLSGRIIANFPSYLT.....AEQQIGDALAELGDIAKTPEAN
A8LP43_DINSH/9-721.IVYTTVDEAPELASASLLPIIQAFAAPAGVSVGKKDISLAARILAAV............AGAPDHLAELGGLVKTPTAN
K0C4Y6_CYCSP/7-740KIIYTLTDEAPLLATASFLPIVEAFAGAAGIDVEVSDISLASRVLATFADQLP.....DDQKVPDALSELGRLTQNPETN
A0RPF0_CAMFF/4-728.IIYTYTDEAPALATFSLFPVIKEFLNRANIDIQTVDISLSGRILANFSEYLN.....DDQKVPNYLEILGEMTKEKSAN
B3ENX3_CHLPB/3-736KIIYTKIDEAPALATYSLLPIIQAFTNGTGISVETSDISLAARIIANFPENLT.....EEQRIPDNLTALGEMAMTKEAN
F9YPD0_CAPCC/6-739TIIYTKTDEAPFLATHSLLPIVKRFTKSSGIDFQLKDISLAGRILANFPDFLK.....KEQQVEDALTELGKLATEPEAN
B3PL57_CELJU/5-738KIIYTQTDEAPALATYSLLPIVQAFTQSSGVNIETRDISLAGRIIALFPEYLS.....EDQRIGDHLAELGQLATTPEAN
C1FF99_MICCC/20-749KIWWTLTDEAPALATHAFLPVVRRFLGPSGVSVETADISLAARILAAFPERLT.....PAQRRVDVLAKLGELAKTSRAN
H2G1D1_OCESG/7-738TIVYTLTDEAPALATYSLLPIIRTFTDAAGIDVTLSDISLAGRVLAAFPERLT.....DEQRVADGLAELGKLTQDPHAN
E6W3A0_DESIS/5-739KIIWTEIDEAPALASYSLLPVVRAFTKGTGIEVEAWDISLAGRILANFPEYLT.....EGQRIPDYLSQMGEVAKTPEAN
D5VA96_MORCB/5-738TIIYTHTDEAPALATHSLLPIIRAFGATAGVDFVTSDISLAGRILAAFPEYLT.....QEQQTPDALAQLAELVTQPKAN
Q5QZT7_IDILO/7-738KIIYTETDEAPRLATYSFLPFIEAFTKAAGVSVETRDISLAGRIISQFPEYLT.....EEQRQSDALAELGEMAKTAEAN
D5BKK7_ZUNPS/6-738KIFYTKTDEAPALATYSLLPIVQTYTKAADVILETKDISLAGRILSQFPEFLE.....DNQKVADALAELGELAKKPEAN
E2SFF0_9ACTN/5-735TIIYTHTDEAPALATYSFLPVVQTYAATAGVAVQTRDISLAGRIISQFPEFLT.....EDQRVDDALAELGALAKTPGAN
I6YVP5_MELRP/4-738KIMWTKTDEAPALASYSLLPILQSYTKGTGIEFEVKDISLAGRILAAFPEYLS.....EAQRIDDHLAELGKLTQDPNAN
W0I0L2_9GAMM/6-739KIIYTLTDEAPALATYSLLPIIRAFTQSLGIAVETRDISLGGRILANFPEHLQ.....SDQRLSDHLAELGQLAVTPEAN
C9RMQ9_FIBSS/4-740KIYYTLTDESPFLATQSLLPIVSAFAKTADIDVETKNISLPGRILAAFADTLPAGTTFAGKPVTDDLAFLGKLTLEPDAN
I5AYK9_9DELT/4-736KIRWTRTDEAPLLATHSLLPIVNSYLKGSGIEVELRDISLAGRVLANWSDRLK.....DDQKVSDDLAFLGQLAKSPDGN
Q3IH53_PSEHT/4-737KIIYTKTDEAPALATYSLLPIIQAYTNAAGVEVETRDISLAGRVIASFPDYLT.....PEQRINDALAELGELAKTPEAN
V5WJE7_9SPIO/3-736KIIYTRTDEAPALATYSLLPVIQQFAGTAGVDIETRDISLAARILSQFPDYLS.....TEQKVHDALAELGELVQRPEAN
B2V8Q7_SULSY/5-744TIVWTKIDEAPALATYSLLPIMRAFTKGADVEIELRDISLSGRVIALFPEYLK.....EDQRIPDELSYLGELVWKPEAN
Q30RQ6_SULDN/3-727KIIWSKIDEAPALATYSLLPIVNAFTKAAGVEVVTSDISLAGRVISKFSDRLK.....PEQRINDELAELGNVVLQPDGN
E8UGI5_TAYEM/3-734TISYTFTDEAPMLATYSFLPIVKAFTSVADIEVETKDISLAGRILAVMGDYLN.....DDQRVPNALAELGELATKPEAN
M1P925_DESSD/6-739.IIYTKVDEAPSLASYSLLPILQGFTKGSGFSLVEKDISLAGRILANFPEKLT.....PGQRVADDLGELGRLVKEPEAN
H1XS30_9BACT/5-740KIYWTKTDEAPYLASFALLPVIKAFTKGTGIEIETKDISLAGRIIATFPDKLR.....EEQKITDDLKELGELTQNPDAN
Q5NET6_FRATT/12-745KIFYTFTDEAPALATGSFLPIVESFTKVADIELETKDISLSARILANFNDYLT.....AEQKCSDDLAILGELAKTPDAN
R7XUF3_9ACTN/3-734KIIYTHTDEAPMLATYSFLPIVAAYARTAGVEVETRDISVAARIISQFPERLT.....EDQRLPDALAELGELATKPEAN
S5R118_9PROT/7-741TIFYTLTDEAPMLATYSFFPIIKKFTTLANIKIISSNISIAARTLSKFSSYLR.....KDQKILDDLDELSKLIKKPYIN
Q7UX35_RHOBA/8-739.IVYTHTDEAPALATRSLLPILQAFTSGSGLSFETKDISLAGRILAGFADRLP.....ADKQVPDALAELGELVTKPEAN
F6GBX4_LACS5/6-738KIIYTKTDEAPALATRSFLPIVKAFVKSSGIDIETKDISLAARILATFPDFLN.....DDQKVNDDLAYLGELAKKPEAN
A4AQ16_MARSH/3-736KIFYTKTDEAPALATQSFLPIVQAFTKTSGITIETKDISLAARIIATFPDYLN.....KEQRVENDLDVLGQMAKMPEAN
D3PCR7_DEFDS/7-744TIIWTETDEAPFLATFSLLPIVKAYLKHADVDVEVRDISVAGRILATFPDYLT.....DDQKVNDDLAYVGELVNKPEAN
Q0VQ19_ALCBS/5-738KIIYTMTDEAPALATYSFLPIIEKFTSIAGIEVESSDISLATRILASFPEYLS.....EQQKVKDTLSELSDLTQDPEAN
Q6A6Z7_PROAC/3-732TIVWTKIDEAPALASYSLLPIVEGFLDGSGIDITTSDISLAGRILAQFPDRLN.....EDQKVADHLAELGELTGSPDAN
I0AFK0_IGNAJ/4-739KIYWTKTDEAPALASYSLLPILKSFTKGTGIEFVEKDISLAGRIIANFPDNLT.....KEQQIPDYLAELGELTQHPNAN
I0IE50_PHYMF/4-736.IVYTLTDEAPALATAALLPVLRAFTRHAGTHFELEDISLAGRILARFPERLT.....ADQRQEDALAKLGAMAKQADAT
M5AMA5_9ACTN/5-738TIIYTITDEAPAMATYSLLPIVKAFAGAAGVEVETRDISLAARVLAQFPERLT.....PEQQTPDALTELGEIALTPGAN
K4IX24_PSYTT/7-740KIIYTKTDEAPALATYSFLPIIRRFTESAGINILSKDISLAARILTSFSDYLT.....EEQKVDDSLTYLGKLAKTPEAN
A4SVS2_POLSQ/7-740KIIYTLTDEAPLLATCAFLPIIRTFTAPAGVEIVNSDISVAARILAEFSECLT.....TEQKVPDNLAELGKMTLMPDTN
G7UU97_PSEUP/6-738KIIYTLTDEAPFLATQSLLPIIDAYTDTAGIVVETRDISLAGRILAQFPDLLG.....AEQRVADDLAELGELATRPEAN
K9UP30_9CYAN/7-740KIVYTFTDEAPALATYSFLPIVQAFTKAANVTIETSDISLAGRIIAAFPERLT.....AAQQQPDDLAILGELAKTPAAN
F0S4K1_PSESL/6-737KIIYTKTDEAPMLATYSFLPIVQAFTASAGVDVETRDISLAGRILANFPEFLK.....EEQRIGDALTELGVLATTPEAN
I3ZAR1_BELBD/7-739KILYTLTDEAPALATYSLLPIVKAFTDSAGVVVETRDISLSGRIIALFPEFLT.....SDQKIGDALAELGDVAKTAEAN
A1SMP0_NOCSJ/3-734TIIYTHTDEAPLLATYSFLPIIQAYAAKAGVEVETRDISLAGRIIAQFPDRLT.....AEQRIDDALAELGELAKRPEAN
C5C942_MICLC/3-736KIIYTLTDEAPMLATASLLPIVRAYAGTAGVELETRDISLAGRILAAFKDVLP.....EEQRTADALAELGELVKTPEAN
A4CN95_ROBBH/3-737TIHYTKTDEAPALATASFLPIVQAFSRTAGIDITTKDISLAGRILAAFPEFLS.....EAQRIPNDLEFLGELAKQPEAN
A9GTS3_SORC5/41-773TIIYTKTDEAPALATYSLLPIVEAFTKAAGVRVETRDISLAGRILANFPERLT.....DNQKLGDHLAELGELAKTPNAN
B1XIH1_SYNP2/14-747KITYTFTDEAPALATYSLLPIVEAFTTAANIEVETKDISLAGRIIANFPEYLT.....ADQRRPDALAELGALAKTPDAY
I4B3K5_TURPD/7-740KIIWTKIDEAPALATYSLLPIVNAFTKAAGVVVETCDISLAGRILANFPENLS.....ESQKVADGLAALGKLVLLPEAN
B0UWC0_HISS2/4-735KITYTLTDEAPMLATYSFLPIVQAFTAVANIDVETKDISLAGRILANLSAYLS.....EEQKIPDALAELGELATKPEAN
E8ND12_MICTS/5-736TIIYTYTDEAPALATASFLPIVQAVTKQAGVDVETRDISLAGRILAAFPQRLT.....PEQQVGDALAELGGLATLPEAN
E6WXM1_PSEUU/6-738KIIYTLTDEAPFLATQSLLPIVQAFAGTAGIQVETRDISLAGRILAQFPDYLG.....DDQKIGDHLAELGELATRPEAN
G0HFV7_CORVD/3-741KIIYTRTDEAPLLATYSLLPVIEAFAGSAGVEVETRDISLAARILAAFDDLLP.....AEQRVDDALAELGEITKTPDAN
G8R0B4_OWEHD/6-739KIIYTKTDEAPALATYSLLPIISAYTDTAGVEVETRDISLAGRILALFPDFLN.....DDQKVGDALAELGALAKTPEAN
Q167P5_ROSDO/9-739.IIYTKVDEAPQLASASLLPIIRKFAAAAGVSVGVKDISLAGRILAAFPEHLS.....ADQRQSDDLAELGKLVKTPDAN
Q5E3X6_VIBF1/7-740KIIYTITDEAPALATHSLLPIIQAFAASSDIDVDTRDISLAGRVIANFPEYLT.....EDQRIGDALAELGELAKTPEAN
B7FVA8_PHATC/76-804.ILYTETDEAPALATFSLYPVISKFSALANVDIVPCDISVAGRVLAAFPECLK.....PSQRVPDNLSYLGKKALEADCA
D6Z308_DESAT/5-739KIIYTEVDEAPALATYSLLPILRAYTRESGVAIETRDISLAGRIIANFPENLT.....KEQQIPDDLTELGRLCQLPQTN
A4GAN1_HERAR/6-739KIIYTLTDEAPALATYSLLPIVEAFTRSSGIIVETRDISLAARILAAFPDVLD.....DKQKIAPALAELGELATTPEAN
D0LWU8_HALO1/6-739TIIYTKTDEAPALATYAFLPVIEAFAAPAGVSVETRDISLAARILAVFADVLE.....PEQKVHDALAELGELAKTPEAI
Q9PA20_XYLFA/23-756KLIYTLTDEAPFLATQSLLPIIKAYTKVAGIQVETRDISLAGRILAKFPDVLT.....ETQRVSDDLAELGEMTASPDAN
G2PQU0_MURRD/3-736KLYYTKTDEAPALATLSFLPIVKSFTETANITVETKDISLAGRIASVFPELLN.....EEQQVPDDLSILGELAKTPEAN
F5XPH8_MICPN/8-738.IVYTRTDEAPLLATYSLLPIIAAYAAKAGVDIESRDISLAARILAQFPERLG.....ADQQVPDALAELGALAKTPEAN
Q15T95_PSEA6/7-740KIIYTKTDEAPALATYSLLPIVESFASSADIEIELSDISLAARILANFADYLS.....DEQKVPDALAELGELTQDAATN
Q74D54_GEOSL/5-738KIIWTEIDEAPALATYSLLPIVQAFTKGTGVEVETRDISLAGRIIANFPENLT.....DAQKIPDFLTQLGELTQSPEAN
L7W579_NONDD/6-738KIIYTKTDEAPALATASFLPIVKKFLAPAGIDVETRDISLAGRILAVFPERLK.....EGQKQEDALAELGNLVKNPEAN
C6X4T6_FLAB3/30-761KIIYTWTDEAPMLATHSFLPIVEAFAKTADIEFSPKDISLSGRILANFPEFLS.....EDQKVEDALAELGKLATTPEAN
F4AZL1_DOKS4/7-740TIKYTLTDEAPMLATHSFLPIIKRFTQSSNIDMELVDISLAGRIVANFPDNLT.....EDQKQEDALLALGELAKQPEAN
E3F024_KETVY/9-740.IVYTKVDEAPDLASASLLPIIRRFAKAAGIAVETRDISLAGRIISAFPERLT.....PAQRQSDDLAGLGHWVKTADAN
A5FHV4_FLAJ1/6-737KIFYTLTDEAPLLATYSLLPIVQAFTSTAGIAIETRDISLAGRILSNFPESLT.....DAQKTGDALAELGQLATQPEAN
E3I1D3_RHOVT/8-741.IVWTKTDESPALASYSLLPIVQAFTKTAGVSVVEKDISLAGRLIATFADTLK.....PEQRQPDALAELGALAKRPEAN
A1BEA8_CHLPD/6-739TIIYTKIDEAPALATYSLLPVIQAFAKGTGVDVETRDISLAGRIIANFPDNLT.....EEQKISDQLAELGQLALTPEAN
Q2L0N5_BORA1/6-739KIIYTFTDEAPALATRSLLPIIQTFAKPAGITFETRDISLAGRIIAVFPEFLT.....ESQRIGDALAELGALALKPEAN
D1BZX3_XYLCX/6-737TIIYTHTDEAPLLATYSFLPIVQAFAGQAGVALETRDISVAARILALFPERLT.....EEQRVPDALAELGRLADAPEAN
E6WZW7_NITSE/6-726TIVWSKIDEAPALATYSLYPVVKKYVGKAGVNMRLSDISLAARTLAAMG............KHEDELAQLGELVHKPEAN
A2U0V2_9FLAO/3-736KIIYTKTDEAPALATRSFLPIVKAFTKSSNIEIEVKDISLAARILANFSHYLT.....ENQKVEDALSILGDLAKQPEAN
A1WFK0_VEREI/7-741TIIYTLTDEAPRLATASFLPIIRSFTAPAGIRVIESDISLAARVLAEFPEFLT.....EAQRRPNALAELGQKTLQADAN
A6W0E3_MARMS/6-738TIYYTFTDEAPALATASLLPIFGAFAKEADIELKLTDISLASRVIAAFSDRLP.....ADKQAEDGLKFLGDLTADPQAN
F4C4X4_SPHS2/6-739KIIYTKTDEAPALATYSLLPIVKAFTASSGIDVETRDISLAGRILAVLPEFLT.....EEQKVSDALTELGELATQPEAN
E4TNZ2_MARTH/6-739KILYTKTDEAPALATYSFLPIIKAFTDSAGVVVETRDISLAGRIISQFPERLK.....PEQQINDDLAELGEIAKTPEAN
F0RFA8_CELLC/3-734KIIYTKTDEAPALATQSFLPIVQAFTKTTGIEMETKDISLAARILAVFPDYLS.....KEQQFEDALAQLGELAKSPEAN
A6Q7S1_SULNB/5-725TIIWSKIDEAPALATYSLLPIVSKFTNAAGVDVKTSDISLAGRVLAAMG............LAEDELSKLGELVHKPEAN
E4TEW9_CALNY/5-739KIIWTKIDEAPALATYSFLPIVQAFFKGTGIEVEEKDISLSGRILANFPDFLK.....PEQRIPDYLAELGELVLKPEAN
F5Z8R7_ALTNA/5-738KIIYTKTDEAPMLATYSLLPIIKKFASAADVEVELSDISLAARVLATFPEFLS.....EEQRVPDTLSELGAMTQDPEAN
M5DRS5_9GAMM/7-740KIIYTQTDEAPALATYSFLPIVKAFTESAGVVVETRDISLASRILANFPDYLT.....EEQRQADALTELGQLAANPDAN
L0GSZ1_9GAMM/6-739KIIYTWTDEAPALATHAFLPIIRAFAGAAEVPVDTRDISLAGRILAVFPDVLA.....DAQRVSDDLADLGQMVLSPEAN
I3ZX83_ORNRL/7-736.IHYTLTDEAPMLATHSFLPMVKALTSLADIEIKLANISLAHRILANFPDYLE.....DEQRVDDALTQLGDLAKRPEAN
X4QUI6_9ACTO/4-731.IIYTHTDEAPMLATASLLPIVTGFAAQAGITIEQRDISLAGRILAALSDFLP.....AEQRQPDALAELGALTQAPDAN
A5WH86_PSYWF/3-738KIIYTKTDEAPALATQSFLPIVQAFTHSADIEVEVSDISLAARILALFPEYLN.....PEQQVPDALTELGQLVLKPDAN
A7I2F0_CAMHC/4-731.IIYTYTDEAPAMATFSLLPIIKRFLKSANINIETMDISLAGRILANFPENLK.....ENQKVKDYLSILGKMTAEKSAN
F6I9T7_ZOBGA/3-737KIFYTKTDEAPALATLSFLPIVKAFTKTADIGIETKDISLAGRIIAAFPDFLK.....EEQRIANDLEELGALAKSPEAN
G8MDD3_9BURK/7-743TIIYTLTDEAPLLATSAFLPIIRTFTAPAGVNVATSDISVAARILGEFPEYLT.....DAQKVPDNLAKLGELTQDADTN
F2J468_POLGS/28-761.ILYTKVDEAPELASASLLPIIRAFTKQAGITVGIKDISLAGRILAAFPDYLA.....DAQKQPDDLAELGTLVTEPDAN
C0QS34_PERMH/5-743TIVWTKIDEAPALATYSLLPIMRAFTKDADINIELRDISLAGRIIAQFPDILP.....EDKRIPDELAYMGELVWKPEAN
O53611_MYCTU/7-741TIIYTLTDEAPLLATYAFLPIVRAFAEPAGIKIEASDISVAARILAEFPDYLT.....EEQRVPDNLAELGRLTQLPDTN
G4QH54_GLANF/7-739KIIYTITDEAPALATQSLLPIIKAFTASSGIDVETRDISLAGRIIANFPDYLT.....EEQRIGDDLAELGELAKTPEAN
W0DU46_9GAMM/6-739TIIYTHTDEAPALATYSLLPIIQTFTAAAGVAVTTRDISLAGRILAQFNDYLT.....PEQQISDALTELGELAKTPAAN
C3PLB9_CORA7/3-723KIIWTRTDEAPLLATYSFKPVVEAFASTAGIEVETRDISLAGRILAQFPERLG......DKKVSDALAELGELAKTPEAN
Q4JTI7_CORJK/3-736KIIYTRTDEAPLLATYSLKPIVEAFASTSGVDVETRDISLAARILAAFSDVLP.....EEQKVDDALAELGELAKTPDAN
D1BGD8_SANKS/3-734KIIYTYTDEAPMLATHSFLPVVSAFAGTAGVELETRDISLAGRIIAAFPERLT.....DAQRIGDALAELGELATTPEAN
Q1R071_CHRSD/6-739KIIYTLTDEAPALATHSLLPIIAAYTSTAGVSVETRDISLAGRILAQFPDLLS.....DEQRVSDDLSELGELAKTPEAN
D4H3K7_DENA2/6-741.IVWTEIDEAPALATYSLLPMVQKFTKEADIAVETRDISLSGRILANFPDKLK.....DDQKVEDYLTQLGDWTQSPEAN
Q7VGX2_HELHP/2-729KITYTLTDESPALATYSFLPIAKAFLRHANIEVATSDISLSARILAQFPERLK.....QEQQVEDALSILGDLVKTKEAN
Q2W9R4_MAGSA/37-771KIIWTKVDEAPALATYSLLPIVQAFTGAAGVAVETRDISLAGRIIANFPENLT.....PAQRIGDELAELGELTLKPEAN

PF02504

PLSX_SYNY3/6-328----------------------------------------------------------AKIALDAMG------GDYA---
PLSX_HELPY/1-317----------------------------------------------------------MKIVIDLMG------ADHG---
PLSX_CHLTR/3-311----------------------------------------------------------VRLGVDMMG------GDHD---
PLSX_ECOLI/4-331----------------------------------------------------------LTLALDVMG------GDFG---
PLSX_BACSU/1-321----------------------------------------------------------MRIAVDAMG------GDHA---
PLSX_AQUAE/2-322----------------------------------------------------------LRIAVDCMG------GDYA---
D5AUL6_RHOCB/12-337----------------------------------------------------------.VLSIDAMG------GDRG---
I3VW60_THESW/1-316----------------------------------------------------------MKIAVDAMG------GDYA---
W8T1H7_EUBAC/28-365----------------------------------------------------------VKVGITTLG------SEHG---

PF01515

PTAS_BACSU/3-319--------------------------------------------------------DLFSTVQEKVA......GKDVKI-
EUTD_ECOLI/1-320--------------------------------------------------------MIIERCRELAL......RAPARV-
PTAS_CLOTH/2-324--------------------------------------------------------SFLEQIIERAK......SDVKTI-
MAO1_RHIME/441-763--------------------------------------------------------FIMKPVFAAAK.....NAAKNRV-
PTAS_CORGL/5-322--------------------------------------------------------LFENWLLKRAR......AEHSHI-
PTA_SYNY3/374-693--------------------------------------------------------LFLYNLVQAAT......AAQRHI-
PTB_CLOB8/4-295--------------------------------------------------------NFDELLSRLKE......VPTKKV-
PTAS_BORBU/10-350--------------------------------------------------------CLKDYVFKKARIFVKENKLKANI-
PTAS_MYCPN/2-315--------------------------------------------------------SVIDLLKQRVQS....AGKKPVI-
MAO2_HAEIN/429-750--------------------------------------------------------LFMRPIFSQAK......SAKQRI-
PTAS_CLOAB/2-326--------------------------------------------------------DLIESIWECAK......QDKKRI-
MAO2_RHIME/438-756--------------------------------------------------------STLQRIVERVR......RQPKRI-
A1B2J3_PARDP/4-314--------------------------------------------------------..LDRIHEAAK......ALDRHI-
I3VW55_THESW/3-324--------------------------------------------------------.IIQNIIEKAK......SDKKKI-
PTB_CLOAB/4-295--------------------------------------------------------SFNEIIMKVKS......KEMKKV-
PTA_MYCTU/365-682--------------------------------------------------------MFTYRLLQQAR......SDLMRI-
Q32DP2_SHIDS/392-707--------------------------------------------------------.FRYQLTELAR......KAGKRI-
Q6MTX6_MYCMS/5-317--------------------------------------------------------...EEIKNQLVL....KSEKKSI-
Q8TK18_METAC/4-325--------------------------------------------------------.FLEKISERAK......KLNKTI-

PF04166

F9D1K6_PREDD/35-324--------------------------------------------------------ELCTPIVY.GS------PK-----
D7BZZ5_STRBB/44-335--------------------------------------------------------RRCRPVAI.GD------AA-----
K9XHU5_9CHRO/45-341--------------------------------------------------------...DVTVV.GS------QA-----
K9Z747_CYAAP/38-335--------------------------------------------------------.RANITII.GS------RS-----
F3ZVB4_MAHA5/32-323--------------------------------------------------------EICRPVLI.CS------HD-----
D4G8G2_RIEPU/43-336--------------------------------------------------------KWPVKLVTFSD------PD-----
E3I1T8_RHOVT/40-335--------------------------------------------------------...APFFVIAD------PA-----
F0R264_BACSH/34-324--------------------------------------------------------ELCTPIVY.GS------PK-----
Q1LSS1_BAUCH/32-325--------------------------------------------------------AWPVEIVVCTD------PY-----
D5WYG1_THIK1/23-322--------------------------------------------------------...GCVVY.GD------AA-----
Q10ZN5_TRIEI/41-337--------------------------------------------------------ENCDLTIV.GS------RQ-----
Q7MTA8_PORGI/34-326--------------------------------------------------------DLFTPVIY.GS------AK-----
G2TI06_BACCO/34-325--------------------------------------------------------ERCQPFVV.GD------LK-----
Q3V872_LEGPH/26-315--------------------------------------------------------..DLPVVILGD------LS-----
B1ZNR3_OPITP/35-329--------------------------------------------------------QVGVPVVF.GD------VG-----
K9SRP6_9SYNE/31-333--------------------------------------------------------DLASFTVI.GD------RS-----
Q3B5B9_CHLL7/30-323--------------------------------------------------------...HRFAVAGS------YR-----
R6EJC4_9BACE/37-325--------------------------------------------------------...TPVIY.GS------SK-----
PDXA1_BRADU/37-333--------------------------------------------------------..LRLLII.GS------GA-----
PDXA_XANP2/36-328--------------------------------------------------------....AFLVAGD------PE-----
D3EPC7_ATETH/40-355--------------------------------------------------------QSCELTVV.GT------KS-----
X2H9I6_9NEIS/29-319--------------------------------------------------------DWPQRIVVLGD------MQ-----
L0ETE9_LIBCB/39-331--------------------------------------------------------....PFIYIGD------PD-----
B4F2I1_PROMH/31-324--------------------------------------------------------QWALPWVVCAD------PQ-----
V5UBQ7_9BURK/58-340--------------------------------------------------------..RCRFAVIGD------AS-----
A6VU54_MARMS/37-327--------------------------------------------------------..PARLIILAD------PA-----
M7SPY7_EUTLA/39-323--------------------------------------------------------.RADIVLL.AD------RS-----
Q0K4Q7_CUPNH/34-327--------------------------------------------------------.QAEILLI.AD------RD-----
D4J4Q1_9FIRM/33-335--------------------------------------------------------EKCSPIII.GD------AA-----
A0JTQ9_ARTS2/490-781--------------------------------------------------------KECRPVVI.GD------AL-----
G4RBH1_PELHB/33-315--------------------------------------------------------...RPVIV.GD------RH-----
D2R6V9_PIRSD/43-337--------------------------------------------------------RECIPIVI.GD------AE-----
G7Z7B0_AZOL4/38-329--------------------------------------------------------..VPPFVVLDD------PD-----
I7HG37_9HELI/28-302--------------------------------------------------------QICEPVYV.TH------LE-----
R6SBC2_9BACE/34-324--------------------------------------------------------ELCTPVIY.GS------PK-----
D9RAU4_CLOSW/32-323--------------------------------------------------------EAARCVAV.GD------RK-----
F0NYL8_WEEVC/36-325--------------------------------------------------------DFFTPIIF.AS------TK-----
F2IC16_FLUTR/45-335--------------------------------------------------------LDCTPIIY.AS------SK-----
M1PE68_DESSD/26-315--------------------------------------------------------...PCIVV.GD------KN-----
H1Z8Q7_MYROD/36-324--------------------------------------------------------ELCTPVIF.GS------SK-----
PDXA_BACHD/33-324--------------------------------------------------------DVANPVVI.GH------GD-----
Q3SGF8_THIDA/30-317--------------------------------------------------------..PCRMTVLGD------VQ-----
R5KK03_9BACT/34-324--------------------------------------------------------DMCIPIIY.GS------PK-----
B8IWD3_METNO/40-332--------------------------------------------------------SAAQIVTI.GD------RC-----
K9TXI9_9CYAN/42-377--------------------------------------------------------AACQITVV.GN------KQ-----
PDXA_SYNJB/34-331--------------------------------------------------------SCAHITVV.GD------RQ-----
Q1QSM0_CHRSD/42-333--------------------------------------------------------ESGHAVLV.AD------TW-----
K9SMQ8_9CYAN/47-343--------------------------------------------------------...KVTII.GD------RH-----
PDXA_PROAC/35-325--------------------------------------------------------..FIPIVY.GD------PA-----
L0DWB4_THIND/35-324--------------------------------------------------------...AQRVAIGN------PA-----
H8GMF2_METAL/35-325--------------------------------------------------------.LPCEAVVIAS------EE-----
PDXA_GEOMG/34-325--------------------------------------------------------QCCRFLVV.GD------SA-----
R4I106_9GAMM/29-321--------------------------------------------------------NWPVELVVCAD------PI-----
E1SLK8_FERBD/27-319--------------------------------------------------------DWSVELVVCAD------PE-----
A1AU02_PELPD/36-329--------------------------------------------------------AHCVPLVI.GD------PA-----
PDXA_RALSO/37-328--------------------------------------------------------...VRWHVIGD------AA-----
PDXA_THISH/31-321--------------------------------------------------------..AAQRVVLSD------PA-----
Q3V808_SINFN/34-320--------------------------------------------------------...RSVVV.GD------PA-----
D3VCQ4_XENNA/32-324--------------------------------------------------------EWPIQLVVCAD------PE-----
PDXA_AGRFC/37-329--------------------------------------------------------....PFIFIGD------PD-----
G7URF7_PSEUP/27-304--------------------------------------------------------QTCNPVLI.GS------VE-----
G0IUL6_CYCMS/36-326--------------------------------------------------------KMITPVIY.GH------GK-----
R7J8E6_9PORP/34-325--------------------------------------------------------ELCVPIIY.GS------SK-----
J3Z564_9ENTR/29-321--------------------------------------------------------TWPVELVICAD------PF-----
I1F0R6_AMPQE/348-642--------------------------------------------------------SKGIPFVAFAD------PE-----
K7AU99_9ALTE/28-319--------------------------------------------------------EWPVQLVAFAD------GD-----
PDXA_SYNY3/35-336--------------------------------------------------------SICQLTAI.GS------RS-----
E1VLH2_9GAMM/30-317--------------------------------------------------------...IALVAIAN------AE-----
R4KFZ8_CLOPA/32-323--------------------------------------------------------YVCNPIVV.GD------KE-----
R5Y392_9BACE/33-324--------------------------------------------------------ELCTPVVY.GS------SK-----
W0PFJ8_9BURK/36-327--------------------------------------------------------DMARFVVI.GD------VA-----
R6YA75_9BACT/37-327--------------------------------------------------------.SFTPVIY.GS------SK-----
R5TI46_9CLOT/31-334--------------------------------------------------------ETCRPVVI.GD------TF-----
A5FXM2_ACICJ/38-335--------------------------------------------------------...ALVVT.GS------GH-----
PDXA_RHOBA/37-349--------------------------------------------------------SQGYPLLF.GD------AA-----
R6W392_9BACT/35-320--------------------------------------------------------ELCTPIIY.GS------PK-----
K9QGD1_9NOSO/46-349--------------------------------------------------------QNCDVTVV.GN------WN-----
PDXA_XYLFA/29-316--------------------------------------------------------RQDCRLVAFAD------PA-----
F2LWP1_HIPMA/33-327--------------------------------------------------------PKYRFVIF.GS------PD-----
PDXA_CAUCR/30-324--------------------------------------------------------QDGPTFVVIGD------AQ-----
F5YGA4_TREAZ/37-343--------------------------------------------------------DKCIPVLI.GD------TP-----
K9RH38_9CYAN/45-348--------------------------------------------------------QGCDLTLV.GN------RS-----
R5P2E5_9BACT/33-319--------------------------------------------------------EICTPILY.GS------SK-----
D2QDF7_SPILD/236-527--------------------------------------------------------KICTPVIY.GS------MR-----
C4LDY8_TOLAT/35-322--------------------------------------------------------DECKPFLI.GS------IP-----
K9T599_9CYAN/41-347--------------------------------------------------------ETCRVTVV.GS------RS-----
PDXA_WIGBR/31-321--------------------------------------------------------..RSELVICCD------PD-----
F4LQ79_TREBD/32-322--------------------------------------------------------KDINCLII.GD------SR-----
E6WQK3_PSEUU/29-316--------------------------------------------------------RTDCSLVALAD------PE-----
I3Y835_THIV6/27-318--------------------------------------------------------SQAAQLVAVAD------PD-----
PDXA2_BRADU/38-337--------------------------------------------------------....AFYLLGD------EA-----
Q12FB7_POLSJ/51-359--------------------------------------------------------.MAGCVVV.GD------VA-----
G4L110_OSCVS/33-352--------------------------------------------------------DHCRPLVV.GD------AS-----
K9UJS8_9CYAN/31-336--------------------------------------------------------AECDLTLI.GN------RE-----
H8KWR5_SOLCM/37-327--------------------------------------------------------EHCTPIVY.GS------VK-----
F2K4J5_MARM1/33-323--------------------------------------------------------..PARLIVLAD------PA-----
S6BVY4_9GAMM/29-317--------------------------------------------------------.WDRPLVAVAD------PA-----
A7I3Y6_CAMHC/27-298--------------------------------------------------------KFCEPVYF.IN------RE-----
F0SPW7_RUBBR/43-344--------------------------------------------------------EPCRLIIF.GD------KT-----
D5MIQ8_9BACT/37-328--------------------------------------------------------AACRPLIV.GE------AG-----
F2NDA2_DESAR/37-329--------------------------------------------------------GLCRPLVL.GD------LP-----
A4CID9_ROBBH/38-321--------------------------------------------------------..CTPVFF.AS------GK-----
B3PKV3_CELJU/31-323--------------------------------------------------------VQPHQLVAIAD------PA-----
Q2YBP4_NITMU/30-318--------------------------------------------------------..PFKLIVIAD------RE-----
Q145L2_BURXL/43-326--------------------------------------------------------...AQFIVLGD------AD-----
C7PP38_CHIPD/38-328--------------------------------------------------------EFCTPVIF.AS------NK-----
D5BRI0_PUNMI/31-320--------------------------------------------------------....DFVILDN------VP-----
K0C9N5_ALCDB/29-316--------------------------------------------------------..DTALVVLAD------RQ-----
F6ACQ2_PSEF1/33-324--------------------------------------------------------AMCRPLVI.GD------AR-----
W8WYV9_CASDE/45-334--------------------------------------------------------...PAVVY.GD------AG-----
A1BHC0_CHLPD/30-323--------------------------------------------------------...HTFLVAGS------FK-----
L0FWR6_ECHVK/32-334--------------------------------------------------------AKCKPLVV.GD------AT-----
F7YI45_VIBA7/28-321--------------------------------------------------------DWAHQLVVCAD------KS-----
Q2W0V4_MAGSA/33-323--------------------------------------------------------....PFMLIDD------AG-----
Q11UL9_CYTH3/38-329--------------------------------------------------------KVCIPVIY.AN------YK-----
D7A738_STAND/37-327--------------------------------------------------------...PPFLVTGD------PE-----
W0ERT9_9PORP/33-324--------------------------------------------------------EICTPVVY.GS------AK-----
R6ZD40_9FIRM/33-335--------------------------------------------------------RKCMPVVL.GD------KE-----
Q0VMV3_ALCBS/33-325--------------------------------------------------------..DAPMVIIGD------RQ-----
M1LX07_9CLOT/31-321--------------------------------------------------------DICRPLVI.GD------LK-----
Q6LV40_PHOPR/30-323--------------------------------------------------------TWSHELVICAN------AQ-----
I4WVN0_9GAMM/31-318--------------------------------------------------------...ATLVAITD------RH-----
R5AZH6_9BACE/43-334--------------------------------------------------------ELCTPVLY.GS------GK-----
A8ESJ0_ARCB4/32-303--------------------------------------------------------KICQPIYC.IN------NK-----
D5C4K3_NITHN/29-320--------------------------------------------------------.REYELVVVAD------PE-----
D4LRH6_9FIRM/31-357--------------------------------------------------------EVCRPLIV.GD------AK-----
PDXA_DESAH/34-326--------------------------------------------------------TVCRPLVL.GD------EG-----
Q7VHV2_HELHP/28-304--------------------------------------------------------QWCEPLYC.VH------RE-----
C5BPB7_TERTT/27-316--------------------------------------------------------..GFELVCIAS------GE-----
K0C3B1_CYCSP/29-319--------------------------------------------------------.WPCELIFVAD------PN-----
PDXA_AQUAE/29-313--------------------------------------------------------EKFTYVIY.GE------EK-----
F0S0E1_DESTD/33-310--------------------------------------------------------....PIFIYGS------KG-----
Q31F25_THICR/26-318--------------------------------------------------------DWDYEWVVIAN------KT-----
D5A6D6_ARTPN/31-330--------------------------------------------------------DKCEITVV.GS------RW-----
Q1LRA2_CUPMC/46-333--------------------------------------------------------....RFHVIGD------AR-----
A4FFA9_SACEN/36-326--------------------------------------------------------ETARPLAV.GD------AT-----
PDXA_CHRVO/29-318--------------------------------------------------------APEARCVAIAD------HA-----
R6FKU7_9BACE/34-324--------------------------------------------------------ELCTPIIY.GS------PK-----
K9V9D2_9CYAN/37-340--------------------------------------------------------ENYDVTLV.GS------AR-----
R6XPS3_9BACT/34-324--------------------------------------------------------ELCTPIIY.GS------PK-----
K9YBG1_HALP7/36-336--------------------------------------------------------EGCEVTVV.GT------RS-----
A1STS2_PSYIN/28-319--------------------------------------------------------.WPVELIICTD------KR-----
A1WLE5_VEREI/41-335--------------------------------------------------------HLANVVLV.GD------RW-----
R6F0Q9_9BACT/34-321--------------------------------------------------------ELCTPIIY.GS------PK-----
PDXA_RHOPA/35-328--------------------------------------------------------..LPPFYLLGD------AG-----
PDXA_DESOH/33-325--------------------------------------------------------EKCRPLVI.GD------PG-----
G2PNX1_MURRD/35-323--------------------------------------------------------DFCTPVIF.AS------NK-----
G7UQC7_PSEUP/28-315--------------------------------------------------------RQDCRLVAFAD------PV-----
PDXA_SACD2/29-320--------------------------------------------------------ARDYPLVALCD------PQ-----
E6VTD1_DESAO/30-339--------------------------------------------------------.GDERVLLLGP------AA-----
Q24RU8_DESHY/36-320--------------------------------------------------------KDAHPIIV.GD------QR-----
R5L6M7_9SPIR/33-320--------------------------------------------------------ENAIPVVY.SH------KK-----
K9TNE7_9CYAN/53-349--------------------------------------------------------QNCQITLV.GS------RK-----
D3IAQ7_9BACT/34-319--------------------------------------------------------ELCTPIIY.GS------PK-----
D5BDL9_ZUNPS/47-332--------------------------------------------------------DFCTPVIF.AS------TK-----
Q2IHP1_ANADE/33-321--------------------------------------------------------GELVPLVF.GD------RR-----
R6CJV8_9BACT/34-324--------------------------------------------------------EYCTPIIY.GS------PK-----
R6WB32_9FIRM/32-323--------------------------------------------------------EAADCVIV.GD------KT-----
E4RQ40_LEAB4/33-324--------------------------------------------------------KTCIPIIY.GS------GK-----
Q11HH0_CHESB/29-325--------------------------------------------------------KELAPFYVLGD------PA-----
E6SJ78_THEM7/43-331--------------------------------------------------------RVLRPLVI.GD------RG-----
F9ZZH4_METMM/31-322--------------------------------------------------------PQPCELVAIAD------PE-----
L7W827_NONDD/35-323--------------------------------------------------------ELFTPVVF.AS------TK-----
F3ZNL8_9BACE/34-324--------------------------------------------------------DMCTPIIY.GS------PK-----
R7HMN9_9BACT/35-323--------------------------------------------------------DLCTPIVY.GS------SK-----
W0JF83_DESAE/33-320--------------------------------------------------------.DFNIVVF.GA------SN-----
PDXA_RUEST/31-317--------------------------------------------------------RADCPFVWIGD------PR-----
Q0AC81_ALKEH/31-319--------------------------------------------------------...ASLVVLGD------PQ-----
PDXA_DESAA/33-325--------------------------------------------------------KICRPLVI.GD------LK-----
A4YT91_BRASO/34-325--------------------------------------------------------....AFYVLGD------PA-----
K4KQ47_SIMAS/25-316--------------------------------------------------------ARQAEWVVVAS------GD-----
F9YQW3_CAPCC/34-322--------------------------------------------------------ELCTPIVF.GS------NK-----
D5V304_ARCNC/38-309--------------------------------------------------------KYCSPVYC.IN------KD-----
D4MSX7_9FIRM/33-348--------------------------------------------------------DRCRPIVV.GD------AK-----
M5DPJ7_9GAMM/27-319--------------------------------------------------------PQEHELVVIAN------AD-----
A6TJU5_ALKMQ/33-334--------------------------------------------------------EVCRPIVV.GS------AK-----
E0URZ3_SULAO/30-300--------------------------------------------------------KICHPIYC.IN------RT-----
N0BC98_9RHIZ/43-337--------------------------------------------------------....PFAVYAD------FK-----
PDXA_XANCP/28-315--------------------------------------------------------RSDAHLIAYAD------PD-----
F2NA55_CORGP/35-342--------------------------------------------------------RRMRPVVV.GD------AS-----
B4RBS3_PHEZH/33-326--------------------------------------------------------...QAFVVVGD------AQ-----
K0NNW0_DESTT/36-328--------------------------------------------------------AVCKPLIL.GD------SH-----
M1FJA7_9ALTE/30-319--------------------------------------------------------.RQVGIVVVAS------QP-----
C0ZNI3_RHOE4/384-675--------------------------------------------------------KRCRPVVV.GD------AK-----
Q65VM2_MANSM/32-323--------------------------------------------------------NVCKPFVI.GS------IP-----
A6H263_FLAPJ/36-324--------------------------------------------------------ELCTPIIF.AN------VK-----
B5YL57_THEYD/32-311--------------------------------------------------------KICNPIVI.GD------KA-----
PDXA_PROA2/35-326--------------------------------------------------------...EKPIVIGS------AE-----
B1WU75_CYAA5/40-358--------------------------------------------------------QTCDLTVI.GT------RS-----
I0IQ54_LEPFC/42-330--------------------------------------------------------R....IVI.GD------PE-----
B7K1J6_CYAP8/40-344--------------------------------------------------------ENCRLTVI.GT------RS-----
K9VBC1_9CYAN/53-351--------------------------------------------------------...RITVI.GS------RR-----
C6VZ75_DYAFD/37-328--------------------------------------------------------KLCTPIIY.GS------LR-----
A3DDY3_CLOTH/32-324--------------------------------------------------------RFLTPVVI.GS------KD-----
B0UIV0_METS4/30-326--------------------------------------------------------AGLAPFVLIGD------PD-----
K8GJQ6_9CYAN/32-348--------------------------------------------------------QACDITLV.GS------EY-----
F6ILZ0_9SPHN/44-324--------------------------------------------------------EVSIPVLV.GS------AA-----
A2TY27_9FLAO/35-323--------------------------------------------------------DFCTPVLF.GA------TK-----
PDXA_OCEIH/33-325--------------------------------------------------------EQAHPIVI.GD------TK-----
D2UFS9_XANAP/28-315--------------------------------------------------------RHDCQLLAFAD------PD-----
E6X8R2_CELAD/35-320--------------------------------------------------------DFCTPVIF.AS------NK-----
PDXA_SYMTH/33-323--------------------------------------------------------ALCRPLLI.GD------SR-----
B5Y706_COPPD/31-322--------------------------------------------------------DTCKPLVI.GH------SI-----
F8EQB4_RUNSL/37-328--------------------------------------------------------RICVPVIY.GS------MR-----
I3YUG2_AEQSU/35-321--------------------------------------------------------EFCTPVVF.AS------VK-----
B8ET21_METSB/41-335--------------------------------------------------------...PAFVIAAE------AD-----
F8GL31_NITSI/33-321--------------------------------------------------------..SCNLVVIAD------SD-----
PDXA_GEOLS/34-329--------------------------------------------------------SACKPLVL.GD------RR-----
Q5WKA6_BACSK/32-321--------------------------------------------------------DLCTPVVI.GN------AA-----
C1D5J7_LARHH/29-317--------------------------------------------------------..QTRVVAIGD------AS-----
F4B1R1_DOKS4/36-321--------------------------------------------------------.FCTPIIF.AS------AK-----
D6Z2T8_DESAT/51-341--------------------------------------------------------..AAAVVL.GD------LG-----
C9LXC2_SELS3/37-327--------------------------------------------------------DVARVIVV.GD------KG-----
G4QFQ7_GLANF/29-320--------------------------------------------------------VWDAQLVVYAD------AD-----
PDXA2_PSEAE/35-329--------------------------------------------------------EKAHIVLI.AD------EA-----
Q0RWE6_RHOJR/36-321--------------------------------------------------------..FNPVLV.GD------RC-----
PDXA_CYAP7/30-337--------------------------------------------------------ENYNITVV.GS------RS-----
R7G4X4_9FIRM/35-326--------------------------------------------------------DCCRPFVI.GS------IA-----
D3RQF4_ALLVD/35-326--------------------------------------------------------HSAAELVAIAD------PD-----
D8JA34_HALJB/30-324--------------------------------------------------------AAADVLVI.GD------AD-----
D3SLG0_THEAH/28-312--------------------------------------------------------KETAYVVY.GE------YK-----
F0SBZ7_PSESL/33-323--------------------------------------------------------KYCTPIVY.GH------TK-----
D3SBX0_THISK/44-331--------------------------------------------------------....QRVAIGD------PD-----
A8IH54_AZOC5/35-332--------------------------------------------------------.HLRLLVI.GS------NA-----
F8KS88_HELBC/29-303--------------------------------------------------------QICTPLYC.VH------SQ-----
U5RZ60_9CLOT/33-326--------------------------------------------------------DICAPVVI.GD------PK-----
B0SWM5_CAUSK/34-324--------------------------------------------------------....PFMVVGD------AQ-----
PDXA_SULSY/29-314--------------------------------------------------------RNISYVIY.GS------KK-----
V4LB68_9GAMM/33-335--------------------------------------------------------AHAAELIAISD------PR-----
B3ENY2_CHLPB/30-323--------------------------------------------------------...SRPLVVGS------AE-----
R5Q2C0_9BACT/34-312--------------------------------------------------------DLCIPIIY.GS------PK-----
G2Z4E3_FLABF/35-323--------------------------------------------------------EMCTPVIF.AN------VK-----
C6XKP9_HIRBI/31-329--------------------------------------------------------TTQRPFFVIAS------SD-----
Q0K4F5_CUPNH/34-323--------------------------------------------------------AQCRPLVI.GD------VR-----
W0BBF6_9GAMM/27-315--------------------------------------------------------...LPVVILGD------KS-----
K9XSR0_STAC7/33-337--------------------------------------------------------ENCYITII.GN------RD-----
B6JGM3_OLICO/32-326--------------------------------------------------------.NLPPFYLIGD------AD-----
D5SV98_PLAL2/38-331--------------------------------------------------------EDSLPIIW.GD------AE-----
PDXA_SERP5/29-321--------------------------------------------------------DWPVELVVCAD------PA-----
C7RNL8_ACCPU/39-326--------------------------------------------------------...ARLVVLAD------RS-----
R6WFT1_9BACT/34-321--------------------------------------------------------ELCTPIIY.GS------PK-----
PDXA_PSEA6/27-318--------------------------------------------------------QWQAMLVVFAN------AE-----
J7Q941_METSZ/35-329--------------------------------------------------------...PPFFLLGH------PA-----
PDXA_METCA/29-318--------------------------------------------------------..PCGITVLGD------PD-----
R5FA16_9BACT/34-322--------------------------------------------------------ELCTPIIY.GS------PK-----
PDXA_AZOSB/30-318--------------------------------------------------------.WPARLVVLGD------AD-----
D3HPI6_LEGLN/27-314--------------------------------------------------------...FPLVILGD------RD-----
C6D3S5_PAESJ/31-322--------------------------------------------------------EDSNPFVI.GD------AK-----
C4ZNQ2_THASP/34-328--------------------------------------------------------AWPLRPVVLAD------IG-----
Q1ART0_RUBXD/32-322--------------------------------------------------------EENRVVVV.GD------GA-----
A0KGT9_AERHH/28-320--------------------------------------------------------DWPHQLVVIAD------PA-----
PDXA_PASMU/32-326--------------------------------------------------------EKANIVLV.AD------KD-----
Q5QVN8_IDILO/29-320--------------------------------------------------------.WSAAVVVCAD------KN-----
I2F8G1_9BACT/47-340--------------------------------------------------------EICRPIVI.GE------FG-----
D7DN38_METV0/32-322--------------------------------------------------------..NAEVVIIAD------AN-----
K4IU70_PSYTT/35-320--------------------------------------------------------ELFTPIIF.AN------SK-----
D9QLJ7_BRESC/29-321--------------------------------------------------------SAESPFAVIGD------RA-----
B0BZ85_ACAM1/36-343--------------------------------------------------------DVAHVCVI.GE------RS-----
Q8KEU1_CHLTE/31-322--------------------------------------------------------....TYMVAGS------LK-----
A5G9E3_GEOUR/36-328--------------------------------------------------------AVCRPLVL.GD------ME-----
F0RGS0_CELLC/35-323--------------------------------------------------------DFCTPVIF.AS------NK-----
Q2G9Z1_NOVAD/34-325--------------------------------------------------------..LLPFFVVGS------AR-----
Q3IWS4_RHOS4/37-320--------------------------------------------------------...AYAVI.GD------RE-----
E4RPK4_HALHG/32-334--------------------------------------------------------EKANPVVV.GS------SN-----
Q82W16_NITEU/32-321--------------------------------------------------------.LPCRLTVIAD------RD-----
D5QAY7_KOMHA/32-316--------------------------------------------------------...PAFVVIGD------PA-----
R5CC16_9BACE/34-324--------------------------------------------------------ELCTPIVY.GS------PK-----
R5P6P7_9BACT/34-321--------------------------------------------------------ELCTPIVY.GS------PK-----
A4FIE2_SACEN/34-325--------------------------------------------------------ARCRPVVV.GD------AA-----
B9LZ80_GEODF/35-326--------------------------------------------------------ASCRPVII.GD------RS-----
A3U5N8_CROAH/35-320--------------------------------------------------------EFCTPVIF.AN------SK-----
PDXA_CAMJE/28-357--------------------------------------------------------KICTPFYF.IH------ES-----
R5GSB3_9BACT/34-324--------------------------------------------------------DVCTPVIY.GS------PK-----
Q479U5_DECAR/29-319--------------------------------------------------------..AAHPVVLGD------RS-----
R6AA64_9BACT/49-340--------------------------------------------------------ELCTPIIF.GH------VK-----
PDXA_NEIMB/28-321--------------------------------------------------------RLPCRCAVLGD------KN-----
D1B2K3_SULD5/28-299--------------------------------------------------------KLCQPIYC.IN------EN-----
K9PX21_9CYAN/31-332--------------------------------------------------------QLCSLTII.GN------RR-----
B4EGN0_BURCJ/39-337--------------------------------------------------------ARANLVLI.GD------RW-----
M1WYQ3_DESPC/31-331--------------------------------------------------------PENERILLIGP------ES-----
E8V3H9_TERSS/35-313--------------------------------------------------------ASANWIVL.GD------GP-----
E7ABT4_HELFC/29-301--------------------------------------------------------QTCQPIYC.VH------RE-----
PDXA3_RHIME/42-334--------------------------------------------------------DAAHIIAI.GD------RR-----
E6WY24_NITSE/28-307--------------------------------------------------------KLAEPLYL.ID------RE-----
C6XUZ6_PEDHD/33-321--------------------------------------------------------DYCTPIVY.GH------TK-----
B4SF48_PELPB/31-318--------------------------------------------------------....SFLVAGS------YR-----
I5B2I7_9DELT/36-328--------------------------------------------------------NLCTPVVL.GD------FK-----
Q65EJ5_BACLD/32-325--------------------------------------------------------DMCRPLVI.GD------MK-----
D3QBQ2_STANL/35-328--------------------------------------------------------...HGIAV.GD------AG-----
I6ZML4_MELRP/28-311--------------------------------------------------------SKKRKFFIYSP------AN-----
Q5LKY3_RUEPO/32-322--------------------------------------------------------EAANVLLV.GD------RH-----
Q2RKJ4_MOOTA/32-333--------------------------------------------------------NLCRPLAI.AD------AG-----
R5EF26_9GAMM/29-323--------------------------------------------------------.KDTQLVIIAS------KE-----
W0E2J5_MARPU/29-320--------------------------------------------------------PQSAELVAIAD------PH-----
H1Y4I7_9SPHI/33-321--------------------------------------------------------DYCTPIVY.GH------TK-----
E3GDT1_EUBLK/31-337--------------------------------------------------------EVCSPVAV.GD------KK-----
E0WS58_9ENTR/33-325--------------------------------------------------------DWPIELVVCAD------EQ-----
W8F8Y2_9BACT/31-322--------------------------------------------------------KFCTPVVY.GT------AA-----
B3QV85_CHLT3/26-321--------------------------------------------------------ERGEQFVVVGS------FK-----
A8LS85_DINSH/31-321--------------------------------------------------------EAADILLV.GD------AH-----
A0Q399_CLONN/32-323--------------------------------------------------------EKCRPVLI.GD------KD-----
R7EVF6_9BACT/42-333--------------------------------------------------------EMCTPVIF.GS------AK-----
I3Z6X6_BELBD/36-323--------------------------------------------------------KLITPVIY.AH------GK-----
PDXA_HYDS0/28-302--------------------------------------------------------DENAYVIY.GE------EY-----
W0EZ35_9BACT/35-325--------------------------------------------------------DFCTPVIF.AS------NK-----
D5CTH9_SIDLE/30-349--------------------------------------------------------...QPLVVIAD------KS-----
R7LG84_9BACT/48-339--------------------------------------------------------ELFTPIVY.GH------VK-----
D3E9G4_GEOS4/31-324--------------------------------------------------------DNCNPLVI.GD------AK-----
E3FNJ1_STIAD/27-308--------------------------------------------------------QALVPVVF.GD------GP-----
X5D8G7_9BACT/35-325--------------------------------------------------------EMCTPVVY.GS------PK-----
G8PQZ0_PSEUV/36-329--------------------------------------------------------...QPFYVLCD------PE-----
L0DE58_SINAD/36-336--------------------------------------------------------ALARPFVI.GS------KS-----
G8QYY1_SPHPG/33-336--------------------------------------------------------DRCRPLVV.GD------VT-----
W8KS11_HALHR/35-325--------------------------------------------------------...AQRVVLGD------PQ-----
G8TP28_NIAKG/36-322--------------------------------------------------------ELCTPVIF.AS------NK-----
PDXA_VIBCH/28-321--------------------------------------------------------DWPHQLVVCAD------KA-----
T2KID2_9FLAO/35-320--------------------------------------------------------EFCTPVIF.AS------VK-----
U5LJV8_9BACI/34-327--------------------------------------------------------QICNPLVI.GD------RK-----
PDXA_PERMH/27-312--------------------------------------------------------KKAIYVIY.GS------YK-----
PDXA_RHILO/36-329--------------------------------------------------------...PAFYLLAD------PA-----
Q89M19_BRADU/33-325--------------------------------------------------------ASCRLVVI.GD------RR-----
K9VZP3_9CYAN/50-362--------------------------------------------------------QNLDITVV.GS------KS-----
PDXA_FUSNN/31-321--------------------------------------------------------DLCDLVVI.GD------KK-----
E0SNM5_IGNAA/34-327--------------------------------------------------------EYAKPIVI.GN------PN-----
G0AAS4_COLFT/40-342--------------------------------------------------------RDEINSVLIGD------AA-----
A6Q3Y7_NITSB/29-300--------------------------------------------------------QSCTPLYF.TN------YK-----
A7HYG3_PARL1/38-330--------------------------------------------------------..LPIFFVAGD------PA-----
G4STZ3_META2/32-323--------------------------------------------------------SHACQLVAIAD------PD-----
R4W4P1_9EURY/25-318--------------------------------------------------------ALADVVVI.GD------AS-----
E4TVA5_MARTH/35-325--------------------------------------------------------KMMTPVVY.GS------GK-----
R5IKT1_9CLOT/33-336--------------------------------------------------------DLCNPVVV.GD------AC-----
R7CXE5_9BACE/34-324--------------------------------------------------------ELCTPIIY.GS------PK-----
G8QPR5_DECSP/28-330--------------------------------------------------------.AQARLVVLAD------KE-----
PDXA_HERAR/30-332--------------------------------------------------------RADVKSILIGD------AA-----
Q7VQK2_BLOFL/37-330--------------------------------------------------------KWPVELVICAD------LN-----
C7M3J3_CAPOD/34-323--------------------------------------------------------ELCTPIIF.AS------NK-----
R6TUF4_9FIRM/17-307--------------------------------------------------------DYCRPVII.GD------VR-----
D1CHU7_THET1/34-324--------------------------------------------------------DLCRPIVV.GD------TS-----
PDXA_CAMFF/30-301--------------------------------------------------------NICSPIYF.IN------NE-----
I4BXC4_ANAMD/32-320--------------------------------------------------------DMCIPVVI.GD------IN-----
E1R632_SPISS/37-339--------------------------------------------------------DMCRPLVV.GD------SK-----
C4ZHF2_AGARV/32-338--------------------------------------------------------EQCRPVII.GD------AA-----
B8I6T9_CLOCE/32-323--------------------------------------------------------KVCNPLVI.GD------AG-----
F4CNN9_PSEUX/26-309--------------------------------------------------------AQEPPVLV.GD------RH-----
C5B7P2_EDWI9/30-321--------------------------------------------------------.WPAELVVCAD------PG-----
PDXA_SYNFM/34-329--------------------------------------------------------ECCTPIVV.GD------PS-----
F2I3R8_PELSM/32-321--------------------------------------------------------DKANCVLI.GE------RS-----
K7VXY6_9NOST/36-337--------------------------------------------------------QNCDVMVV.GN------RT-----
R5D0H0_9BACT/34-324--------------------------------------------------------ELCTPIIY.GS------PK-----
H6L3Q9_SAPGL/32-322--------------------------------------------------------ELCTPVIF.GS------AK-----
R6F1V4_9BACT/34-322--------------------------------------------------------DMCVPIVY.GS------PK-----
Q2S3U3_SALRD/96-387--------------------------------------------------------.SMTPVLI.GS------AH-----
H2FZ12_OCESG/28-320--------------------------------------------------------DWPAELVVIAD------PE-----
L0K3J5_9EURY/33-327--------------------------------------------------------ERADPIVV.GD------AS-----
G8R4P5_OWEHD/35-324--------------------------------------------------------DLCTPVVF.AS------SK-----
I1YL39_METFJ/29-320--------------------------------------------------------.HANELVVLAD------PD-----
PDXA_COLP3/27-319--------------------------------------------------------DWPVEMVVIAS------KA-----
Q215S3_RHOPB/38-329--------------------------------------------------------....AFYLLGD------RA-----
D3DGU5_HYDTT/29-313--------------------------------------------------------PKNAYIIY.GE------RK-----
C6X2C9_FLAB3/36-324--------------------------------------------------------DFFTPIIF.GS------GK-----
Q02C14_SOLUE/41-313--------------------------------------------------------...RWIVV.GD------GE-----
G0G667_AMYMS/33-323--------------------------------------------------------QMAHGVAV.GD------AI-----
A9GKN1_SORC5/15-317--------------------------------------------------------..GARCVLVGD------EA-----
Q1QKW1_NITHX/32-325--------------------------------------------------------..VPPFYLLGD------RA-----
H1XYD5_9BACT/33-325--------------------------------------------------------ELCTPVVF.GP------LP-----
D4GUQ8_HALVD/34-328--------------------------------------------------------EDASLVVI.GD------AD-----
PDXA_BEII9/33-322--------------------------------------------------------.KRNWIVV.GD------PL-----
F9Z465_ODOSD/33-319--------------------------------------------------------EVCTPVLF.GS------SK-----
A6VPP4_ACTSZ/32-327--------------------------------------------------------AKANVLLV.AD------RD-----
I0KFB6_9BACT/263-588--------------------------------------------------------KICTPVIY.GS------MR-----
B5E8C6_GEOBB/32-324--------------------------------------------------------ALCRPLVL.GD------RG-----
Q4FMQ9_PELUB/32-317--------------------------------------------------------...SPLIIIIS------KK-----
A5FM92_FLAJ1/36-324--------------------------------------------------------ELCTPVIF.AN------AK-----
E3H6A7_ILYPC/32-321--------------------------------------------------------..GKYLVI.GD------YE-----
A6QAX9_SULNB/28-306--------------------------------------------------------SIIDPVYC.ID------KE-----
A9BT55_DELAS/23-315--------------------------------------------------------.HAPFFVI.GD------TG-----
C3M9C3_SINFN/34-330--------------------------------------------------------QATAPFLFIGD------PS-----
Q5LQN1_RUEPO/27-312--------------------------------------------------------RADCPFVWIGD------PA-----
E8UEJ0_TAYEM/35-326--------------------------------------------------------...KAIVF.GD------MK-----
R5UVJ1_9BACT/33-321--------------------------------------------------------EICTPILY.GS------SK-----
PDXA_ERYLH/36-326--------------------------------------------------------...APFAVAGG------AN-----
I0IDK7_PHYMF/40-342--------------------------------------------------------RLARFVVF.GL------NE-----
A8MJU3_ALKOO/32-323--------------------------------------------------------EVAKVVVV.GD------KD-----
R6WM45_9PORP/34-325--------------------------------------------------------ELCTPVIY.GS------SK-----
Q3ARA5_CHLCH/34-329--------------------------------------------------------..VGRVVVAGS------MR-----
G8X7V7_FLACA/36-324--------------------------------------------------------ELCTPIIF.AN------VK-----
D3UFK7_HELM1/31-300--------------------------------------------------------QYCMPIYC.AK------RE-----
D9SID5_GALCS/30-319--------------------------------------------------------..ALNVVVVAD------KH-----
K9WP18_9CYAN/130-441--------------------------------------------------------NNCEITVI.GS------PS-----
PDXA_PSEHT/27-319--------------------------------------------------------TWDAQLVAIAD------AN-----
A1AWJ1_RUTMC/26-312--------------------------------------------------------KSNKNLLLFAD------PD-----
PDXA_STRMK/28-315--------------------------------------------------------REDCRLLAFAD------PD-----
Q3V8D3_GEOSL/34-325--------------------------------------------------------ECCRHLVV.GD------EF-----
B6IN68_RHOCS/40-329--------------------------------------------------------....PFVLLDD------PA-----
D4M806_9BACT/32-348--------------------------------------------------------DRCRPLVV.GD------AS-----
I4A0Q6_ORNRL/35-323--------------------------------------------------------GICTPVVF.CT------HK-----
V4JCI5_9DELT/37-338--------------------------------------------------------DLCRPLVI.GE------TD-----
I1XKV7_METNJ/29-321--------------------------------------------------------GQRHEIVVIAD------PE-----
U6B4X5_9RHIZ/39-331--------------------------------------------------------....PFIYIGD------PD-----
G8UPW0_TANFA/30-320--------------------------------------------------------ELCTPVIY.GS------LK-----
B0TBI8_HELMI/32-323--------------------------------------------------------RIARPLVI.GD------AG-----
F4HD17_GALAU/31-322--------------------------------------------------------EIAQPVVI.GD------KK-----
J9QT86_RIEAN/36-321--------------------------------------------------------DFFTPVIF.GS------GK-----
PDXA1_PSEAE/27-320--------------------------------------------------------AQPHPLIAIAS------RT-----
F4KTC5_HALH1/42-332--------------------------------------------------------NFCVPVLY.GS------SK-----
V9VUT8_9RHOB/30-316--------------------------------------------------------RSSCPFFWIGD------PR-----
A1WVT6_HALHL/30-323--------------------------------------------------------SHAAELVAIGD------PA-----
A8FHA9_BACP2/32-324--------------------------------------------------------EEAVLFVI.GD------TS-----
I4AG95_FLELS/65-362--------------------------------------------------------DLCIPVIF.GA------AR-----
F6GFQ1_LACS5/35-322--------------------------------------------------------EFCTPIIF.AS------VK-----
D9S1Z9_THEOJ/31-320--------------------------------------------------------GVARPLIL.GS------GP-----
U3U9G2_9GAMM/29-322--------------------------------------------------------NWPVELVVCAD------GE-----
C5ZY06_9HELI/27-295--------------------------------------------------------KICTPLYC.ID------KP-----
W0HX00_9GAMM/29-321--------------------------------------------------------AWPVELVICAD------PA-----
L0KAL8_HALHC/32-321--------------------------------------------------------KKAKLILI.GD------KK-----
F9ZTS3_ACICS/32-320--------------------------------------------------------....TPVVIGS------HA-----
W0PD12_9BURK/38-333--------------------------------------------------------..ASTVVY.GD------AG-----
I2EZC0_EMTOG/35-326--------------------------------------------------------KICTPVIY.GS------SK-----
R7PD86_9BACT/34-324--------------------------------------------------------DLCTPVLY.AS------AK-----
Q2S9C2_HAHCH/25-319--------------------------------------------------------SWPADLVFVCD------PE-----
R7DEZ6_9PORP/35-326--------------------------------------------------------EMCTPVVY.GS------SK-----
D0L089_HALNC/37-327--------------------------------------------------------..PVELVILGD------RG-----
K9WWL5_9NOST/42-342--------------------------------------------------------QYCDVVVV.GS------RE-----
E1V6Y8_HALED/34-339--------------------------------------------------------..QARVVAVGD------PA-----
D7AYM9_NOCDD/33-324--------------------------------------------------------EYAKPVVV.GD------AD-----
G8M1K4_CLOCD/32-322--------------------------------------------------------EVCNPVVI.GS------KD-----
Q13RP4_BURXL/47-338--------------------------------------------------------HSQPRIVLFGD------AF-----
B1XQD4_SYNP2/31-333--------------------------------------------------------ALCPMRVI.GD------RP-----
K9PRQ4_9CYAN/33-337--------------------------------------------------------QNCELTVV.GN------LD-----
B2JVC5_PARP8/44-333--------------------------------------------------------AQCRPLVI.GD------AK-----
E6U0H3_BACCJ/33-324--------------------------------------------------------QAGKPFVI.GD------TA-----
I3TLQ2_TISMK/41-330--------------------------------------------------------....AFLAIDD------PD-----
U3U6Y7_9ENTR/31-323--------------------------------------------------------DWPVELVVCAD------GD-----
D8PAQ2_9BACT/40-332--------------------------------------------------------RLCTPVVV.GS------RP-----
A6WG90_KINRD/420-711--------------------------------------------------------ETSRSVVV.GD------AA-----
Q6AJE3_DESPS/35-321--------------------------------------------------------..RANIVL.GD------IG-----
D8IZA6_HERSS/29-330--------------------------------------------------------RHEVRCILLGD------AA-----
PDXA_HELPY/30-306--------------------------------------------------------ALCEPLYL.TD------GE-----
E0UJK2_CYAP2/32-338--------------------------------------------------------ENYQITVV.GS------RA-----
H6LGK9_ACEWD/32-322--------------------------------------------------------ARARLIVV.GD------RK-----
E4T4J1_PALPW/35-325--------------------------------------------------------.TFVPVIY.GS------SK-----
I1YT17_PREI7/35-321--------------------------------------------------------ELCTPIIY.GS------PK-----
Q1GZB9_METFK/29-319--------------------------------------------------------..PCYLAVIAD------RD-----
W0DQ96_9GAMM/30-322--------------------------------------------------------HWPVPMVVIGD------RQ-----
S6ADC8_9PROT/41-329--------------------------------------------------------...SRIVAIAN------RS-----
Q3ACP1_CARHZ/32-323--------------------------------------------------------AICKPLVI.GD------AK-----
C4K4L0_HAMD5/30-322--------------------------------------------------------HWPVELVVCAD------PD-----
PDXA_ECOLI/29-321--------------------------------------------------------EWPVELVVCAD------AT-----
F4LW28_TEPAE/34-336--------------------------------------------------------DKCNPVVI.SD------AE-----
R5A8A6_9CLOT/34-337--------------------------------------------------------EKCKPLVI.GD------RA-----
V5SD81_9RHIZ/47-343--------------------------------------------------------....PFVFFGD------AE-----
D0MJ80_RHOM4/43-335--------------------------------------------------------KFFDPIIV.GS------AE-----
M9WW13_MANHA/31-320--------------------------------------------------------ELAHPVVI.GD------RK-----
PDXA_SULDN/30-300--------------------------------------------------------KLCAPLYC.IN------SY-----
M4UJW4_9GAMM/32-323--------------------------------------------------------.WSLPIVICCD------KN-----
A9IK05_BORPD/40-331--------------------------------------------------------QRARLVVV.GD------AA-----
Q5E864_VIBF1/34-327--------------------------------------------------------DWPHQLVICGS------KQ-----
H8XRP0_FLAIG/36-322--------------------------------------------------------ETCTPVIF.AN------AK-----
K1WRA1_MARBU/43-327--------------------------------------------------------KKADIFLL.AD------RS-----
PDXA_SHEDO/27-319--------------------------------------------------------AWPAELVVCAN------PE-----

PF00180

LEU3_BACSU/4-352--------------------------------------------------------RIALLPGDGIG------PE-----
LEU3_ECOLI/6-355--------------------------------------------------------HIAVLPGDGIG------PE-----
IDHC_SOYBN/8-403--------------------------------------------------------KVANPIVEMDG------DE-----
LEU3_AGRFC/5-361--------------------------------------------------------SLFLLPGDGIG------PE-----
IDH3A_BOVIN/33-358--------------------------------------------------------TVTLIPGDGIG------PE-----
LEU3_SCHPO/5-363--------------------------------------------------------KIVVLPGDHIG------PE-----
LEU3_LEPIN/3-354--------------------------------------------------------NVAVLSGDGIG------PE-----
LEU3_NEUCR/5-358--------------------------------------------------------NIVVFGGDHCG------PE-----
LEU3_LACLA/4-340--------------------------------------------------------KIVTLAGDGIG------PE-----
IDH_THET8/21-351--------------------------------------------------------LITVIPGDGIG------PE-----
LEU3_YARLI/14-367--------------------------------------------------------KIVLLGGDFCG------PE-----
IDH2_YEAST/38-365--------------------------------------------------------TVSFIEGDGIG------PE-----
IDH_BACSU/21-418--------------------------------------------------------IIPFIEGDGTG------PD-----
LYS12_YEAST/25-367--------------------------------------------------------TIGLIPGDGIG------KE-----
D5A186_ARTPN/6-352--------------------------------------------------------RITLLSGDGIG------PE-----
G2TK86_BACCO/4-350--------------------------------------------------------KLAVLPGDGIG------PE-----
M4CW66_BRARP/45-394--------------------------------------------------------NITLLPGDGIG------PE-----
Q480C2_COLP3/29-412--------------------------------------------------------.IPFIEGDGIG------VD-----
LEU3_THET8/2-339--------------------------------------------------------KVAVLPGDGIG------PE-----
R4KBV6_CLOPA/5-353--------------------------------------------------------KIAVIPGDGIG------PD-----

PF03971

D5CQ42_SIDLE/5-737IIKLPNISASVPQLKAAIKELQSQGYKVPDFP....ENPQNEAEKEIKARYGKVLGSAVNPVLREGN------SDRRAAA
A6Q387_NITSB/6-736IIKLPNISASIPQLVATIKELQAQGYDIPDFP....EEPKTAEEVELRNRFAKLLGSAVNPVLRQGN------SDRRLSK
I6WPR8_PROPF/3-733IIKLPNISASAPQLKAAIAELRAKGFPLPDYP....EEPATPEEREIRSRYDRIKGSAVNPVLREGN------SDRRAPE
D9SIT7_GALCS/5-738IIKLPNVSATPPQLKAAIAELQSQGFDIPDYP....DEPQDDAQKAIKARYSRVLGSAVNPVLREGN------SDRRAAG
D5V1Z1_ARCNC/3-729IVKLPNISASIPQLKAAIAELQSKGYNVPNYD....ESP......EITARYSKILGSAVNPVLREGN------SDRRAPS
D1B1Z3_SULD5/7-741IIKLPNISASLPQLNAAIKELQDKGYLIPSYP....ENPANEKEQEIKARYAKVLGSAVNPVLREGN------SDRRAPL
K7SLX7_PROA4/3-736IIKLPNISASVPQLKAAIAELRAQGFDIPEYP....ARIATEEDREIVARYAAVLGSAVNPVLRQGN------SDRRAPA
A3U876_CROAH/5-738IIKLPNISASVPQLNAAVLELQAKGFDIPTYP....EDAETEEDKALRAKFAKCLGSAVNPVLREGN------SDRRAPK
A1S7A8_SHEAM/7-739IIKLPNISASIPQLKACIKELQAQGYDIPNYP....EEPKTDEEKSIKARYDKIKGSAVNPVLREGN------SDRRAPL
L0FYJ1_ECHVK/23-756IVKLPNISASIPQLKAAIKELQEKGYALPDYP....DEPKDQEEKGVKAKYDKIKGSAVNPVLREGN------SDRRAPQ
F6FT01_ISOV2/6-736IIKLPNISASVPQLKAAIAELQSQGYAIPDYP....EEPRTDEEREIRARYDKVKGSAVNPVLREGN------SDRRAPA
F2II47_FLUTR/7-740IIKLPNISASIPQLKEAIAELQKLGFKVPNFV....ENPTTEEEKTAKAKYDKIKGSAVNPVLREGN------SDRRAPR
V9VSX7_9RHOB/9-736VIKLPNVSASVPQLVAAVTELQGQGYAIPDYP....AEPATDAEKEIRARYDAIKGSAVNPVLREGN------SDRRAAK
Q9I0L4_PSEAE/6-738IIKLPNISASVPQLKGAIAELQGLGYKVPDFP....EDPQTDEEKEVRARYAKILGSAVNPVLREGN------SDRRAPA
A1R425_ARTAT/3-735IIKLPNISASVPQLKAAIAELQAQGYALPDYP....DNPSSDTETDIRSRYDKIKGSAVNPVLREGN------SDRRAPL
B1VF46_CORU7/3-734ILKLPNISASVPQMRAAIGELQKAGYDLPDFP....LEVNTEEEKDAYARYSSVMGSAVNPVLREGN------SDRRAPK
A7HAP6_ANADF/7-741IVKLPNISASIPQLKEAIKELQGKGYKIPDYP....EAPKDEAEKAIQTRYAKCLGSAVNPVLREGN------SDRRSPL
F2LTW4_HIPMA/7-743IIKLPNISASVVQLKEAIKELQEKGYNVPDYP....EEPKDEKEKEIKERYAKVLGSAVNPVLRQGN------SDRRLPT
D2UG49_XANAP/6-738IIKLPNISASVPQLKAAIKELQQQGYALPDYV....DEPKNAQERDAKARYDRVKGSAVNPVLREGN------SDRRAPA
B0BZF4_ACAM1/9-741IIKLPNISASIPQLTAAIQELQAKGYNIPDYP....ASPQNEQEITIKNRYAKVLGSAVNPVLREGN------SDRRVAA
E1STT1_FERBD/3-736IIKLPNISASIPQLKAAIAELQSQGFDVPNYP....EEPANDAERAIQARYAKVLGSAVNPVLREGN------SDRRVAD
Q0A9L5_ALKEH/8-739IIKLPNISASIPQLNACIRELQSQGYDVPSYP....AEPKNDEEQAIHDRYAKVLGSAVNPVLREGN------SDRRAPR
B3QVP5_CHLT3/7-740IIKLPNISASVPQLKAAIKELQEKGYNLPDYP....EDPKNEAEKEIKARYAKVLGSAVNPVLREGN------SDRRAPL
H8XU75_FLAIG/5-736IIKLPNISASVIQLKEAIAELQKHGFAVPNYP....EEPQNDTEKEIKTKYSKVLGSAVNPVLREGN------SDRRAPK
A5WH85_PSYWF/3-737IIKLPNISASVQQLKAAIKELQDKGYAIPDFP....EDPKTEEEETLRKRYGKALGSAVNPVLREGN------SDRRAPK
D7BKH3_ARCHD/4-733IIKLPNISASLPQLQAAIAELQNQGYPLPDYP....LNPHTEAERDVRVRYDSVKGSAVNPVLREGN------SDRRAPQ
A3QD82_SHELP/6-738IIKLPNISASIPQLKACIKELQDKDYALPNYP....DEPQNDAEADIKARYDKIKGSAVNPVLREGN------SDRRAPT
Q31GM7_THICR/4-737IIKLPNISASVPQLNAAIKELQSQGYDIPDYP....ATPQNAEEEKIKAAYAKVLGSAVNPVLREGN------SDRRAPT
C7M412_CAPOD/4-735IIKLPNISASVPQLKAAIAELQSQGYALSDYP....ENPTNEAETAIKQRYDKVKGSAVNPVLREGN------SDRRAPK
E1V4K9_HALED/6-739IIKLPNISASMPQLKAAIKELQGQGYPLPDYP....DEPSDDAERDIKARYDRVKGSAVNPVLREGN------SDRRAPG
Q88FS1_PSEPK/6-739IIKLPNISASVPQLKAAIKELQGKGFNIPDYA....DEPATAEEKESRARYDRIKGSAVNPVLREGN------SDRRAPL
K4KV52_SIMAS/7-739IIKLPNISASIPQLKAAIKELQSQGYGLPDYP....DSPANEKEQDIKARYAKVLGSAVNPVLREGN------SDRRAPR
F2JWD6_MARM1/5-737FIKLPNISASIPQLTATIKELQSQGYEIPDYP....EAPATDEEKEINSRYSKVLGSAVNPVLRQGN------SDRRAPA
F0S094_DESTD/6-733IMKLPNISASIPQLIDAVKELQSQGYDLPDFP....ENPQTEEEKEIRAKYDKCIGSVVNPVLRQGN------SDRRIAP
D3UGP7_HELM1/2-738LIKTPNISASIPQLKNAIAELQAKGYNVPNYP....DNPKNQEEEEIKENYQKILGSAVNPVLRQGN------SDRRSTK
W0J5H7_9BACT/9-742IIKLPNISASVPQLKSAIAELQAKGYALPDYP....ESPKNDAEKDAKARYDRIKGSAVNPVLREGN------SDRRAPK
B9L5J0_NAUPA/5-736VIKLPNISASVPQLVATIKELQSQGYPLPDFP....EEPQNAEEEKIKLKYLKCVGSNVNPVLREGN------SDRRLAE
T2KNT3_9FLAO/6-739IIKLPNISASVPQLHAAIKELQSQGYKLPNYP....DEPKTDAEKEIKSRYDKIKGSAVNPVLREGN------SDRRAPK
A0LZ01_GRAFK/6-739IIKLPNISASVPQLKNAISELQSKGFQIPDYP....DEPSNDKEKEVQSRYDKIKGSAVNPVLREGN------SDRRAPK
C7MEJ9_BRAFD/4-740IIKLPNISASVPQLKAAVAELQGQGIALPDYP....ESPSTEEEKDIRARYNSVMGSAVNPVLREGN------SDRRAPS
A8EUE7_ARCB4/3-729IIKLPNISASIPQLKAAIAELQSKGYKIPDYD..........SSEEVNARYAKILGSAVNPVLREGN------SDRRAPG
M1MV91_9CORY/3-734IIKLPNISASVPQLQAAIKELQEQGYDLPDYP....ANPETDEEKDVRARYDAVKGSAVNPVLREGN------SDRRAPV
Q21K35_SACD2/7-740IIKLPNISASIPQLVAAIKELQAKGYALPDYP....EEPKDEKEASIKARYDSVKGSAVNPVLREGN------SDRRAPA
A0L819_MAGMM/7-741VIKLPNVSASMPQLKAAIKELQEQGYALPDYV....DSPSSEEEKDNQARYDKIKGSAVNPVLREGN------SDRRAPK
E6X675_CELAD/3-737IIKLPNISASVPQLKEAITELQEKGYELPNYP....DEPKSDEEKQIKSRYDKIKGSAVNPVLREGN------SDRRAPR
D5EP32_CORAD/6-738IIKLPNISASIPQMKAAIAELQAQGYKLPDYP....EEASSDEEQSIKARYDKIKGSAVNPVLREGN------SDRRAAA
D8IWJ4_HERSS/7-740IIKLPNISASILQLQAAIRELQSRGYKLPDYP....ENPTTEEEKALQKRYAKVTGSAVNPVLREGN------SDRRAPN
Q480C1_COLP3/7-740IIKLPNISASIPQLELAIKELQAKGYDLPHYP....AEPQNEAEESIKLTYAKVLGSAVNPVLREGN------SDRRAPG
J9R9T1_RIEAN/5-736IIKLPNISASIPQLNEAIEELQKKGFNVPNYP....AEPKTEEEKEIKAKYAKVLGSAVNPVLREGN------SDRRAPK
I1XFF5_METNJ/3-736IIKLPNISASVPQLKAAIKELKAKGYDLPDYP....DNPKTIAEQTIKDRYARVLGSAVNPVLREGN------SDRRAPA
H9UIG1_SPIAZ/5-737IIKLPNISASLPQLRAAIAELQAKGFDIPDYP....EKPQNDEQRDWQARYDRVKGSAVNPVLREGN------SDRRAAR
C1N5W5_MICPC/17-758IIKLPNVSASVPQLESCVAELKSKGYDLPKYPGKANAETMDAETLSIATRYAKVIGSAVNPVLREGN------SDRRVAP
D8PBJ4_9BACT/7-740IIKLPNISASLPQLQAAIKELQSQGYKLPEYP....ENPKDDKEKDIKFRYDKVKGSAVNPVLREGN------SDRRAPL
H1Z8C0_MYROD/6-737IIKLPNISASIPQLNAAIKELQAHGFAVPNYP....AEPKNDEEKEIKAKYAKILGSAVNPVLREGN------SDRRAPK
E1WXB0_HALMS/7-740IVKLPNISASIPQLKACIAELQSQGFDIPNYP....ESATTDSEKDIKARYAKVLGSAVNPVLREGN------SDRRVAG
Q9KSW5_VIBCH/7-740IIKLPNISASVPQLKAAIKELQDKGYALPNYP....EEPSSYEEEAIKATYDKIKGSAVNPVLREGN------SDRRAPA
I3YS17_AEQSU/6-739IIKLPNISASLPQLNEAIEELQKKGFNIPDYP....EAATSSEQKEIKAKYDKIKGSAVNPVLREGN------SDRRAPK
A1STK8_PSYIN/7-740IIKLPNVSASVPQLHAAIKELQSHGFDIPNYP....EDPKTEAEKEAKARYAKVLGSAVNPVLREGN------SDRRVAD
D7WAL0_9CORY/3-734IVKLPNISASLVQLKNAIKELQDAGFKIPDYP....ANPSSDEEKDIKSRYDAVKGSAVNPVLRQGN------SDRRAPR
B2GKD0_KOCRD/3-733IVKLPNISASIPQLKAAIKELQADGYDLPDYP....EDASSDEAKDVRARYDRVKGSAVNPVLREGN------SDRRAPK
M4U620_9GAMM/7-740IIKLPNVSASIPQLKTAIKELQAHGYALPDYP....ETQSSDEERDIAARYAQVLGSAVNPVLREGN------SDRRVAD
A1K4K8_AZOSB/7-741IIKLPNISASVAQLKAAIKELQGKGYKIPDFP....EDPKNDEEKAIKTRYSKCLGSSVNPVLREGN------SDRRAPA
C5BIJ2_TERTT/8-740IIKLPNISASVPQLQATIKELQAKGYKLPDYP....ADPSTEEEKSVKARYDKIKGSAVNPVLREGN------SDRRAPA
E4PIW6_MARAH/7-740IIKLPNISASIPQLRAAIKELNEQGYNVPEYK....ENPENDEEKEIQSRYAKVLGSAVNPVLREGN------SDRRAPT
E4RUN8_LEAB4/17-750IIKLPNISASIPQLVAAIKELQAKGYAVPDYP....EEPKTGEETFIKAKYDKIKGSAVNPVLREGN------SDRRAPK
F8JJ69_STREN/5-736IIKLPNISASIPQLKAAVAELREQGYALPEYP....DDPKTDEEREIRARYDKVKGSAVNPVLREGN------SDRRAPA
C7NKD1_KYTSD/3-736IIKLPNISASVPQLKEAITELQGQGYAIPDYP....EDPQTDEDRAVRATYDAVKGSAVNPVLREGN------SDRRAPQ
Q9JZS1_NEIMB/6-739VIKLPNISASVPQLTAAIKELQSKGFAVPDYP....ADPQTDEEKAVRERYDRIKGSAVNPVLREGN------SDRRAPK
C5ZYN4_9HELI/2-724LIKTPNISASIPQLKAAIAELQQKGFKIPNFP....DEPKNDAEKTIKEKYQKVLGSAVNPVLRQGN------SDRRSTK
C1DL01_AZOVD/5-737IIKLPNISASVPQLKAAIKELQQQGYKLPDYP....EEPKTDTEKDVKARYDKIKGSAVNPVLREGN------SDRRAPL
E6S9C5_INTC7/5-731IIKLPNVSASIPQLKAAVKELQDEGHAVPDYP....DNPTTDEEKAARAAYDKIKGSAVNPVLREGN------SDRRAPA
Q2SHA1_HAHCH/6-738VIKLPNISASIPQLKATIKELQQQGFNVPNYP....EEAVTEEEKKIEQTYTKVLGSAVNPVLREGN------SDRRAPA
C4LKD9_CORK4/3-734IVKLPNISASVPQLKATIKELQAAGYELPDYP....EEPSTDEERDARARYDSVKGSAVNPVLREGN------SDRRAPK
F8E409_FLESM/8-745IIKLPNISATIPQLRAAIDELQNKGFNVPDYP....WDPQNEKEREIQERYGKVLGSAVNPVLRQGN------SDRRPPL
W8S0Q0_9RHOB/9-733VIKLPNISASVPQLVAAIKELQSQGYALPDYP....ETPQTDAEKETRARYDAIKGSAVNPVLREGN------SDRRAAA
W0JIX7_DESAE/6-742VIKLPNISASVPQLVAAIKELQNKGYNVPDYP....EDPKTEEEKKIKETYSKVLGSAVNPVLREGN------NIRAISK
B3E9R4_GEOLS/7-740IIKLPNVSASIPQLKAAIKELQEQGYKLPDYP....EEPKTDAEKELHARYAKCLGSAVNPVLREGN------SDRRSAK
M1E507_9FIRM/6-743LIKLPNISASLPQLKDAIKELQAKGFNIPDYP....DELKSAQDEKIRERYSKILGSAVNPVLRQGN------NIRAVPR
Q0PAY5_CAMJE/3-729LIKTPNISASIPQLKAAIKELQDKGYMLPNYP....DEPKNDEELQIKTKYQKVLGSAVNPVLRQGN------SDRRSTK
A3HX33_9BACT/7-740IVKLPNISASIPQLKAAIKELQGKGYALPNYP....EEPKNEEEKNIKATYDKIKGSAVNPVLREGN------SDRRAPQ
A8LP43_DINSH/9-721VIKLPNISASQPQLDAAIAELQSQGHDIPAYP....ANPTTPEEERIKAAYDAVKGSAVNPVLREGN------SDRRAAQ
K0C4Y6_CYCSP/7-740IIKLPNISASVPQLKAIINELQGKGFDIPNYP....EDPQTDEEKALQQKYGKVLGSAVNPVLREGN------SDRRAPK
A0RPF0_CAMFF/4-728IIKLPNISASLPQLNAAIAELQSKGYAVPNYI....ENPTNDKEESIKARYARVLGSAVNPVLREGN------SDRRCAG
B3ENX3_CHLPB/3-736IIKLPNISASIPQLQAAIKELQEHGYAIPDYP....EDPKTDAEKELRARFAKVLGSAVNPVLREGN------SDRRAAA
F9YPD0_CAPCC/6-739IIKLPNISASVPQLVAAIKELQSKGYDLPNYP....EEPKTEAEKLIKARYDKIKGSAVNPVLREGN------SDRRAPK
B3PL57_CELJU/5-738IIKLPNISASIPQLKAAIKELQSQGYKLPDYP....ESPASDEEKSIKSRYDKVKGSAVNPVLREGN------SDRRAPL
C1FF99_MICCC/20-749IIKLPNVSASVYQLEQAISELNRKGFDVPKYP...SGDALSPEDAAIKARYGKVIGSAVNPVLREGN------SDRRVAG
H2G1D1_OCESG/7-738IIKLPNISASVPQLRACIKELQSQGYNVPDFP....EEPKTDEDKAIREAYSKILGSAVNPVLRQGN------SDRRAPA
E6W3A0_DESIS/5-739IIKLPNISASIPQLQDAIKELQSQGYKVPDYP....ANPKNDEEKKIQEQYSKVLGSAVNPVLREGN------SDRRAAA
D5VA96_MORCB/5-738IIKLPNISASMPQLLAAIKELQAKGYQLPDYP....TNPQTDQEKDIQKRYDKIKGSAVNPVLREGN------SDRRAPK
Q5QZT7_IDILO/7-738IIKLPNISASIPQMTACIKELQNQGYKLPDYP....FDPQTDEEKDVRSRYDKVKGSAVNPVLREGN------SDRRAPS
D5BKK7_ZUNPS/6-738IIKLPNISASIPQLKAAIKELQEKGYKLPEYP....DEPATEEEKEIRAKYDKVKGSAVNPVLREGN------SDRRAPK
E2SFF0_9ACTN/5-735IIKLPNVSASIPQLKAAVAELQQQGYALPNYP....DSPQTDEERDVRARYDKVKGSAVNPVLREGN------SDRRAPA
I6YVP5_MELRP/4-738IIKLPNISATIPQLKAAIKELQEKGYSVPDFP....DEPGSDEDKKIRERYSKILGSAVNPVLREGN------SDRRAAA
W0I0L2_9GAMM/6-739IIKLPNISASLPQLKAAIKELQTQGYAVPDYV....DEPNTDAQKEAKARYDKIKGSAVNPVLREGN------SDRRAPL
C9RMQ9_FIBSS/4-740IIKLPNISASVPQLKAAIAELQKNGYALPDYP....DAPANDEEKAIRARYDKVKGSAVNPVLRQGN------SDRRAPN
I5AYK9_9DELT/4-736IIKLPNISASVPQLKGAIKELQAAGYDVPDYP....DEPKNAEEEAIKTKYSKNLGSAVNPVLREGN------SDRRAAV
Q3IH53_PSEHT/4-737IIKLPNISASVPQLRAVIKELQAKGYALPEYP....VEPKNDEEKAIQAAYDKIKGSAVNPVLREGN------SDRRAPG
V5WJE7_9SPIO/3-736IIKLPNISASIPQIKRAVSELQAAGFAVPDYP....DEPQSDTEREIRKRYDRVKGSAVNPVLREGN------SDRRAPR
B2V8Q7_SULSY/5-744IMKLPNISASVPQLIATIKELQSQGYNLPDFP....EDPKTEEEKAIRERYMKAVGSVVNPVLRQGN------SDRRLSK
Q30RQ6_SULDN/3-727IIKLPNISASVGQLIECITELQAQGYDVPNYP....EDAKTDEEKALKEIYSTCLGSAVNPVLREGN------SDRRAAA
E8UGI5_TAYEM/3-734IIKLPNISASIPQLNEAIAELQKQGFAIPDYP....ADPQNDEEKKVKALYAKVLGSAVNPVLREGN------SDRRAPK
M1P925_DESSD/6-739IVKLPNISASIPQLTGAIKELQDKGYDIPDYP....AEPRNDKEKELHVRYSRVLGSAVNPVLREGN------SDRRAAA
H1XS30_9BACT/5-740IIKLPNISASVPQLQDAIKELQQQGYDIPDYP....EEPKTEEEKAIQARFSKVLGSAVNPVLREGN------SDRRPAP
Q5NET6_FRATT/12-745IIKLPNISASIPQLTAAIKELQSKGYKIPDYP....YEPKDDKEQEIKARYAKVLGSAVNPVLREGN------SDRRVAD
R7XUF3_9ACTN/3-734IIKLPNVSASIPQLKAAIKELQDKGYDLPDYP....ENPQSDEDKATRAKYDKVKGSAVNPVLREGN------SDRRAPG
S5R118_9PROT/7-741IIKLPNISASLPQLINVISELQLHGYKIPNFP....ENPKTEKEKLIKIKYSQLLGSVVNPILREGN------SDRRIPV
Q7UX35_RHOBA/8-739VIKLPNISASIPQLVEAITELQAQGYDIPDFP....QDPKTDEEKSVRATYAKVLGSAVNPVLREGN------SDRRVAA
F6GBX4_LACS5/6-738IIKLPNISASIPQLKAAIEELQEQGFKIPNYP....DEPENDSEKDIKSRYDKIKGSAVNPVLREGN------SDRRAPK
A4AQ16_MARSH/3-736IIKLPNISASVPQLNEAIEELQQKGYALPEYP....DDPKNDEEKDIKARYNKIKGSAVNPVLREGN------SDRRAPR
D3PCR7_DEFDS/7-744IIKLPNISASIPQLKAAIEELQRQGYNVPDYP....EEPKTEEEKKIQERYAKVLGSAVNPVLRQGN------SDRRAPL
Q0VQ19_ALCBS/5-738IIKLPNISASIPQLREAIAELNEHGYAVPEYP....DEPQNEKEKDIQARYTKILGSAVNPVLREGN------SDRRAPI
Q6A6Z7_PROAC/3-732IIKLPNISASVPQLKAAIAELQSQGYELPDFP....DKPSTDEEREIAARYATVLGSAVNPVLRQGN------SDRRAPT
I0AFK0_IGNAJ/4-739IIKLPNISSTVPQLKAAIKELQSKGYNIPDYP....DEPKTDEEKAIKGRYSKVLGSAVNPVLREGN------SDRHAAA
I0IE50_PHYMF/4-736IVKLPNISASIPQLREAIAELQAAGFDVPDHH....DDPQNDEQRATNATYAKVLGSAVNPVLREGN------SDRRVAG
M5AMA5_9ACTN/5-738IIKLPNISASIPQLKAAIAELQGLGYDLPDFP....DDPETDDERAIRAKYSVALGSAVNPVLRQGN------SDRRAPK
K4IX24_PSYTT/7-740IIKLPNISASVPQLTEAIKELQDKGYKIPSYP....EDPQNDKEKDVKNRFAKVLGSAVNPILREGN------SDRRVAG
A4SVS2_POLSQ/7-740IIKLPNISASVPQLLAAIKELQSKGYKIPNFP....EDPKTDEEKSIRTRYSKCLGSSVNPVLREGN------SDRRAPP
G7UU97_PSEUP/6-738IIKLPNISASMPQLKAAIKELQDQGYPLPDYP....DEPRTEAEKDIKARYDRTKGSAVNPVLREGN------SDRRAPL
K9UP30_9CYAN/7-740IIKLPNISASTPQLTAAIQELQVQGYDIPDYP....AQPQNEVEVEIKARYAKILGSAVNPVLREGN------SDRRVAA
F0S4K1_PSESL/6-737IIKLPNISASIPQLKGAIAELQADGYAVPNYP....DDPQTEEDKAIKAKYAKVLGSAVNPVLREGN------SDRRAPK
I3ZAR1_BELBD/7-739IVKLPNISASMPQLLAAIKELKEKGYALPEYP....LNPKNDQEKEVKSRYDKVKGSAVNPVLREGN------SDRRAPL
A1SMP0_NOCSJ/3-734IIKLPNVSASVPQLKTAIKELQEQGYDLPDYP....ENPQTDEDRDVRARYDKVKGSAVNPVLRQGN------SDRRAPA
C5C942_MICLC/3-736VIKLPNISASVPQLRAAIKELQAHGYALPEYP....DEPKTDAEKDAKARYDSVKGSAVNPVLREGN------SDRRAPK
A4CN95_ROBBH/3-737IIKLPNISASIPQLEEAITELQGQGYAIPDYP....AEASSDEEKAIKARYDKIKGSAVNPVLREGN------SDRRAPR
A9GTS3_SORC5/41-773IIKLPNISASIPQLVAAIKELQQQGYAVPDYP....SEPKTEEEKAIKARYAKVLGSAVNPVLREGN------SDRRASP
B1XIH1_SYNP2/14-747IIKLPNISASIPQLTAAIKELQTKGYNMPDYP....ADPKTEAEKEIKAKYAKVLGSAVNPVLREGN------SDRRVAA
I4B3K5_TURPD/7-740VIKLPNISASIPQLKAAIKELQSQGYKVPDYP....EEPKTEDEKAIKARYAKVLGSAVNPVLREGN------SDRRVAR
B0UWC0_HISS2/4-735IIKLPNISASIPQLNAAIKELQQQGFAVPDYP....TEPQTEEEKKIKAAYTKVLGSAVNPVLREGN------SDRRAPK
E8ND12_MICTS/5-736IIKLPNISASIPQLKAAIAELQAQGYDIPDYP....DEASTVEDKDVRARYDRIKGSAVNPVLREGN------SDRRAPL
E6WXM1_PSEUU/6-738IIKLPNISASVPQLKAAIRELQSQGYPLPDYP....DAPKDEKEKDIQARYDRVKGSAVNPVLREGN------SDRRAPA
G0HFV7_CORVD/3-741IIKLPNISASVPQLKAAIAELQADGYALPNFP....DEPATDEEKDARARYDSVKGSAVNPVLREGN------SDRRAPQ
G8R0B4_OWEHD/6-739IIKLPNISASIPQLEAAIKELQSKGYNLPDYP....KDPQTEAEKAIRAKYDKVKGSAVNPVLREGN------SDRRAPR
Q167P5_ROSDO/9-739VIKLPNISASVPQLVAAIEELQAQGYPVPDYP....ENPQTEADKDARARYDTIKGSAVNPVLREGN------SDRRAAV
Q5E3X6_VIBF1/7-740IIKLPNISASIPQLHAVIKELQAKGYALPNYP....EEAKTDEEKAVKAVYDKIKGSAVNPVLREGN------SDRRAPG
B7FVA8_PHATC/76-804IVKLPNISAPLNQLLECVNELRHKGYDVPLYP....HEPSNVEETDVKHRYDKLMGSAVNPVLREGN------SDRRVAA
D6Z308_DESAT/5-739IIKLPNISASIPQLKDAIKELQGQGYRVPDYP....DEPQSEADHEIQQRYAKVLGSAVNPVLREGN------SDRRAPA
A4GAN1_HERAR/6-739IIKLPNISASIPQLKAAIKELQQQGYKLPAYP....DDAQTDAERDAKARYDKIKGSAVNPVLREGN------SDRRAPL
D0LWU8_HALO1/6-739IIKLPNISASIPQMKACIAELQGKGYKIPDYP....EEPKNDAEKAAKARYDAVKGSAVNPVLREGN------SDRRAPK
Q9PA20_XYLFA/23-756IIKLPNISASMPQLKAAIKELQEQGYLLPDYP....DEPKNSAQKDVKIRYDRVKGSAVNPVLREGN------SDRRAPL
G2PQU0_MURRD/3-736IIKLPNISASIPQLKEAIEELQKKGYNLPNYP....DEPKTDEEKVIKAKYDKIKGSAVNPVLREGN------SDRRAPK
F5XPH8_MICPN/8-738IIKLPNISASIPQLKAAIRELQEKGFDLPDYP....DDPKSDEDRSIRARYDKVKGSAVNPVLREGN------SDRRAPL
Q15T95_PSEA6/7-740IIKLPNISASKPQLKAAIKELNDKGFNVPAYP....EDPATDEEKDIEARYSKVLGSAVNPVLREGN------SDRRAPK
Q74D54_GEOSL/5-738IIKLPNISASVPQLKEAIKELQDQGYNVPDYP....EDPKNDAEKEIKERYAKVLGSAVNPVLREGN------SDRRAPL
L7W579_NONDD/6-738VIKLPNISASVPQLVAAIKELQAKGYDIPDYL....EDPETEEEKESKKRYDKIKGSAVNPVLREGN------SDRRAPK
C6X4T6_FLAB3/30-761IIKLPNISASAPQLDAAIAELQKHGYAVPNYP....GEPKNAEEESIKAKYAKVLGSAVNPVLREGN------SDRRAPK
F4AZL1_DOKS4/7-740IIKLPNISASIPQLTAAIKELQSDGYDIPDFP....EEPKTDEEKSIRARYAKVLGSAVNPVLREGN------SDRRAPK
E3F024_KETVY/9-740VIKLPNISASVPQLVAALKELQAQGYDLPDYP....TAPATPAEAEIRARYDAIKGSAVNPVLREGN------SDRRAAK
A5FHV4_FLAJ1/6-737IIKLPNISASVPQLKAAIAELQSHGYNVPNYP....EDPQNDSEKEIKAKYAKVLGSAVNPVLREGN------SDRRAPR
E3I1D3_RHOVT/8-741IIKLPNISASLPQLKAAIKELQGKGYDLPDYP....EEPKTDAEREIKARYAKVLGSAVNPVLREGN------SDRRSAP
A1BEA8_CHLPD/6-739IIKLPNISASLPQLQAAIKELQSHGYNIPDYP....EAPENDAEKEIQLRYAKVLGSAVNPVLREGN------SDRRAPL
Q2L0N5_BORA1/6-739IIKLPNISASMPQLKAAIKELQEQGYKLPDYP....DEPKTDAERDIKARYDKVKGSAVNPVLREGN------SDRRAPL
D1BZX3_XYLCX/6-737IIKLPNVSASVPQLKAAIAELQAQGFDVPDYP....EAPATDEEREIRARYDRVKGSAVNPVLRQGN------SDRRAPA
E6WZW7_NITSE/6-726IIKLPNISASLTQLKECIAELQEHGHDIPDYP....ENPQTEEEKQIAAKYATCLGSAVNPVLREGN------SDRRSAL
A2U0V2_9FLAO/3-736IIKLPNISASVSQLTEAISELQKLGYNIPDYP....ENATTEEEKSILALYNKVKGSAVNPVLREGN------SDRRAPK
A1WFK0_VEREI/7-741IIKLPNISASVGQLIACIKELQDKGHALPDYP....NDPQTGEEKALRARYAKCIGSAVNPVLREGN------SDRRAPK
A6W0E3_MARMS/6-738IVKLPNISASLPQLNATIKELNAEGYGLPEYP....ENPQTDEEKEVQARYSKVLGSAVNPVLRQGN------SDRRAPA
F4C4X4_SPHS2/6-739IIKLPNISASVPQLKAAIKELQAKGYKLPDYP....EEPKNDQEKDIKAKYDKVKGSAVNPVLREGN------SDRRAPK
E4TNZ2_MARTH/6-739IVKLPNISASIPQLKAAIRELQSLGYDLPDYP....DEPENDDEKKVKAKYDNVKGSAVNPVLREGN------SDRRAPK
F0RFA8_CELLC/3-734IIKLPNISASIPQLKEAIAELQEKGYAIPSYP....DDPKDAKEQEIKRRYDKIKGSAVNPVLREGN------SDRRAPK
A6Q7S1_SULNB/5-725IIKLPNISASIGQLKECIAELQSQGFDIPDFP....ENPETEEEKAIRAKYNPCLGSAVNPVLREGN------SDRRAAA
E4TEW9_CALNY/5-739IIKLPNISASIPQLKAAIKELQEKGFAVPDYP....EDPQTPEEKAIHARYAKVLGSAVNPVLRQGN------SDRRAPI
F5Z8R7_ALTNA/5-738IIKLPNVSASIPQLRATIAELNEKGFNVPAFP....DSPKTDEDQEIRERYGKVLGSAVNPVLREGN------SDRRAPT
M5DRS5_9GAMM/7-740IIKLPNISASLPQLKDALKELRKKGYALPLYP....NDPVTEADFELRARYDKIKGSAVNPVLREGN------SDRRAPA
L0GSZ1_9GAMM/6-739VIKLPNISASIPQIKACIKELRGKGYPLPDYP....DEPKTDAERDIKARYDKVKGSAVNPVLREGN------SDRRAPA
I3ZX83_ORNRL/7-736IIKLPNISASVKQLEDAIAELQSHGYNVPNYP....LEPKNDEEKDIKKRYAVVLGSAVNPVLREGN------SDRRAPK
X4QUI6_9ACTO/4-731IIKLPNISASIPQLKAAVAELQSQGYALPDYP....EDPQTDAEREVRARYDAVKGSAVNPVLREGN------SDRRAPA
A5WH86_PSYWF/3-738IIKLPNISASIPQLKAAIKELQDKGFAVPDFP....DTSSTDKEKEVRARFDKIKGSAVNPVLREGN------SDRRAPK
A7I2F0_CAMHC/4-731IIKLPNISASIPQLIACIKELREKGFDVPQFP....AEPKNANEKEIFTRYQKILGSAVNPVLREGN------SDRRSAK
F6I9T7_ZOBGA/3-737IIKLPNISASVPQLNEAIKELQDKGYALPNYP....DEPSNDTEKDIKSRYDKIKGSAVNPVLREGN------SDRRAPR
G8MDD3_9BURK/7-743IIKLPNISASLHQLTSAIKELQSKGYKLPDYP....EEPKNDEEKAIRARYGKCLGSAVNPVLREGN------SDRRAPL
F2J468_POLGS/28-761VIKLPNISASQPQLNAAIKELQAQGYKLPDYP....SEPATEEEKSVKARYDAIKGSAVNPVLREGN------SDRRAPK
C0QS34_PERMH/5-743IMKLPNISASVPQLKEAIKELQEQGYPLPDYP....ENPQTEEEKKIKERYDRCVGSVVNPVLRQGN------SDRRLAA
O53611_MYCTU/7-741IIKLPNISASVPQLVAAIKELQDKGYAVPDYP....ADPKTDQEKAIKERYARCLGSAVNPVLRQGN------SDRRAPK
G4QH54_GLANF/7-739IIKLPNISASIPQLQAALKELRAKGYALPNYP....EEAKTEEEKIIKATYAKVLGSSVNPVLREGN------SDRRAPA
W0DU46_9GAMM/6-739IIKLPNISASIPQLTGAIAELQAQGYAVPDYP....ANPQNEQERDIKARYAKVLGSAVNPVLREGN------SDRRVAG
C3PLB9_CORA7/3-723IIKLPNISASLVQLKKAIAELQAAGYDLPEY.............EEAQEKYDAVKGSAVNPVLREGN------SDRRAPI
Q4JTI7_CORJK/3-736IIKLPNISASIPQLQAAIAELQKAGYDLPDYP....SEPKTDEERDAQARYDSVKGSAVNPVLREGN------SDRRAPK
D1BGD8_SANKS/3-734IIKLPNVSASLPQLKAAIAELQAQGYDLPDHP....DAPATDADEDVRARYDKIKGSAVNPVLREGN------SDRRAPL
Q1R071_CHRSD/6-739IIKLPNISASGPQLKAAIKELQSQGYPLPDYP....DEPSSDEEKAIKAAYDKAKGSAVNPVLREGN------SDRRAPQ
D4H3K7_DENA2/6-741IIKLPNISASIPQLQEAIKELQEKGYDVPDYP....EEPKNDEEKSIKERYAKVLGSAVNPVLREGN------SDRRAAA
Q7VGX2_HELHP/2-729LIKTPNISASIPQLKAAIKELQGKGYDVPNFP....DEPQNDTEKAIKEKYQKVLGSAVNPVLRQGN------SDRRSTK
Q2W9R4_MAGSA/37-771IIKLPNVSASVPQLKAAIKELQSQGYKIPDFP....EDPKTDAEKELKARFGKVLGSAVNPVLREGN------SDRRAAA

PF02504

PLSX_SYNY3/6-328---------------------PE...EIVIGAIRASQELD.VD-IFLVGDRQAIEDCLNR...HPHQG------------
PLSX_HELPY/1-317---------------------VL...PVIEGVSRALENKS.FS-TVLVGDKDKATPFISK.....ELA------------
PLSX_CHLTR/3-311---------------------PLVVWEALGEVLLSSTGEQPVE-FTVFATSDVHHQLMNS.....PLS------------
PLSX_ECOLI/4-331---------------------PS...VTVPAALQALNSNSQLT-LLLVGNSDAITPLLAK..ADFEQR------------
PLSX_BACSU/1-321---------------------PK...AVIDGVIKGIEAFDDLH-ITLVGDKTTIESHLTT.....TSD------------
PLSX_AQUAE/2-322---------------------PL...EIVRGCILAAKELG.YK-IYLVGDKEQIIPILEKA..KEHNN------------
D5AUL6_RHOCB/12-337---------------------PA...AVLDGIALARRKYPDLH-FLVHGPEAELAPLVKAR....RLK------------
I3VW60_THESW/1-316---------------------PR...EIIKGVEKALDSFD.IE-IILVGNKEQLDKYVRE.....KD.------------
W8T1H7_EUBAC/28-365---------------------VE...NLVKGAELAAKDAAGFD-IVLIGPKVETSLEVVEVATEEEAH------------

PF01515

PTAS_BACSU/3-319-------------------VFPEGLDERILEAVSKLAGNKVLN.PIVIG..NENEIQAKAKELNLTLG------------
EUTD_ECOLI/1-320-------------------VFPDALDQRVLKAAQYLHQQGLAT.PILVA..NPFELRQFALSHGVAMD------------
PTAS_CLOTH/2-324-------------------VLPESTDLRVIKAASMIMKKGIAK.VVLIG..NEKEIKS..LAGDIDLE------------
MAO1_RHIME/441-763-------------------IFAEGEDERVLRAAQVLLEEGTAK.PILIGRPQIIETRLRRYGLRIRPD------------
PTAS_CORGL/5-322-------------------VLPEGDDDRILMAAHQLLDQDICD.ITILG..DPVKIKERATELGLHLN------------
PTA_SYNY3/374-693-------------------VLPEGEEIRILKAAASLINHGIVR.LTLLGNIEAIEQTVKINHIDLDLS------------
PTB_CLOB8/4-295-------------------AVAVAQDEPVLEAIKEATENNIAQ.AILVG...................------------
PTAS_BORBU/10-350-------------------VFPESSDSRVLKAAIVILQKNLADSIILIGKKDTVINSLKEFSNCNDIL------------
PTAS_MYCPN/2-315-------------------IFPEGWSPTVMEAVNQLQQAGILT.PPVIF.RTRSEVPAGFNTA.....------------
MAO2_HAEIN/429-750-------------------ILAEGEENKALHATQEVISMGLAN.PILIGRRSVIEEKIKKLGLRLTAG------------
PTAS_CLOAB/2-326-------------------ILAEGEEKRNLIAADKIIKEGLAE.LVLVG..DENKIKEKASELNLDIS------------
MAO2_RHIME/438-756-------------------VFAEGEEVQMMRSAIAYANQQLGT.ALLLGREEVMRETAEREGIDLDRA------------
A1B2J3_PARDP/4-314-------------------ILPEGEDPRVAEAARRLLAAGLAR.VTLMG...GPEIPG..........------------
I3VW55_THESW/3-324-------------------VLPEGAEPRTLKAAEIVLKEGIAD.LVLLG..NEDEIRN..AAKDLDIS------------
PTB_CLOAB/4-295-------------------AVAVAQDEPVLEAVRDAKKNGIAD.AILVG...................------------
PTA_MYCTU/365-682-------------------VLPEGDDDRILKSAGRLLQRGIVD.LTILG..DEAKVRLRAAELGVDLD------------
Q32DP2_SHIDS/392-707-------------------VLPEGDEPRTVKAAAICAERGIAT.CVLLG..NPAEINRVAASQGVELG------------
Q6MTX6_MYCMS/5-317-------------------VFPEGESEIIQSVAKTLVDEKLGL.PILLF.KSSKEVPSEIKNN.....------------
Q8TK18_METAC/4-325-------------------ALPETEDIRTLQAAAKILERGIAN.VVLVG..DEADIKA..LAGDLDLS------------

PF04166

F9D1K6_PREDD/35-324-------------------IA..AYHRKAL.NI.....................EGNFSIIAD...AR............
D7BZZ5_STRBB/44-335-------------------RL.....RQAA.RL......R....G........IDCEIVPV.....SG............
K9XHU5_9CHRO/45-341-------------------QL.....TKTYEQL...............................................
K9Z747_CYAAP/38-335-------------------HL.....EKTYHHL...............................................
F3ZVB4_MAHA5/32-323-------------------VV.....DNIM.HI......C....G........INADIHDIYS...PE............
D4G8G2_RIEPU/43-336-------------------LL.....EERSRDL..N...L..............KLNLIPYSK...KS............
E3I1T8_RHOVT/40-335-------------------LF.....EARA.AL......L....G........IAVRVMRIAR...PE............
F0R264_BACSH/34-324-------------------VA..AYHRKAM.DI...................S.T.NFSIVNS...AS............
Q1LSS1_BAUCH/32-325-------------------LL.....IHRVKQL..G...L.............PPLLLHPYQP...NY............
D5WYG1_THIK1/23-322-------------------WL.....ARTA.RT......L....R........FSPDSSRP.....AI............
Q10ZN5_TRIEI/41-337-------------------IL.....QETYQQL...............................................
Q7MTA8_PORGI/34-326-------------------VA..AYYRKTL.EL...................D.LESWNQVSS...AT............
G2TI06_BACCO/34-325-------------------IL.....KRAL.AV......T....G........CNLHLNSI.....SS............
Q3V872_LEGPH/26-315-------------------LL.....EARASEL..N...L..............SIKFLEYSP...HQ............
B1ZNR3_OPITP/35-329-------------------VL.....RRVSALL.................GIPFYAPILKPDT...WT............
K9SRP6_9SYNE/31-333-------------------VI.....TSTYQLL...............................................
Q3B5B9_CHLL7/30-323-------------------VL.....EHYR.QA......L....G........LPIELERVED...AR............
R6EJC4_9BACE/37-325-------------------IF..GFYRKQIHNL...................E.QLDTYVINS...AK............
PDXA1_BRADU/37-333-------------------AL.....DGAK.AA......L....G........TDVAIPQVSA...D.............
PDXA_XANP2/36-328-------------------AL.....KARV.RQ......L....G........LTVPLAE.TG...PE............
D3EPC7_ATETH/40-355-------------------IL.....LQNYQQL...............................................
X2H9I6_9NEIS/29-319-------------------LL.....QQRAAQL..N...K..............KITIQAYQP...DS............
L0ETE9_LIBCB/39-331-------------------VL.....NARA.KT......L....N........LDISIRE.AN...CS............
B4F2I1_PROMH/31-324-------------------LL.....RARAQQL..N...L..............PLTLVEYSP...DN............
V5UBQ7_9BURK/58-340-------------------LL.....ASRAQAV..GLGDAWQALLAG.................................
A6VU54_MARMS/37-327-------------------LL.....QDRALTL..G...L..............AVNIQTLNS...AQ............
M7SPY7_EUTLA/39-323-------------------EL.....DSAIADAGGVHVPASDDPAGPHNVQVLDDNTASQYQS.................
Q0K4Q7_CUPNH/34-327-------------------EW.....RHGMRIAG.VEL.....................ALAE...TDAPAFADDGKPRL
D4J4Q1_9FIRM/33-335-------------------VM.....EAAV.GI......V....G........KNVKINAV.....SD............
A0JTQ9_ARTS2/490-781-------------------RL.....RQAA.DV......L....G........IEADIHTI.....EK............
G4RBH1_PELHB/33-315-------------------LM.....NPFVRAGG.FEIE.........................................
D2R6V9_PIRSD/43-337-------------------VL.....TRVSAAT.................GISWQADVISLGE...WN............
G7Z7B0_AZOL4/38-329-------------------RL.....SALA.AR......L....G........MAVPVREVAS...PG............
I7HG37_9HELI/28-302-------------------IV.....ESAAKIL...............................................
R6SBC2_9BACE/34-324-------------------VA..AYHRKAM.DI...................Q.T.NFSIVPS...AA............
D9RAU4_CLOSW/32-323-------------------VM.....EQAV.RI......T....G........TDLKIKTVKA...PE............
F0NYL8_WEEVC/36-325-------------------LL..NFHKDIL.KL....................DRIYLQGIPH...AS............
F2IC16_FLUTR/45-335-------------------TI..SFHKKAI.NE...................P.EFNYQNCKS...AT............
M1PE68_DESSD/26-315-------------------VL.....NVYA.Q.......................................RLAIDCT..
H1Z8Q7_MYROD/36-324-------------------PL..SYIKKNI.NS.....................NVNFQGIDS...LD............
PDXA_BACHD/33-324-------------------ML.....EKML.PV......M....K........ADLTINRITT...VD............
Q3SGF8_THIDA/30-317-------------------VL.....EARARQL..G...V..............EVEFLA......GE............
R5KK03_9BACT/34-324-------------------VA..AYHRNAL.GI...................Q.A.NFTIISS...AA............
B8IWD3_METNO/40-332-------------------VI.....ERGAAVAG.VEL.....DLRYVAPGEPIPQNSARPIF...VD............
K9TXI9_9CYAN/42-377-------------------VL.....LDTYDRL...............................................
PDXA_SYNJB/34-331-------------------VL.....EATYRLL...............................................
Q1QSM0_CHRSD/42-333-------------------LW.....EEGQRIAG.TRL...............DLPVIERFAE...AR.....EYTTPVL
K9SMQ8_9CYAN/47-343-------------------QL.....ESHFAVL...............................................
PDXA_PROAC/35-325-------------------II.....SRAC.SV......T....G........LSETVRRVTS...EE............
L0DWB4_THIND/35-324-------------------LL.....EQRARQL..R...L..............PLRIVTFAP...DG............
H8GMF2_METAL/35-325-------------------LL.....LERAERL..G...I..............EIKLNRFDG...TL............
PDXA_GEOMG/34-325-------------------AM.....ARGI.TV......A....G........AALRVERT......D............
R4I106_9GAMM/29-321-------------------LL.....IERAHLL..N...L..............HITLFDYNP...QQ............
E1SLK8_FERBD/27-319-------------------LM.....TQRAKML..G...L..............PLSLRPYQP...SQ............
A1AU02_PELPD/36-329-------------------AL.....ERAV.RV......C....G........SALPIRVV.....ES............
PDXA_RALSO/37-328-------------------LL.....QARADAI..GLGDAWRDAA...................................
PDXA_THISH/31-321-------------------LL.....RERARLL..G...L..............PLEIRPFDP...QT............
Q3V808_SINFN/34-320-------------------VM.....AKAI.AS......L....G........GGLHLNEI.....HD............
D3VCQ4_XENNA/32-324-------------------ML.....LSRARQL..N...L..............PLQLQTYSP...EL............
PDXA_AGRFC/37-329-------------------VV.....ASRA.AL......I....G........VPVNIET.CD...PE............
G7URF7_PSEUP/27-304-------------------VM.....GDAVRIAG.LHAQV........................................
G0IUL6_CYCMS/36-326-------------------AL..TYYRKAL.DM...................N.DFNFIQVKS...ID............
R7J8E6_9PORP/34-325-------------------VA..AYHRKAL.DL...................P.AVNINVVSR...AE............
J3Z564_9ENTR/29-321-------------------ML.....EARARQL..Y...L..............PLRLRPYCS...TQ............
I1F0R6_AMPQE/348-642-------------------LL.....EERARML..G...I..............DIDLRPVDE...NA............
K7AU99_9ALTE/28-319-------------------ML.....RQRAKEL..N...L..............AITLVPYDQ...DN............
PDXA_SYNY3/35-336-------------------VL.....DQTRRQL...............................................
E1VLH2_9GAMM/30-317-------------------ML.....ARRAQQL..G...L..............GVQLVPDDG...GD............
R4KFZ8_CLOPA/32-323-------------------VL.....KKAL.DI......T....N........ISLKLNAVSS...PD............
R5Y392_9BACE/33-324-------------------VA..AYHRKAL.DL...................P.PFNFNIITS...AE............
W0PFJ8_9BURK/36-327-------------------SL.....RKAV.AN......L...NG........DVSKVREISA...PA............
R6YA75_9BACT/37-327-------------------IF..GFYRKLIHNL...................D.QMDTYVIQS...AK............
R5TI46_9CLOT/31-334-------------------VL.....KNAA.RI......V...GR........PEIRINTV.....EK............
A5FXM2_ACICJ/38-335-------------------RL.....AAAC.AG......L....G........IAQPFAAVSA...DT............
PDXA_RHOBA/37-349-------------------IY.....HRAAKKL...............................................
R6W392_9BACT/35-320-------------------AA..AFHRKAL.GL....................EPTGYAVISH...AG............
K9QGD1_9NOSO/46-349-------------------WL.....VQTYDEL...............................................
PDXA_XYLFA/29-316-------------------TL.....QAAAAAL.....................DLPLRLLPP...EA............
F2LWP1_HIPMA/33-327-------------------VF.....EFYM.DK......F....N........LALNINLIES...PD............
PDXA_CAUCR/30-324-------------------LL.....AS...AG......G....G..........VKVRAVTR...PQ............
F5YGA4_TREAZ/37-343-------------------VI.....EDAL.KV......T....N........ITFTLNKI.....SS............
K9RH38_9CYAN/45-348-------------------LL.....LENYTNL...............................................
R5P2E5_9BACT/33-319-------------------VA..AYHRKTL.NI....................ENFNLNSIQT...PR............
D2QDF7_SPILD/236-527-------------------IL..NRYRNLL.NL...................K.DWNLNGAQT...IG............
C4LDY8_TOLAT/35-322-------------------II.....ERAM.KI......R....N........CDFNINKITK...PS............
K9T599_9CYAN/41-347-------------------LL.....QQTYQKL...............................................
PDXA_WIGBR/31-321-------------------IL.....VKRAKDH..G...I..............KLKLHFYNK...NL............
F4LQ79_TREBD/32-322-------------------IM.....EEAV.KI......T....G........LPLRIRRIQD...PS............
E6WQK3_PSEUU/29-316-------------------VL.....AAAAAAL.....................GLPLNLLPA...DA............
I3Y835_THIV6/27-318-------------------LL.....AARARNL..G...I..............ALRLQTFDP...HT............
PDXA2_BRADU/38-337-------------------LI.....ARRA.KT......L....DKTLGKALGAEIRIAS.VS...AH............
Q12FB7_POLSJ/51-359-------------------TL.....RRAA.AL......V....A........SPLALPVAEF...AE............
G4L110_OSCVS/33-352-------------------CM.....EYAL.QV......AERLRG........VRLALHRV.....KS............
K9UJS8_9CYAN/31-336-------------------LL.....IDRYEYL...............................................
H8KWR5_SOLCM/37-327-------------------IT..SFHRKAL.NI...................Q.DFSFNIIQN...TE............
F2K4J5_MARM1/33-323-------------------VI.....EARANAL..G...I..............DIHINICSS...VD............
S6BVY4_9GAMM/29-317-------------------LL.....EERAKRL..D...L..............PLTLLPFED...GT............
A7I3Y6_CAMHC/27-298-------------------LL.....NQAAEIS...............................................
F0SPW7_RUBBR/43-344-------------------VF.....EK...........LIDCPGFEDVAAVYQQLPVVAWEE...FR............
D5MIQ8_9BACT/37-328-------------------IM.....RRAI.RL......C....R........LDLVVRSI.....AS............
F2NDA2_DESAR/37-329-------------------AL.....EKAR.AV......C....G........SRARLHAT.....DD..PGSGFYQP..
A4CID9_ROBBH/38-321-------------------TI..SHQKAHF.CL.....................DIGFQGVGD...AS............
B3PKV3_CELJU/31-323-------------------ML.....NERATAL..G...L..............PLMIKPFDP...GL............
Q2YBP4_NITMU/30-318-------------------LL.....QERAHLL..R...L..............PLTITDYSS...RA............
Q145L2_BURXL/43-326-------------------LL.....AERARAV.....................GVDWRALVA...DG............
C7PP38_CHIPD/38-328-------------------TI..NFYRKLM.NE...................N.NFNYQSVKE...FA............
D5BRI0_PUNMI/31-320-------------------RL.....ESLA.ST......L....G........IEIPIIS.IS...QL............
K0C9N5_ALCDB/29-316-------------------VL.....HDRARLL..G...V..............QATWPQWQP...GD............
F6ACQ2_PSEF1/33-324-------------------RL.....ADAN.RI......V....G........GSLEVNAI.....EH............
W8WYV9_CASDE/45-334-------------------AL.....RRAC.RA......L....G........LDGRLEIR.....PL............
A1BHC0_CHLPD/30-323-------------------TM.....TYYR.DR......L....D........LPVHLTLISS...TT............
L0FWR6_ECHVK/32-334-------------------TI.....AHMA.EQ......L....Q........APLTVKPI.....ET............
F7YI45_VIBA7/28-321-------------------LL.....AERAKEL..N...I..............DVILEDYSI...TS............
Q2W0V4_MAGSA/33-323-------------------RL.....RSLA.AR......L....G........LDVPVVEVSS...PT............
Q11UL9_CYTH3/38-329-------------------LL..ARYKKIL.GL...................YEELNFHSIRS...IQ............
D7A738_STAND/37-327-------------------LL.....RARA.EL......L....G........LAVPVEE.ST...PE............
W0ERT9_9PORP/33-324-------------------VA..AYHRKAL.DI...................P.AVNFNIIAD...AS............
R6ZD40_9FIRM/33-335-------------------AL.....LDAL.SF......C....G........LPLELREIKN...TD............
Q0VMV3_ALCBS/33-325-------------------VL.....SERAQQL..G...L..............TVALSDWQP...GD............
M1LX07_9CLOT/31-321-------------------IL.....ERAT.AV......T....K........SKVTFNKV.....EH............
Q6LV40_PHOPR/30-323-------------------LM.....VERAAQL..G...L..............PLEVKHYDA...TL............
I4WVN0_9GAMM/31-318-------------------LL.....QRAAARC..G...L..............AVELADDDG...SA............
R5AZH6_9BACE/43-334-------------------IA..AFYRKAL.NL...................A.PIQWHQIDN...VD............
A8ESJ0_ARCB4/32-303-------------------ML.....TQASSLL...............................................
D5C4K3_NITHN/29-320-------------------VL.....TQRARQR..G...L..............ALALDIYDP...VQ............
D4LRH6_9FIRM/31-357-------------------CM.....EAAI.PT......VK..GA........ESMKINVI.....HD............
PDXA_DESAH/34-326-------------------VM.....ERAI.DL......K....S........ARMDVHTT.....DT..PAGGKYCH..
Q7VHV2_HELHP/28-304-------------------VL.....ESASTLL...............................................
C5BPB7_TERTT/27-316-------------------ML.....AQRAEQL..G...V..............PLTLIPFEE...GR............
K0C3B1_CYCSP/29-319-------------------LL.....ARRATKL..N...L..............SIDIQQADL...RQ............
PDXA_AQUAE/29-313-------------------TL.....LEASKLT...........G........IKLNYKKIEK...VE............
F0S0E1_DESTD/33-310-------------------VL.....SFYS.KL......L....R........LPFSIKEV.....SS............
Q31F25_THICR/26-318-------------------LL.....TERAAQI..G...L..............PITLTTFDA...SQ............
D5A6D6_ARTPN/31-330-------------------VL.....ENTYQQL...............................................
Q1LRA2_CUPMC/46-333-------------------LL.....DQRAEAL..GVAHAWARRIAD.................................
A4FFA9_SACEN/36-326-------------------AL.....RRAV.EV......C....G........LDVEVNTVSE...VS............
PDXA_CHRVO/29-318-------------------LL.....ADRAAAL..G...L..............NLELADYRR...DR............
R6FKU7_9BACE/34-324-------------------VA..AYHRKSL.DL...................S.T.NFSIVNS...AS............
K9V9D2_9CYAN/37-340-------------------LL.....AKTYTQL...............................................
R6XPS3_9BACT/34-324-------------------VA..AYYRKAM.NL.....................PGQFSIIQK...AE............
K9YBG1_HALP7/36-336-------------------LL.....EKTAQQL...............................................
A1STS2_PSYIN/28-319-------------------LL.....AERALQL..N...E..............QVTLLDYDP...KI............
A1WLE5_VEREI/41-335-------------------LW.....KEGQAIAG.LKV.QTVPVSDFAEVRDRDMLSIPAFLE...MD............
R6F0Q9_9BACT/34-321-------------------IA..AYHRKAL.DI.....................QASFSIINK...AE............
PDXA_RHOPA/35-328-------------------CL.....SRCA.KL......L....G........LDVPLAE.VK...AE............
PDXA_DESOH/33-325-------------------VL.....GQAM.AV......A....G........YAPVIHMT.....DT..PETGVYRPGT
G2PNX1_MURRD/35-323-------------------TV..SQQMKDL.GI.....................DLKFNGVRD...AD............
G7UQC7_PSEUP/28-315-------------------VL.....QAAAQAL.....................GLPLNLLDS...GA............
PDXA_SACD2/29-320-------------------LL.....KDRAKLL..G...L..............PLTVSTYIQ...GS............
E6VTD1_DESAO/30-339-------------------PLHRELKRLDLPAF...............................................
Q24RU8_DESHY/36-320-------------------LF.....KRGMEIAK.VRV......DFQVAATLEEALTMDGIVV...LD............
R5L6M7_9SPIR/33-320-------------------AL.....ERVL.Q.....................PNILLKKINT...PL............
K9TNE7_9CYAN/53-349-------------------LL.....QGCYQQL...............................................
D3IAQ7_9BACT/34-319-------------------LA..AYHSKVL.EI.....................PTNFTIINS...AR............
D5BDL9_ZUNPS/47-332-------------------II..TFLKKKY.KL.....................AINFQGIDS...AE............
Q2IHP1_ANADE/33-321-------------------VL.....ARALGDL...............................................
R6CJV8_9BACT/34-324-------------------VA..AYYRKAM.NL.....................PAQFSIIQK...AE............
R6WB32_9FIRM/32-323-------------------II.....ENAI.KI......V....G........VDLTVHVISE...AE............
E4RQ40_LEAB4/33-324-------------------HL..NKYKSII.GL...................N.NWQYTIIND...PA............
Q11HH0_CHESB/29-325-------------------LL.....SARI.RL......L....K........LDISIVE.AE...PE............
E6SJ78_THEM7/43-331-------------------AV.....ERAR.AL......V....P........GAPAVRVVAD...PA............
F9ZZH4_METMM/31-322-------------------LL.....KERAALL..G...L..............PLTIRTFAA...DK............
L7W827_NONDD/35-323-------------------LL..SYYAKSF.GL.....................KTKIHGITS...LD............
F3ZNL8_9BACE/34-324-------------------VA..AYHRKSL.EI...................S.T.NFSIINN...AE............
R7HMN9_9BACT/35-323-------------------AL..SYHRKAL.EM...................G.NVNFTLVPR...AE............
W0JF83_DESAE/33-320-------------------VF.....EFYK.RL......F....K........LDFKINAIDR...LD............
PDXA_RUEST/31-317-------------------HL.....P..........................SSHPWQPVSA...PA............
Q0AC81_ALKEH/31-319-------------------LL.....RARAALL..G...L..............EVRIEPVES...A.............
PDXA_DESAA/33-325-------------------VM.....EQAE.SL......I....R........SGLDFRPA.....GS..PEDAAYEY..
A4YT91_BRASO/34-325-------------------FL.....AQRA.KL......L....D........LQIPIAE.AR...PE............
K4KQ47_SIMAS/25-316-------------------LL.....RARAASL..K...L..............PLSLYPFDP...AS............
F9YQW3_CAPCC/34-322-------------------TI..SFQRKHL.NI.....................NVNFQGIDL...LE............
D5V304_ARCNC/38-309-------------------LL.....KDGAKLL...............................................
D4MSX7_9FIRM/33-348-------------------MI.....EQAA.RF......V...GR........PDINIHRC.....EK............
M5DPJ7_9GAMM/27-319-------------------LL.....HQRAAEL..G...L..............PLTLQVFDP...DS............
A6TJU5_ALKMQ/33-334-------------------VL.....EAAI.AI......C....N........KDLKVNVV.....SN............
E0URZ3_SULAO/30-300-------------------ML.....QKASARL...............................................
N0BC98_9RHIZ/43-337-------------------LM.....RATC.SS......L............ALHCDVVSAPD...AV............
PDXA_XANCP/28-315-------------------TL.....HSAAKAL.....................CLSVRLLDP...DQ............
F2NA55_CORGP/35-342-------------------MI.....EMAC.GI......A...GH........PEMRVRRV.....ER............
B4RBS3_PHEZH/33-326-------------------AL.....ASAP.AG......G....A..........GLVRTIQS...PD............
K0NNW0_DESTT/36-328-------------------II.....KKAL.SL......L....N........ISNNINII.....DN..PEQGKYQS..
M1FJA7_9ALTE/30-319-------------------LL.....EARARLL..G...L..............SVQIIAWQP...GM............
C0ZNI3_RHOE4/384-675-------------------RL.....RLAA.TV......L....G........IDVDVVAI.....EE............
Q65VM2_MANSM/32-323-------------------IL.....ERAA.KV......R....G........VSIKFNKIQD...PS............
A6H263_FLAPJ/36-324-------------------IL..SFLKKEL.RL.....................EAPLHGIDR...LD............
B5YL57_THEYD/32-311-------------------VI.....KELIKVI...........GMDFDLDNIEMLNLNEIKN...PS............
PDXA_PROA2/35-326-------------------AL.....LYYS.KR......L....G........LSIDI...RT...ID............
B1WU75_CYAA5/40-358-------------------LL.....HQTYQQL...............................................
I0IQ54_LEPFC/42-330-------------------IM.....KDVA.RR......Y....E........PSLVVRTI.....TD............
B7K1J6_CYAP8/40-344-------------------LL.....QDTYQRL...............................................
K9VBC1_9CYAN/53-351-------------------VL.....QETYDRL...............................................
C6VZ75_DYAFD/37-328-------------------VL..NQYRNLL.EM...................K.DWTLHGIQK...AE............
A3DDY3_CLOTH/32-324-------------------AI.....CQAL.EI......C....G........LDSRINVVDE...TL............
B0UIV0_METS4/30-326-------------------FM.....AERA.AR......L....G........LAVPVAA.AA...PE............
K8GJQ6_9CYAN/32-348-------------------LL.....EKTYHQL...............................................
F6ILZ0_9SPHN/44-324-------------------AV.....ERALDMTG.VKARV........................................
A2TY27_9FLAO/35-323-------------------AI..SYHKKTL.GL.....................ETPVHGITS...IN............
PDXA_OCEIH/33-325-------------------ML.....ERAA.KI......L....D........VDVSFDKKT....KD............
D2UFS9_XANAP/28-315-------------------TL.....RAAAAAL.....................SLPLQLLPE...SS............
E6X8R2_CELAD/35-320-------------------TI..SFQKSEL.NL.....................EINYHGVQE...AS............
PDXA_SYMTH/33-323-------------------VM.....ARAF.ET......T....G........VKLNLNPVAT...PA............
B5Y706_COPPD/31-322-------------------PL.....QKAM.KV......S....G........VALEINRIDN...PE............
F8EQB4_RUNSL/37-328-------------------LL..NRYRNQM.DM...................K.EWNLFGLQK...IE............
I3YUG2_AEQSU/35-321-------------------LM..SFFKKHY.EI.....................DINFHGIDK...IE............
B8ET21_METSB/41-335-------------------HL.....GALA.RS......L....G........IEAPIARVAS...AA............
F8GL31_NITSI/33-321-------------------LL.....LARAQQL..K...L..............PLKLIDISV...TN............
PDXA_GEOLS/34-329-------------------AM.....QRAL.TV......C....N........SPLELITV.....SS............
Q5WKA6_BACSK/32-321-------------------VL.....EKLL.PV......V....K........ADLTINKVNT...PA............
C1D5J7_LARHH/29-317-------------------LL.....ADRAATL..G...L..............LARFAAYDP...AA............
F4B1R1_DOKS4/36-321-------------------TL..SYIKKSL.SL.....................QAEFHGIDA...FA............
D6Z2T8_DESAT/51-341-------------------VL.....AQCA.R.......................................QLGVKVE..
C9LXC2_SELS3/37-327-------------------TM.....EQAI.GV......C....G........VKARIHTVEE...PA............
G4QFQ7_GLANF/29-320-------------------ML.....QERATLL..G...V..............PLDIIPYDA...GS............
PDXA2_PSEAE/35-329-------------------EM.....RRGMRIAG.CEF...............PYRRIDALET...LD....FADATPLL
Q0RWE6_RHOJR/36-321-------------------VV.....EPLAHRAG.MTVRE........................................
PDXA_CYAP7/30-337-------------------LL.....EESYHQL...............................................
R7G4X4_9FIRM/35-326-------------------IM.....ERAA.KV......L....G........KELKYNKIED...PS............
D3RQF4_ALLVD/35-326-------------------LL.....AERAARL..G...L..............SLTIAPFDP...AQ............
D8JA34_HALJB/30-324-------------------VV.....ESAR.GI......C....G........SDLGVERI.....AS............
D3SLG0_THEAH/28-312-------------------IL.....RACASHL...........G........MDWEFPTVEK...VE............
F0SBZ7_PSESL/33-323-------------------VA..SFHRKAA.GI...................N.EFVFQVIND...AE............
D3SBX0_THISK/44-331-------------------VL.....EQRAQQL..G...Q..............SIHLIPFDP...AR............
A8IH54_AZOC5/35-332-------------------AL.....HGAQ.KA......L....G........STVAIPEVSA...D.............
F8KS88_HELBC/29-303-------------------LL.....EQANALL...............................................
U5RZ60_9CLOT/33-326-------------------FL.....KKAI.EI......T....N........SDVSLNLI.....ND............
B0SWM5_CAUSK/34-324-------------------LL.....AS...AG......G....G..........VKVRPVTG...PA............
PDXA_SULSY/29-314-------------------AL.....EKAKKLT...........G........VDLNIKEIKS...IN............
V4LB68_9GAMM/33-335-------------------LL.....YERAEHL..H...L..............PIQLLPFDP...QK............
B3ENY2_CHLPB/30-323-------------------AL.....RFYT.VK......L....G........LGVNIAAFTS...FD............
R5Q2C0_9BACT/34-312-------------------IA..AYHRKAL.DI.....................QANFSIINS...AE............
G2Z4E3_FLABF/35-323-------------------II..SFVKKII.GS.....................NSMIQGIDH...LD............
C6XKP9_HIRBI/31-329-------------------IL.....KNSQ.EL......S....G........VDGNIQIIQT...PA............
Q0K4F5_CUPNH/34-323-------------------RL.....EVAG.RL......V....G........SPLKLRAI.....QA............
W0BBF6_9GAMM/27-315-------------------LL.....AQRAEQL..G...L..............NIVLKDYSV...RE............
K9XSR0_STAC7/33-337-------------------YL.....QTTYKHL...............................................
B6JGM3_OLICO/32-326-------------------LI.....RRRA.ER......L....G........VRIEIAE.TS...PQ............
D5SV98_PLAL2/38-331-------------------VL.....EAAAAST.................GQKLATPVISLSE...FT............
PDXA_SERP5/29-321-------------------LL.....LERARQL..D...L..............PLQLRTYQP...QQ............
C7RNL8_ACCPU/39-326-------------------LL.....VETAAAL..N...L..............SVVFRDWHP...AS............
R6WFT1_9BACT/34-321-------------------VA..AYHRNAL.GI...................Q.A.NFTIINK...VE............
PDXA_PSEA6/27-318-------------------LM.....RTRANEL..N...I..............PLTLLPYDA...SR............
J7Q941_METSZ/35-329-------------------FI.....ARVA.AA......L....A........LEIQIES.TT...AA............
PDXA_METCA/29-318-------------------LL.....ESRARLL..G...V..............PIELRRVVS...GD............
R5FA16_9BACT/34-322-------------------VA..AYHHKAL.GI.....................PGNFTIIKS...AE............
PDXA_AZOSB/30-318-------------------LI.....AARAAAV..G...S..............PIAVRHYSR...GQ............
D3HPI6_LEGLN/27-314-------------------VL.....EARAKEL..K...L..............DISFTSYMG.................
C6D3S5_PAESJ/31-322-------------------IL.....ERAA.RV......V....N........SELKVRPI.....AS............
C4ZNQ2_THASP/34-328-------------------LM.....RARAAAL..D...S..............AVGVVEFDA...AR............
Q1ART0_RUBXD/32-322-------------------RL.....ERAA.AL......L....R........LPLRIETV.....SG............
A0KGT9_AERHH/28-320-------------------LL.....RERAALL..G...L..............PIELQPYDA...DQ............
PDXA_PASMU/32-326-------------------EL.....EKGMEIAK.AQFVY.............EEVSFHQLGQ...YE....FKTGVPVL
Q5QVN8_IDILO/29-320-------------------LL.....KQRAEQL..N...L..............PITLHRYRK...GE............
I2F8G1_9BACT/47-340-------------------TL.....QREI.DR......N....H........LGMKIETVSE...IT............
D7DN38_METV0/32-322-------------------ML.....QARAKAL..D...V..............SIQIQEYSA...KS............
K4IU70_PSYTT/35-320-------------------MM..SFFGNQF.NI.....................KLQFNGITD...AS............
D9QLJ7_BRESC/29-321-------------------LL.....EA...........Q....G..........VRVVEIGA...PG............
B0BZ85_ACAM1/36-343-------------------LF.....EAVYEHL...............................................
Q8KEU1_CHLTE/31-322-------------------AL.....EFYR.DL......L....G........LPVELRRIEG...PE............
A5G9E3_GEOUR/36-328-------------------TL.....ERGI.KI......V....G........AQLRIETM.....GT............
F0RGS0_CELLC/35-323-------------------TI..SFQKKEL.NI.....................NINYNGVPD...AD............
Q2G9Z1_NOVAD/34-325-------------------VV.....EEAA.RR......R....G........ITVPVCAVKT...TD............
Q3IWS4_RHOS4/37-320-------------------TL.....LRAR.........A..ACG........LDLALHEF...................
E4RPK4_HALHG/32-334-------------------FL.....KDAV.NL......I....P........SNLKINPV.....ES............
Q82W16_NITEU/32-321-------------------VL.....DQRAEKL..R...L..............PLQLHEDDP...DN............
D5QAY7_KOMHA/32-316-------------------IL.....AR.........................AGGAVCEVAD...VA............
R5CC16_9BACE/34-324-------------------VA..AYHRKSL.DL...................P.T.NFSIVES...AE............
R5P6P7_9BACT/34-321-------------------VA..AYHRNAL.NM.....................QANFTIISN...AD............
A4FIE2_SACEN/34-325-------------------RL.....RQAA.EI......L....G........RPAEVVAV.....ES............
B9LZ80_GEODF/35-326-------------------VL.....QRAI.DL......L....A........ADLRITTV......E............
A3U5N8_CROAH/35-320-------------------VL..SFIKKHL.NI.....................DLQFQGISD...LN............
PDXA_CAMJE/28-357-------------------LL.....NKALKLL...............................................
R5GSB3_9BACT/34-324-------------------AA..AYHRKAI.DS...................Q.V.AFTTVAS...AE............
Q479U5_DECAR/29-319-------------------LL.....EARAAQL..G...L..............NVAFRDYTA...GQ............
R6AA64_9BACT/49-340-------------------VA..NFHRKTL.GL...................N.T.PLQVIAR...AE............
PDXA_NEIMB/28-321-------------------LL.....RARAEAL..G...K..............SVVLRDFDP...ES............
D1B2K3_SULD5/28-299-------------------ML.....GWGAALL...............................................
K9PX21_9CYAN/31-332-------------------LL.....EQAYEQL...............................................
B4EGN0_BURCJ/39-337-------------------LW.....EAGQRVAG.VTI.DVEPVASLAAVRGRPSTARAAFVA...VD............
M1WYQ3_DESPC/31-331-------------------ALVREMERYTVEPF...............................................
E8V3H9_TERSS/35-313-------------------SI.....AAAE.KS......T........................................
E7ABT4_HELFC/29-301-------------------LL.....EQANTLL...............................................
PDXA3_RHIME/42-334-------------------IL.....DEGARVAG.VTL.....DLEAASLDALDNAGTARHVF...VD............
E6WY24_NITSE/28-307-------------------ML.....EQAAELL...............................................
C6XUZ6_PEDHD/33-321-------------------VA..SYHRKAL.GL...................T.DFAFNVINE...PA............
B4SF48_PELPB/31-318-------------------VM.....EYYR.NA......L....D........LPVELELIES...AT............
I5B2I7_9DELT/36-328-------------------IL.....KQAD.FN......Y....K........ILQKLVIT.....DDLISDFSNFPK..
Q65EJ5_BACLD/32-325-------------------ML.....KKAA.FQ......I....G........SEVVINKV.....GH............
D3QBQ2_STANL/35-328-------------------AL.....RRGA.AA......A....G........LDVDVRVVND...FS............
I6ZML4_MELRP/28-311-------------------VF.....ERYRKKF......N.............IGVSYEIIED.................
Q5LKY3_RUEPO/32-322-------------------LW.....EQGAAQAG.QEV.......PLNSLDPRAIPIQTGLAH...LN............
Q2RKJ4_MOOTA/32-333-------------------LM.....GEAI.KI......A....G........VNLSVRAV.....TS............
R5EF26_9GAMM/29-323-------------------LI.....AQRIALF..NSNHT.............ESVKITDYSK...DN............
W0E2J5_MARPU/29-320-------------------LL.....RARARAL..G...L..............ALETLPFDP...DQ............
H1Y4I7_9SPHI/33-321-------------------VA..SFHRKAL.NL...................S.DFSFNVVAA...PD............
E3GDT1_EUBLK/31-337-------------------VL.....ENAL.KI......T....K........IKKKLIAVKE...GS............
E0WS58_9ENTR/33-325-------------------LL.....NQRAEQL..K...L..............PLILREYQC...DR............
W8F8Y2_9BACT/31-322-------------------VLFDDFPQDAS.HE.....................PLTFRQVRE...AA............
B3QV85_CHLT3/26-321-------------------VL.....QHYV.DV......L....S........LPVQLKRIKN...IE............
A8LS85_DINSH/31-321-------------------LW.....RRGADQAG.LEI.......PLDTIDPRDSGSFTGLAH...LD............
A0Q399_CLONN/32-323-------------------VI.....KQAI.GF......C....D........LKLNINTITD...AK............
R7EVF6_9BACT/42-333-------------------LI..GYYRKVL.GM...................E.PFSANQITD...AS............
I3Z6X6_BELBD/36-323-------------------AI..TFYRKQL.EM...................E.DFNFMQIKS...ID............
PDXA_HYDS0/28-302-------------------IL.....KHASSVL...........G........QNFYYEKVNS...VD............
W0EZ35_9BACT/35-325-------------------VV..NFYRKTV.TE...................S.SFSFYHTRE...FD............
D5CTH9_SIDLE/30-349-------------------LL.....LHRAALL..G...T..............GVRLHDYAA...DR............
R7LG84_9BACT/48-339-------------------VA..TYHRKAL.GL...................N.T.PFTVIKS...VD............
D3E9G4_GEOS4/31-324-------------------IL.....ERVL.PI......I....G........SSLKVNAI.....QE............
E3FNJ1_STIAD/27-308-------------------TL.....ERFALFRR.YARTTPATLGRATEPTVCEVTALAEKDR.................
X5D8G7_9BACT/35-325-------------------VA..AYHRKAL.DI...................N.DVSFNHIRS...TK............
G8PQZ0_PSEUV/36-329-------------------LL.....KARA.KH......L....G........FKIPIKV.VE...PE............
L0DE58_SINAD/36-336-------------------VL.....ERALACV...................GGQAVVQSISR...PE............
G8QYY1_SPHPG/33-336-------------------IL.....HRAL.SF......P...GI........PQVALNAI.....QN............
W8KS11_HALHR/35-325-------------------VL.....LDRAEQL..G...I..............HLTLTPLDP...DQ............
G8TP28_NIAKG/36-322-------------------VI..NFYRKSV.PD...................I.NFSYQSIKE...LN............
PDXA_VIBCH/28-321-------------------LL.....AQRATQL..G...I..............QVKLLDYQR...DN............
T2KID2_9FLAO/35-320-------------------VM..SFYKNHF.KM.....................DINFNGINQ...IN............
U5LJV8_9BACI/34-327-------------------IL.....ERAK.GF......V....D........SQLTIETVNE...QD............
PDXA_PERMH/27-312-------------------II.....EKVSSIL...........D........KKTEINIIDS...PE............
PDXA_RHILO/36-329-------------------LI.....ASRA.SR......L....G........VSVPIVE.TT...PA............
Q89M19_BRADU/33-325-------------------IF.....DEGAHVAG.AKP.....DLTMVEQGADLRSAQGDALF...VD............
K9VZP3_9CYAN/50-362-------------------LL.....QETYLHL...............................................
PDXA_FUSNN/31-321-------------------VL.....EKAT.KI......C....Q........VDLKIHTIKN...IE............
E0SNM5_IGNAA/34-327-------------------VF..........NI......VRDRCDIDVDIVEVSENRIKDLEY...RV............
G0AAS4_COLFT/40-342-------------------FL.....AMIAAEI..D...P..............QIRLVALSQ...QA............
A6Q3Y7_NITSB/29-300-------------------II.....QQAANIL...............................................
A7HYG3_PARL1/38-330-------------------LY.....RTAS.ER......L....G........AGAAIREISD...PS............
G4STZ3_META2/32-323-------------------LL.....MQRAESL..G...L..............KLEIKSFDP...LS............
R4W4P1_9EURY/25-318-------------------VL.....RAAV.EC......C....D........SSLSVEAV.....DD............
E4TVA5_MARTH/35-325-------------------IL..SYYRKAL.NI...................R.DFNYFQLKK...LE............
R5IKT1_9CLOT/33-336-------------------VM.....EAAL.PI......V...GH........TEMKIHAI.....KD............
R7CXE5_9BACE/34-324-------------------VA..AYHRKAM.EL...................Q.A.NFSIVNS...AS............
G8QPR5_DECSP/28-330-------------------LL.....HQRAAQL..G...M..............DVPLHDYAP...DR............
PDXA_HERAR/30-332-------------------FL.....AMIAGAI..N...P..............DIHLSALSW...QA............
Q7VQK2_BLOFL/37-330-------------------LL.....LDRAKKL..Q...L..............PLTLQPYYI...NT............
C7M3J3_CAPOD/34-323-------------------LV..SFQKKHF.NT.....................TANFQGIES...VE............
R6TUF4_9FIRM/17-307-------------------MF.....EHGLKVVG.GDV...............PHYVISDLSE...CDWERGYPVLDLKD
D1CHU7_THET1/34-324-------------------TM.....ERQL.TC......A...PG.........VRSVRQVGE...PD............
PDXA_CAMFF/30-301-------------------LL.....NSAANIL...............................................
I4BXC4_ANAMD/32-320-------------------VI.....KKAA.TI......V....G........YDSEINLI.....ED............
E1R632_SPISS/37-339-------------------MF.....EDSI.RI......L...KE........KKIKVRRV.....SL............
C4ZHF2_AGARV/32-338-------------------CM.....EEAV.KI......AG..KE........GQIKIHAI.....ND............
B8I6T9_CLOCE/32-323-------------------VI.....EKAA.RI......C....G........IQTKVNPVAG...AD............
F4CNN9_PSEUX/26-309-------------------VL.....AGHAAAAG..............................................
C5B7P2_EDWI9/30-321-------------------LL.....EARAHAL..G...L..............PLTLRRYDS...AL............
PDXA_SYNFM/34-329-------------------AL.....QRSM.AL......S....G........ASKKVLVL.....RE............
F2I3R8_PELSM/32-321-------------------IL.....EDGEKTSG.VKTDLIPAKNFDEIDFSKGSKFFIDITN...GKNRAY........
K7VXY6_9NOST/36-337-------------------LL.....TKSYENI...............................................
R5D0H0_9BACT/34-324-------------------VA..AYHRNAL.GI...................Q.G.NFTIINS...AA............
H6L3Q9_SAPGL/32-322-------------------IL..AYHKNIV.KL...................R.SFQFHTIEE...GE............
R6F1V4_9BACT/34-322-------------------VA..AYHKKVM.NT.....................PAQFTIIHK...AE............
Q2S3U3_SALRD/96-387-------------------VL..RVHADVL.GF...................S.DLDIHIVDE..VPE............
H2FZ12_OCESG/28-320-------------------LI.....QARAQAQ..G...R..............DITLLPYRQ...QA............
L0K3J5_9EURY/33-327-------------------VM.....RAGV.DV......S....G........ADLEIEPV.....DT............
G8R4P5_OWEHD/35-324-------------------VA..SYHRKAL.NM...................D.HFNFHICND...FG............
I1YL39_METFJ/29-320-------------------LV.....AQRAAQL..D...L..............DVQIVAVDL...SM............
PDXA_COLP3/27-319-------------------LL.....QERSKAL..S...L..............PLTIIDYDQ...HA............
Q215S3_RHOPB/38-329-------------------FL.....QARA.AT......L....G........LNVPFAE.VR...PD............
D3DGU5_HYDTT/29-313-------------------II.....ERAMRLL...........G........KEHTLRDIYV...ID............
C6X2C9_FLAB3/36-324-------------------LF..TYQKNIF.KL.....................QINFNYITE...AL............
Q02C14_SOLUE/41-313-------------------VL.....EQAS.RI......T....G........IGLQAKLHDA...RA............
G0G667_AMYMS/33-323-------------------VL.....ERLV.RH......L....G........LHLEINPIAT...VA............
A9GKN1_SORC5/15-317-------------------IT.....RRAARLV...............................................
Q1QKW1_NITHX/32-325-------------------FI.....AARA.KL......L....G........VDLPLAD.AD...PG............
H1XYD5_9BACT/33-325-------------------VL.....KKYL.TL......F....G........MEASLISIND...FK............
D4GUQ8_HALVD/34-328-------------------VI.....RHAV.DQ......C....D........SDLSVEAV.....ES............
PDXA_BEII9/33-322-------------------VM.....EHAI.AN......L....G........VAVQIRRI.....AT............
F9Z465_ODOSD/33-319-------------------VA..AYHRKAL.NI....................ENFSLNSIQN...AR............
A6VPP4_ACTSZ/32-327-------------------EL.....CKGLTIAE.VSFEY.............NEIVPENLPN...YS....FKPGIPAL
I0KFB6_9BACT/263-588-------------------VL..NRYRNLL.NL...................K.DWNLNGIQQ...VD............
B5E8C6_GEOBB/32-324-------------------AM.....ERGI.AV......A....G........VKLAIASA.....PD............
Q4FMQ9_PELUB/32-317-------------------LL.....QEQMKKL...................DFYFKINDIDK...EL............
A5FM92_FLAJ1/36-324-------------------IL..SFVKKSF.TS.....................TVQFHGVDK...LD............
E3H6A7_ILYPC/32-321-------------------II.....EFFN.KK......L....G........LNVKLEKL.....IN............
A6QAX9_SULNB/28-306-------------------ML.....LQAAEKL...............................................
A9BT55_DELAS/23-315-------------------RL.....QRAA.DM......L....G........VRPRIQAI.....DA............
C3M9C3_SINFN/34-330-------------------VL.....SARA.RV......L....G........QPVRIEE.TD...CL............
Q5LQN1_RUEPO/27-312-------------------HL.....P..........................SGTPVTLLDD...PA............
E8UEJ0_TAYEM/35-326-------------------CL.....ETYASRL......G............YVDVKFKLIHE...IG............
R5UVJ1_9BACT/33-321-------------------VA..AYHRKTL.NI....................ENFNLNSIQT...PQ............
PDXA_ERYLH/36-326-------------------VL.....RSAT.EA......L....G........VPCPIQEIDD...IA............
I0IDK7_PHYMF/40-342-------------------LM.....AYAADLAE.IEPFWHRVQHGADRTRHELTHDVVVVDF.................
A8MJU3_ALKOO/32-323-------------------TL.....EQAM.KF......T....N........TTLEINVIEN...VE............
R6WM45_9PORP/34-325-------------------IA..AYHRKVL.DL...................P.AVNLSIIAQ...AE............
Q3ARA5_CHLCH/34-329-------------------VM.....EFYR.NL......L....Q........LPLTLQPIER...VE............
G8X7V7_FLACA/36-324-------------------IV..SYLKKQL.NL.....................NVNLHGIDK...ID............
D3UFK7_HELM1/31-300-------------------LL.....DSMAEIL...............................................
D9SID5_GALCS/30-319-------------------LL.....QQRAQQL..G...I..............DLKIREWDR...AK............
K9WP18_9CYAN/130-441-------------------LL.....QTTYTQL...............................................
PDXA_PSEHT/27-319-------------------ML.....KQRAKHL..G...L..............SIKLIEFDQ...HA............
A1AWJ1_RUTMC/26-312-------------------VL.....LNRAKQL.....................NLNIKIVES...EQ............
PDXA_STRMK/28-315-------------------TL.....RAAAAAL.....................NLPLQLLPE...GA............
Q3V8D3_GEOSL/34-325-------------------AM.....SRGI.AL......T....G........TGFRIETS......E............
B6IN68_RHOCS/40-329-------------------RL.....AALA.GS......L....G........WDVPLVTVAD...PA............
D4M806_9BACT/32-348-------------------SI.....RYAA.AA......ARTLSG........ADLEVRPV.....KA............
I4A0Q6_ORNRL/35-323-------------------LW..GYLSAVV.DK.....................NFTYHKIND...LS............
V4JCI5_9DELT/37-338-------------------IM.....ADAV.SF......S....G........LSLDIAPV.....DN............
I1XKV7_METNJ/29-321-------------------LL.....QQRADEL..S...L..............PLKLVEFDP...NS............
U6B4X5_9RHIZ/39-331-------------------IL.....MFRA.KQ......L....N........IDIPIYE.TD...CA............
G8UPW0_TANFA/30-320-------------------IA..LSYQKVL.GF...................E.PLGFKVIQK...AE............
B0TBI8_HELMI/32-323-------------------VL.....RQAM.AF......C....G........LELAVHTVTE...PA............
F4HD17_GALAU/31-322-------------------MM.....QRAL.DL......L....Q........SPLKINVV.....EN............
J9QT86_RIEAN/36-321-------------------LF..SYQKNIF.KI.....................QANFNYINK...AT............
PDXA1_PSEAE/27-320-------------------LL.....QERAGQL..G...L..............AIDLKDVSP...AA............
F4KTC5_HALH1/42-332-------------------IV..SYHKNIV.GL.....................DLLFQQIRN...AE............
V9VUT8_9RHOB/30-316-------------------HL.....P..........................EGTPVKEITA...PS............
A1WVT6_HALHL/30-323-------------------LL.....RERSRVLD.G...P..............ELDTPAWTP...DA............
A8FHA9_BACP2/32-324-------------------IL.....NRAK.DF......V....K........ANIEIVRI.....TE............
I4AG95_FLELS/65-362-------------------VF..SHYKKLL.NI...................DFTFQQHFIDDENIAS............
F6GFQ1_LACS5/35-322-------------------TM..NFVKNHF.KL.....................NVHLNSIQH...LN............
D9S1Z9_THEOJ/31-320-------------------VL.....RYYA.DL......L....K........LSVPLRSI.....NS............
U3U9G2_9GAMM/29-322-------------------LL.....QYRATQL..G...L..............PLTLLKYQS...TL............
C5ZY06_9HELI/27-295-------------------LL.....KKAARIL...............................................
W0HX00_9GAMM/29-321-------------------LL.....TARARQL..N...L..............PLRLHPYRP...EE............
L0KAL8_HALHC/32-321-------------------TL.....EQAL.EI......T....E........VGLDINIIQK...I.............
F9ZTS3_ACICS/32-320-------------------CL.....QRRAADL..G...L..............GLRLRRWSA...DQ............
W0PD12_9BURK/38-333-------------------AV.....SRAV.AQ......L....G........LSLPVTAH.....DS............
I2EZC0_EMTOG/35-326-------------------II..NRYRQLL.EM...................K.DWQFFTIHK...IE............
R7PD86_9BACT/34-324-------------------AA..TYHRKAI.SS...................E.T.NFHIVKS...AT............
Q2S9C2_HAHCH/25-319-------------------VL.....LKRAESL..G...I..............LLKVEIYSP...GD............
R7DEZ6_9PORP/35-326-------------------VA..AYHRKAL.DL...................P.TINFNIITN...AE............
D0L089_HALNC/37-327-------------------VF.....DERAKLL..G...L..............TYDWPDHDA...EA............
K9WWL5_9NOST/42-342-------------------LL.....TQTYHKL...............................................
E1V6Y8_HALED/34-339-------------------LL.....EERAHAI..G...R..............SVTVRTLSP...GE............
D7AYM9_NOCDD/33-324-------------------AL.....RNAV.AA......V...GG........DPEAVNTVAS...PA............
G8M1K4_CLOCD/32-322-------------------SI.....LKAL.SV......C....G........LKTELTILSD...IF............
Q13RP4_BURXL/47-338-------------------VI.....RRYARQCC.PELML........................................
B1XQD4_SYNP2/31-333-------------------LL.....EKTYQHL...............................................
K9PRQ4_9CYAN/33-337-------------------LL.....TQTYERL...............................................
B2JVC5_PARP8/44-333-------------------RL.....ERAN.QI......V....G........GEMKIRRI.....ED............
E6U0H3_BACCJ/33-324-------------------IL.....NKAI.AL......T....G........VNLKVNEVSS...LE............
I3TLQ2_TISMK/41-330-------------------RL.....AGIA.RK......L....G........WTVPIREIAS...AG............
U3U6Y7_9ENTR/31-323-------------------VL.....RQRAAQL..G...L..............PLTLRDYQP...GV............
D8PAQ2_9BACT/40-332-------------------VM.....ERTI.AW......L....K........LPLQVVDF.....NP............
A6WG90_KINRD/420-711-------------------RL.....RQAA.DV......L....G........VDAEIVPV.....QG............
Q6AJE3_DESPS/35-321-------------------IL.....KKAA.Q.......................................ELGLNVP..
D8IZA6_HERSS/29-330-------------------LL.....AQSAYEI..D...A..............QMRVAAISI...QA............
PDXA_HELPY/30-306-------------------LL.....ERANQLL...............................................
E0UJK2_CYAP2/32-338-------------------LL.....ISTYERL...............................................
H6LGK9_ACEWD/32-322-------------------VL.....QQAI.AF......S....K........VDLQINCVQD...PR............
E4T4J1_PALPW/35-325-------------------VA..AYHRKNL.DI...................Q.GLNLNVVNS...IE............
I1YT17_PREI7/35-321-------------------VA..TYHRNAL.EI.....................EATFTIIND...IS............
Q1GZB9_METFK/29-319-------------------VL.....ASRAHAL..G...L..............PLNIHVYDP...AH............
W0DQ96_9GAMM/30-322-------------------LL.....LDRAQQL..N...L..............PLTLHDYQA...DE............
S6ADC8_9PROT/41-329-------------------LL.....AERAAQL..G...L..............PLELVDFSP...AA............
Q3ACP1_CARHZ/32-323-------------------IL.....QRAE.TI......I....H........TGLHIKPI.....QS............
C4K4L0_HAMD5/30-322-------------------LL.....SARAKQM..N...L..............PLTLKQYHP...KK............
PDXA_ECOLI/29-321-------------------LL.....TNRAAML..G...L..............PLTLRPYSP...NS............
F4LW28_TEPAE/34-336-------------------VM.....KQAI.KI......A....K........VNMQINPV.....TN............
R5A8A6_9CLOT/34-337-------------------IL.....ERAC.RL......V...GA........EEIQIHPV.....SD............
V5SD81_9RHIZ/47-343-------------------AL.....AARA.RA......L....G.....FGGLPVEIVS.DD...LR............
D0MJ80_RHOM4/43-335-------------------VL..RKHAEVL.EL...................P.LPELQVVGD..VPE............
M9WW13_MANHA/31-320-------------------II.....QRAL.PI......V....H........SELKLRIL.....NN............
PDXA_SULDN/30-300-------------------ML.....NQASTLL...............................................
M4UJW4_9GAMM/32-323-------------------LL.....AIRIKQL..N...N..............QIELIDYAL...NT............
A9IK05_BORPD/40-331-------------------AL.....RRAA.QA......L...GA........DASRVRVVEG...PE............
Q5E864_VIBF1/34-327-------------------VL.....AERAAQL..G...I..............QIQIEDYNA...QL............
H8XRP0_FLAIG/36-322-------------------IV..SFLKKTY.QL.....................NANINGIDK...IE............
K1WRA1_MARBU/43-327-------------------EL.....DSAITDAGNVQVFLS.DIAGPKGAQLLDDNTAALYPT.................
PDXA_SHEDO/27-319-------------------LL.....LARAAKL..G...L..............PLRLIPYHS...EN............

PF00180

LEU3_BACSU/4-352-------------------VL-----ESATDVL-----------------------------------------------
LEU3_ECOLI/6-355-------------------VM-----TQALKVL-----------------------------------------------
IDHC_SOYBN/8-403-------------------MT-----RVIWKSI-----------------------------------------------
LEU3_AGRFC/5-361-------------------AM-----TEVRKLI-----------------------------------------------
IDH3A_BOVIN/33-358-------------------IS-----AAVMKIF-----------------------------------------------
LEU3_SCHPO/5-363-------------------IV-----ASALEVL-----------------------------------------------
LEU3_LEPIN/3-354-------------------VM-----EIAISVL-----------------------------------------------
LEU3_NEUCR/5-358-------------------VV-----LEAIKVL-----------------------------------------------
LEU3_LACLA/4-340-------------------IM-----SAGLSVL-----------------------------------------------
IDH_THET8/21-351-------------------CV-----EATLKVL-----------------------------------------------
LEU3_YARLI/14-367-------------------VI-----AEAVKVL-----------------------------------------------
IDH2_YEAST/38-365-------------------IS-----KSVKKIF-----------------------------------------------
IDH_BACSU/21-418-------------------IW-----NAASKVL-----------------------------------------------
LYS12_YEAST/25-367-------------------VI-----PAGKQVL-----------------------------------------------
D5A186_ARTPN/6-352-------------------IM-----AVAVDVL-----------------------------------------------
G2TK86_BACCO/4-350-------------------VM-----DAAIRVL-----------------------------------------------
M4CW66_BRARP/45-394-------------------VI-----SIAKNVL-----------------------------------------------
Q480C2_COLP3/29-412-------------------VT-----PPMLKVV-----------------------------------------------
LEU3_THET8/2-339-------------------VT-----EAALKVL-----------------------------------------------
R4KBV6_CLOPA/5-353-------------------IM-----REAVKVM-----------------------------------------------

PF03971

D5CQ42_SIDLE/5-737SVKQYARKHPHR.MG....KWA.ANSRTRVAHMSS.GDFYGSERSMTVP..EAVSTRIEFVSK....D------------
A6Q387_NITSB/6-736AVKEYAKKFPHK.MR....DVS.PDSKSYVAHMDK.NDFYQNEQSFISD..KDQTVKLVFEGQ....D------------
I6WPR8_PROPF/3-733SVKNYARTNPHR.LG....AWA.PDSRTRVATMAS.GDFRHNERSVVLA..GGDVLTIRHVAG....D------------
D9SIT7_GALCS/5-738AVKQFAKNNPHK.MG....AWS.PESKTHVAHMNA.HDFYGSEKSTTVS..NACTVRIEFTGS....E------------
D5V1Z1_ARCNC/3-729AVKNYAKNNPHR.MG....EWT.KDSKTEVAHMDH.GDFYGSELSETFE..KADDLKISFFDK....S------------
D1B1Z3_SULD5/7-741CVKEYVRKNPHR.MG....EWH.QNSRSHVAYMHE.GDFYGNEKSITMD..KATTLRIELLSS....E------------
K7SLX7_PROA4/3-736AVKAYAKAHPHR.LG....PWS.PQVRARVAHMDS.GDFFGHEESYVS...GGETLDIVHVAE....D------------
A3U876_CROAH/5-738PVKQYAKNNPHR.MG....EWS.SDSKSHVSTMDH.GDFRHNEKSVTIK..NAGSLKIEHVGK....D------------
A1S7A8_SHEAM/7-739SVKNYARKNPHS.MG....KWA.SDSKSHVSHMEA.GDFYGSEQSVTLA..DADSVSIVHTSK....A------------
L0FYJ1_ECHVK/23-756AVKQFARNNPHS.MG....EWS.ADSKSHVASMSE.GDFYGSEQSLTMS..EAGTVKIQLEAG....D------------
F6FT01_ISOV2/6-736AVKNYARTHPHR.MG....AWS.PESRTNVATMGH.DDFFSNEKSVVMP..AADTLTIRLRTA....E------------
F2II47_FLUTR/7-740AVKNYAKKHPHS.MG....AWS.ADSQTKVASMPN.GDFYGSEKSVVVP..AATDVKIELVAQ....D------------
V9VSX7_9RHOB/9-736AVKNYARKNPHS.MG....EWS.AGSKTKVSSMPG.NDFYANEKSATITAAQAGDAKIEFAAG....D------------
Q9I0L4_PSEAE/6-738AVKAYARKHPHS.MG....KWS.MASRSHADYMRG.GDFFSSEQSITMA..KAGDVRIEFVGK....D------------
A1R425_ARTAT/3-735SVKNYARQNPHS.MG....AWS.ADSKTNVATMGE.NDFRSNEKSVVLK..ADDSLSIQLVRE....D------------
B1VF46_CORU7/3-734AVKNYVRTHPHT.MG....EWT.AESKTNVATMEA.NDFRHNEQSVIMP..AEDDLRIQLVKA....N------------
A7HAP6_ANADF/7-741SVKAFSKKNPHK.LG....AWT.QDSKSHVAHMTD.GDFYGSENSTTIQ..KATDYRIEFVSP....A------------
F2LTW4_HIPMA/7-743SVKEFAKKYPDS.MGLPLKPWP.EDSKTHVAHMDG.GDFYEHEKSFTTD..REMDIEIQFVDE....N------------
D2UG49_XANAP/6-738SVKQYARKHPHR.MG....AWS.AQSKSHVAHMDA.GDFYGSERSALIE..QAGSVKIELIGK....D------------
B0BZF4_ACAM1/9-741AVKQYAQKNPHS.VG....PWT.SDSKSHVAHMDT.GDFYGTEQSVVIS..QSGQVKIQLVRE....D------------
E1STT1_FERBD/3-736AVKQYAKANPHS.MG....AWS.ADSRSHVAHMSE.GDFYGSEQSHVCT..EGDNVRIELVNP....A------------
Q0A9L5_ALKEH/8-739AVKNFVRKHPHS.MG....KWS.KASRTHADYMRG.GDFYSAEQSVTMP..QAGTVRIEFVDK....D------------
B3QVP5_CHLT3/7-740SVKNYAKKFPHS.MG....AWS.QDSKSHVSTMNS.DDFRSNEKSVTMS..QATDAKIEFVAE....D------------
H8XU75_FLAIG/5-736AVKNYAKVNPHR.MG....TWA.NDSKTEVAHMNA.GDFYGTENSTTLA..NACKYKIVFTDI....S------------
A5WH85_PSYWF/3-737AVKNYARKHPHS.MG....EWK.QWSSTHVSHMHS.GDFYHGEQSMTLD..KARNVRMELQLD....D------------
D7BKH3_ARCHD/4-733AVKNYARTHPHT.MA....PWS.PQSRTRVATMPR.GDFKHNEVSAVAD..RSTNARIVFTRT....D------------
A3QD82_SHELP/6-738SVKNYAKKNPHS.MG....AWS.SDSKSHVAHMEA.GDFYGSEQSVTVA..EPTSIDILFEGK....D------------
Q31GM7_THICR/4-737SVKNFAKKHPHS.MG....AWS.EDSKSKVAHMTE.GDFYGSEKSMTLP..EATEFKIEFVSE....S------------
C7M412_CAPOD/4-735SVKQYAQTHPHS.MG....AWS.AESLTEVATMQA.GDFYHNEQSVTLQ..KADVVRIELVSP....K------------
E1V4K9_HALED/6-739SVKNYARKYPHR.MG....EWQ.ADSRSHVAHMSE.GDFYGSEKSARIA..ADGEVKIELIGQ....D------------
Q88FS1_PSEPK/6-739SVKNYARKHPHK.MG....AWA.ADSKSHVAHMTQ.GDFYGSEKAALIE..ADDSLRIELVGK....D------------
K4KV52_SIMAS/7-739AVKEYARANPHS.MG....KWS.QASRTHVAHMRE.GDFYASDISTTMT..QADSLKIELVEE....G------------
F2JWD6_MARM1/5-737AVKGFARKHPHS.MG....KWQ.KTSQTHADYMRD.GDFFSSEQSVTMD..KAQEVRIEFVNK....S------------
F0S094_DESTD/6-733PVKEYAKKHPHR.MR....DVS.PKSLSYVAHMKS.GDFYENEKSVTLK..KDTKIRYEFVDK....E------------
D3UGP7_HELM1/2-738AVKQYAKKNPYK.IA....PFD.SNSKTIVSYMQE.GDFFSNEKAVWIK..EPTEARIVFENK....E------------
W0J5H7_9BACT/9-742AVKDYARKHPHS.MG....AWS.PDSKTTVGTMGR.DDFYSNEKSVTVP..AATDVKIEFTGA....D------------
B9L5J0_NAUPA/5-736PVKNYAKMHPHS.MK....PVS.PDSKSYVAHMEK.RDFYETEQSFTSD..KDQTVKIVFEDN....A------------
T2KNT3_9FLAO/6-739AVKNYAKKYPHS.MG....AWS.ADSKTHVATMTE.GDFAHNEKSVTLD..KATSISIQFEDN....N------------
A0LZ01_GRAFK/6-739AVKNFAKKNPHR.MG....EWS.SDSKTHVATMSE.GDFRTNEKSLTLS..SDDTLKIEFTSE....S------------
C7MEJ9_BRAFD/4-740AVKNFAKKHPHR.MG....EWA.KESKTSVVTMGE.NDFASNEQSVISE..GEDTFSIVHVAS....D------------
A8EUE7_ARCB4/3-729AVKNYAKNNPHR.MG....VWA.KDSKTDVAHMNA.NDFYGTEVSTTLD..SADNFKISFINK....N------------
M1MV91_9CORY/3-734AVKNFVKKNPHR.MG....EWS.SDSKTNVATMDA.DDFRHNEKSVILP..SDDTLTIKHVAA....D------------
Q21K35_SACD2/7-740SVKAYAQKNPHS.MG....EWK.SDSKSHVASMES.GDFFGSEKSVTVD..AATAVRIELVGA....D------------
A0L819_MAGMM/7-741AVKEFAKKNPHS.MG....EWK.PDSKTHVAHMQS.GDFFSHETSTTVDSADAGSASIVLTTN....S------------
E6X675_CELAD/3-737AVKNYAKKNPHS.MG....PWS.SDSKTHVATMGE.NDFKTNEKSLTIP..SATKINIEFVAV....D------------
D5EP32_CORAD/6-738AVKQYAKNNPHR.MG....AWA.SDSKSVVSSMSG.NDFFGNEKSVTIP..EATTAKIELVTA....E------------
D8IWJ4_HERSS/7-740AVKNYARKHPHS.MA....KWS.MASRTHVAHMHG.GDFYAGEKSLTLD..KAVDVKMDLVTK....S------------
Q480C1_COLP3/7-740SVKQYARNNPHS.MG....AWS.PESKSHVAHMES.GDFYGSEKSVTID..GATSINIEFVAQ....N------------
J9R9T1_RIEAN/5-736AVKNYAKANPHR.IG....EWK.SDSKTDVAHMNQ.GDFYGTETSTTVE..KDGKFKIVFFGN....D------------
I1XFF5_METNJ/3-736AVKNYARSHPHY.MG....QWN.VDSATDVAHMQA.DDFYGCEQSYTSA..EQDDYQVSFVDA....S------------
H9UIG1_SPIAZ/5-737AVKEYARKYPHS.MG....TWS.PDSKSHVASMSS.GDYYESEKSTTVP..AGGSATIRLLPE....S------------
C1N5W5_MICPC/17-758PVKDFAKKNPHR.LA....DWR.ADSSTRVASMSD.GDFYGSEKSWTNESREPATLRVELHAKGDGGG------------
D8PBJ4_9BACT/7-740SVKAHTRKHPHK.MG....AWS.SDSKSHVSHMKG.GDFFSNEKSLTTT..AATEVRVEFVGQ....D------------
H1Z8C0_MYROD/6-737AVKNYAKKHPHS.MG....AWA.TNSQTRVASMAD.GDFYGTEKSVTVA..QNAKFKIEFVGA....D------------
E1WXB0_HALMS/7-740PVKEYAKNNPHS.MG....AWS.KDSKSHVSHMND.KDFFGSEKSHTMS..GAGDVKIQFVSD....S------------
Q9KSW5_VIBCH/7-740SVKNYAKKNPHS.MG....AWS.KDSKSHVASMSD.KDFFGSEKSMTVS..GATKVAIEFVGK....E------------
I3YS17_AEQSU/6-739AVKNYAKKHPHS.MG....AWS.SDSKSHVATMQH.GDFFHNEKSLTLT..ADDTLSIVLVQN....D------------
A1STK8_PSYIN/7-740AVKQYAQDHPHR.MG....AWS.KESKSHVADMSE.GDFYGSEQSVVLK..EADDVKIEFTST....S------------
D7WAL0_9CORY/3-734SVKNFARKNPHS.MG....EWS.SDSKTNVATMED.NDFRHNEKSVILD..NDDTLTMKLVGA....D------------
B2GKD0_KOCRD/3-733AVKEYAKKHPHT.MG....AWS.EDSRTNVATLGH.DDFRTNEQSVVMP..ADDTLTIQLVS.....D------------
M4U620_9GAMM/7-740AVKQYAKDNPHR.MG....AWS.RESKSHVANMQQ.DDFYGSEQSHLLG..QDDDVKIEFVNN....T------------
A1K4K8_AZOSB/7-741AVKNYAKKHPHS.MG....DWK.QWSRTHVSHMEH.GDFYHGEKSMTLD..KARDVKMELLTK....S------------
C5BIJ2_TERTT/8-740SVKQYARKNPHS.MG....AWE.SSSKSHVSAMTD.GDFYGSEQSVTVD..SATTVSIQLVTD....A------------
E4PIW6_MARAH/7-740AVKAFARKYPHS.MG....EWS.PASRTHVAHMRG.GDFYSSEQSVTLD..KATKANIVFENK....Q------------
E4RUN8_LEAB4/17-750AVKEYARKHPHS.MG....AWS.ADSKSHVSSMTE.GDFYGSEKSVVVP..KATKYKITFVGA....D------------
F8JJ69_STREN/5-736SVKNYAKTHPHR.MG....AWT.ADSKTNVAHMTG.DDFRSTEKSAVVA..EAGSLRIELAGD....D------------
C7NKD1_KYTSD/3-736AVKNFARKHPHS.MG....EWS.ADSRTRVATMGE.DDFASHEKSVVIK..GDDTLTIQLVDD....S------------
Q9JZS1_NEIMB/6-739AVKNFAKKNPHS.MG....AWT.KDSKTHVATMQS.GDFFHNEQSVIVP..EATSVSIVFTDK....Q------------
C5ZYN4_9HELI/2-724AVKEYAKKNPYK.VV....PFN.KDSKSRVSYMQK.GDFFDNEKAILIQ..NPTTAKIEFIGS....K------------
C1DL01_AZOVD/5-737SVKNYARKHPHK.MG....AWS.ADSKSHVAHMDN.GDFYGSEKAALIG..APGSVKIELIAK....D------------
E6S9C5_INTC7/5-731SVKNYARRHPHS.MG....AWS.PDSKTNVATMDA.DDFAHNEKSVILA..QDDTLRMEHVAA....D------------
Q2SHA1_HAHCH/6-738AVKQYARKHPHK.MG....KWS.QASRTHVAHMRE.GDFHATEKSVIID..RPMVARIEFVGK....D------------
C4LKD9_CORK4/3-734AVKNFARKHPHT.MG....EWS.KDSKTNVSTMES.DDFRHNEQSAVLE..NDDELRIQLVAP....N------------
F8E409_FLESM/8-745AVKKFAKKYPKS.MGLPLLDWD.KDSKTHVAHMDE.GDFYANEKSVTTE..KKKGFKIEFQDE....T------------
W8S0Q0_9RHOB/9-733AVKSFAQANPHR.MG....AWS.SGSKTRVASMSG.GDFFSNEVSATLD..KPATARIVLETA....A------------
W0JIX7_DESAE/6-742AVKESAKKYPDS.MGLPLKPWS.KDSKTHVAHMNG.GDFYEHEKSITTD..KPMKVKIEFIDE....T------------
B3E9R4_GEOLS/7-740AVKEYAKKHPHK.MG....AWS.ADSKTHVSWMES.SDFYENEKSVTME..KAGNVKIEFVDK....A------------
M1E507_9FIRM/6-743SIKETAKKFPDL.MGLPLKEWN.PSSKTHVSHMTD.GDFYGHERSITLT..KDTRVRIEFIDK....N------------
Q0PAY5_CAMJE/3-729AVKDYAKNNPYR.VV....EFN.PNSKTRVSYMKE.GDFFSNEKAVLID..QDCVANIEFTSV....D------------
A3HX33_9BACT/7-740AVKAYAKKHPHS.MG....KWS.ADSKSHVDSMSE.GDFYGSEKSHTMT..QATKVSIELTKE....D------------
A8LP43_DINSH/9-721AVKNYARANPHR.MG....EWT.ADSKTTVMTMGA.RDFCSNETSTTITAAQAGPARIEFVGA....D------------
K0C4Y6_CYCSP/7-740AVKEYAKKNPHS.MG....KWS.QASRTHVSHMRS.GDFYSSEKSLTLD..KACKVNIEFVAK....N------------
A0RPF0_CAMFF/4-728AVKAYAKEFPHK.NG....AWD.SSIKTRVAYMQD.GDFYGNEKSIIAK..NSCEFKIEFQNK....F------------
B3ENX3_CHLPB/3-736SVKQYARNNPHR.LR....AWD.EGSRSHVAHMES.GDFYESEQSATMN..GATDVRIEYVDA....D------------
F9YPD0_CAPCC/6-739AVKNYAKKHPHS.MG....AWS.KDSLTKVATMSE.GDFYHSEKSITME..KPDNVKIELTTT....S------------
B3PL57_CELJU/5-738SVKNYARKNPHK.MG....AWS.ADSKSHVAHMNA.DDFYGSEKSALIS..DAGSVKIELVTT....D------------
C1FF99_MICCC/20-749PVKDFARANPHR.LK....DWS.GDSKTEVKSMPG.DDFFGSEKSSVRT..NAGSLRVELHAA....D------------
H2G1D1_OCESG/7-738AVKAFARKYPHS.MG....AWS.KASRSHADYMNG.GDFFSSEQSVTMD..KAQTVRIEFIGQ....D------------
E6W3A0_DESIS/5-739SVKKFAQINPHKFMK....PWP.AGSKTRVAHMAG.GDFYAHETATTVS..AATSVKIEFVGA....D------------
D5VA96_MORCB/5-738AVKNFAKKYPHS.MG....QWS.KDSQSHVATMNG.GDFFANEQSKTVA..DATTVSFIFTDT....Q------------
Q5QZT7_IDILO/7-738AVKNYAKKHPHR.MG....EWS.KDSKSHVAHMNE.GDFYGSEKSVTSA..SEDTFKIVF.ES....N------------
D5BKK7_ZUNPS/6-738AVKNFAKKNPHS.MG....EWS.SDSKSHVATMDS.GDFYHNEKSVTLN..EDDSVDIVFTSA....S------------
E2SFF0_9ACTN/5-735SVKNYAKAHPHS.MG....AWS.ADSRTNVATMGA.DDFAANEQSVVIA..ADDTLRIELVGA....D------------
I6YVP5_MELRP/4-738SVKKFAQKHPHKMMK....PWS.KDSKTRVAHMNQ.KDFYGSEKSLTLD..KNDVVKIEFVDK....N------------
W0I0L2_9GAMM/6-739SVKNYARKHPHR.MG....EWS.ASSQSHVAHMHE.GDFYGSEKSALIE..RDGNVSITLVGR....D------------
C9RMQ9_FIBSS/4-740AVKNYARNNPHS.NG....VWN.ESVKTYVASMQA.DDFYGNEKSITMA..EADSFKIEFVDE....A------------
I5AYK9_9DELT/4-736AVKEFAKKNPHS.MG....AWS.PDSKTHVASMTE.GDYYGSEISTTVE..KACTIKIELAGA....D------------
Q3IH53_PSEHT/4-737SVKEYARNNPHS.MG....AWS.KDSESYVASMSE.GDFFGSEQSVTVD..TATDVRIEHVAT....N------------
V5WJE7_9SPIO/3-736AVKNYAKKHPHS.MG....EWT.PESRSVVASMSE.GDFYGSEESVRFQ..QADSVQIEFHGN....D------------
B2V8Q7_SULSY/5-744SVKEYAKKFPHK.MK....AVS.PNSKAHVAHMLG.GDFYENEKSVTIK..KDTTIRYEFVNK....N------------
Q30RQ6_SULDN/3-727AVKRFAQKNPHK.LR....AFE.SPSKAYVAHMNG.GDFFSNEKSVIVE..GNAPVTIELNGK.....------------
E8UGI5_TAYEM/3-734AVKNYARKNPHS.MG....VWD.SNSKTRVLHMNK.GDFFESEKSVTLE..GASDFAIVFVGA....D------------
M1P925_DESSD/6-739SVKKNGQKNPHRMMK....EWP.SASQCRVSHMDD.GDFYGSEKSVTVS..TPCDVRIECESE....D------------
H1XS30_9BACT/5-740AVKQFAKKNPHKLMK....PWPKEGSKTRVGHMEK.GDFYGSEKSITME..KAAQTRIEFVDK....S------------
Q5NET6_FRATT/12-745AVKKYAEKHPHS.MG....EWT.KDSKSHVASMSA.DDFYANEKSYIVP..KATKVKIVHIDT....K------------
R7XUF3_9ACTN/3-734AVKNYAKSHPHS.MG....AWS.ADSRTNVATMDS.DDFRHNEKSVVMA..ADDTLRIEHTAK....D------------
S5R118_9PROT/7-741FIKNHARKNPYY.IK....KWS.STSKTHVSYMTK.GDFYDNEKSITLN..KSCNIRMELLCH....N------------
Q7UX35_RHOBA/8-739PVKAYAQKNPHS.MG....DWT.ADSKSHVAHMSE.GDFYGSEKSVILD..SDDSLRIEHVDQ....D------------
F6GBX4_LACS5/6-738AVKNYAKKNPHS.MG....AWS.KDSKSHVSTMTQ.GDFAHNEKSVTVT..DATSVKIQHTAA....N------------
A4AQ16_MARSH/3-736AVKNYAKQNPHS.MG....AWS.SSSKSHVATMDQ.GDFKSNEKSITLP..SATSVRIELKAQ....D------------
D3PCR7_DEFDS/7-744AVKKYAQKYPTS.MGLPLKPWS.PDSKCHVAHMSG.GDFYENEKSVTLD..KETDVRIEFVDK....D------------
Q0VQ19_ALCBS/5-738AVKNYARKNPHS.MG....YWS.PASRTHVAHMRG.GDFFSHETSCTID..KACKVRIEFEDS....N------------
Q6A6Z7_PROAC/3-732AVKAYAKAHPHR.MG....QWT.DQVKARVAHMDH.GDFFDHEESFVS...RGQDLDVVLIRT....D------------
I0AFK0_IGNAJ/4-739SVKKFAQKHPHKMMK....PWPTSGSKCRVAHMKQ.NDFYGNKKSLTIK..KDDVVKIEFIDN....N------------
I0IE50_PHYMF/4-736PVKAYARAHPHA.MG....AWS.QDSKSHVSHMAG.DDFYGSEQSVTLA..EPTTVRIQLVGE....S------------
M5AMA5_9ACTN/5-738AVKEYARKNPHS.MG....AWS.SDSKTHVATMSG.DDFASNEQSVTIG..DAGTVRIEHVDA....D------------
K4IX24_PSYTT/7-740PVKEYAQDHPHK.LN....EWS.KESKTHVSTMKD.GDFYGSEKSVVLT..SEDDVKIVHTDA....N------------
A4SVS2_POLSQ/7-740AVKRYARKNPHS.MG....EWS.QASRTHVSHMHG.GDFYSSEKSMTMT..KACDVKMDLVTK....S------------
G7UU97_PSEUP/6-738SVKNYARKHPHR.MG....KWS.ADSKTHVAHMES.GDFFGSEKSVTLA..GADTLKISFVGN....D------------
K9UP30_9CYAN/7-740SVKQYAQKNPHR.VG....KWQ.QDSKTHVAHMES.GDFYGSEQSVVIN..EAGNVKIELVAA....D------------
F0S4K1_PSESL/6-737AVKNYAKANPHS.MG....AWS.ADSKTKVAHMNE.GDFYGSEKSVTVE..EASQFKIEFVAE....N------------
I3ZAR1_BELBD/7-739AVKNYAKKNPHS.MG....AWS.ADSKTHVASMQK.GDFYGSEKSLTLS..SATSVDIEFVNA....A------------
A1SMP0_NOCSJ/3-734SVKQYAKAYPHR.MG....AWS.TDSKTNVATMGE.HDFKTNEKSVVLA..ADDTLRIELEAA....D------------
C5C942_MICLC/3-736AVKEYAKRFPHS.MG....EWT.PDSKTAVATMGA.DDFRANEQSVTLP..AADVLTIEFTDE....D------------
A4CN95_ROBBH/3-737PVKNFARKNPHS.MG....AWS.ADSKSHVATMSS.GDFKSNEKSVTLG..QGTRLRIEWVGA....G------------
A9GTS3_SORC5/41-773AVKDYAKKHPHS.MG....AWS.RDSKSHVAHMSG.GDFYGSEKSVVVD..KAQELKIELVA.....G------------
B1XIH1_SYNP2/14-747AVKEYARHNPHK.VG....EWT.KNSKSHVAHMDE.GDFYGSEQSVVIE..QAGTLKIEHQGT....D------------
I4B3K5_TURPD/7-740SVKEFAKKNPHK.LG....EWS.KECKSHVANMKA.GDFFHNEKSVTIE..DATDVKFEFEDK....S------------
B0UWC0_HISS2/4-735AVKNYAQKNPHS.MG....DWS.AQSKTQVVSMQQ.GDFYGTEKSVTVK..SAGQFQIEFVAA....N------------
E8ND12_MICTS/5-736AVKNYAKKHPHR.NK....AFA.EGSKTRVATMGH.DDFFSNEKSVVIA..DDDVLTIQHVAA....D------------
E6WXM1_PSEUU/6-738SVKNYARKHPHR.MG....AWS.KDSKSHVAHMDA.GDFYGSEQSATIA..NAGSLKIELAQA....D------------
G0HFV7_CORVD/3-741AVKNFARKHPHT.MG....AWD.KDSRTNVATMTE.GDFRHNEKSVIID..GDDTLQIRLVAA....D------------
G8R0B4_OWEHD/6-739AVKQYAQKHPHR.MG....AWS.SDSKSHVASMSH.GDFYGSEKSVTVP..AATDVKIEFFGD....D------------
Q167P5_ROSDO/9-739AVKNYAQSNPHS.MG....AWS.KDSKTRVSTMSA.NDFRSNETSVTLSAAQAGPAKIELIGA....D------------
Q5E3X6_VIBF1/7-740AVKQYARNNPHS.MG....AWS.SDSKSHVASMSD.GDFYSSEQSVTID..GATNVSIEFVAE....N------------
B7FVA8_PHATC/76-804PVKAYAQKNPHR.MG....LWS.KASRTHVAHMET.GDFYETEQSAVMA..LPTSVSIVLATK....N------------
D6Z308_DESAT/5-739AVKRFGQQNPHRLMK....PWP.QDSKSRVAHMSG.GDFYGSEKSITVN..EACQARIEFVGA....D------------
A4GAN1_HERAR/6-739SVKNYARKHPHK.MG....AWS.ADSKSHVAHMDG.GDFYGSEKSVLIA..EAGNVKIELFAA....D------------
D0LWU8_HALO1/6-739AVKEYARNNPHS.MG....AWS.SDSKSHVATMGA.GDFFANEKSVTLS..APTTARIEHVDA....E------------
Q9PA20_XYLFA/23-756SVKNYVRKYPHR.MG....AWS.TTSKSHVAHMEG.GDFFGSERSAVLA..QAGMLKVELIAK....D------------
G2PQU0_MURRD/3-736AVKNYAKAHPHT.MG....EWS.SDSKTHVATMSH.GDFKANEKSLTMA..NADEVRIELVDT....H------------
F5XPH8_MICPN/8-738SVKNYARKHPHR.MG....AWS.GDSKTNVAHMTA.DDFRSNEKSVVIP..ADTSLRIALVEE....A------------
Q15T95_PSEA6/7-740AVKSYARKNPHS.MG....AWS.QASQTHVAHMRG.GDFYSGEKSVTVK..NAGHVRIEFTDN....N------------
Q74D54_GEOSL/5-738SVKNFSKKNPHK.LS....PWS.PDSKAHVAHMTG.GDFYGNEKSVTVG..NGGEFKIEFVDK....N------------
L7W579_NONDD/6-738PVKQYARNNPHS.MG....EWS.KDSKSHVSTMSH.GDFAHNEKSFTTT..KDTTVNIQLIDK....A------------
C6X4T6_FLAB3/30-761AVKNYAKANPHR.MG....SWS.ADSKTKVAYMTA.GDFYGTEKSVTVE..TEGKFKIEFYGN....D------------
F4AZL1_DOKS4/7-740PVKQYARNNPHS.MG....AWS.ADSKTHVSTMSH.GDFRNNEKSVTIQ..EAGNVRIEHVAA....D------------
E3F024_KETVY/9-740AVKNYAMSHPHS.MG....KWS.KDSKTRVSSMDH.GDFFANETSVTLSAAQAGAVRIELTDK....A------------
A5FHV4_FLAJ1/6-737AVKNFAKANPHS.MG....AWS.ADSKTKVASMSN.GDFYGSEKSLTVN..DANDVKIEFVAK....D------------
E3I1D3_RHOVT/8-741SVKQYAKNHPHK.MG....AWK.ASSKTNVAHMAG.GDFYGSEKSITMT..ADGSFMIEFFGE....D------------
A1BEA8_CHLPD/6-739SVKQFAKKHPHK.MG....AWS.NDSQSHVAHMHS.GDFYGSEQSLTVQ..EPTSVRIEFVDG....S------------
Q2L0N5_BORA1/6-739SVKNYARKHPHK.MG....AWS.ADSKSHVASMES.GDFYGSENSVTLT..EAGNLSIELTAA....D------------
D1BZX3_XYLCX/6-737SVKAYAKAHPHR.MG....AWS.PSSKTNVATMTE.GDFFHNEKSVVIP..ADDTLTIRLVAA....D------------
E6WZW7_NITSE/6-726AVKRYAQKHPHR.LK....PFA.ENSQAKVAHMNGDGDFYGNEQSIINP..KAQTISIKLNGK.....------------
A2U0V2_9FLAO/3-736AIKNYARKNPHS.MG....AWS.SDSKTHVASMKS.GDFANSEKSVTVA..KATDVSIKHISN....S------------
A1WFK0_VEREI/7-741AVKEYARKNPHA.MA....EWS.QASRSHVSHMHH.GDFYHGEKSLTLD..KARDVKLELITH....G------------
A6W0E3_MARMS/6-738AVKGYARKNPHS.MG....KWK.KTSISHADYMRD.GDFYSSEQSVTMD..SAQTVRLEFVGT....D------------
F4C4X4_SPHS2/6-739AVKNYAKKHPHS.MG....AWS.AASKSHVATMSS.GDFRHNEKSLTIN..EETDVKIIFTDK....Q------------
E4TNZ2_MARTH/6-739AVKEFAQKHPHS.MG....EWS.KDSKSHVASMSE.GDFYGSEKSLTLP..SATEVKIELKTK....S------------
F0RFA8_CELLC/3-734AVKNYAKANPHS.MG....AWS.PDSKSQVATMSS.GDFKANEKSITLD..KATDVSVVLVKE....D------------
A6Q7S1_SULNB/5-725AVKKYAQQHPHR.LK....PFA.ENSKAYVAHMEGNGDFYGNEKSVTMD..KAQTVKILLNGK.....------------
E4TEW9_CALNY/5-739SVKNYSKKNPHK.MA....AWD.PNTKAHVAHMTQ.GDFYGSEKSVTIE..KATSVRYEFVDK....N------------
F5Z8R7_ALTNA/5-738AVKNFARKHPHS.MG....EWS.QASRTHVAHMRG.GDFYSGEKTVTVE..KEGYVSIEFTGS....D------------
M5DRS5_9GAMM/7-740SVKEYARNNPHE.MG....AWS.SDSKSHVAHMSH.GDFYGSEKSVTLA..EATDVSVEFIGA....N------------
L0GSZ1_9GAMM/6-739SVKTYARANPPR.MG....AWS.SDSKAHVVTMDA.GDFRHNEKSVTLP..AATTARIEHVAA....D------------
I3ZX83_ORNRL/7-736AVKNYAKAHPHR.MG....AWT.KDSKTRVAHMEY.GDFYDTEKSVTIE..KDNQFRIVFKAE....N------------
X4QUI6_9ACTO/4-731AVKNYAKAHPHS.MK....AWL.PESKTRVAAMSA.HDFRANEVSAVIE..GEGTAQIVFVGE....D------------
A5WH86_PSYWF/3-738AVKAYARANPHA.MK....PWR.RDSKTHVSTMAH.CDFVDDEKSVTID..KETKYRVVYTDE....T------------
A7I2F0_CAMHC/4-731AVKEYAKANPHK.NG....KWD.KNVKTEVMHMNG.GDFYSNEKSMIAD..KNLTLKVEFKGK....S------------
F6I9T7_ZOBGA/3-737AVKNYAKQNPHS.MG....AWS.PDSKTHVATMEH.GDFKANEKSLTLP..KATDIRIELVKN....D------------
G8MDD3_9BURK/7-743AVKNYAKKHPHS.MG....EWS.MASRTHVAHMKH.GDFYHGEKSVTND..KAREVRMELVTK....R------------
F2J468_POLGS/28-761AVKEYAKKNPHS.MG....AWA.PTSRTHVATMEH.DDFASNEKSVTVPSASAGKARIEHVAK....D------------
C0QS34_PERMH/5-743VVKEYAKKHPHR.LK....EVS.PHSKSHVAHMKE.GDFYQHEKSVIIE..KDTKIKYVFEDK....N------------
O53611_MYCTU/7-741AVKEYARKHPHS.MG....EWS.MASRTHVAHMRH.GDFYAGEKSMTLD..RARNVRMELLAK....S------------
G4QH54_GLANF/7-739SVKQYARINPHS.MG....AWA.PDSKSHVSHMQS.GDFYGSEKSTTVS..GAQDVRIEFIDA....S------------
W0DU46_9GAMM/6-739PVKAYAKAHPHS.MG....AWA.KDSKSHVAHMQA.DDFYGSELSYVSP..TEDSVRIEFHGE....D------------
C3PLB9_CORA7/3-723AVKNFAKKNPHK.MG....AWS.ADSKTNVATMDA.NDFRHNEKSVIMP..EEDTLSIVLKTA....E------------
Q4JTI7_CORJK/3-736AVKNFARKHPHS.MG....KWS.PDSKTNVATMEA.DDFRHNEQSVIMD..GDDTLRIQLVKP....N------------
D1BGD8_SANKS/3-734SVKEYVRKNPHR.MG....AWT.ADSKTNVATMGH.DDFFSNEKSVVLD..ADDVLRIEHVSA....S------------
Q1R071_CHRSD/6-739SVKNYARKYPHR.MG....EWS.ADSQSHVAHMSE.GDFYGSEQSAVIA..QAGKLKIELQQK....D------------
D4H3K7_DENA2/6-741AVKRFGQKFPHRMMK....PWPESGSQCRVAHMES.GDFYESEVSTTLP..EATTIKWVFKGK....D------------
Q7VGX2_HELHP/2-729AVKSYAQKNPYR.VV....PFS.ADSKSYVSYMKE.GDFFDNEKAVLIP..SATTAKIIFRDS....S------------
Q2W9R4_MAGSA/37-771SVKAFARKNPHK.MG....AWA.ASSQSHVAHMNA.GDFYGSEKSVTVA..AATDVKIEFHGK....D------------

PF02504

PLSX_SYNY3/6-328--------------INLTIVDAEGVV---EM-------------------------------------------------
PLSX_HELPY/1-317--------------SKVEMIHTQDYI---KM-------------------------------------------------
PLSX_CHLTR/3-311--------------RSVRIVTAEDFV---SM-------------------------------------------------
PLSX_ECOLI/4-331--------------SRLQIIPAQSVI---AS-------------------------------------------------
PLSX_BACSU/1-321--------------R.ITVLHADEVI---EP-------------------------------------------------
PLSX_AQUAE/2-322--------------SLLEVVHAPDKV---EM-------------------------------------------------
D5AUL6_RHOCB/12-337--------------SCVTIRHATGVV---TM-------------------------------------------------
I3VW60_THESW/1-316--------------.GLTIVHAKDVI---TN-------------------------------------------------
W8T1H7_EUBAC/28-365--------------KKMEELLDSGYI---HS-------------------------------------------------

PF01515

PTAS_BACSU/3-319--------------G.VKIYDPHTYEGM.ED-------------------------------------------------
EUTD_ECOLI/1-320--------------G.LQVIDPHGNLAMREE-------------------------------------------------
PTAS_CLOTH/2-324--------------G.VMIEDSLNSEKL.ED-------------------------------------------------
MAO1_RHIME/441-763--------------VDFEVVNPEGDPRY.RD-------------------------------------------------
PTAS_CORGL/5-322--------------T.AYLVNPLTDPRL.EE-------------------------------------------------
PTA_SYNY3/374-693--------------K.VRLINPKTSPDR.ER-------------------------------------------------
PTB_CLOB8/4-295--------------.............D.KQ-------------------------------------------------
PTAS_BORBU/10-350--------------GRIEVVDPNSFPDI.EM-------------------------------------------------
PTAS_MYCPN/2-315--------------..IKHYVIEEMD.L.TK-------------------------------------------------
MAO2_HAEIN/429-750--------------VDFEIVDNEDNPRY.EE-------------------------------------------------
PTAS_CLOAB/2-326--------------K.AEIMDPETSLKT.ET-------------------------------------------------
MAO2_RHIME/438-756--------------G.IQIVNARLSKRV.GA-------------------------------------------------
A1B2J3_PARDP/4-314--------------..AGRIDPAGAPDL.AE-------------------------------------------------
I3VW55_THESW/3-324--------------K.AEIIDPVKSEMF.DR-------------------------------------------------
PTB_CLOAB/4-295--------------.............D.HD-------------------------------------------------
PTA_MYCTU/365-682--------------G.ATVIEPCASELH.DQ-------------------------------------------------
Q32DP2_SHIDS/392-707--------------AGIEIVDPEVVR...ES-------------------------------------------------
Q6MTX6_MYCMS/5-317--------------..SSIKTICLDEFDTKE-------------------------------------------------
Q8TK18_METAC/4-325--------------K.AKIVNPKTYEKK.DE-------------------------------------------------

PF04166

F9D1K6_PREDD/35-324..............EAQEDRVNLLTVFDEDI...................................K.............
D7BZZ5_STRBB/44-335...PEE..AE.FT.PGR.............I...................................N.............
K9XHU5_9CHRO/45-341.................CQCCRDNFANPEEL...................................K.............
K9Z747_CYAAP/38-335.................QPFTSQELIHPDSL...................................N.............
F3ZVB4_MAHA5/32-323........QGVYK.HGI.............I...................................D.............
D4G8G2_RIEPU/43-336..............LEYARQDK......GSI...................................Y.............
E3I1T8_RHOVT/40-335..............DAAPVFD.......DAL...................................P.............
F0R264_BACSH/34-324..............EAQEGRLSIVNCTEDEL...................................K.............
Q1LSS1_BAUCH/32-325...............VRLNNI.......GEL...................................T.............
D5WYG1_THIK1/23-322...VEL..DE.LA.EWKKVPR.......GAI...................................P.............
Q10ZN5_TRIEI/41-337....................SLEKLVYWENL...................................K.............
Q7MTA8_PORGI/34-326..............EAVEGRVNLVNCIPEDA...................................K.............
G2TI06_BACCO/34-325...PEE..GK.YQ.SGT.............I...................................D.............
Q3V872_LEGPH/26-315..............SFKKKA........GYL...................................T.............
B1ZNR3_OPITP/35-329..............QGFAEVIQPSVLDLGLL...................................A.............
K9SRP6_9SYNE/31-333..................KKYDLQLADPDSL...................................E.............
Q3B5B9_CHLL7/30-323...........ALEHLPSCSC.......GVL...................................P.............
R6EJC4_9BACE/37-325..............DAKVKKINILNCLPDNV...................................Y.............
PDXA1_BRADU/37-333....DREWPN....................L...................................C.............
PDXA_XANP2/36-328..............DAAGHFA.......EAL...................................P.............
D3EPC7_ATETH/40-355..................PIKKEKLANPETL...................................S.............
X2H9I6_9NEIS/29-319..............NKPV..S.......GVL...................................E.............
L0ETE9_LIBCB/39-331..............NAISIFR.......DHL...................................P.............
B4F2I1_PROMH/31-324..............PPTAHIP.......GQI...................................C.............
V5UBQ7_9BURK/58-340............................DRV...................................R.............
A6VU54_MARMS/37-327..............DVTAHQQ.......GSI...................................S.............
M7SPY7_EUTLA/39-323................................................................................
Q0K4Q7_CUPNH/34-327YHWQLPERPAY.....................................................................
D4J4Q1_9FIRM/33-335...VKE..AK.FE.FGI.............I...................................D.............
A0JTQ9_ARTS2/490-781...VED..AV.FT.PGR.............V...................................N.............
G4RBH1_PELHB/33-315...................TDPESWGRSGSV...................................D.............
D2R6V9_PIRSD/43-337..............RAPSAIVRPTVVHLPSL...................................D.............
G7Z7B0_AZOL4/38-329..............EAVDLFA.......QAL...................................P.............
I7HG37_9HELI/28-302.............................GL...................................S.............
R6SBC2_9BACE/34-324..............EAQDGRVNIVNCTADEL...................................K.............
D9RAU4_CLOSW/32-323........EGVFE.EGI.............L...................................N.............
F0NYL8_WEEVC/36-325..............KAVEGKINVVNLWKNPI...................................E.............
F2IC16_FLUTR/45-335..............EAVNRKINIVNVWNEEV...................................Q.............
M1PE68_DESSD/26-315IIPWLP..GDAIP.AGQ.................................................N.............
H1Z8Q7_MYROD/36-324..............QIVTGKLNVLNLWKENV...................................N.............
PDXA_BACHD/33-324........EAMFE.YGT.............I...................................D.............
Q3SGF8_THIDA/30-317..............SVPEHRP.......GAL...................................H.............
R5KK03_9BACT/34-324..............EAHSGKLNLLTTFDEEV...................................K.............
B8IWD3_METNO/40-332..LCNLDPADI.....................................................................
K9TXI9_9CYAN/42-377..............RQSPYCPLDSYIHPDEL...................................N.............
PDXA_SYNJB/34-331.................RDRSPAPLAHPAGI...................................P.............
Q1QSM0_CHRSD/42-333MPIDSISRDET.....................................................................
K9SMQ8_9CYAN/47-343.................NKLSCEPLADPEII...................................T.............
PDXA_PROAC/35-325........HIEPE.SNV.............I...................................N.............
L0DWB4_THIND/35-324..............PRAPTPP.......GTL...................................E.............
H8GMF2_METAL/35-325..............PPSPHRH.......GEL...................................S.............
PDXA_GEOMG/34-325...TLN..WEESK.EGV.............L...................................P.............
R4I106_9GAMM/29-321..............SVQPQCA.......GRL...................................L.............
E1SLK8_FERBD/27-319..............PAREQQA.......GTL...................................T.............
A1AU02_PELPD/36-329...VEE..ARRVE.NGA.............I...................................P.............
PDXA_RALSO/37-328............................AAL...................................T.............
PDXA_THISH/31-321..............PAAPDPA.......GCL...................................T.............
Q3V808_SINFN/34-320...VVD..AK..P.DGALN.............................................................
D3VCQ4_XENNA/32-324..............TSSSQSA.......GTL...................................T.............
PDXA_AGRFC/37-329..............SAVSLFE.......RAF...................................P.............
G7URF7_PSEUP/27-304..............RAVPRASQV..THSHTI...................................D.............
G0IUL6_CYCMS/36-326..............DVHHRKINVINVVQESP...................................E.............
R7J8E6_9PORP/34-325..............EAGLNRVNIINCVEDDI...................................K.............
J3Z564_9ENTR/29-321..............APTLRPS.......GEL...................................S.............
I1F0R6_AMPQE/348-642..............LPSACEIAP.....GEL...................................P.............
K7AU99_9ALTE/28-319...............EHTLPA.......GQL...................................F.............
PDXA_SYNY3/35-336................LAQNPGLNLADPETI...................................N.............
E1VLH2_9GAMM/30-317..............TPLPK.........GQL...................................R.............
R4KFZ8_CLOPA/32-323........EGKYT.LGT.............I...................................D.............
R5Y392_9BACE/33-324..............QCAAGKINMINCFDDEL...................................K.............
W0PFJ8_9BURK/36-327........EASNE.VGT.............I...................................E.............
R6YA75_9BACT/37-327..............DAKPKKINIVNCLPDNV...................................F.............
R5TI46_9CLOT/31-334...PSD..GL.YR.SGC.............I...................................D.............
A5FXM2_ACICJ/38-335...PREALPP....................C...................................A.............
PDXA_RHOBA/37-349.......................GCDCPGTI...................................S.............
R6W392_9BACT/35-320..............EAKDGRVNLVAVTNDEI...................................K.............
K9QGD1_9NOSO/46-349.............NLSGNL...VALANPNSL...................................K.............
PDXA_XYLFA/29-316................LAERP.......GDL...................................P.............
F2LWP1_HIPMA/33-327......EIPSLYK.DGE.............L...................................N.............
PDXA_CAUCR/30-324..............EAAQVFP.......DAL...................................P.............
F5YGA4_TREAZ/37-343...ING..TQ.SK.PGT.............V...................................D.............
K9RH38_9CYAN/45-348................KTNGNIDFLPNPADL...................................S.............
R5P2E5_9BACT/33-319..............EANPKRCNVINCIDDAV...................................K.............
D2QDF7_SPILD/236-527..............QISHKLTNVITCWPDQNQ..................................D.............
C4LDY8_TOLAT/35-322........EAKYE.FGT.............I...................................D.............
K9T599_9CYAN/41-347..............QQIFTSKEKTLANPDEF...................................P.............
PDXA_WIGBR/31-321..............SPKVREK.......GEL...................................T.............
F4LQ79_TREBD/32-322........ECRYA.QGT.............I...................................N.............
E6WQK3_PSEUU/29-316................VARQP.......GDL...................................P.............
I3Y835_THIV6/27-318..............TPVASPP.......GHL...................................T.............
PDXA2_BRADU/38-337..............EAAAAFT.......EAL...................................P.............
Q12FB7_POLSJ/51-359...........LADAASVPPHCIGVLQKCEL...................................D.............
G4L110_OSCVS/33-352...VAE..AK.FQ.YGV.............I...................................D.............
K9UJS8_9CYAN/31-336...............CQQVPSTVTLANPSDL...................................K.............
H8KWR5_SOLCM/37-327..............QANPKRANLINCWDEEV...................................K.............
F2K4J5_MARM1/33-323..............DCPVHKS.......GSI...................................D.............
S6BVY4_9GAMM/29-317..............PPAPP.........GAL...................................H.............
A7I3Y6_CAMHC/27-298.............................GL...................................N.............
F0SPW7_RUBBR/43-344.............NSPCDSHKTPLLVDMASI...................................A.............
D5MIQ8_9BACT/37-328...PAE..IT.GD.PGC.............L...................................E.............
F2NDA2_DESAR/37-329...............GT.............I...................................D.............
A4CID9_ROBBH/38-321..............GAIPGKVNVVNVWKEHP...................................E.............
B3PKV3_CELJU/31-323..............PVQPSQP.......GEL...................................V.............
Q2YBP4_NITMU/30-318..............EHRPGE........GIL...................................H.............
Q145L2_BURXL/43-326............................KRV...................................R.............
C7PP38_CHIPD/38-328..............RLNHKQVNVFNCWEEEV...................................Q.............
D5BRI0_PUNMI/31-320..............DAFSPDC.......GAL...................................Q.............
K0C9N5_ALCDB/29-316..............APPT..........GPV.................................................
F6ACQ2_PSEF1/33-324...PRQ..AR.FQ.PGV.............V...................................D.............
W8WYV9_CASDE/45-334...........DA.PGAGTTQ.......GVI...................................G.............
A1BHC0_CHLPD/30-323...........AIDEIAANNN.......RTL...................................P.............
L0FWR6_ECHVK/32-334...VQA..AN.FD.PQV.............I...................................E.............
F7YI45_VIBA7/28-321..............APKPQQA.......GRL...................................V.............
Q2W0V4_MAGSA/33-323..............EAEAAFA.......VAL...................................P.............
Q11UL9_CYTH3/38-329..............EVQPKKINLLVCWEDDF...................................E.............
D7A738_STAND/37-327..............EASRLFL.......TAL...................................P.............
W0ERT9_9PORP/33-324..............LADDNKINLITCVDDEV...................................K.............
R6ZD40_9FIRM/33-335........ELTGK.FGT.............I...................................E.............
Q0VMV3_ALCBS/33-325..............LLPV..........GSL...................................P.............
M1LX07_9CLOT/31-321...ASE..CK.FN.MGT.............I...................................D.............
Q6LV40_PHOPR/30-323..............PAQPHQA.......GTL...................................V.............
I4WVN0_9GAMM/31-318..............PPMRRP........GTL...................................R.............
R5AZH6_9BACE/43-334..............DTIDGDYNIINVIPEDT...................................K.............
A8ESJ0_ARCB4/32-303.............................KI...................................R.............
D5C4K3_NITHN/29-320..............PPEPGIP.......GRL...................................K.............
D4LRH6_9FIRM/31-357...VKE..AK.FE.PGI.............I...................................D.............
PDXA_DESAH/34-326...............GT.............M...................................D.............
Q7VHV2_HELHP/28-304.............................DY...................................P.............
C5BPB7_TERTT/27-316..............PATAAP........GEL...................................C.............
K0C3B1_CYCSP/29-319..............ASSAHKP.......GTI...................................N.............
PDXA_AQUAE/29-313...................EAKERGVYLIDL...................................N.............
F0S0E1_DESTD/33-310.....P..INEPG.THL.............I...................................N.............
Q31F25_THICR/26-318..............PPCANQA.......GEL...................................K.............
D5A6D6_ARTPN/31-330..................RKTTQAIANPDHL...................................N.............
Q1LRA2_CUPMC/46-333............................GDV...................................I.............
A4FFA9_SACEN/36-326........QARFE.PGA.............I...................................D.............
PDXA_CHRVO/29-318..............PAPA..........GAL...................................E.............
R6FKU7_9BACE/34-324..............EAMPDKLSVVNCTDDEV...................................K.............
K9V9D2_9CYAN/37-340...........KFVVDADL.....LVNPDEI...................................K.............
R6XPS3_9BACT/34-324..............DAQDGRINLLAAVEEEV...................................K.............
K9YBG1_HALP7/36-336...................NDVSDLVSVDQI...................................P.............
A1STS2_PSYIN/28-319..............AAKANQI.......GSL...................................K.............
A1WLE5_VEREI/41-335....TIQASQV.....................................................................
R6F0Q9_9BACT/34-321..............DAVDGRVNLLACFDEEV...................................K.............
PDXA_RHOPA/35-328..............DAAAAFA.......TTL...................................P.............
PDXA_DESOH/33-325ISMFSP..APPLS...................................................................
G2PNX1_MURRD/35-323..............QALEGKVNIVNVWKEVP...................................K.............
G7UQC7_PSEUP/28-315................SAAAP.......GDL...................................P.............
PDXA_SACD2/29-320..............AVTTSA........QHI...................................S.............
E6VTD1_DESAO/30-339..............FEVLENPETIGRQEAGV...................................Y.............
Q24RU8_DESHY/36-320..TRKFDAADL.....................................................................
R5L6M7_9SPIR/33-320........EA....EGI.............N...................................N.............
K9TNE7_9CYAN/53-349...................KSQTAIADPEQF...................................L.............
D3IAQ7_9BACT/34-319..............EATDGKVNLLTCFDEEI...................................K.............
D5BDL9_ZUNPS/47-332..............HAIDGKVNIVNVWKESV...................................T.............
Q2IHP1_ANADE/33-321........GLPVVEPGAPLPPGGALVATTAL...................................P.............
R6CJV8_9BACT/34-324..............DAEDGRINLLPAVDEEV...................................K.............
R6WB32_9FIRM/32-323........EGDYR.KGI.............L...................................N.............
E4RQ40_LEAB4/33-324..............QAQQKHSNLINCGKGEFF..................................D.............
Q11HH0_CHESB/29-325..............TAAAHFG.......RAL...................................P.............
E6SJ78_THEM7/43-331........HGAYT.PGT.............L...................................D.............
F9ZZH4_METMM/31-322..............PASPTPA.......GSL...................................S.............
L7W827_NONDD/35-323..............QIVHGKFNVLRLIKEPF...................................N.............
F3ZNL8_9BACE/34-324..............EAEDNKLSVLNCADDDI...................................R.............
R7HMN9_9BACT/35-323..............DAADGVNNLVEVVDGEV...................................R.............
W0JF83_DESAE/33-320......NI....K.EEA.............L...................................N.............
PDXA_RUEST/31-317..............EALQVSA.......DAL...................................P.............
Q0AC81_ALKEH/31-319..............PAGPHRP.......GVL...................................P.............
PDXA_DESAA/33-325...............GR.............V...................................D.............
A4YT91_BRASO/34-325..............EASQAFA.......SAL...................................P.............
K4KQ47_SIMAS/25-316..............TRRSQAP.......GEL...................................A.............
F9YQW3_CAPCC/34-322..............NAVEGKLNVLNCWKDSP...................................N.............
D5V304_ARCNC/38-309.............................NL...................................E.............
D4MSX7_9FIRM/33-348...VSD..AL.FE.SGT.............I...................................D.............
M5DPJ7_9GAMM/27-319..............PIRASGN.......GTL...................................T.............
A6TJU5_ALKMQ/33-334...VKE..AK.FA.FGT.............I...................................D.............
E0URZ3_SULAO/30-300.............................HV...................................T.............
N0BC98_9RHIZ/43-337..............AAADVFP.......HAL...................................P.............
PDXA_XANCP/28-315................HARLP.......GDL...................................P.............
F2NA55_CORGP/35-342...PDQ..AR.FE.PGV.............I...................................D.............
B4RBS3_PHEZH/33-326..............EAARVFP.......EAL...................................P.............
K0NNW0_DESTT/36-328...............GT.............L...................................D.............
M1FJA7_9ALTE/30-319..............VASTAA........GEL...................................S.............
C0ZNI3_RHOE4/384-675...IKD..AE.FI.DGR.............I...................................N.............
Q65VM2_MANSM/32-323........EAKYE.LGT.............F...................................D.............
A6H263_FLAPJ/36-324..............QMVIGKINVLNVWREGV...................................N.............
B5YL57_THEYD/32-311..................................................................K.............
PDXA_PROA2/35-326...........APEKAAAYPQ.......GVL...................................P.............
B1WU75_CYAA5/40-358..................YSTVQPLADPDSF...................................P.............
I0IQ54_LEPFC/42-330....AE..EFSKD.PGV.............M...................................D.............
B7K1J6_CYAP8/40-344..................HSQGVSLAHPDTL...................................D.............
K9VBC1_9CYAN/53-351................RSSNPAAQAANPETL...................................N.............
C6VZ75_DYAFD/37-328..............QANHKLTNVITCWHDHQT..................................E.............
A3DDY3_CLOTH/32-324........SKVVSDSST.............I...................................N.............
B0UIV0_METS4/30-326..............EAAAAFS.......RAL...................................P.............
K8GJQ6_9CYAN/32-348.................VRETDAPLAHPSQL...................................S.............
F6ILZ0_9SPHN/44-324..............RRM.RSFEAPSDEAGVI...................................D.............
A2TY27_9FLAO/35-323..............QINHNKINVLNIWKEEV...................................K.............
PDXA_OCEIH/33-325...EEL..MD.TE.FGK.............I...................................T.............
D2UFS9_XANAP/28-315................AALAP.......GDL...................................R.............
E6X8R2_CELAD/35-320..............KALAGKINVVNVWREIP...................................N.............
PDXA_SYMTH/33-323........EGKYA.HGT.............V...................................D.............
B5Y706_COPPD/31-322........EGLYR.HGT.............V...................................D.............
F8EQB4_RUNSL/37-328..............QANPKVTNVITCWPNTDE..................................D.............
I3YUG2_AEQSU/35-321..............DLVPKKINVLNVWKEHV...................................D.............
B8ET21_METSB/41-335..............EALEAFS.......RSL...................................P.............
F8GL31_NITSI/33-321...............PSPHKA.......GSL...................................H.............
PDXA_GEOLS/34-329...PAE..AADLP.DSV.............I...................................P.............
Q5WKA6_BACSK/32-321........EARGE.YGT.............I...................................D.............
C1D5J7_LARHH/29-317..............PAPAA.........GVL...................................E.............
F4B1R1_DOKS4/36-321..............KALDNKINVYNLWKEPV...................................E.............
D6Z2T8_DESAT/51-341LNPWQP..GQPLG.SGA.............L...................................N.............
C9LXC2_SELS3/37-327........AALDE.AGV.............I...................................N.............
G4QFQ7_GLANF/29-320...............NYIQQP.......GQL...................................I.............
PDXA2_PSEAE/35-329HPWLSQGGDEF.....................................................................
Q0RWE6_RHOJR/36-321..................TADGLATPMADVV...................................D.............
PDXA_CYAP7/30-337..............RSLPHVNHSDLVDPANL...................................L.............
R7G4X4_9FIRM/35-326........EAKYE.FGT.............V...................................D.............
D3RQF4_ALLVD/35-326..............AACPSEP.......GRL...................................N.............
D8JA34_HALJB/30-324...PTE..AT.FS.PDA.............I...................................P.............
D3SLG0_THEAH/28-312...................DIKEPGVYVIDL...................................N.............
F0SBZ7_PSESL/33-323..............SAQAGKPNMINCWEEDV...................................K.............
D3SBX0_THISK/44-331..............PRTATPR.......GTL...................................E.............
A8IH54_AZOC5/35-332....DAEWPA....................L...................................A.............
F8KS88_HELBC/29-303............................NNG...................................Y.............
U5RZ60_9CLOT/33-326...IKD..AE.FS.YGK.............I...................................D.............
B0SWM5_CAUSK/34-324..............EAIKVFG.......EAL...................................P.............
PDXA_SULSY/29-314...................DVVKSGIYLINL...................................Y.............
V4LB68_9GAMM/33-335..............PPCSQPP.......GTL...................................Y.............
B3ENY2_CHLPB/30-323...........AIRNASLSPD........TL...................................P.............
R5Q2C0_9BACT/34-312..............EACEGRINMLACFDEEV...................................K.............
G2Z4E3_FLABF/35-323..............QIVLGKINVLNVWKEGV...................................N.............
C6XKP9_HIRBI/31-329..............DAEKAFH.......TSL...................................P.............
Q0K4F5_CUPNH/34-323...PEE..AR.FQ.SGT.............I...................................D.............
W0BBF6_9GAMM/27-315..............KTVTDS........NQL...................................A.............
K9XSR0_STAC7/33-337..............QQNSNLKPQDLANPENL...................................D.............
B6JGM3_OLICO/32-326..............SAAEIFP.......RAL...................................P.............
D5SV98_PLAL2/38-331..............KGMS.VTGPTVIDCGAI...................................E.............
PDXA_SERP5/29-321..............PAQPQRA.......GTL...................................T.............
C7RNL8_ACCPU/39-326..............SPQA..........GVL...................................D.............
R6WFT1_9BACT/34-321..............DAVDGKVNLLTAFDEDV...................................K.............
PDXA_PSEA6/27-318...............TDIQPA.......GSL...................................Y.............
J7Q941_METSZ/35-329..............QARDVFS.......RAL...................................P.............
PDXA_METCA/29-318..............VVPPHEP.......GVL...................................H.............
R5FA16_9BACT/34-322..............NAEPGKLNLLPVFDEDV...................................K.............
PDXA_AZOSB/30-318..............AQAA..........GVL...................................E.............
D3HPI6_LEGLN/27-314..............EPLKSKP.......GCL...................................S.............
C6D3S5_PAESJ/31-322...VTE..AQ.YE.YGT.............V...................................D.............
C4ZNQ2_THASP/34-328..............PAP..E........GAV...................................E.............
Q1ART0_RUBXD/32-322...PEE..AR.FR.PGSVD.............................................................
A0KGT9_AERHH/28-320..............PARPQRA.......GTL...................................T.............
PDXA_PASMU/32-326ISHKSSHPKPF.....................................................................
Q5QVN8_IDILO/29-320..............ELPQHEP.......GHL...................................W.............
I2F8G1_9BACT/47-340........DQTEFSPGT.............L...................................S.............
D7DN38_METV0/32-322..............HTAHLGN.......GSI...................................T.............
K4IU70_PSYTT/35-320..............EAIEGKINVVNVWKENV...................................K.............
D9QLJ7_BRESC/29-321..............DAASVFA.......RGL...................................P.............
B0BZ85_ACAM1/36-343.............QKQTGLDVDQTLANPKNL...................................D.............
Q8KEU1_CHLTE/31-322...........AIAKIAAEPG........VL...................................H.............
A5G9E3_GEOUR/36-328...GVP..PEATT.PGV.............L...................................Y.............
F0RGS0_CELLC/35-323..............KAVDNKINVVNVWKEIP...................................K.............
Q2G9Z1_NOVAD/34-325..............EVADRFA.......DAL...................................P.............
Q3IWS4_RHOS4/37-320........GDGAP.EGS.............V...................................A.............
E4RPK4_HALHG/32-334...VDD..IK.GE.YGT.............I...................................D.............
Q82W16_NITEU/32-321...............VQPHRA.......GQL...................................S.............
D5QAY7_KOMHA/32-316..............AARAAFA.......DAI...................................P.............
R5CC16_9BACE/34-324..............DAAPDRLSIVNCNDDEV...................................K.............
R5P6P7_9BACT/34-321..............EAKEDKLNIITAFDEEV...................................K.............
A4FIE2_SACEN/34-325...VAD..AV.FA.PGR.............V...................................N.............
B9LZ80_GEODF/35-326...EMP..DRDPA.SGE.............L...................................Y.............
A3U5N8_CROAH/35-320..............KIIDGKVNVYNVWKENV...................................N.............
PDXA_CAMJE/28-357.............................NL...................................KLFNAKIVAFKDDK
R5GSB3_9BACT/34-324..............DIAEGRLNMVECYPEEV...................................K.............
Q479U5_DECAR/29-319..............AQAP..........GSL...................................D.............
R6AA64_9BACT/49-340..............DAVAGKLNIVNCSDDEI...................................N.............
PDXA_NEIMB/28-321..............GGAA..Y.......GEL...................................E.............
D1B2K3_SULD5/28-299.............................GL...................................D.............
K9PX21_9CYAN/31-332.................RLKTTEPLADPATL...................................D.............
B4EGN0_BURCJ/39-337....TIGAAQV.....................................................................
M1WYQ3_DESPC/31-331..............YERVTQPETLGDRPTGV...................................Y.............
E8V3H9_TERSS/35-313...............GVNFVA.......LGV...................................D.............
E7ABT4_HELFC/29-301............................DHA...................................Y.............
PDXA3_RHIME/42-334..LAHLDPADV.....................................................................
E6WY24_NITSE/28-307.............................GL...................................E.............
C6XUZ6_PEDHD/33-321..............TANPKKPNLINCWEEDV...................................K.............
B4SF48_PELPB/31-318...........APVRHGA............L...................................P.............
I5B2I7_9DELT/36-328...............GF.............L.................................................
Q65EJ5_BACLD/32-325...PDE..GG.FV.HGK.............I...................................D.............
D3QBQ2_STANL/35-328........VAPAG.PGT.............I...................................D.............
I6ZML4_MELRP/28-311..............EEQASDK.......YNI...................................H.............
Q5LKY3_RUEPO/32-322..MQTIDPSEI.....................................................................
Q2RKJ4_MOOTA/32-333...PGE..GR.YE.YGT.............I...................................D.............
R5EF26_9GAMM/29-323..............FVPQTK........GTL...................................C.............
W0E2J5_MARPU/29-320..............APAPNQP.......GTI...................................R.............
H1Y4I7_9SPHI/33-321..............QVNPKRANLINCWEEDV...................................K.............
E3GDT1_EUBLK/31-337...LKETLAH.LE.KDA.............L...................................P.............
E0WS58_9ENTR/33-325..............TNALSSK.......GTL...................................T.............
W8F8Y2_9BACT/31-322..............DIAPGKHNAVTCWDEDY...................................H.............
B3QV85_CHLT3/26-321...........AISTMDAAQK........VL...................................P.............
A8LS85_DINSH/31-321..LDTIAPEDV.....................................................................
A0Q399_CLONN/32-323........DGKYE.AGT.............L...................................D.............
R7EVF6_9BACT/42-333..............QARDGVVNLVNISDKEF...................................K.............
I3Z6X6_BELBD/36-323..............EVHHKKINLINVIDESP...................................E.............
PDXA_HYDS0/28-302...................DVKDKGIYLISL...................................S.............
W0EZ35_9BACT/35-325..............KINPKQVTIFNCWDEEV...................................N.............
D5CTH9_SIDLE/30-349..............PLEN..........GKL...................................S.............
R7LG84_9BACT/48-339..............EAVDGQLNFVNVSDDEI...................................K.............
D3E9G4_GEOS4/31-324...PAE..AT.YE.FGT.............V...................................D.............
E3FNJ1_STIAD/27-308................................................................................
X5D8G7_9BACT/35-325..............ELLPKKANIINCVDENI...................................R.............
G8PQZ0_PSEUV/36-329..............AACDCFD.......EAL...................................P.............
L0DE58_SINAD/36-336..............DARPTARLIPCLEATDE...................................D.............
G8QYY1_SPHPG/33-336...VSD..AK.FE.QGT.............I...................................D.............
W8KS11_HALHR/35-325..............PPQANAP.......GQL...................................H.............
G8TP28_NIAKG/36-322..............RVNYKQINIFNCWEEEV...................................G.............
PDXA_VIBCH/28-321..............PVQAQQA.......GTL...................................L.............
T2KID2_9FLAO/35-320..............QLVIGKVNVLNCWKENV...................................S.............
U5LJV8_9BACI/34-327...LEG..LD.YQ.LGT.............V...................................Y.............
PDXA_PERMH/27-312...................EAEKEGVYLINV...................................Y.............
PDXA_RHILO/36-329..............LAAQVFA.......RAL...................................P.............
Q89M19_BRADU/33-325..LRHLDPRDV.....................................................................
K9VZP3_9CYAN/50-362..............QRQNHQNSDLLIDPAKL...................................T.............
PDXA_FUSNN/31-321........EGKYE.KGI.............L...................................N.............
E0SNM5_IGNAA/34-327............................GKV...................................Y.............
G0AAS4_COLFT/40-342..............LRNNGLPNFPP...GQI...................................A.............
A6Q3Y7_NITSB/29-300.............................KV...................................Q.............
A7HYG3_PARL1/38-330..............EAAEVFP.......GAL...................................P.............
G4STZ3_META2/32-323..............ELVEQSA.......GSI...................................S.............
R4W4P1_9EURY/25-318...VAE..AS.FA.DDA.............V...................................S.............
E4TVA5_MARTH/35-325..............ELSDKKLNVLNLWEETV...................................N.............
R5IKT1_9CLOT/33-336...VSE..AK.YE.YGT.............I...................................D.............
R7CXE5_9BACE/34-324..............EASHGKLSVVNCANDEV...................................K.............
G8QPR5_DECSP/28-330..............PAPA..........GSL...................................E.............
PDXA_HERAR/30-332..............VRNSGLPAFPR...DQI...................................T.............
Q7VQK2_BLOFL/37-330..............TTSYKS........HSA...................................S.............
C7M3J3_CAPOD/34-323..............AAIDGKLNVLNCWKETP...................................T.............
R6TUF4_9FIRM/17-307QDPEQV..........................................................................
D1CHU7_THET1/34-324........EAVCE.YGT.............L...................................E.............
PDXA_CAMFF/30-301.............................KF...................................T.............
I4BXC4_ANAMD/32-320...TDQ.....CK.EGK.............L...................................N.............
E1R632_SPISS/37-339...VED..AR.FE.YGT.............I...................................D.............
C4ZHF2_AGARV/32-338...IKA..AK.FE.YGT.............I...................................D.............
B8I6T9_CLOCE/32-323........MPASD.KST.............I...................................N.............
F4CNN9_PSEUX/26-309..............VRLREHVPDVPPEAGVL...................................D.............
C5B7P2_EDWI9/30-321..............SPQAQQA.......ATL...................................T.............
PDXA_SYNFM/34-329..PAEL..PDDPG.SDR.............I...................................P.............
F2I3R8_PELSM/32-321................................................................................
K7VXY6_9NOST/36-337...............SKNIDNSLALANPVDL...................................S.............
R5D0H0_9BACT/34-324..............EAHNNKVNLLTTFDQEI...................................K.............
H6L3Q9_SAPGL/32-322..............QPEEGQINVVNCWSDNV...................................R.............
R6F1V4_9BACT/34-322..............DAMEGRLNLLAAIEDEV...................................K.............
Q2S3U3_SALRD/96-387..............EVPHGDVAVLDVAEDPEP..................................P.............
H2FZ12_OCESG/28-320..............EPVPQKA.......GTL...................................T.............
L0K3J5_9EURY/33-327...VAD..AT.FA.ADA.............I...................................P.............
G8R4P5_OWEHD/35-324..............QISDRKANLLNCWNDEV...................................N.............
I1YL39_METFJ/29-320..............PATPSRA.......GMI...................................K.............
PDXA_COLP3/27-319..............PAKSQKS.......GSL...................................T.............
Q215S3_RHOPB/38-329..............QAAATFA.......DAL...................................P.............
D3DGU5_HYDTT/29-313...................EVKAPGTYIADL...................................D.............
C6X2C9_FLAB3/36-324..............QAQSDKINMVNLTADNV...................................N.............
Q02C14_SOLUE/41-313................................................................................
G0G667_AMYMS/33-323........DARFT.TGV.............I...................................D.............
A9GKN1_SORC5/15-317..................................................................R.............
Q1QKW1_NITHX/32-325..............DVSGIFT.......EAL...................................P.............
H1XYD5_9BACT/33-325........KAPEK.LFQ.............N...................................D.............
D4GUQ8_HALVD/34-328...VAD..VR.SD.PST.............L...................................F.............
PDXA_BEII9/33-322...VEE..AG.CE.DGVLN.............................................................
F9Z465_ODOSD/33-319..............DANPKRCNIVNCVDDAI...................................K.............
A6VPP4_ACTSZ/32-327IHHKCSHPVPF.....................................................................
I0KFB6_9BACT/263-588..............QASHKMTNVITCFSENTPPPVPQPTVAEGDPPADGEAETPAPVVEKPAPLPVD.............
B5E8C6_GEOBB/32-324...LLP..PLDAS.PHT.............L...................................Y.............
Q4FMQ9_PELUB/32-317....................KDFSKLTNKKI...................................N.............
A5FM92_FLAJ1/36-324..............QIIPGKVNVYNLWKEGV...................................D.............
E3H6A7_ILYPC/32-321...IDN..IN.FS.KDV.............L...................................S.............
A6QAX9_SULNB/28-306.............................NL...................................P.............
A9BT55_DELAS/23-315...PAQ..VP.AT.VPPAT...........L...................................F.............
C3M9C3_SINFN/34-330..............NAAAVFA.......NAL...................................P.............
Q5LQN1_RUEPO/27-312..............RAVAASD.......SAL...................................P.............
E8UEJ0_TAYEM/35-326..............DVHEHCQ.......NEI...................................P.............
R5UVJ1_9BACT/33-321..............EANAKRCNVINCVDDAV...................................K.............
PDXA_ERYLH/36-326..............EANSAFL.......EAL...................................P.............
I0IDK7_PHYMF/40-342............................DEL...................................S.............
A8MJU3_ALKOO/32-323........DGRYE.VGI.............L...................................N.............
R6WM45_9PORP/34-325..............DAGANRVNIINCVDDET...................................K.............
Q3ARA5_CHLCH/34-329...........DIANLPTTFD.......GVL...................................P.............
G8X7V7_FLACA/36-324..............QVVVGKVNVLNVWREGV...................................N.............
D3UFK7_HELM1/31-300................................................................................
D9SID5_GALCS/30-319..............WEGACA........GRL...................................D.............
K9WP18_9CYAN/130-441...............RQTLENQEALVDPEHL...................................S.............
PDXA_PSEHT/27-319..............AATPAPA.......GSL...................................Y.............
A1AWJ1_RUTMC/26-312..............ASSA..........YEL...................................P.............
PDXA_STRMK/28-315................EARVP.......GDL...................................R.............
Q3V8D3_GEOSL/34-325...SVP..FEEPA.DGV.............I...................................T.............
B6IN68_RHOCS/40-329..............EAPALFG.......SAL...................................P.............
D4M806_9BACT/32-348...VSE..AA.FT.PGV.............I...................................D.............
I4A0Q6_ORNRL/35-323..............KIVAGKVNILDIEAPDI...................................L.............
V4JCI5_9DELT/37-338...IET..AP.YR.HGA.............I...................................D.............
I1XKV7_METNJ/29-321..............DPKPGEA.......GRI...................................V.............
U6B4X5_9RHIZ/39-331..............NAVAVFD.......KYF...................................P.............
G8UPW0_TANFA/30-320..............DAAEGKLNIINCMPAEL...................................T.............
B0TBI8_HELMI/32-323........MGKFE.PGV.............I...................................D.............
F4HD17_GALAU/31-322...LDN..LN.TK.YGT.............I...................................D.............
J9QT86_RIEAN/36-321..............EASAGKINIVNLWKDNV...................................N.............
PDXA1_PSEAE/27-320.............WPERPAKA.......GQL...................................Y.............
F4KTC5_HALH1/42-332..............RVFPDRVNVVNCWQENV...................................N.............
V9VUT8_9RHOB/30-316..............AAATACA.......DSF...................................P.............
A1WVT6_HALHL/30-323..............PRQAHRV.......GRL...................................P.............
A8FHA9_BACP2/32-324...PEE..AEQVK.AGA.............V...................................P.............
I4AG95_FLELS/65-362..............SIHQQKTNIVNCSSAKI...................................E.............
F6GFQ1_LACS5/35-322..............QVSNKKVNVFNCWKEDV...................................H.............
D9S1Z9_THEOJ/31-320...PED.....YL.DGF.............V...................................N.............
U3U9G2_9GAMM/29-322..............EPKPQKS.......GSL...................................T.............
C5ZY06_9HELI/27-295.............................DI............