Sequence alignment for CL0270

PF02504

PLSX_SYNY3/6-328---------------------------------------------------------------------AKIALDAMG--
PLSX_HELPY/1-317---------------------------------------------------------------------MKIVIDLMG--
PLSX_CHLTR/3-311---------------------------------------------------------------------VRLGVDMMG--
PLSX_ECOLI/4-331---------------------------------------------------------------------LTLALDVMG--
PLSX_BACSU/1-321---------------------------------------------------------------------MRIAVDAMG--
PLSX_AQUAE/2-322---------------------------------------------------------------------LRIAVDCMG--
D5AUL6_RHOCB/12-337---------------------------------------------------------------------.VLSIDAMG--
I3VW60_THESW/1-316---------------------------------------------------------------------MKIAVDAMG--
W8T1H7_EUBAC/28-365---------------------------------------------------------------------VKVGITTLG--

PF01515

PTAS_BACSU/3-319-------------------------------------------------------------------DLFSTVQEKVA..
EUTD_ECOLI/1-320-------------------------------------------------------------------MIIERCRELAL..
PTAS_CLOTH/2-324-------------------------------------------------------------------SFLEQIIERAK..
MAO1_RHIME/441-763-------------------------------------------------------------------FIMKPVFAAAK..
PTAS_CORGL/5-322-------------------------------------------------------------------LFENWLLKRAR..
PTA_SYNY3/374-693-------------------------------------------------------------------LFLYNLVQAAT..
PTB_CLOB8/4-295-------------------------------------------------------------------NFDELLSRLKE..
PTAS_BORBU/10-350-------------------------------------------------------------------CLKDYVFKKARIF
PTAS_MYCPN/2-315-------------------------------------------------------------------SVIDLLKQRVQS.
MAO2_HAEIN/429-750-------------------------------------------------------------------LFMRPIFSQAK..
PTAS_CLOAB/2-326-------------------------------------------------------------------DLIESIWECAK..
MAO2_RHIME/438-756-------------------------------------------------------------------STLQRIVERVR..
A1B2J3_PARDP/4-314-------------------------------------------------------------------..LDRIHEAAK..
I3VW55_THESW/3-324-------------------------------------------------------------------.IIQNIIEKAK..
PTB_CLOAB/4-295-------------------------------------------------------------------SFNEIIMKVKS..
PTA_MYCTU/365-682-------------------------------------------------------------------MFTYRLLQQAR..
Q32DP2_SHIDS/392-707-------------------------------------------------------------------.FRYQLTELAR..
Q6MTX6_MYCMS/5-317-------------------------------------------------------------------...EEIKNQLVL.
Q8TK18_METAC/4-325-------------------------------------------------------------------.FLEKISERAK..

PF04166

F9D1K6_PREDD/35-324-------------------------------------------------------------------ELCTPIVY.GS--
D7BZZ5_STRBB/44-335-------------------------------------------------------------------RRCRPVAI.GD--
K9XHU5_9CHRO/45-341-------------------------------------------------------------------...DVTVV.GS--
K9Z747_CYAAP/38-335-------------------------------------------------------------------.RANITII.GS--
F3ZVB4_MAHA5/32-323-------------------------------------------------------------------EICRPVLI.CS--
D4G8G2_RIEPU/43-336-------------------------------------------------------------------KWPVKLVTFSD--
E3I1T8_RHOVT/40-335-------------------------------------------------------------------...APFFVIAD--
F0R264_BACSH/34-324-------------------------------------------------------------------ELCTPIVY.GS--
Q1LSS1_BAUCH/32-325-------------------------------------------------------------------AWPVEIVVCTD--
D5WYG1_THIK1/23-322-------------------------------------------------------------------...GCVVY.GD--
Q10ZN5_TRIEI/41-337-------------------------------------------------------------------ENCDLTIV.GS--
Q7MTA8_PORGI/34-326-------------------------------------------------------------------DLFTPVIY.GS--
G2TI06_BACCO/34-325-------------------------------------------------------------------ERCQPFVV.GD--
Q3V872_LEGPH/26-315-------------------------------------------------------------------..DLPVVILGD--
B1ZNR3_OPITP/35-329-------------------------------------------------------------------QVGVPVVF.GD--
K9SRP6_9SYNE/31-333-------------------------------------------------------------------DLASFTVI.GD--
Q3B5B9_PELLD/30-323-------------------------------------------------------------------...HRFAVAGS--
R6EJC4_9BACE/37-325-------------------------------------------------------------------...TPVIY.GS--
M4Q2H5_LIBAS/32-328-------------------------------------------------------------------TAIPPFIYIGD--
PDXA1_BRADU/37-333-------------------------------------------------------------------..LRLLII.GS--
PDXA_XANP2/36-328-------------------------------------------------------------------....AFLVAGD--
D3EPC7_ATETH/40-355-------------------------------------------------------------------QSCELTVV.GT--
X2H9I6_9NEIS/29-319-------------------------------------------------------------------DWPQRIVVLGD--
L0ETE9_LIBCB/39-331-------------------------------------------------------------------....PFIYIGD--
B4F2I1_PROMH/31-324-------------------------------------------------------------------QWALPWVVCAD--
V5UBQ7_9BURK/58-340-------------------------------------------------------------------..RCRFAVIGD--
A6VU54_MARMS/37-327-------------------------------------------------------------------..PARLIILAD--
C4XST4_DESMR/41-331-------------------------------------------------------------------....PVVLVGP--
M7SPY7_EUTLA/39-323-------------------------------------------------------------------.RADIVLL.AD--
Q0K4Q7_CUPNH/34-327-------------------------------------------------------------------.QAEILLI.AD--
D4J4Q1_9FIRM/33-335-------------------------------------------------------------------EKCSPIII.GD--
A0JTQ9_ARTS2/490-781-------------------------------------------------------------------KECRPVVI.GD--
W0DDM8_9AQUI/28-311-------------------------------------------------------------------PQYAYMIY.GE--
G4RBH1_PELHB/33-315-------------------------------------------------------------------...RPVIV.GD--
D2R6V9_PIRSD/43-337-------------------------------------------------------------------RECIPIVI.GD--
G7Z7B0_AZOL4/38-329-------------------------------------------------------------------..VPPFVVLDD--
I7HG37_9HELI/28-302-------------------------------------------------------------------QICEPVYV.TH--
R6SBC2_9BACE/34-324-------------------------------------------------------------------ELCTPVIY.GS--
D9RAU4_CLOSW/32-323-------------------------------------------------------------------EAARCVAV.GD--
F0NYL8_WEEVC/36-325-------------------------------------------------------------------DFFTPIIF.AS--
F2IC16_FLUTR/45-335-------------------------------------------------------------------LDCTPIIY.AS--
M1PE68_DESSD/26-315-------------------------------------------------------------------...PCIVV.GD--
H1Z8Q7_MYROD/36-324-------------------------------------------------------------------ELCTPVIF.GS--
PDXA_BACHD/33-324-------------------------------------------------------------------DVANPVVI.GH--
Q3SGF8_THIDA/30-317-------------------------------------------------------------------..PCRMTVLGD--
R5KK03_9BACT/34-324-------------------------------------------------------------------DMCIPIIY.GS--
B8IWD3_METNO/40-332-------------------------------------------------------------------SAAQIVTI.GD--
K9TXI9_9CYAN/42-377-------------------------------------------------------------------AACQITVV.GN--
PDXA_SYNJB/34-331-------------------------------------------------------------------SCAHITVV.GD--
Q1QSM0_CHRSD/42-333-------------------------------------------------------------------ESGHAVLV.AD--
K9SMQ8_9CYAN/47-343-------------------------------------------------------------------...KVTII.GD--
PDXA_PROAC/35-325-------------------------------------------------------------------..FIPIVY.GD--
L0DWB4_THIND/35-324-------------------------------------------------------------------...AQRVAIGN--
H8GMF2_METAL/35-325-------------------------------------------------------------------.LPCEAVVIAS--
PDXA_GEOMG/34-325-------------------------------------------------------------------QCCRFLVV.GD--
R4I106_9ENTR/29-321-------------------------------------------------------------------NWPVELVVCAD--
E1SLK8_FERBD/27-319-------------------------------------------------------------------DWSVELVVCAD--
A1AU02_PELPD/36-329-------------------------------------------------------------------AHCVPLVI.GD--
PDXA_RALSO/37-328-------------------------------------------------------------------...VRWHVIGD--
PDXA_THISH/31-321-------------------------------------------------------------------..AAQRVVLSD--
Q3V808_RHISN/34-320-------------------------------------------------------------------...RSVVV.GD--
D3VCQ4_XENNA/32-324-------------------------------------------------------------------EWPIQLVVCAD--
PDXA_AGRT5/37-329-------------------------------------------------------------------....PFIFIGD--
G7URF7_PSEUP/27-304-------------------------------------------------------------------QTCNPVLI.GS--
G0IUL6_CYCMS/36-326-------------------------------------------------------------------KMITPVIY.GH--
R7J8E6_9PORP/34-325-------------------------------------------------------------------ELCVPIIY.GS--
J3Z564_9ENTR/29-321-------------------------------------------------------------------TWPVELVICAD--
I1F0R6_AMPQE/348-642-------------------------------------------------------------------SKGIPFVAFAD--
K7AU99_9ALTE/28-319-------------------------------------------------------------------EWPVQLVAFAD--
PDXA_SYNY3/35-336-------------------------------------------------------------------SICQLTAI.GS--
E1VLH2_9GAMM/30-317-------------------------------------------------------------------...IALVAIAN--
R4KFZ8_CLOPA/32-323-------------------------------------------------------------------YVCNPIVV.GD--
R5Y392_9BACE/33-324-------------------------------------------------------------------ELCTPVVY.GS--
W0PFJ8_9BURK/36-327-------------------------------------------------------------------DMARFVVI.GD--
R6YA75_9BACT/37-327-------------------------------------------------------------------.SFTPVIY.GS--
R5TI46_9CLOT/31-334-------------------------------------------------------------------ETCRPVVI.GD--
A5FXM2_ACICJ/38-335-------------------------------------------------------------------...ALVVT.GS--
PDXA_RHOBA/37-349-------------------------------------------------------------------SQGYPLLF.GD--
R6W392_9BACT/35-320-------------------------------------------------------------------ELCTPIIY.GS--
K9QGD1_9NOSO/46-349-------------------------------------------------------------------QNCDVTVV.GN--
PDXA_XYLFA/29-316-------------------------------------------------------------------RQDCRLVAFAD--
F2LWP1_HIPMA/33-327-------------------------------------------------------------------PKYRFVIF.GS--
PDXA_CAUCR/30-324-------------------------------------------------------------------QDGPTFVVIGD--
F5YGA4_TREAZ/37-343-------------------------------------------------------------------DKCIPVLI.GD--
K9RH38_9CYAN/45-348-------------------------------------------------------------------QGCDLTLV.GN--
R5P2E5_9PORP/33-319-------------------------------------------------------------------EICTPILY.GS--
D2QDF7_SPILD/236-527-------------------------------------------------------------------KICTPVIY.GS--
C4LDY8_TOLAT/35-322-------------------------------------------------------------------DECKPFLI.GS--
K9T599_9CYAN/41-347-------------------------------------------------------------------ETCRVTVV.GS--
PDXA_WIGBR/31-321-------------------------------------------------------------------..RSELVICCD--
F4LQ79_TREBD/32-322-------------------------------------------------------------------KDINCLII.GD--
E3HED3_ACHXA/32-321-------------------------------------------------------------------..APCVVY.GD--
E6WQK3_PSEUU/29-316-------------------------------------------------------------------RTDCSLVALAD--
I3Y835_THIV6/27-318-------------------------------------------------------------------SQAAQLVAVAD--
PDXA2_BRADU/38-337-------------------------------------------------------------------....AFYLLGD--
Q12FB7_POLSJ/51-359-------------------------------------------------------------------.MAGCVVV.GD--
G4L110_OSCVS/33-352-------------------------------------------------------------------DHCRPLVV.GD--
K9UJS8_9CHRO/31-336-------------------------------------------------------------------AECDLTLI.GN--
H8KWR5_SOLCM/37-327-------------------------------------------------------------------EHCTPIVY.GS--
F2K4J5_MARM1/33-323-------------------------------------------------------------------..PARLIVLAD--
S6BVY4_9GAMM/29-317-------------------------------------------------------------------.WDRPLVAVAD--
A7I3Y6_CAMHC/27-298-------------------------------------------------------------------KFCEPVYF.IN--
F0SPW7_PLABD/43-344-------------------------------------------------------------------EPCRLIIF.GD--
D5MIQ8_9BACT/37-328-------------------------------------------------------------------AACRPLIV.GE--
F2NDA2_DESAR/37-329-------------------------------------------------------------------GLCRPLVL.GD--
A4CID9_ROBBH/38-321-------------------------------------------------------------------..CTPVFF.AS--
B3PKV3_CELJU/31-323-------------------------------------------------------------------VQPHQLVAIAD--
Q2YBP4_NITMU/30-318-------------------------------------------------------------------..PFKLIVIAD--
Q145L2_BURXL/43-326-------------------------------------------------------------------...AQFIVLGD--
C7PP38_CHIPD/38-328-------------------------------------------------------------------EFCTPVIF.AS--
D5BRI0_PUNMI/31-320-------------------------------------------------------------------....DFVILDN--
K0C9N5_ALCDB/29-316-------------------------------------------------------------------..DTALVVLAD--
F6ACQ2_PSEF1/33-324-------------------------------------------------------------------AMCRPLVI.GD--
W8WYV9_CASDE/45-334-------------------------------------------------------------------...PAVVY.GD--
A1BHC0_CHLPD/30-323-------------------------------------------------------------------...HTFLVAGS--
L0FWR6_ECHVK/32-334-------------------------------------------------------------------AKCKPLVV.GD--
B8CSX4_SHEPW/8-300-------------------------------------------------------------------AWPAELVVCAD--
F7YI45_VIBA7/28-321-------------------------------------------------------------------DWAHQLVVCAD--
Q2W0V4_MAGSA/33-323-------------------------------------------------------------------....PFMLIDD--
Q11UL9_CYTH3/38-329-------------------------------------------------------------------KVCIPVIY.AN--
D7A738_STAND/37-327-------------------------------------------------------------------...PPFLVTGD--
W0ERT9_9PORP/33-324-------------------------------------------------------------------EICTPVVY.GS--
R6ZD40_9FIRM/33-335-------------------------------------------------------------------RKCMPVVL.GD--
Q0VMV3_ALCBS/33-325-------------------------------------------------------------------..DAPMVIIGD--
M1LX07_9CLOT/31-321-------------------------------------------------------------------DICRPLVI.GD--
Q6LV40_PHOPR/30-323-------------------------------------------------------------------TWSHELVICAN--
I4WVN0_9GAMM/31-318-------------------------------------------------------------------...ATLVAITD--
R5AZH6_9BACE/43-334-------------------------------------------------------------------ELCTPVLY.GS--
A8ESJ0_ARCB4/32-303-------------------------------------------------------------------KICQPIYC.IN--
D5C4K3_NITHN/29-320-------------------------------------------------------------------.REYELVVVAD--
D4LRH6_9FIRM/31-357-------------------------------------------------------------------EVCRPLIV.GD--
PDXA_DESAH/34-326-------------------------------------------------------------------TVCRPLVL.GD--
Q7VHV2_HELHP/28-304-------------------------------------------------------------------QWCEPLYC.VH--
C5BPB7_TERTT/27-316-------------------------------------------------------------------..GFELVCIAS--
K0C3B1_CYCSP/29-319-------------------------------------------------------------------.WPCELIFVAD--
PDXA_AQUAE/29-313-------------------------------------------------------------------EKFTYVIY.GE--
Q3V7R0_BARHE/29-325-------------------------------------------------------------------RQIPPFVLIAD--
F0S0E1_DESTD/33-310-------------------------------------------------------------------....PIFIYGS--
X4ZK45_9BORD/30-329-------------------------------------------------------------------QLANVVLI.GD--
Q31F25_THICR/26-318-------------------------------------------------------------------DWDYEWVVIAN--
D5A6D6_ARTPN/31-330-------------------------------------------------------------------DKCEITVV.GS--
Q1LRA2_RALME/46-333-------------------------------------------------------------------....RFHVIGD--
A4FFA9_SACEN/36-326-------------------------------------------------------------------ETARPLAV.GD--
PDXA_CHRVO/29-318-------------------------------------------------------------------APEARCVAIAD--
R6FKU7_9BACE/34-324-------------------------------------------------------------------ELCTPIIY.GS--
K9V9D2_9CYAN/37-340-------------------------------------------------------------------ENYDVTLV.GS--
R6XPS3_9BACT/34-324-------------------------------------------------------------------ELCTPIIY.GS--
K9YBG1_HALP7/36-336-------------------------------------------------------------------EGCEVTVV.GT--
A1STS2_PSYIN/28-319-------------------------------------------------------------------.WPVELIICTD--
A1WLE5_VEREI/41-335-------------------------------------------------------------------HLANVVLV.GD--
R6F0Q9_9BACT/34-321-------------------------------------------------------------------ELCTPIIY.GS--
PDXA_RHOPA/35-328-------------------------------------------------------------------..LPPFYLLGD--
PDXA_DESOH/33-325-------------------------------------------------------------------EKCRPLVI.GD--
G2PNX1_MURRD/35-323-------------------------------------------------------------------DFCTPVIF.AS--
G7UQC7_PSEUP/28-315-------------------------------------------------------------------RQDCRLVAFAD--
PDXA_SACD2/29-320-------------------------------------------------------------------ARDYPLVALCD--
E6VTD1_DESAO/30-339-------------------------------------------------------------------.GDERVLLLGP--
Q24RU8_DESHY/36-320-------------------------------------------------------------------KDAHPIIV.GD--
R5L6M7_9SPIR/33-320-------------------------------------------------------------------ENAIPVVY.SH--
K9TNE7_9CYAN/53-349-------------------------------------------------------------------QNCQITLV.GS--
D3IAQ7_9BACT/34-319-------------------------------------------------------------------ELCTPIIY.GS--
D5BDL9_ZUNPS/47-332-------------------------------------------------------------------DFCTPVIF.AS--
Q2IHP1_ANADE/33-321-------------------------------------------------------------------GELVPLVF.GD--
R6CJV8_9BACT/34-324-------------------------------------------------------------------EYCTPIIY.GS--
R6WB32_9FIRM/32-323-------------------------------------------------------------------EAADCVIV.GD--
E4RQ40_LEAB4/33-324-------------------------------------------------------------------KTCIPIIY.GS--
W6RZF2_9RHIZ/33-317-------------------------------------------------------------------ERRDFVIV.GN--
Q11HH0_CHESB/29-325-------------------------------------------------------------------KELAPFYVLGD--
E6SJ78_THEM7/43-331-------------------------------------------------------------------RVLRPLVI.GD--
F9ZZH4_METMM/31-322-------------------------------------------------------------------PQPCELVAIAD--
L7W827_NONDD/35-323-------------------------------------------------------------------ELFTPVVF.AS--
F3ZNL8_9BACE/34-324-------------------------------------------------------------------DMCTPIIY.GS--
R7HMN9_9BACT/35-323-------------------------------------------------------------------DLCTPIVY.GS--
W0JF83_DESAE/33-320-------------------------------------------------------------------.DFNIVVF.GA--
PDXA_RUEST/31-317-------------------------------------------------------------------RADCPFVWIGD--
C7R7U0_KANKD/33-321-------------------------------------------------------------------....QLIACAS--
Q0AC81_ALKEH/31-319-------------------------------------------------------------------...ASLVVLGD--
PDXA_DESAA/33-325-------------------------------------------------------------------KICRPLVI.GD--
A4YT91_BRASO/34-325-------------------------------------------------------------------....AFYVLGD--
K4KQ47_SIMAS/25-316-------------------------------------------------------------------ARQAEWVVVAS--
F9YQW3_CAPCC/34-322-------------------------------------------------------------------ELCTPIVF.GS--
D5V304_ARCNC/38-309-------------------------------------------------------------------KYCSPVYC.IN--
D4MSX7_9FIRM/33-348-------------------------------------------------------------------DRCRPIVV.GD--
M5DPJ7_9GAMM/27-319-------------------------------------------------------------------PQEHELVVIAN--
A6TJU5_ALKMQ/33-334-------------------------------------------------------------------EVCRPIVV.GS--
E0URZ3_SULAO/30-300-------------------------------------------------------------------KICHPIYC.IN--
N0BC98_9RHIZ/43-337-------------------------------------------------------------------....PFAVYAD--
PDXA_XANCP/28-315-------------------------------------------------------------------RSDAHLIAYAD--
F2NA55_CORGP/35-342-------------------------------------------------------------------RRMRPVVV.GD--
B4RBS3_PHEZH/33-326-------------------------------------------------------------------...QAFVVVGD--
K0NNW0_DESTT/36-328-------------------------------------------------------------------AVCKPLIL.GD--
M1FJA7_9ALTE/30-319-------------------------------------------------------------------.RQVGIVVVAS--
K4RKJ5_HELHE/29-301-------------------------------------------------------------------QICQPLYC.VH--
C0ZNI3_RHOE4/384-675-------------------------------------------------------------------KRCRPVVV.GD--
Q65VM2_MANSM/32-323-------------------------------------------------------------------NVCKPFVI.GS--
A6H263_FLAPJ/36-324-------------------------------------------------------------------ELCTPIIF.AN--
B5YL57_THEYD/32-311-------------------------------------------------------------------KICNPIVI.GD--
PDXA_PROA2/35-326-------------------------------------------------------------------...EKPIVIGS--
B1WU75_CYAA5/40-358-------------------------------------------------------------------QTCDLTVI.GT--
I0IQ54_LEPFC/42-330-------------------------------------------------------------------R....IVI.GD--
B7K1J6_CYAP8/40-344-------------------------------------------------------------------ENCRLTVI.GT--
K9VBC1_9CYAN/53-351-------------------------------------------------------------------...RITVI.GS--
C6VZ75_DYAFD/37-328-------------------------------------------------------------------KLCTPIIY.GS--
A3DDY3_CLOTH/32-324-------------------------------------------------------------------RFLTPVVI.GS--
B0UIV0_METS4/30-326-------------------------------------------------------------------AGLAPFVLIGD--
K8GJQ6_9CYAN/32-348-------------------------------------------------------------------QACDITLV.GS--
F6ILZ0_9SPHN/44-324-------------------------------------------------------------------EVSIPVLV.GS--
A2TY27_9FLAO/35-323-------------------------------------------------------------------DFCTPVLF.GA--
PDXA_OCEIH/33-325-------------------------------------------------------------------EQAHPIVI.GD--
D2UFS9_XANAP/28-315-------------------------------------------------------------------RHDCQLLAFAD--
E6X8R2_CELAD/35-320-------------------------------------------------------------------DFCTPVIF.AS--
PDXA_SYMTH/33-323-------------------------------------------------------------------ALCRPLLI.GD--
B5Y706_COPPD/31-322-------------------------------------------------------------------DTCKPLVI.GH--
F8EQB4_RUNSL/37-328-------------------------------------------------------------------RICVPVIY.GS--
I3YUG2_AEQSU/35-321-------------------------------------------------------------------EFCTPVVF.AS--
B8ET21_METSB/41-335-------------------------------------------------------------------...PAFVIAAE--
F8GL31_NITSI/33-321-------------------------------------------------------------------..SCNLVVIAD--
PDXA_GEOLS/34-329-------------------------------------------------------------------SACKPLVL.GD--
E4PQY6_MARAH/32-319-------------------------------------------------------------------...AGVVVVAS--
Q5WKA6_BACSK/32-321-------------------------------------------------------------------DLCTPVVI.GN--
C1D5J7_LARHH/29-317-------------------------------------------------------------------..QTRVVAIGD--
F4B1R1_KROS4/36-321-------------------------------------------------------------------.FCTPIIF.AS--
D6Z2T8_DESAT/51-341-------------------------------------------------------------------..AAAVVL.GD--
C9LXC2_SELS3/37-327-------------------------------------------------------------------DVARVIVV.GD--
G4QFQ7_GLANF/29-320-------------------------------------------------------------------VWDAQLVVYAD--
PDXA2_PSEAE/35-329-------------------------------------------------------------------EKAHIVLI.AD--
Q0RWE6_RHOSR/36-321-------------------------------------------------------------------..FNPVLV.GD--
PDXA_CYAP7/30-337-------------------------------------------------------------------ENYNITVV.GS--
M4ZUB5_9FLAO/36-325-------------------------------------------------------------------DFFTPILF.GS--
R7G4X4_9FIRM/35-326-------------------------------------------------------------------DCCRPFVI.GS--
D3RQF4_ALLVD/35-326-------------------------------------------------------------------HSAAELVAIAD--
D8JA34_HALJB/30-324-------------------------------------------------------------------AAADVLVI.GD--
D3SLG0_THEAH/28-312-------------------------------------------------------------------KETAYVVY.GE--
F0SBZ7_PEDSD/33-323-------------------------------------------------------------------KYCTPIVY.GH--
D3SBX0_THISK/44-331-------------------------------------------------------------------....QRVAIGD--
A8IH54_AZOC5/35-332-------------------------------------------------------------------.HLRLLVI.GS--
F8KS88_HELBC/29-303-------------------------------------------------------------------QICTPLYC.VH--
U5RZ60_9CLOT/33-326-------------------------------------------------------------------DICAPVVI.GD--
B0SWM5_CAUSK/34-324-------------------------------------------------------------------....PFMVVGD--
PDXA_SULSY/29-314-------------------------------------------------------------------RNISYVIY.GS--
V4LB68_9GAMM/33-335-------------------------------------------------------------------AHAAELIAISD--
B3ENY2_CHLPB/30-323-------------------------------------------------------------------...SRPLVVGS--
R5Q2C0_9BACT/34-312-------------------------------------------------------------------DLCIPIIY.GS--
G2Z4E3_FLABF/35-323-------------------------------------------------------------------EMCTPVIF.AN--
C6XKP9_HIRBI/31-329-------------------------------------------------------------------TTQRPFFVIAS--
Q0K4F5_CUPNH/34-323-------------------------------------------------------------------AQCRPLVI.GD--
W0BBF6_9GAMM/27-315-------------------------------------------------------------------...LPVVILGD--
K9XSR0_STAC7/33-337-------------------------------------------------------------------ENCYITII.GN--
B6JGM3_OLICO/32-326-------------------------------------------------------------------.NLPPFYLIGD--
D5SV98_PLAL2/38-331-------------------------------------------------------------------EDSLPIIW.GD--
PDXA_SERP5/29-321-------------------------------------------------------------------DWPVELVVCAD--
C7RNL8_ACCPU/39-326-------------------------------------------------------------------...ARLVVLAD--
R6WFT1_9BACT/34-321-------------------------------------------------------------------ELCTPIIY.GS--
PDXA_PSEA6/27-318-------------------------------------------------------------------QWQAMLVVFAN--
J7Q941_METSZ/35-329-------------------------------------------------------------------...PPFFLLGH--
PDXA_METCA/29-318-------------------------------------------------------------------..PCGITVLGD--
R5FA16_9BACT/34-322-------------------------------------------------------------------ELCTPIIY.GS--
PDXA_AZOSB/30-318-------------------------------------------------------------------.WPARLVVLGD--
D3HPI6_LEGLN/27-314-------------------------------------------------------------------...FPLVILGD--
C6D3S5_PAESJ/31-322-------------------------------------------------------------------EDSNPFVI.GD--
C4ZNQ2_THASP/34-328-------------------------------------------------------------------AWPLRPVVLAD--
Q1ART0_RUBXD/32-322-------------------------------------------------------------------EENRVVVV.GD--
A0KGT9_AERHH/28-320-------------------------------------------------------------------DWPHQLVVIAD--
PDXA_PASMU/32-326-------------------------------------------------------------------EKANIVLV.AD--
Q5QVN8_IDILO/29-320-------------------------------------------------------------------.WSAAVVVCAD--
I2F8G1_9THEM/47-340-------------------------------------------------------------------EICRPIVI.GE--
D7DN38_METV0/32-322-------------------------------------------------------------------..NAEVVIIAD--
K4IU70_PSYTT/35-320-------------------------------------------------------------------ELFTPIIF.AN--
F2KU47_PREDF/35-321-------------------------------------------------------------------ELCTPIVY.GS--
D9QLJ7_BRESC/29-321-------------------------------------------------------------------SAESPFAVIGD--
B0BZ85_ACAM1/36-343-------------------------------------------------------------------DVAHVCVI.GE--
Q8KEU1_CHLTE/31-322-------------------------------------------------------------------....TYMVAGS--
A5G9E3_GEOUR/36-328-------------------------------------------------------------------AVCRPLVL.GD--
F0RGS0_CELLC/35-323-------------------------------------------------------------------DFCTPVIF.AS--
Q2G9Z1_NOVAD/34-325-------------------------------------------------------------------..LLPFFVVGS--
Q3IWS4_RHOS4/37-320-------------------------------------------------------------------...AYAVI.GD--
E4RPK4_HALHG/32-334-------------------------------------------------------------------EKANPVVV.GS--
Q82W16_NITEU/32-321-------------------------------------------------------------------.LPCRLTVIAD--
D5QAY7_KOMHA/32-316-------------------------------------------------------------------...PAFVVIGD--
R5CC16_9BACE/34-324-------------------------------------------------------------------ELCTPIVY.GS--
R5P6P7_9BACT/34-321-------------------------------------------------------------------ELCTPIVY.GS--
A4FIE2_SACEN/34-325-------------------------------------------------------------------ARCRPVVV.GD--
B9LZ80_GEODF/35-326-------------------------------------------------------------------ASCRPVII.GD--
A3U5N8_CROAH/35-320-------------------------------------------------------------------EFCTPVIF.AN--
PDXA_CAMJE/28-357-------------------------------------------------------------------KICTPFYF.IH--
R5GSB3_9BACT/34-324-------------------------------------------------------------------DVCTPVIY.GS--
Q479U5_DECAR/29-319-------------------------------------------------------------------..AAHPVVLGD--
R6AA64_9BACT/49-340-------------------------------------------------------------------ELCTPIIF.GH--
PDXA_NEIMB/28-321-------------------------------------------------------------------RLPCRCAVLGD--
D1B2K3_SULD5/28-299-------------------------------------------------------------------KLCQPIYC.IN--
K9PX21_9CYAN/31-332-------------------------------------------------------------------QLCSLTII.GN--
F2GA18_ALTMD/29-320-------------------------------------------------------------------AWQAQLVVFAD--
B4EGN0_BURCJ/39-337-------------------------------------------------------------------ARANLVLI.GD--
M1WYQ3_DESPC/31-331-------------------------------------------------------------------PENERILLIGP--
E8V3H9_TERSS/35-313-------------------------------------------------------------------ASANWIVL.GD--
E7ABT4_HELFC/29-301-------------------------------------------------------------------QTCQPIYC.VH--
PDXA3_RHIME/42-334-------------------------------------------------------------------DAAHIIAI.GD--
E6WY24_NITSE/28-307-------------------------------------------------------------------KLAEPLYL.ID--
C6XUZ6_PEDHD/33-321-------------------------------------------------------------------DYCTPIVY.GH--
B4SF48_PELPB/31-318-------------------------------------------------------------------....SFLVAGS--
I5B2I7_9DELT/36-328-------------------------------------------------------------------NLCTPVVL.GD--
Q65EJ5_BACLD/32-325-------------------------------------------------------------------DMCRPLVI.GD--
D3QBQ2_STANL/35-328-------------------------------------------------------------------...HGIAV.GD--
I6ZML4_MELRP/28-311-------------------------------------------------------------------SKKRKFFIYSP--
Q5LKY3_RUEPO/32-322-------------------------------------------------------------------EAANVLLV.GD--
Q2RKJ4_MOOTA/32-333-------------------------------------------------------------------NLCRPLAI.AD--
R5EF26_9GAMM/29-323-------------------------------------------------------------------.KDTQLVIIAS--
W0E2J5_MARPU/29-320-------------------------------------------------------------------PQSAELVAIAD--
H1Y4I7_9SPHI/33-321-------------------------------------------------------------------DYCTPIVY.GH--
E3GDT1_EUBLK/31-337-------------------------------------------------------------------EVCSPVAV.GD--
E0WS58_9ENTR/33-325-------------------------------------------------------------------DWPIELVVCAD--
W8F8Y2_9BACT/31-322-------------------------------------------------------------------KFCTPVVY.GT--
B3QV85_CHLT3/26-321-------------------------------------------------------------------ERGEQFVVVGS--
A8LS85_DINSH/31-321-------------------------------------------------------------------EAADILLV.GD--
A0Q399_CLONN/32-323-------------------------------------------------------------------EKCRPVLI.GD--
K7YNJ0_9PROT/35-327-------------------------------------------------------------------.DTPAFFLIDD--
R7EVF6_9BACT/42-333-------------------------------------------------------------------EMCTPVIF.GS--
I3Z6X6_BELBD/36-323-------------------------------------------------------------------KLITPVIY.AH--
PDXA_HYDS0/28-302-------------------------------------------------------------------DENAYVIY.GE--
W0EZ35_9SPHI/35-325-------------------------------------------------------------------DFCTPVIF.AS--
D5CTH9_SIDLE/30-349-------------------------------------------------------------------...QPLVVIAD--
R7LG84_9BACT/48-339-------------------------------------------------------------------ELFTPIVY.GH--
D3E9G4_GEOS4/31-324-------------------------------------------------------------------DNCNPLVI.GD--
E3FNJ1_STIAD/27-308-------------------------------------------------------------------QALVPVVF.GD--
X5D8G7_9BACT/35-325-------------------------------------------------------------------EMCTPVVY.GS--
G8PQZ0_PSEUV/36-329-------------------------------------------------------------------...QPFYVLCD--
L0DE58_SINAD/36-336-------------------------------------------------------------------ALARPFVI.GS--
G8QYY1_SPHPG/33-336-------------------------------------------------------------------DRCRPLVV.GD--
W8KS11_HALHR/35-325-------------------------------------------------------------------...AQRVVLGD--
G8TP28_NIAKG/36-322-------------------------------------------------------------------ELCTPVIF.AS--
PDXA_VIBCH/28-321-------------------------------------------------------------------DWPHQLVVCAD--
T2KID2_9FLAO/35-320-------------------------------------------------------------------EFCTPVIF.AS--
U5LJV8_9BACI/34-327-------------------------------------------------------------------QICNPLVI.GD--
PDXA_PERMH/27-312-------------------------------------------------------------------KKAIYVIY.GS--
PDXA_RHILO/36-329-------------------------------------------------------------------...PAFYLLAD--
Q89M19_BRADU/33-325-------------------------------------------------------------------ASCRLVVI.GD--
K9VZP3_9CYAN/50-362-------------------------------------------------------------------QNLDITVV.GS--
PDXA_FUSNN/31-321-------------------------------------------------------------------DLCDLVVI.GD--
E0SNM5_IGNAA/34-327-------------------------------------------------------------------EYAKPIVI.GN--
G0AAS4_COLFT/40-342-------------------------------------------------------------------RDEINSVLIGD--
A6Q3Y7_NITSB/29-300-------------------------------------------------------------------QSCTPLYF.TN--
A7HYG3_PARL1/38-330-------------------------------------------------------------------..LPIFFVAGD--
G4STZ3_META2/32-323-------------------------------------------------------------------SHACQLVAIAD--
R4W4P1_9EURY/25-318-------------------------------------------------------------------ALADVVVI.GD--
E4TVA5_MARTH/35-325-------------------------------------------------------------------KMMTPVVY.GS--
R5IKT1_9CLOT/33-336-------------------------------------------------------------------DLCNPVVV.GD--
R7CXE5_9BACE/34-324-------------------------------------------------------------------ELCTPIIY.GS--
G8QPR5_AZOSU/28-330-------------------------------------------------------------------.AQARLVVLAD--
PDXA_HERAR/30-332-------------------------------------------------------------------RADVKSILIGD--
Q7VQK2_BLOFL/37-330-------------------------------------------------------------------KWPVELVICAD--
C7M3J3_CAPOD/34-323-------------------------------------------------------------------ELCTPIIF.AS--
R6TUF4_9FIRM/17-307-------------------------------------------------------------------DYCRPVII.GD--
D1CHU7_THET1/34-324-------------------------------------------------------------------DLCRPIVV.GD--
PDXA_CAMFF/30-301-------------------------------------------------------------------NICSPIYF.IN--
I4BXC4_ANAMD/32-320-------------------------------------------------------------------DMCIPVVI.GD--
E1R632_SPISS/37-339-------------------------------------------------------------------DMCRPLVV.GD--
C4ZHF2_EUBR3/32-338-------------------------------------------------------------------EQCRPVII.GD--
B8I6T9_CLOCE/32-323-------------------------------------------------------------------KVCNPLVI.GD--
F4CNN9_PSEUX/26-309-------------------------------------------------------------------AQEPPVLV.GD--
C5B7P2_EDWI9/30-321-------------------------------------------------------------------.WPAELVVCAD--
PDXA_SYNFM/34-329-------------------------------------------------------------------ECCTPIVV.GD--
F2I3R8_PELSM/32-321-------------------------------------------------------------------DKANCVLI.GE--
K7VXY6_9NOST/36-337-------------------------------------------------------------------QNCDVMVV.GN--
R5D0H0_9BACT/34-324-------------------------------------------------------------------ELCTPIIY.GS--
H6L3Q9_SAPGL/32-322-------------------------------------------------------------------ELCTPVIF.GS--
R6F1V4_9BACT/34-322-------------------------------------------------------------------DMCVPIVY.GS--
Q2S3U3_SALRD/96-387-------------------------------------------------------------------.SMTPVLI.GS--
H2FZ12_OCESG/28-320-------------------------------------------------------------------DWPAELVVIAD--
L0K3J5_9EURY/33-327-------------------------------------------------------------------ERADPIVV.GD--
G8R4P5_OWEHD/35-324-------------------------------------------------------------------DLCTPVVF.AS--
I1YL39_METFJ/29-320-------------------------------------------------------------------.HANELVVLAD--
PDXA_COLP3/27-319-------------------------------------------------------------------DWPVEMVVIAS--
Q215S3_RHOPB/38-329-------------------------------------------------------------------....AFYLLGD--
I0DWR7_PROSM/32-323-------------------------------------------------------------------.WPVELVACAD--
D3DGU5_HYDTT/29-313-------------------------------------------------------------------PKNAYIIY.GE--
C6X2C9_FLAB3/36-324-------------------------------------------------------------------DFFTPIIF.GS--
Q02C14_SOLUE/41-313-------------------------------------------------------------------...RWIVV.GD--
G0G667_AMYMS/33-323-------------------------------------------------------------------QMAHGVAV.GD--
A9GKN1_SORC5/15-317-------------------------------------------------------------------..GARCVLVGD--
Q1QKW1_NITHX/32-325-------------------------------------------------------------------..VPPFYLLGD--
H1XYD5_9BACT/33-325-------------------------------------------------------------------ELCTPVVF.GP--
D4GUQ8_HALVD/34-328-------------------------------------------------------------------EDASLVVI.GD--
PDXA_BEII9/33-322-------------------------------------------------------------------.KRNWIVV.GD--
F9Z465_ODOSD/33-319-------------------------------------------------------------------EVCTPVLF.GS--
A6VPP4_ACTSZ/32-327-------------------------------------------------------------------AKANVLLV.AD--
I0KFB6_9BACT/263-588-------------------------------------------------------------------KICTPVIY.GS--
B5E8C6_GEOBB/32-324-------------------------------------------------------------------ALCRPLVL.GD--
Q4FMQ9_PELUB/32-317-------------------------------------------------------------------...SPLIIIIS--
A5FM92_FLAJ1/36-324-------------------------------------------------------------------ELCTPVIF.AN--
E3H6A7_ILYPC/32-321-------------------------------------------------------------------..GKYLVI.GD--
A6QAX9_SULNB/28-306-------------------------------------------------------------------SIIDPVYC.ID--
A9BT55_DELAS/23-315-------------------------------------------------------------------.HAPFFVI.GD--
C3M9C3_RHISN/34-330-------------------------------------------------------------------QATAPFLFIGD--
Q5LQN1_RUEPO/27-312-------------------------------------------------------------------RADCPFVWIGD--
E8UEJ0_TAYEM/35-326-------------------------------------------------------------------...KAIVF.GD--
R5UVJ1_9PORP/33-321-------------------------------------------------------------------EICTPILY.GS--
PDXA_ERYLH/36-326-------------------------------------------------------------------...APFAVAGG--
I0IDK7_PHYMF/40-342-------------------------------------------------------------------RLARFVVF.GL--
A8MJU3_ALKOO/32-323-------------------------------------------------------------------EVAKVVVV.GD--
R6WM45_9PORP/34-325-------------------------------------------------------------------ELCTPVIY.GS--
Q3ARA5_CHLCH/34-329-------------------------------------------------------------------..VGRVVVAGS--
G8X7V7_FLACA/36-324-------------------------------------------------------------------ELCTPIIF.AN--
D3UFK7_HELM1/31-300-------------------------------------------------------------------QYCMPIYC.AK--
D9SID5_GALCS/30-319-------------------------------------------------------------------..ALNVVVVAD--
K9WP18_9CYAN/130-441-------------------------------------------------------------------NNCEITVI.GS--
PDXA_PSEHT/27-319-------------------------------------------------------------------TWDAQLVAIAD--
A1AWJ1_RUTMC/26-312-------------------------------------------------------------------KSNKNLLLFAD--
PDXA_STRMK/28-315-------------------------------------------------------------------REDCRLLAFAD--
Q3V8D3_GEOSL/34-325-------------------------------------------------------------------ECCRHLVV.GD--
B6IN68_RHOCS/40-329-------------------------------------------------------------------....PFVLLDD--
D4M806_9BACT/32-348-------------------------------------------------------------------DRCRPLVV.GD--
I4A0Q6_ORNRL/35-323-------------------------------------------------------------------GICTPVVF.CT--
V4JCI5_9DELT/37-338-------------------------------------------------------------------DLCRPLVI.GE--
I1XKV7_METNJ/29-321-------------------------------------------------------------------GQRHEIVVIAD--
U6B4X5_9RHIZ/39-331-------------------------------------------------------------------....PFIYIGD--
G8UPW0_TANFA/30-320-------------------------------------------------------------------ELCTPVIY.GS--
B0TBI8_HELMI/32-323-------------------------------------------------------------------RIARPLVI.GD--
F4HD17_GALAU/31-322-------------------------------------------------------------------EIAQPVVI.GD--
J9QT86_RIEAN/36-321-------------------------------------------------------------------DFFTPVIF.GS--
PDXA1_PSEAE/27-320-------------------------------------------------------------------AQPHPLIAIAS--
F4KTC5_HALH1/42-332-------------------------------------------------------------------NFCVPVLY.GS--
V9VUT8_9RHOB/30-316-------------------------------------------------------------------RSSCPFFWIGD--
A1WVT6_HALHL/30-323-------------------------------------------------------------------SHAAELVAIGD--
C5CPN5_VARPS/44-335-------------------------------------------------------------------.AARVLLI.AD--
A8FHA9_BACP2/32-324-------------------------------------------------------------------EEAVLFVI.GD--
I4AG95_FLELS/65-362-------------------------------------------------------------------DLCIPVIF.GA--
F6GFQ1_LACS5/35-322-------------------------------------------------------------------EFCTPIIF.AS--
D9S1Z9_THEOJ/31-320-------------------------------------------------------------------GVARPLIL.GS--
U3U9G2_9BACT/29-322-------------------------------------------------------------------NWPVELVVCAD--
C5ZY06_9HELI/27-295-------------------------------------------------------------------KICTPLYC.ID--
W0HX00_9ENTR/29-321-------------------------------------------------------------------AWPVELVICAD--
L0KAL8_HALHC/32-321-------------------------------------------------------------------KKAKLILI.GD--
F9ZTS3_ACICS/32-320-------------------------------------------------------------------....TPVVIGS--
W0PD12_9BURK/38-333-------------------------------------------------------------------..ASTVVY.GD--
I2EZC0_EMTOG/35-326-------------------------------------------------------------------KICTPVIY.GS--
R7PD86_9BACT/34-324-------------------------------------------------------------------DLCTPVLY.AS--
Q2S9C2_HAHCH/25-319-------------------------------------------------------------------SWPADLVFVCD--
R7DEZ6_9PORP/35-326-------------------------------------------------------------------EMCTPVVY.GS--
D0L089_HALNC/37-327-------------------------------------------------------------------..PVELVILGD--
K9WWL5_9NOST/42-342-------------------------------------------------------------------QYCDVVVV.GS--
E1V6Y8_HALED/34-339-------------------------------------------------------------------..QARVVAVGD--
D7AYM9_NOCDD/33-324-------------------------------------------------------------------EYAKPVVV.GD--
G8M1K4_CLOCD/32-322-------------------------------------------------------------------EVCNPVVI.GS--
Q13RP4_BURXL/47-338-------------------------------------------------------------------HSQPRIVLFGD--
B1XQD4_SYNP2/31-333-------------------------------------------------------------------ALCPMRVI.GD--
K9PRQ4_9CYAN/33-337-------------------------------------------------------------------QNCELTVV.GN--
B2JVC5_BURP8/44-333-------------------------------------------------------------------AQCRPLVI.GD--
E6U0H3_BACCJ/33-324-------------------------------------------------------------------QAGKPFVI.GD--
I3TLQ2_TISMK/41-330-------------------------------------------------------------------....AFLAIDD--
U3U6Y7_9ENTR/31-323-------------------------------------------------------------------DWPVELVVCAD--
D8PAQ2_9BACT/40-332-------------------------------------------------------------------RLCTPVVV.GS--
A6WG90_KINRD/420-711-------------------------------------------------------------------ETSRSVVV.GD--
Q6AJE3_DESPS/35-321-------------------------------------------------------------------..RANIVL.GD--
D8IZA6_HERSS/29-330-------------------------------------------------------------------RHEVRCILLGD--
PDXA_HELPY/30-306-------------------------------------------------------------------ALCEPLYL.TD--
E0UJK2_CYAP2/32-338-------------------------------------------------------------------ENYQITVV.GS--
H6LGK9_ACEWD/32-322-------------------------------------------------------------------ARARLIVV.GD--
E4T4J1_PALPW/35-325-------------------------------------------------------------------.TFVPVIY.GS--
I1YT17_PREI7/35-321-------------------------------------------------------------------ELCTPIIY.GS--
Q1GZB9_METFK/29-319-------------------------------------------------------------------..PCYLAVIAD--
W0DQ96_9GAMM/30-322-------------------------------------------------------------------HWPVPMVVIGD--
S6ADC8_9PROT/41-329-------------------------------------------------------------------...SRIVAIAN--
Q3ACP1_CARHZ/32-323-------------------------------------------------------------------AICKPLVI.GD--
C4K4L0_HAMD5/30-322-------------------------------------------------------------------HWPVELVVCAD--
PDXA_ECOLI/29-321-------------------------------------------------------------------EWPVELVVCAD--
F4LW28_TEPAE/34-336-------------------------------------------------------------------DKCNPVVI.SD--
R5A8A6_9CLOT/34-337-------------------------------------------------------------------EKCKPLVI.GD--
V5SD81_9RHIZ/47-343-------------------------------------------------------------------....PFVFFGD--
D0MJ80_RHOM4/43-335-------------------------------------------------------------------KFFDPIIV.GS--
M9WW13_PASHA/31-320-------------------------------------------------------------------ELAHPVVI.GD--
PDXA_SULDN/30-300-------------------------------------------------------------------KLCAPLYC.IN--
M4UJW4_9GAMM/32-323-------------------------------------------------------------------.WSLPIVICCD--
A9IK05_BORPD/40-331-------------------------------------------------------------------QRARLVVV.GD--
Q5E864_VIBF1/34-327-------------------------------------------------------------------DWPHQLVICGS--
H8XRP0_FLAIG/36-322-------------------------------------------------------------------ETCTPVIF.AN--
K1WRA1_MARBU/43-327-------------------------------------------------------------------KKADIFLL.AD--
PDXA_SHEDO/27-319-------------------------------------------------------------------AWPAELVVCAN--

PF00180

LEU3_BACMD/4-351-------------------------------------------------------------------KVAVLPGDGVG--
LEU3_BACSU/4-352-------------------------------------------------------------------RIALLPGDGIG--
LEU3_ECOLI/6-355-------------------------------------------------------------------HIAVLPGDGIG--
IDHC_SOYBN/8-403-------------------------------------------------------------------KVANPIVEMDG--
LEU3_AGRT5/5-361-------------------------------------------------------------------SLFLLPGDGIG--
IDH3A_BOVIN/33-358-------------------------------------------------------------------TVTLIPGDGIG--
LEU3_SCHPO/5-363-------------------------------------------------------------------KIVVLPGDHIG--
LEU3_LEPIN/3-354-------------------------------------------------------------------NVAVLSGDGIG--
LEU3_NEUCR/5-358-------------------------------------------------------------------NIVVFGGDHCG--
LEU3_LACLA/4-340-------------------------------------------------------------------KIVTLAGDGIG--
IDH_THET8/21-351-------------------------------------------------------------------LITVIPGDGIG--
LEU3_YARLI/14-367-------------------------------------------------------------------KIVLLGGDFCG--
IDH2_YEAST/38-365-------------------------------------------------------------------TVSFIEGDGIG--
IDH_BACSU/21-418-------------------------------------------------------------------IIPFIEGDGTG--
LYS12_YEAST/25-367-------------------------------------------------------------------TIGLIPGDGIG--
D5A186_ARTPN/6-352-------------------------------------------------------------------RITLLSGDGIG--
G2TK86_BACCO/4-350-------------------------------------------------------------------KLAVLPGDGIG--
M4CW66_BRARP/45-394-------------------------------------------------------------------NITLLPGDGIG--
Q480C2_COLP3/29-412-------------------------------------------------------------------.IPFIEGDGIG--
LEU3_THET8/2-339-------------------------------------------------------------------KVAVLPGDGIG--
R4KBV6_CLOPA/5-353-------------------------------------------------------------------KIAVIPGDGIG--

PF03971

D5CQ42_SIDLE/5-737KIIYTLTDEAPSLATYSLLHIIQAFTKAAGVTVETSDISLAGRILANFPEHLS.....AAQKVTDGLAELGALTLKPE--
A6Q387_NITSB/6-736.IVWTKIDEAPALATYSLLPIVKAFTKDSGVEIELRDISLAGRVIAEFSDRLP.....EDKKQADELAYMGELVLKPE--
I6WPR8_PROPF/3-733KIIYTLTDEAPRLATCSLLPVLQAYGRLAGIGIEGRDISLAARILARFPDFLP.....DDKRVSDTLDELGELTRDPL--
D9SIT7_GALCS/5-738KIIYTMVDEAPALATYSLLPIVQAFTKAAGVAVETRDISLAGRILANFPDKLT.....PEQKIADELSELGQLALKDE--
D5V1Z1_ARCNC/3-729KIIYTKVDEAPALATYSFLPIIKAFTKSSGIEMVTKDISLAGRILANFPENLK.....EDQKIGDHLAELGKLTQDPT--
D1B1Z3_SULD5/7-741KIIYTQVDEAPALATYSLLPIIKAFVKRSSIKIETRDISLSGRILAHFSDYLT.....NEQRVNDDLAYLGTLANTPE--
K7SLX7_PROA4/3-736TIVWTKVDEAPALASYSLLPIIRGFLTGTGVDITTSDISLAARILAQFPERLA.....ADQRVDDNLAELGRLTGDPQ--
A3U876_CROAH/5-738TIKYTKTDEAPMLATHSFLPIVQRFTKTSNITIDVEDISLAGRIIATFSDRLT.....EEQKQYDALAALGELAKQPE--
A1S7A8_SHEAM/7-739TIIYTETDEAPALATLSLLPILQTFAEPAGVKIETRDISLSGRVIATFPEKLT.....DAQRIGDHLAELGELATKPE--
L0FYJ1_ECHVK/23-756KILYTLTDEAPALATYSLLPIIKSFTDSAGVVVETRDISLSGRIIANFPEYLK.....EDQRIGDALAELGEIAKTPE--
F6FT01_ISOV2/6-736TIIYTHTDEAPLLATYSFLPIVQAYAAKAGVNVETRDISLAGRILAQFPEHLT.....DEQRVGDALAELGQLATTPE--
F2II47_FLUTR/7-740TILYTLTDEAPALATYSFLPIVKAFASTAGIEVESRDISLAARILASFPESLT.....DAQRVPDSLSELGKLATAPE--
V9VSX7_9RHOB/9-736.ILYTIVDEAPELASASFLPIIRKFASAAGVTVGTKDISLAGRIIAAFPENLT.....EDQRQSDDLAELGQLVKTPD--
Q9I0L4_PSEAE/6-738KITYTFTDEAPALATYSLLPIVKAFAASAGIDVETSDISLAGRILANFADRLE.....ADQRIEDDLARLAVLATSPD--
A1R425_ARTAT/3-735KIIYTHTDEAPMLATYSFLPIVEAYASTAGVEVETRDISLAGRIIAVFGDFLT.....EEQRTGNALAELGELAKQPE--
B1VF46_CORU7/3-734KIIYTRTDEAPLLATYSLKPIVEAFASTCGVDVETRDISLAGRILAAFNDKLP.....KEQQVNDALKELGELTQSPE--
A7HAP6_ANADF/7-741TIIWTEIDEAPALATYSLLPIVQAFTKGTGVSVETRDISLAGRIIANFPENLT.....ESQRIPDYLAQLGELARTPE--
F2LTW4_HIPMA/7-743TIVWTKTDEAPYLASFSLLPIVKGFVKHADVDVEVRDISLAGRILATFPEYLK.....EDQRINDDLAYLGELVNKPE--
D2UG49_XANAP/6-738KILYTLTDEAPYLATQSLLPIVAAFAGTAGIAVETRDISLAGRLIAQFPESLR.....EDQRIADDLAELGQLATTPE--
B0BZF4_ACAM1/9-741.IIYTHTDEAPALATYSFLPIVEVFTQVAGIEVETRDISLAGRIIASFPEKLT.....ADQQQLDNLAYLGDLAKTPE--
E1STT1_FERBD/3-736KIIYTHTDEAPALATQSLLPIIEAFTGAANIDIETRDISLSGRIIANFPENLT.....EAQRMNDALAELGELAKTPD--
Q0A9L5_ALKEH/8-739TIYYTLTDEAPALATRSLLPVVQTFTGAAGIDVKLSDISLAGRILSAFPERLS.....DDQKVEDGLAFLGDLTQDPN--
B3QVP5_CHLT3/7-740KIIWTEVDEAPALATYSLLPIVNAFTGVAGVPVETRDISLSGRIIANFPENLT.....DEQKIPDELTALGELAKTPE--
H8XU75_FLAIG/5-736KIIYTLTDEAPMLATHSLLPIIQAYTKTAGIKVETRDISLAGRILANFSEYLK.....EEQKINDALAELGQLATTPE--
A5WH85_PSYWF/3-737KIIYTKTDEAPALATLSLLPIVEAFTKTAGISVETSDISVAARILAEFPDYLT.....EEQRVPDNLAELGRLTQDPN--
D7BKH3_ARCHD/4-733.MIYTYTDEAPMLASASFLPIAQAFVRTAGIDLVSRDISLSGRIIAAFSDLLP.....TSLRQPDALADLGKLTLEPD--
A3QD82_SHELP/6-738TIIYTETDEAPALATLSLLPIIKHFTAAAGVGVETRDISLSGRVIANFPEFLK.....PEQQISDALAELGELATKPE--
Q31GM7_THICR/4-737KIIYTLTDEAPALATYSLLPIVEAFTKAAGVSVETRDISLAGRILANVPDKLS.....EAQKVGDALTELGNLAKTPE--
C7M412_CAPOD/4-735.IIYTITDESPYLATHSLLPIIKRFCASSGINFEAKDISLAGRILATFPDFLT.....AEQRVPDALSELGALATCPE--
E1V4K9_HALED/6-739KIIYTLTDEAPALATRSLLPIIDAYTDSAGITVETRDISLAGRIISQFPDRLS.....DAQQLGDHLAELGELAKTPE--
Q88FS1_PSEPK/6-739KIIYTFTDEAPALATYSLLPIIEAFTASADIAVETRDISLAGRILAAFPEQLG.....AEKQVGDHLAELGQLATTPE--
K4KV52_SIMAS/7-739KIIYTLTDEAPALATYSLLPIVNAFAAAAGIEVETSDISLAARILAHFPECLT.....FEQRVPDALAELGALTQDPN--
F2JWD6_MARM1/5-737TIYYTLTDEAPALATASLLPIFQAFAKEADINLQLTDISLAARVLSLFTDRLP.....EDKQVEDGLSFLGELTADPD--
F0S094_DESTD/6-733TIIWTKVDEAPALATYSLLPIMRAFVKHADVDIEVRDISLAGRILAQFG............YVPDDLAYLGELVWKPE--
D3UGP7_HELM1/2-738KITYTLTDESPALATYSFLPIVRAFLHTAGIEVESADISLAGRILAQFPQHLT.....PSQRIPNALEALGELVKHKD--
W0J5H7_9BACT/9-742.IIYTKTDEAPALATYSLLPIIQAFTKHSGISVEPRDISLAGRILAAFADLLP.....PSQKTHDALAELGALTLKPE--
B9L5J0_NAUPA/5-736TIVWTKIDEAPYLATFSLLPIMEAFTKDANINWELRDISLAGRVIAEFSDMLP.....ENLRQFDELAYLGELVKKPE--
T2KNT3_9FLAO/6-739KIIYTKTDEAPALATYSFLPIVQAFLNPSGINVETRDISLAGRIIANFSDFLS.....EEQQLPDALTELGELAKKPE--
A0LZ01_GRAFK/6-739KIIYTKTDEAPMLATYSFLPIIEAFTKAAGVSLETRDISLAGRILSQFPDYLN.....EDQKVKDDLAELGELAKKPE--
C7MEJ9_BRAFD/4-740.IIYTHTDEAPMLATASFLPILDAFSDTAGIEVTTRDISLAGRIVAAFSELLP.....EDQREADALAELGELAKTPE--
A8EUE7_ARCB4/3-729KIIYTKVDEAPALATYSFLPIIQSFTKSSGIEMVQKDISLAGRIIAAFPENLT.....DEQKIGDALAELGEMTQDPN--
M1MV91_9CORY/3-734KIIWTRTDEAPLLATYSFKPVVEAFAGTAGIDVETRDISLAGRILAQFPDKLT.....DEQRVDDALAELGELAKTPE--
Q21K35_SACD2/7-740KIIYTETDEAPALATYSLFPIVKKYAAAAGVELEMRDISLAGRILAVFPEFLA.....EDQRQSDALAELGELAKQPS--
A0L819_MAGSM/7-741.IIYTIVDEAPELASGSFLPIIQAFTKPAGISVGTKDISLSGRIIAAFNDKLP.....AEQRIPDALAELGEMVKTPG--
E6X675_CELAD/3-737KIIYTKTDEAPALATQSFLPIVKAFTKTSGINIETKDISLAGRIIATFPDFLK.....EDQRIADDLTELGELAKNPD--
D5EP32_CORAD/6-738KILYTITDEAPALATHSLLPIISAYTAAAGVSVETRDISLSGRILANFPDYLT.....EDQQISDALAELGELAKTPE--
D8IWJ4_HERSS/7-740TIIYTLTDEAPYLATHSLLPIVKKFTAAAGIDVVESDISVAARILAEFPEYLT.....DEQKVPDNLAALGALTQSPD--
Q480C1_COLP3/7-740KIIYTITDEAPALATYSLLPIIQAYTASSGINVETRDISLAARILANFPKYLT.....KEQRVDDALSELGKLAKTPE--
J9R9T1_RIEAN/5-736KIYYTLTDEAPMLATHSFLPIVKAFTKSADIQIEVPDISLSGRILANFPEVLT.....EEQRILDALTQLGELATKPE--
I1XFF5_METNJ/3-736KIIYTKVDESPAAATFSLLPIITAFIKAAEISFEISDISLAGRIIATFPDNLT.....DDQKIPDHLAELGNLTQDPA--
H9UIG1_SPIAZ/5-737.IVYTQTDEAPALATHSFLPVIKTFADAVGVAVETRDISLAGRILAQFPERLS.....DAQRVSDDLAELGELVHQPD--
C1N5W5_MICPC/17-758KIWWTLTDEAPALATHAFLPVVRRFCGGVGVSVESADISLASRVLAAFPERLT.....PAQRKTDVLAKLGELATTER--
D8PBJ4_9BACT/7-740KIIYTKTDEAPMFATYSLLPIINAFSKAAGVSVELRDISLAGRILAVFPEYLT.....PEQRQPDALSELGELAKKPE--
H1Z8C0_MYROD/6-737KILYTFTDEAPMLATYSFLPIVQAFAQTAGIDVETRDISLAGRILANFPEYLK.....EEQRIGDALAELGELAKSPE--
E1WXB0_BACMS/7-740KIIYTKTDEAPALATESLLPIVKAFTATAGIEVETRDISLAGRVLANFPENLK.....DDQKISDALTELGELAKTPE--
Q9KSW5_VIBCH/7-740TIIYTITDEAPALATYSLLPIIQSFTASSGINVETRDISLAGRILANFPEHLT.....EEQRISDALTELGELAKTPE--
I3YS17_AEQSU/6-739KIIYTKTDEAPALATHSFLPIVEAFTAPANIELESKDISLATRILAVFPEFLK.....EEQRVNDDLAELGELAKKPE--
A1STK8_PSYIN/7-740KIIYTQTDEAPALATYSLLPIVSAFTQAADITVETRDISLAARILATFPDNLS.....AEQKQADALTELGELAQQPQ--
D7WAL0_9CORY/3-734KIIWTQTDEAPLLATYSLKPIVEAFASNAGVDVETCDISLAGRILAQFPDYLD.....EDQRVNDDLAKLGELAETPE--
B2GKD0_KOCRD/3-733KIIYTETDEAPMLATYSFKPMVEAFASTAGVEVETRDISLAARILAQFPDRLT.....DAQRVPDTLGELGELAKTPE--
W6EER3_SULMU/7-741KIIYTKVDEAPALATYSLLPIVQAFTASSNIEMEIRDISLSGRILANFPENLT.....AEQKVNDDLTYLGELANQPE--
M4U620_9GAMM/7-740KIIYTLTDEAPALATYSLLPIVNAFTNVADIVVETRDISLATRILSQFSHYLS.....TKQQRPDALAELGVLVKDAS--
A1K4K8_AZOSB/7-741TIIYTITDEAPMLATAAFLPVIRSFTKPAGIQIEEADISLAGRILAEFPDFLS.....DAQKVPNTLAELGALTLKPE--
C5BIJ2_TERTT/8-740.IIYTETDEAPALATYSLLPIVQAFAKAAGISVETKDISLSGRVIANFSDYLT.....ADQQQEDALALLGELATKPE--
E4PIW6_MARAH/7-740KIVYTLTDEAPALATRSLLPILETYAKPAGIEFETSDISLAARILANFPDYLE.....EDQRVPDALAELGEYTKDPD--
E4RUN8_LEAB4/17-750KIIYTITDEAPALATYSFLPIVEAFTKPAGVEIETRDISLSGRILANFSEFLT.....DEQKVSDDLAYLGKLAVEPE--
F8JJ69_STREN/5-736TIIYTHTDEAPALATYSFLPVVEAYASKAGVTVETRDISLAGRILAVFPEYLE.....EGQRIDDALAELGELAKTPG--
C7NKD1_KYTSD/3-736KISWTRTDEAPLLATYSLKPIVEAFATTADIDVETRDISLAGRILAQFPEQLS.....EDQRVEDALGNLGDLAKTPE--
Q9JZS1_NEIMB/6-739TIVYTHTDEAPALATQSLLPIVQAFARHADIDVKTSDISLSGRILAAFPEYLT.....EAQRVPDALAELGELVKQPD--
C5ZYN4_9HELI/2-724KITYTLTDESPALATYSFLPIVKAFLKKAEIEVETSDISLAARILAQFP..........ENGYKDELALLGNLVEKPD--
C1DL01_AZOVD/5-737KIIYTLTDEAPALATYSLLPIIKAFTGSSGIAVETRDISLAGRLIATFPEYLT.....DTQKISDDLAELGKLATTPD--
E6S9C5_INTC7/5-731KIIYTYTDEAPALATASLLPIVQAFASKAGVDVETRDISLAGRILAAF............GLADDALAELGALAKRPE--
Q2SHA1_HAHCH/6-738KIVYTLTDEAPLLATYSFLPIIKKFASAAGVDVETSDISLAARVLANFPECLS.....EEQKVPDALAELGELVKQAD--
C4LKD9_CORK4/3-734TIIYTRTDEAPLMATYSLKPVVEAFASTAGVDVETRDISLAARTLAAFNDVLP.....EDQRVNDALAELGALAKTPD--
F8E409_FLESM/8-745.IIWTEIDEAPALASYSLLPIVRKFLESAGIDVEAVDISLAGRIIANFPDYLK.....EDQRIPDYLSQLGELALKPE--
W8S0Q0_9RHOB/9-733.IIYTKVDEAPELASASLLPIIQRFADAAGVSVGTRDISLAGRIIAAFPETLT.....EEQRQSDDLADLGELVKTPE--
W0JIX7_DESAE/6-742KIYWTKVDEAPYLATFSLLPAVERFLKAAGIDVEIKDISVAGRILANFPEYLK.....EDQRVPDDLGELAELVKLPD--
B3E9R4_GEOLS/7-740KIIWSKIDEAPALATYSLLPIVNAFTKAAGVVVETRDISVAGRIIANFPDYLT.....PEQRMPDYLAELGELTQKPE--
M1E507_9FIRM/6-743KVIWTITDEAPYLATFSLLPIVKKFFDVSDIEIDIKDISLSSRILANFSDFLT.....QDQRVSDDLSILGELVNKPD--
Q0PAY5_CAMJE/3-729.ITYTLTDESPALATYSFLPIVKAFLSRAHIGVKTSDISLSGRILATFSEYLK.....EEQRCEDALELLGELVKRSD--
A3HX33_9BACT/7-740KILYTLTDEAPALATYSLLPIVQAFTSSAGVQVETRDISLSGRIIANFPSYLT.....AEQQIGDALAELGDIAKTPE--
A8LP43_DINSH/9-721.IVYTTVDEAPELASASLLPIIQAFAAPAGVSVGKKDISLAARILAAV............AGAPDHLAELGGLVKTPT--
E4TZB1_SULKY/3-729KIIWSVIDEAPALATYSLLPIVNAFTKAAGVEVVTSDISLAGRVIATFPERMT.....DAQRIPDNLAQLGVVATQPD--
K0C4Y6_CYCSP/7-740KIIYTLTDEAPLLATASFLPIVEAFAGAAGIDVEVSDISLASRVLATFADQLP.....DDQKVPDALSELGRLTQNPE--
A0RPF0_CAMFF/4-728.IIYTYTDEAPALATFSLFPVIKEFLNRANIDIQTVDISLSGRILANFSEYLN.....DDQKVPNYLEILGEMTKEKS--
B3ENX3_CHLPB/3-736KIIYTKIDEAPALATYSLLPIIQAFTNGTGISVETSDISLAARIIANFPENLT.....EEQRIPDNLTALGEMAMTKE--
F9YPD0_CAPCC/6-739TIIYTKTDEAPFLATHSLLPIVKRFTKSSGIDFQLKDISLAGRILANFPDFLK.....KEQQVEDALTELGKLATEPE--
B3PL57_CELJU/5-738KIIYTQTDEAPALATYSLLPIVQAFTQSSGVNIETRDISLAGRIIALFPEYLS.....EDQRIGDHLAELGQLATTPE--
C1FF99_MICSR/20-749KIWWTLTDEAPALATHAFLPVVRRFLGPSGVSVETADISLAARILAAFPERLT.....PAQRRVDVLAKLGELAKTSR--
H2G1D1_OCESG/7-738TIVYTLTDEAPALATYSLLPIIRTFTDAAGIDVTLSDISLAGRVLAAFPERLT.....DEQRVADGLAELGKLTQDPH--
E6W3A0_DESIS/5-739KIIWTEIDEAPALASYSLLPVVRAFTKGTGIEVEAWDISLAGRILANFPEYLT.....EGQRIPDYLSQMGEVAKTPE--
D5VA96_MORCR/5-738TIIYTHTDEAPALATHSLLPIIRAFGATAGVDFVTSDISLAGRILAAFPEYLT.....QEQQTPDALAQLAELVTQPK--
Q5QZT7_IDILO/7-738KIIYTETDEAPRLATYSFLPFIEAFTKAAGVSVETRDISLAGRIISQFPEYLT.....EEQRQSDALAELGEMAKTAE--
D5BKK7_ZUNPS/6-738KIFYTKTDEAPALATYSLLPIVQTYTKAADVILETKDISLAGRILSQFPEFLE.....DNQKVADALAELGELAKKPE--
E2SFF0_9ACTO/5-735TIIYTHTDEAPALATYSFLPVVQTYAATAGVAVQTRDISLAGRIISQFPEFLT.....EDQRVDDALAELGALAKTPG--
I6YVP5_MELRP/4-738KIMWTKTDEAPALASYSLLPILQSYTKGTGIEFEVKDISLAGRILAAFPEYLS.....EAQRIDDHLAELGKLTQDPN--
W0I0L2_9ENTR/6-739KIIYTLTDEAPALATYSLLPIIRAFTQSLGIAVETRDISLGGRILANFPEHLQ.....SDQRLSDHLAELGQLAVTPE--
C9RMQ9_FIBSS/4-740KIYYTLTDESPFLATQSLLPIVSAFAKTADIDVETKNISLPGRILAAFADTLPAGTTFAGKPVTDDLAFLGKLTLEPD--
I5AYK9_9DELT/4-736KIRWTRTDEAPLLATHSLLPIVNSYLKGSGIEVELRDISLAGRVLANWSDRLK.....DDQKVSDDLAFLGQLAKSPD--
Q3IH53_PSEHT/4-737KIIYTKTDEAPALATYSLLPIIQAYTNAAGVEVETRDISLAGRVIASFPDYLT.....PEQRINDALAELGELAKTPE--
V5WJE7_9SPIO/3-736KIIYTRTDEAPALATYSLLPVIQQFAGTAGVDIETRDISLAARILSQFPDYLS.....TEQKVHDALAELGELVQRPE--
B2V8Q7_SULSY/5-744TIVWTKIDEAPALATYSLLPIMRAFTKGADVEIELRDISLSGRVIALFPEYLK.....EDQRIPDELSYLGELVWKPE--
Q30RQ6_SULDN/3-727KIIWSKIDEAPALATYSLLPIVNAFTKAAGVEVVTSDISLAGRVISKFSDRLK.....PEQRINDELAELGNVVLQPD--
E8UGI5_TAYEM/3-734TISYTFTDEAPMLATYSFLPIVKAFTSVADIEVETKDISLAGRILAVMGDYLN.....DDQRVPNALAELGELATKPE--
M1P925_DESSD/6-739.IIYTKVDEAPSLASYSLLPILQGFTKGSGFSLVEKDISLAGRILANFPEKLT.....PGQRVADDLGELGRLVKEPE--
H1XS30_9BACT/5-740KIYWTKTDEAPYLASFALLPVIKAFTKGTGIEIETKDISLAGRIIATFPDKLR.....EEQKITDDLKELGELTQNPD--
Q5NET6_FRATT/12-745KIFYTFTDEAPALATGSFLPIVESFTKVADIELETKDISLSARILANFNDYLT.....AEQKCSDDLAILGELAKTPD--
R7XUF3_9ACTO/3-734KIIYTHTDEAPMLATYSFLPIVAAYARTAGVEVETRDISVAARIISQFPERLT.....EDQRLPDALAELGELATKPE--
S5R118_9PROT/7-741TIFYTLTDEAPMLATYSFFPIIKKFTTLANIKIISSNISIAARTLSKFSSYLR.....KDQKILDDLDELSKLIKKPY--
Q7UX35_RHOBA/8-739.IVYTHTDEAPALATRSLLPILQAFTSGSGLSFETKDISLAGRILAGFADRLP.....ADKQVPDALAELGELVTKPE--
F6GBX4_LACS5/6-738KIIYTKTDEAPALATRSFLPIVKAFVKSSGIDIETKDISLAARILATFPDFLN.....DDQKVNDDLAYLGELAKKPE--
A4AQ16_MARSH/3-736KIFYTKTDEAPALATQSFLPIVQAFTKTSGITIETKDISLAARIIATFPDYLN.....KEQRVENDLDVLGQMAKMPE--
D3PCR7_DEFDS/7-744TIIWTETDEAPFLATFSLLPIVKAYLKHADVDVEVRDISVAGRILATFPDYLT.....DDQKVNDDLAYVGELVNKPE--
Q0VQ19_ALCBS/5-738KIIYTMTDEAPALATYSFLPIIEKFTSIAGIEVESSDISLATRILASFPEYLS.....EQQKVKDTLSELSDLTQDPE--
Q6A6Z7_PROAC/3-732TIVWTKIDEAPALASYSLLPIVEGFLDGSGIDITTSDISLAGRILAQFPDRLN.....EDQKVADHLAELGELTGSPD--
I0AFK0_IGNAJ/4-739KIYWTKTDEAPALASYSLLPILKSFTKGTGIEFVEKDISLAGRIIANFPDNLT.....KEQQIPDYLAELGELTQHPN--
I0IE50_PHYMF/4-736.IVYTLTDEAPALATAALLPVLRAFTRHAGTHFELEDISLAGRILARFPERLT.....ADQRQEDALAKLGAMAKQAD--
M5AMA5_9ACTN/5-738TIIYTITDEAPAMATYSLLPIVKAFAGAAGVEVETRDISLAARVLAQFPERLT.....PEQQTPDALTELGEIALTPG--
K4IX24_PSYTT/7-740KIIYTKTDEAPALATYSFLPIIRRFTESAGINILSKDISLAARILTSFSDYLT.....EEQKVDDSLTYLGKLAKTPE--
A4SVS2_POLSQ/7-740KIIYTLTDEAPLLATCAFLPIIRTFTAPAGVEIVNSDISVAARILAEFSECLT.....TEQKVPDNLAELGKMTLMPD--
G7UU97_PSEUP/6-738KIIYTLTDEAPFLATQSLLPIIDAYTDTAGIVVETRDISLAGRILAQFPDLLG.....AEQRVADDLAELGELATRPE--
K9UP30_9CHRO/7-740KIVYTFTDEAPALATYSFLPIVQAFTKAANVTIETSDISLAGRIIAAFPERLT.....AAQQQPDDLAILGELAKTPA--
F0S4K1_PEDSD/6-737KIIYTKTDEAPMLATYSFLPIVQAFTASAGVDVETRDISLAGRILANFPEFLK.....EEQRIGDALTELGVLATTPE--
I3ZAR1_BELBD/7-739KILYTLTDEAPALATYSLLPIVKAFTDSAGVVVETRDISLSGRIIALFPEFLT.....SDQKIGDALAELGDVAKTAE--
A1SMP0_NOCSJ/3-734TIIYTHTDEAPLLATYSFLPIIQAYAAKAGVEVETRDISLAGRIIAQFPDRLT.....AEQRIDDALAELGELAKRPE--
C5C942_MICLC/3-736KIIYTLTDEAPMLATASLLPIVRAYAGTAGVELETRDISLAGRILAAFKDVLP.....EEQRTADALAELGELVKTPE--
A4CN95_ROBBH/3-737TIHYTKTDEAPALATASFLPIVQAFSRTAGIDITTKDISLAGRILAAFPEFLS.....EAQRIPNDLEFLGELAKQPE--
A9GTS3_SORC5/41-773TIIYTKTDEAPALATYSLLPIVEAFTKAAGVRVETRDISLAGRILANFPERLT.....DNQKLGDHLAELGELAKTPN--
B1XIH1_SYNP2/14-747KITYTFTDEAPALATYSLLPIVEAFTTAANIEVETKDISLAGRIIANFPEYLT.....ADQRRPDALAELGALAKTPD--
I4B3K5_TURPD/7-740KIIWTKIDEAPALATYSLLPIVNAFTKAAGVVVETCDISLAGRILANFPENLS.....ESQKVADGLAALGKLVLLPE--
B0UWC0_HISS2/4-735KITYTLTDEAPMLATYSFLPIVQAFTAVANIDVETKDISLAGRILANLSAYLS.....EEQKIPDALAELGELATKPE--
E8ND12_MICTS/5-736TIIYTYTDEAPALATASFLPIVQAVTKQAGVDVETRDISLAGRILAAFPQRLT.....PEQQVGDALAELGGLATLPE--
E6WXM1_PSEUU/6-738KIIYTLTDEAPFLATQSLLPIVQAFAGTAGIQVETRDISLAGRILAQFPDYLG.....DDQKIGDHLAELGELATRPE--
G0HFV7_CORVD/3-741KIIYTRTDEAPLLATYSLLPVIEAFAGSAGVEVETRDISLAARILAAFDDLLP.....AEQRVDDALAELGEITKTPD--
G8R0B4_OWEHD/6-739KIIYTKTDEAPALATYSLLPIISAYTDTAGVEVETRDISLAGRILALFPDFLN.....DDQKVGDALAELGALAKTPE--
Q167P5_ROSDO/9-739.IIYTKVDEAPQLASASLLPIIRKFAAAAGVSVGVKDISLAGRILAAFPEHLS.....ADQRQSDDLAELGKLVKTPD--
Q5E3X6_VIBF1/7-740KIIYTITDEAPALATHSLLPIIQAFAASSDIDVDTRDISLAGRVIANFPEYLT.....EDQRIGDALAELGELAKTPE--
B7FVA8_PHATC/76-804.ILYTETDEAPALATFSLYPVISKFSALANVDIVPCDISVAGRVLAAFPECLK.....PSQRVPDNLSYLGKKALEAD--
D6Z308_DESAT/5-739KIIYTEVDEAPALATYSLLPILRAYTRESGVAIETRDISLAGRIIANFPENLT.....KEQQIPDDLTELGRLCQLPQ--
A4GAN1_HERAR/6-739KIIYTLTDEAPALATYSLLPIVEAFTRSSGIIVETRDISLAARILAAFPDVLD.....DKQKIAPALAELGELATTPE--
D0LWU8_HALO1/6-739TIIYTKTDEAPALATYAFLPVIEAFAAPAGVSVETRDISLAARILAVFADVLE.....PEQKVHDALAELGELAKTPE--
Q9PA20_XYLFA/23-756KLIYTLTDEAPFLATQSLLPIIKAYTKVAGIQVETRDISLAGRILAKFPDVLT.....ETQRVSDDLAELGEMTASPD--
G2PQU0_MURRD/3-736KLYYTKTDEAPALATLSFLPIVKSFTETANITVETKDISLAGRIASVFPELLN.....EEQQVPDDLSILGELAKTPE--
F5XPH8_MICPN/8-738.IVYTRTDEAPLLATYSLLPIIAAYAAKAGVDIESRDISLAARILAQFPERLG.....ADQQVPDALAELGALAKTPE--
Q15T95_PSEA6/7-740KIIYTKTDEAPALATYSLLPIVESFASSADIEIELSDISLAARILANFADYLS.....DEQKVPDALAELGELTQDAA--
Q74D54_GEOSL/5-738KIIWTEIDEAPALATYSLLPIVQAFTKGTGVEVETRDISLAGRIIANFPENLT.....DAQKIPDFLTQLGELTQSPE--
L7W579_NONDD/6-738KIIYTKTDEAPALATASFLPIVKKFLAPAGIDVETRDISLAGRILAVFPERLK.....EGQKQEDALAELGNLVKNPE--
C6X4T6_FLAB3/30-761KIIYTWTDEAPMLATHSFLPIVEAFAKTADIEFSPKDISLSGRILANFPEFLS.....EDQKVEDALAELGKLATTPE--
F4AZL1_KROS4/7-740TIKYTLTDEAPMLATHSFLPIIKRFTQSSNIDMELVDISLAGRIVANFPDNLT.....EDQKQEDALLALGELAKQPE--
E3F024_KETVY/9-740.IVYTKVDEAPDLASASLLPIIRRFAKAAGIAVETRDISLAGRIISAFPERLT.....PAQRQSDDLAGLGHWVKTAD--
A5FHV4_FLAJ1/6-737KIFYTLTDEAPLLATYSLLPIVQAFTSTAGIAIETRDISLAGRILSNFPESLT.....DAQKTGDALAELGQLATQPE--
E3I1D3_RHOVT/8-741.IVWTKTDESPALASYSLLPIVQAFTKTAGVSVVEKDISLAGRLIATFADTLK.....PEQRQPDALAELGALAKRPE--
A1BEA8_CHLPD/6-739TIIYTKIDEAPALATYSLLPVIQAFAKGTGVDVETRDISLAGRIIANFPDNLT.....EEQKISDQLAELGQLALTPE--
Q2L0N5_BORA1/6-739KIIYTFTDEAPALATRSLLPIIQTFAKPAGITFETRDISLAGRIIAVFPEFLT.....ESQRIGDALAELGALALKPE--
D1BZX3_XYLCX/6-737TIIYTHTDEAPLLATYSFLPIVQAFAGQAGVALETRDISVAARILALFPERLT.....EEQRVPDALAELGRLADAPE--
E6WZW7_NITSE/6-726TIVWSKIDEAPALATYSLYPVVKKYVGKAGVNMRLSDISLAARTLAAMG............KHEDELAQLGELVHKPE--
A2U0V2_9FLAO/3-736KIIYTKTDEAPALATRSFLPIVKAFTKSSNIEIEVKDISLAARILANFSHYLT.....ENQKVEDALSILGDLAKQPE--
A1WFK0_VEREI/7-741TIIYTLTDEAPRLATASFLPIIRSFTAPAGIRVIESDISLAARVLAEFPEFLT.....EAQRRPNALAELGQKTLQAD--
A6W0E3_MARMS/6-738TIYYTFTDEAPALATASLLPIFGAFAKEADIELKLTDISLASRVIAAFSDRLP.....ADKQAEDGLKFLGDLTADPQ--
F4C4X4_SPHS2/6-739KIIYTKTDEAPALATYSLLPIVKAFTASSGIDVETRDISLAGRILAVLPEFLT.....EEQKVSDALTELGELATQPE--
E4TNZ2_MARTH/6-739KILYTKTDEAPALATYSFLPIIKAFTDSAGVVVETRDISLAGRIISQFPERLK.....PEQQINDDLAELGEIAKTPE--
F0RFA8_CELLC/3-734KIIYTKTDEAPALATQSFLPIVQAFTKTTGIEMETKDISLAARILAVFPDYLS.....KEQQFEDALAQLGELAKSPE--
A6Q7S1_SULNB/5-725TIIWSKIDEAPALATYSLLPIVSKFTNAAGVDVKTSDISLAGRVLAAMG............LAEDELSKLGELVHKPE--
E4TEW9_CALNY/5-739KIIWTKIDEAPALATYSFLPIVQAFFKGTGIEVEEKDISLSGRILANFPDFLK.....PEQRIPDYLAELGELVLKPE--
F5Z8R7_ALTSS/5-738KIIYTKTDEAPMLATYSLLPIIKKFASAADVEVELSDISLAARVLATFPEFLS.....EEQRVPDTLSELGAMTQDPE--
A7ZDM4_CAMC1/4-723.IIWTKTDEAPLFASYSLFPIVKSFLSRAGISITRADISLAGRILSLFSKELG.......LNKADELELLGELTAHKE--
C7RB77_KANKD/5-738KIIYTKTDEAPALATYSLLPIVEAFAKAAGIEVETSDISLAGRVIASFPEYLK.....EEQRIPDALAELGELVKKPE--
M5DRS5_9GAMM/7-740KIIYTQTDEAPALATYSFLPIVKAFTESAGVVVETRDISLASRILANFPDYLT.....EEQRQADALTELGQLAANPD--
L0GSZ1_9GAMM/6-739KIIYTWTDEAPALATHAFLPIIRAFAGAAEVPVDTRDISLAGRILAVFPDVLA.....DAQRVSDDLADLGQMVLSPE--
I3ZX83_ORNRL/7-736.IHYTLTDEAPMLATHSFLPMVKALTSLADIEIKLANISLAHRILANFPDYLE.....DEQRVDDALTQLGDLAKRPE--
X4QUI6_9ACTO/4-731.IIYTHTDEAPMLATASLLPIVTGFAAQAGITIEQRDISLAGRILAALSDFLP.....AEQRQPDALAELGALTQAPD--
A5WH86_PSYWF/3-738KIIYTKTDEAPALATQSFLPIVQAFTHSADIEVEVSDISLAARILALFPEYLN.....PEQQVPDALTELGQLVLKPD--
A7I2F0_CAMHC/4-731.IIYTYTDEAPAMATFSLLPIIKRFLKSANINIETMDISLAGRILANFPENLK.....ENQKVKDYLSILGKMTAEKS--
F6I9T7_ZOBGA/3-737KIFYTKTDEAPALATLSFLPIVKAFTKTADIGIETKDISLAGRIIAAFPDFLK.....EEQRIANDLEELGALAKSPE--
G8MDD3_9BURK/7-743TIIYTLTDEAPLLATSAFLPIIRTFTAPAGVNVATSDISVAARILGEFPEYLT.....DAQKVPDNLAKLGELTQDAD--
F2J468_POLGS/28-761.ILYTKVDEAPELASASLLPIIRAFTKQAGITVGIKDISLAGRILAAFPDYLA.....DAQKQPDDLAELGTLVTEPD--
C0QS34_PERMH/5-743TIVWTKIDEAPALATYSLLPIMRAFTKDADINIELRDISLAGRIIAQFPDILP.....EDKRIPDELAYMGELVWKPE--
O53611_MYCTU/7-741TIIYTLTDEAPLLATYAFLPIVRAFAEPAGIKIEASDISVAARILAEFPDYLT.....EEQRVPDNLAELGRLTQLPD--
G4QH54_GLANF/7-739KIIYTITDEAPALATQSLLPIIKAFTASSGIDVETRDISLAGRIIANFPDYLT.....EEQRIGDDLAELGELAKTPE--
W0DU46_9GAMM/6-739TIIYTHTDEAPALATYSLLPIIQTFTAAAGVAVTTRDISLAGRILAQFNDYLT.....PEQQISDALTELGELAKTPA--
C3PLB9_CORA7/3-723KIIWTRTDEAPLLATYSFKPVVEAFASTAGIEVETRDISLAGRILAQFPERLG......DKKVSDALAELGELAKTPE--
Q4JTI7_CORJK/3-736KIIYTRTDEAPLLATYSLKPIVEAFASTSGVDVETRDISLAARILAAFSDVLP.....EEQKVDDALAELGELAKTPD--
D1BGD8_SANKS/3-734KIIYTYTDEAPMLATHSFLPVVSAFAGTAGVELETRDISLAGRIIAAFPERLT.....DAQRIGDALAELGELATTPE--
Q1R071_CHRSD/6-739KIIYTLTDEAPALATHSLLPIIAAYTSTAGVSVETRDISLAGRILAQFPDLLS.....DEQRVSDDLSELGELAKTPE--
D4H3K7_DENA2/6-741.IVWTEIDEAPALATYSLLPMVQKFTKEADIAVETRDISLSGRILANFPDKLK.....DDQKVEDYLTQLGDWTQSPE--
Q7VGX2_HELHP/2-729KITYTLTDESPALATYSFLPIAKAFLRHANIEVATSDISLSARILAQFPERLK.....QEQQVEDALSILGDLVKTKE--
Q2W9R4_MAGSA/37-771KIIWTKVDEAPALATYSLLPIVQAFTGAAGVAVETRDISLAGRIIANFPENLT.....PAQRIGDELAELGELTLKPE--

PF02504

PLSX_SYNY3/6-328----GDYA----PE...EIV--------------------------------IGAIRASQELD.VD-IFLVGDRQAIEDC
PLSX_HELPY/1-317----ADHG----VL...PVI--------------------------------EGVSRALENKS.FS-TVLVGDKDKATPF
PLSX_CHLTR/3-311----GDHD----PLVVWEAL--------------------------------GEVLLSSTGEQPVE-FTVFATSDVHHQL
PLSX_ECOLI/4-331----GDFG----PS...VTV--------------------------------PAALQALNSNSQLT-LLLVGNSDAITPL
PLSX_BACSU/1-321----GDHA----PK...AVI--------------------------------DGVIKGIEAFDDLH-ITLVGDKTTIESH
PLSX_AQUAE/2-322----GDYA----PL...EIV--------------------------------RGCILAAKELG.YK-IYLVGDKEQIIPI
D5AUL6_RHOCB/12-337----GDRG----PA...AVL--------------------------------DGIALARRKYPDLH-FLVHGPEAELAPL
I3VW60_THESW/1-316----GDYA----PR...EII--------------------------------KGVEKALDSFD.IE-IILVGNKEQLDKY
W8T1H7_EUBAC/28-365----SEHG----VE...NLV--------------------------------KGAELAAKDAAGFD-IVLIGPKVETSLE

PF01515

PTAS_BACSU/3-319....GKDVKIVFPEGLDERI--------------------------------LEAVSKLAGNKVLN.PIVIG..NENEIQ
EUTD_ECOLI/1-320....RAPARVVFPDALDQRV--------------------------------LKAAQYLHQQGLAT.PILVA..NPFELR
PTAS_CLOTH/2-324....SDVKTIVLPESTDLRV--------------------------------IKAASMIMKKGIAK.VVLIG..NEKEIK
MAO1_RHIME/441-763...NAAKNRVIFAEGEDERV--------------------------------LRAAQVLLEEGTAK.PILIGRPQIIETR
PTAS_CORGL/5-322....AEHSHIVLPEGDDDRI--------------------------------LMAAHQLLDQDICD.ITILG..DPVKIK
PTA_SYNY3/374-693....AAQRHIVLPEGEEIRI--------------------------------LKAAASLINHGIVR.LTLLGNIEAIEQT
PTB_CLOB8/4-295....VPTKKVAVAVAQDEPV--------------------------------LEAIKEATENNIAQ.AILVG........
PTAS_BORBU/10-350VKENKLKANIVFPESSDSRV--------------------------------LKAAIVILQKNLADSIILIGKKDTVINS
PTAS_MYCPN/2-315...AGKKPVIIFPEGWSPTV--------------------------------MEAVNQLQQAGILT.PPVIF.RTRSEVP
MAO2_HAEIN/429-750....SAKQRIILAEGEENKA--------------------------------LHATQEVISMGLAN.PILIGRRSVIEEK
PTAS_CLOAB/2-326....QDKKRIILAEGEEKRN--------------------------------LIAADKIIKEGLAE.LVLVG..DENKIK
MAO2_RHIME/438-756....RQPKRIVFAEGEEVQM--------------------------------MRSAIAYANQQLGT.ALLLGREEVMRET
A1B2J3_PARDP/4-314....ALDRHIILPEGEDPRV--------------------------------AEAARRLLAAGLAR.VTLMG...GPEIP
I3VW55_THESW/3-324....SDKKKIVLPEGAEPRT--------------------------------LKAAEIVLKEGIAD.LVLLG..NEDEIR
PTB_CLOAB/4-295....KEMKKVAVAVAQDEPV--------------------------------LEAVRDAKKNGIAD.AILVG........
PTA_MYCTU/365-682....SDLMRIVLPEGDDDRI--------------------------------LKSAGRLLQRGIVD.LTILG..DEAKVR
Q32DP2_SHIDS/392-707....KAGKRIVLPEGDEPRT--------------------------------VKAAAICAERGIAT.CVLLG..NPAEIN
Q6MTX6_MYCMS/5-317...KSEKKSIVFPEGESEII--------------------------------QSVAKTLVDEKLGL.PILLF.KSSKEVP
Q8TK18_METAC/4-325....KLNKTIALPETEDIRT--------------------------------LQAAAKILERGIAN.VVLVG..DEADIK

PF04166

F9D1K6_PREDD/35-324----PKIA..AYHRKAL.NI..........------------...........EGNFSIIAD...A-R............
D7BZZ5_STRBB/44-335----AARL.....RQAA.RL......R...------------.G........IDCEIVPV.....S-G............
K9XHU5_9CHRO/45-341----QAQL.....TKTYEQL..........------------........................-.............
K9Z747_CYAAP/38-335----RSHL.....EKTYHHL..........------------........................-.............
F3ZVB4_MAHA5/32-323----HDVV.....DNIM.HI......C...------------.G........INADIHDIYS...P-E............
D4G8G2_RIEPU/43-336----PDLL.....EERSRDL..N...L...------------...........KLNLIPYSK...K-S............
E3I1T8_RHOVT/40-335----PALF.....EARA.AL......L...------------.G........IAVRVMRIAR...P-E............
F0R264_BACSH/34-324----PKVA..AYHRKAM.DI..........------------.........S.T.NFSIVNS...A-S............
Q1LSS1_BAUCH/32-325----PYLL.....IHRVKQL..G...L...------------..........PPLLLHPYQP...N-Y............
D5WYG1_THIK1/23-322----AAWL.....ARTA.RT......L...------------.R........FSPDSSRP.....A-I............
Q10ZN5_TRIEI/41-337----RQIL.....QETYQQL..........------------........................-.............
Q7MTA8_PORGI/34-326----AKVA..AYYRKTL.EL..........------------.........D.LESWNQVSS...A-T............
G2TI06_BACCO/34-325----LKIL.....KRAL.AV......T...------------.G........CNLHLNSI.....S-S............
Q3V872_LEGPH/26-315----LSLL.....EARASEL..N...L...------------...........SIKFLEYSP...H-Q............
B1ZNR3_OPITP/35-329----VGVL.....RRVSALL..........------------.......GIPFYAPILKPDT...W-T............
K9SRP6_9SYNE/31-333----RSVI.....TSTYQLL..........------------........................-.............
Q3B5B9_PELLD/30-323----YRVL.....EHYR.QA......L...------------.G........LPIELERVED...A-R............
R6EJC4_9BACE/37-325----SKIF..GFYRKQIHNL..........------------.........E.QLDTYVINS...A-K............
M4Q2H5_LIBAS/32-328----VDVL.....NARA.KQ......L...------------.N........LSVPLYE.TD...C-K............
PDXA1_BRADU/37-333----GAAL.....DGAK.AA......L...------------.G........TDVAIPQVSA...D-.............
PDXA_XANP2/36-328----PEAL.....KARV.RQ......L...------------.G........LTVPLAE.TG...P-E............
D3EPC7_ATETH/40-355----KSIL.....LQNYQQL..........------------........................-.............
X2H9I6_9NEIS/29-319----MQLL.....QQRAAQL..N...K...------------...........KITIQAYQP...D-S............
L0ETE9_LIBCB/39-331----PDVL.....NARA.KT......L...------------.N........LDISIRE.AN...C-S............
B4F2I1_PROMH/31-324----PQLL.....RARAQQL..N...L...------------...........PLTLVEYSP...D-N............
V5UBQ7_9BURK/58-340----ASLL.....ASRAQAV..GLGDAWQA------------LLAG....................-.............
A6VU54_MARMS/37-327----PALL.....QDRALTL..G...L...------------...........AVNIQTLNS...A-Q............
C4XST4_DESMR/41-331----ETALVWHAERLGLARF..........------------........................-.............
M7SPY7_EUTLA/39-323----RSEL.....DSAIADAGGVHVPASDD------------PAGPHNVQVLDDNTASQYQS....-.............
Q0K4Q7_CUPNH/34-327----RDEW.....RHGMRIAG.VEL.....------------................ALAE...T-DAPAFADDGKPRL
D4J4Q1_9FIRM/33-335----AAVM.....EAAV.GI......V...------------.G........KNVKINAV.....S-D............
A0JTQ9_ARTS2/490-781----ALRL.....RQAA.DV......L...------------.G........IEADIHTI.....E-K............
W0DDM8_9AQUI/28-311----EKIL.....KACAKEL..........------------.G........RDFTANLINS...P-Q............
G4RBH1_PELHB/33-315----RHLM.....NPFVRAGG.FEIE....------------........................-.............
D2R6V9_PIRSD/43-337----AEVL.....TRVSAAT..........------------.......GISWQADVISLGE...W-N............
G7Z7B0_AZOL4/38-329----PDRL.....SALA.AR......L...------------.G........MAVPVREVAS...P-G............
I7HG37_9HELI/28-302----LEIV.....ESAAKIL..........------------........................-.............
R6SBC2_9BACE/34-324----PKVA..AYHRKAM.DI..........------------.........Q.T.NFSIVPS...A-A............
D9RAU4_CLOSW/32-323----RKVM.....EQAV.RI......T...------------.G........TDLKIKTVKA...P-E............
F0NYL8_WEEVC/36-325----TKLL..NFHKDIL.KL..........------------..........DRIYLQGIPH...A-S............
F2IC16_FLUTR/45-335----SKTI..SFHKKAI.NE..........------------.........P.EFNYQNCKS...A-T............
M1PE68_DESSD/26-315----KNVL.....NVYA.Q...........------------........................-....RLAIDCT..
H1Z8Q7_MYROD/36-324----SKPL..SYIKKNI.NS..........------------...........NVNFQGIDS...L-D............
PDXA_BACHD/33-324----GDML.....EKML.PV......M...------------.K........ADLTINRITT...V-D............
Q3SGF8_THIDA/30-317----VQVL.....EARARQL..G...V...------------...........EVEFLA......G-E............
R5KK03_9BACT/34-324----PKVA..AYHRNAL.GI..........------------.........Q.A.NFTIISS...A-A............
B8IWD3_METNO/40-332----RCVI.....ERGAAVAG.VEL.....------------DLRYVAPGEPIPQNSARPIF...V-D............
K9TXI9_9CYAN/42-377----KQVL.....LDTYDRL..........------------........................-.............
PDXA_SYNJB/34-331----RQVL.....EATYRLL..........------------........................-.............
Q1QSM0_CHRSD/42-333----TWLW.....EEGQRIAG.TRL.....------------..........DLPVIERFAE...A-R.....EYTTPVL
K9SMQ8_9CYAN/47-343----RHQL.....ESHFAVL..........------------........................-.............
PDXA_PROAC/35-325----PAII.....SRAC.SV......T...------------.G........LSETVRRVTS...E-E............
L0DWB4_THIND/35-324----PALL.....EQRARQL..R...L...------------...........PLRIVTFAP...D-G............
H8GMF2_METAL/35-325----EELL.....LERAERL..G...I...------------...........EIKLNRFDG...T-L............
PDXA_GEOMG/34-325----SAAM.....ARGI.TV......A...------------.G........AALRVERT......-D............
R4I106_9ENTR/29-321----PILL.....IERAHLL..N...L...------------...........HITLFDYNP...Q-Q............
E1SLK8_FERBD/27-319----PELM.....TQRAKML..G...L...------------...........PLSLRPYQP...S-Q............
A1AU02_PELPD/36-329----PAAL.....ERAV.RV......C...------------.G........SALPIRVV.....E-S............
PDXA_RALSO/37-328----AALL.....QARADAI..GLGDAWRD------------AA......................-.............
PDXA_THISH/31-321----PALL.....RERARLL..G...L...------------...........PLEIRPFDP...Q-T............
Q3V808_RHISN/34-320----PAVM.....AKAI.AS......L...------------.G........GGLHLNEI.....H-D............
D3VCQ4_XENNA/32-324----PEML.....LSRARQL..N...L...------------...........PLQLQTYSP...E-L............
PDXA_AGRT5/37-329----PDVV.....ASRA.AL......I...------------.G........VPVNIET.CD...P-E............
G7URF7_PSEUP/27-304----VEVM.....GDAVRIAG.LHAQV...------------........................-.............
G0IUL6_CYCMS/36-326----GKAL..TYYRKAL.DM..........------------.........N.DFNFIQVKS...I-D............
R7J8E6_9PORP/34-325----SKVA..AYHRKAL.DL..........------------.........P.AVNINVVSR...A-E............
J3Z564_9ENTR/29-321----PFML.....EARARQL..Y...L...------------...........PLRLRPYCS...T-Q............
I1F0R6_AMPQE/348-642----PELL.....EERARML..G...I...------------...........DIDLRPVDE...N-A............
K7AU99_9ALTE/28-319----GDML.....RQRAKEL..N...L...------------...........AITLVPYDQ...D-N............
PDXA_SYNY3/35-336----RSVL.....DQTRRQL..........------------........................-.............
E1VLH2_9GAMM/30-317----AEML.....ARRAQQL..G...L...------------...........GVQLVPDDG...G-D............
R4KFZ8_CLOPA/32-323----KEVL.....KKAL.DI......T...------------.N........ISLKLNAVSS...P-D............
R5Y392_9BACE/33-324----SKVA..AYHRKAL.DL..........------------.........P.PFNFNIITS...A-E............
W0PFJ8_9BURK/36-327----VASL.....RKAV.AN......L...------------NG........DVSKVREISA...P-A............
R6YA75_9BACT/37-327----SKIF..GFYRKLIHNL..........------------.........D.QMDTYVIQS...A-K............
R5TI46_9CLOT/31-334----TFVL.....KNAA.RI......V...------------GR........PEIRINTV.....E-K............
A5FXM2_ACICJ/38-335----GHRL.....AAAC.AG......L...------------.G........IAQPFAAVSA...D-T............
PDXA_RHOBA/37-349----AAIY.....HRAAKKL..........------------........................-.............
R6W392_9BACT/35-320----PKAA..AFHRKAL.GL..........------------..........EPTGYAVISH...A-G............
K9QGD1_9NOSO/46-349----WNWL.....VQTYDEL..........------------........................-.............
PDXA_XYLFA/29-316----PATL.....QAAAAAL..........------------...........DLPLRLLPP...E-A............
F2LWP1_HIPMA/33-327----PDVF.....EFYM.DK......F...------------.N........LALNINLIES...P-D............
PDXA_CAUCR/30-324----AQLL.....AS...AG......G...------------.G..........VKVRAVTR...P-Q............
F5YGA4_TREAZ/37-343----TPVI.....EDAL.KV......T...------------.N........ITFTLNKI.....S-S............
K9RH38_9CYAN/45-348----RSLL.....LENYTNL..........------------........................-.............
R5P2E5_9PORP/33-319----SKVA..AYHRKTL.NI..........------------..........ENFNLNSIQT...P-R............
D2QDF7_SPILD/236-527----MRIL..NRYRNLL.NL..........------------.........K.DWNLNGAQT...I-G............
C4LDY8_TOLAT/35-322----IPII.....ERAM.KI......R...------------.N........CDFNINKITK...P-S............
K9T599_9CYAN/41-347----RSLL.....QQTYQKL..........------------........................-.............
PDXA_WIGBR/31-321----PDIL.....VKRAKDH..G...I...------------...........KLKLHFYNK...N-L............
F4LQ79_TREBD/32-322----SRIM.....EEAV.KI......T...------------.G........LPLRIRRIQD...P-S............
E3HED3_ACHXA/32-321----AGAL.....RRAA.AQ......L...------------.G..........ARLEIV.....E-V............
E6WQK3_PSEUU/29-316----PEVL.....AAAAAAL..........------------...........GLPLNLLPA...D-A............
I3Y835_THIV6/27-318----PDLL.....AARARNL..G...I...------------...........ALRLQTFDP...H-T............
PDXA2_BRADU/38-337----EALI.....ARRA.KT......L...------------.DKTLGKALGAEIRIAS.VS...A-H............
Q12FB7_POLSJ/51-359----VATL.....RRAA.AL......V...------------.A........SPLALPVAEF...A-E............
G4L110_OSCVS/33-352----ASCM.....EYAL.QV......AERL------------RG........VRLALHRV.....K-S............
K9UJS8_9CHRO/31-336----RELL.....IDRYEYL..........------------........................-.............
H8KWR5_SOLCM/37-327----VKIT..SFHRKAL.NI..........------------.........Q.DFSFNIIQN...T-E............
F2K4J5_MARM1/33-323----PAVI.....EARANAL..G...I...------------...........DIHINICSS...V-D............
S6BVY4_9GAMM/29-317----PALL.....EERAKRL..D...L...------------...........PLTLLPFED...G-T............
A7I3Y6_CAMHC/27-298----RELL.....NQAAEIS..........------------........................-.............
F0SPW7_PLABD/43-344----KTVF.....EK...........LIDC------------PGFEDVAAVYQQLPVVAWEE...F-R............
D5MIQ8_9BACT/37-328----AGIM.....RRAI.RL......C...------------.R........LDLVVRSI.....A-S............
F2NDA2_DESAR/37-329----LPAL.....EKAR.AV......C...------------.G........SRARLHAT.....D-D..PGSGFYQP..
A4CID9_ROBBH/38-321----GKTI..SHQKAHF.CL..........------------...........DIGFQGVGD...A-S............
B3PKV3_CELJU/31-323----PAML.....NERATAL..G...L...------------...........PLMIKPFDP...G-L............
Q2YBP4_NITMU/30-318----RELL.....QERAHLL..R...L...------------...........PLTITDYSS...R-A............
Q145L2_BURXL/43-326----ADLL.....AERARAV..........------------...........GVDWRALVA...D-G............
C7PP38_CHIPD/38-328----NKTI..NFYRKLM.NE..........------------.........N.NFNYQSVKE...F-A............
D5BRI0_PUNMI/31-320----VPRL.....ESLA.ST......L...------------.G........IEIPIIS.IS...Q-L............
K0C9N5_ALCDB/29-316----RQVL.....HDRARLL..G...V...------------...........QATWPQWQP...G-D............
F6ACQ2_PSEF1/33-324----ARRL.....ADAN.RI......V...------------.G........GSLEVNAI.....E-H............
W8WYV9_CASDE/45-334----AGAL.....RRAC.RA......L...------------.G........LDGRLEIR.....P-L............
A1BHC0_CHLPD/30-323----FKTM.....TYYR.DR......L...------------.D........LPVHLTLISS...T-T............
L0FWR6_ECHVK/32-334----ATTI.....AHMA.EQ......L...------------.Q........APLTVKPI.....E-T............
B8CSX4_SHEPW/8-300----PELL.....QARAKKL..G...L...------------...........AIQLRPYQP...N-Q............
F7YI45_VIBA7/28-321----KSLL.....AERAKEL..N...I...------------...........DVILEDYSI...T-S............
Q2W0V4_MAGSA/33-323----AGRL.....RSLA.AR......L...------------.G........LDVPVVEVSS...P-T............
Q11UL9_CYTH3/38-329----YKLL..ARYKKIL.GL..........------------.........YEELNFHSIRS...I-Q............
D7A738_STAND/37-327----PELL.....RARA.EL......L...------------.G........LAVPVEE.ST...P-E............
W0ERT9_9PORP/33-324----AKVA..AYHRKAL.DI..........------------.........P.AVNFNIIAD...A-S............
R6ZD40_9FIRM/33-335----KEAL.....LDAL.SF......C...------------.G........LPLELREIKN...T-D............
Q0VMV3_ALCBS/33-325----RQVL.....SERAQQL..G...L...------------...........TVALSDWQP...G-D............
M1LX07_9CLOT/31-321----LKIL.....ERAT.AV......T...------------.K........SKVTFNKV.....E-H............
Q6LV40_PHOPR/30-323----AQLM.....VERAAQL..G...L...------------...........PLEVKHYDA...T-L............
I4WVN0_9GAMM/31-318----RHLL.....QRAAARC..G...L...------------...........AVELADDDG...S-A............
R5AZH6_9BACE/43-334----GKIA..AFYRKAL.NL..........------------.........A.PIQWHQIDN...V-D............
A8ESJ0_ARCB4/32-303----NKML.....TQASSLL..........------------........................-.............
D5C4K3_NITHN/29-320----PEVL.....TQRARQR..G...L...------------...........ALALDIYDP...V-Q............
D4LRH6_9FIRM/31-357----AKCM.....EAAI.PT......VK..------------GA........ESMKINVI.....H-D............
PDXA_DESAH/34-326----EGVM.....ERAI.DL......K...------------.S........ARMDVHTT.....D-T..PAGGKYCH..
Q7VHV2_HELHP/28-304----REVL.....ESASTLL..........------------........................-.............
C5BPB7_TERTT/27-316----GEML.....AQRAEQL..G...V...------------...........PLTLIPFEE...G-R............
K0C3B1_CYCSP/29-319----PNLL.....ARRATKL..N...L...------------...........SIDIQQADL...R-Q............
PDXA_AQUAE/29-313----EKTL.....LEASKLT..........------------.G........IKLNYKKIEK...V-E............
Q3V7R0_BARHE/29-325----PDVI.....RARA.HF......L...------------.Q........IDVKVEA.VL...T-D............
F0S0E1_DESTD/33-310----KGVL.....SFYS.KL......L...------------.R........LPFSIKEV.....S-S............
X4ZK45_9BORD/30-329----YWLW.....EEGNRIAG.TPLPETEL------------ISSLDNVRARSDTSRAAFLA...M-D............
Q31F25_THICR/26-318----KTLL.....TERAAQI..G...L...------------...........PITLTTFDA...S-Q............
D5A6D6_ARTPN/31-330----RWVL.....ENTYQQL..........------------........................-.............
Q1LRA2_RALME/46-333----ARLL.....DQRAEAL..GVAHAWAR------------RIAD....................-.............
A4FFA9_SACEN/36-326----ATAL.....RRAV.EV......C...------------.G........LDVEVNTVSE...V-S............
PDXA_CHRVO/29-318----HALL.....ADRAAAL..G...L...------------...........NLELADYRR...D-R............
R6FKU7_9BACE/34-324----PKVA..AYHRKSL.DL..........------------.........S.T.NFSIVNS...A-S............
K9V9D2_9CYAN/37-340----ARLL.....AKTYTQL..........------------........................-.............
R6XPS3_9BACT/34-324----PKVA..AYYRKAM.NL..........------------...........PGQFSIIQK...A-E............
K9YBG1_HALP7/36-336----RSLL.....EKTAQQL..........------------........................-.............
A1STS2_PSYIN/28-319----KRLL.....AERALQL..N...E...------------...........QVTLLDYDP...K-I............
A1WLE5_VEREI/41-335----RWLW.....KEGQAIAG.LKV.QTVP------------VSDFAEVRDRDMLSIPAFLE...M-D............
R6F0Q9_9BACT/34-321----PKIA..AYHRKAL.DI..........------------...........QASFSIINK...A-E............
PDXA_RHOPA/35-328----AGCL.....SRCA.KL......L...------------.G........LDVPLAE.VK...A-E............
PDXA_DESOH/33-325----PGVL.....GQAM.AV......A...------------.G........YAPVIHMT.....D-T..PETGVYRPGT
G2PNX1_MURRD/35-323----NKTV..SQQMKDL.GI..........------------...........DLKFNGVRD...A-D............
G7UQC7_PSEUP/28-315----PVVL.....QAAAQAL..........------------...........GLPLNLLDS...G-A............
PDXA_SACD2/29-320----PQLL.....KDRAKLL..G...L...------------...........PLTVSTYIQ...G-S............
E6VTD1_DESAO/30-339----AAPLHRELKRLDLPAF..........------------........................-.............
Q24RU8_DESHY/36-320----QRLF.....KRGMEIAK.VRV.....------------.DFQVAATLEEALTMDGIVV...L-D............
R5L6M7_9SPIR/33-320----KKAL.....ERVL.Q...........------------..........PNILLKKINT...P-L............
K9TNE7_9CYAN/53-349----RKLL.....QGCYQQL..........------------........................-.............
D3IAQ7_9BACT/34-319----PKLA..AYHSKVL.EI..........------------...........PTNFTIINS...A-R............
D5BDL9_ZUNPS/47-332----TKII..TFLKKKY.KL..........------------...........AINFQGIDS...A-E............
Q2IHP1_ANADE/33-321----RRVL.....ARALGDL..........------------........................-.............
R6CJV8_9BACT/34-324----PKVA..AYYRKAM.NL..........------------...........PAQFSIIQK...A-E............
R6WB32_9FIRM/32-323----KTII.....ENAI.KI......V...------------.G........VDLTVHVISE...A-E............
E4RQ40_LEAB4/33-324----GKHL..NKYKSII.GL..........------------.........N.NWQYTIIND...P-A............
W6RZF2_9RHIZ/33-317----TEAL.....ERAN.RA......A..A------------TG........LSFAP.........-.............
Q11HH0_CHESB/29-325----PALL.....SARI.RL......L...------------.K........LDISIVE.AE...P-E............
E6SJ78_THEM7/43-331----RGAV.....ERAR.AL......V...------------.P........GAPAVRVVAD...P-A............
F9ZZH4_METMM/31-322----PELL.....KERAALL..G...L...------------...........PLTIRTFAA...D-K............
L7W827_NONDD/35-323----TKLL..SYYAKSF.GL..........------------...........KTKIHGITS...L-D............
F3ZNL8_9BACE/34-324----PKVA..AYHRKSL.EI..........------------.........S.T.NFSIINN...A-E............
R7HMN9_9BACT/35-323----SKAL..SYHRKAL.EM..........------------.........G.NVNFTLVPR...A-E............
W0JF83_DESAE/33-320----SNVF.....EFYK.RL......F...------------.K........LDFKINAIDR...L-D............
PDXA_RUEST/31-317----PRHL.....P................------------..........SSHPWQPVSA...P-A............
C7R7U0_KANKD/33-321----PTLL.....KDTAQQL..H...L...------------...........PLELSVFNT...N-E............
Q0AC81_ALKEH/31-319----PQLL.....RARAALL..G...L...------------...........EVRIEPVES...A-.............
PDXA_DESAA/33-325----LKVM.....EQAE.SL......I...------------.R........SGLDFRPA.....G-S..PEDAAYEY..
A4YT91_BRASO/34-325----PAFL.....AQRA.KL......L...------------.D........LQIPIAE.AR...P-E............
K4KQ47_SIMAS/25-316----GDLL.....RARAASL..K...L...------------...........PLSLYPFDP...A-S............
F9YQW3_CAPCC/34-322----NKTI..SFQRKHL.NI..........------------...........NVNFQGIDL...L-E............
D5V304_ARCNC/38-309----KDLL.....KDGAKLL..........------------........................-.............
D4MSX7_9FIRM/33-348----AKMI.....EQAA.RF......V...------------GR........PDINIHRC.....E-K............
M5DPJ7_9GAMM/27-319----ADLL.....HQRAAEL..G...L...------------...........PLTLQVFDP...D-S............
A6TJU5_ALKMQ/33-334----AKVL.....EAAI.AI......C...------------.N........KDLKVNVV.....S-N............
E0URZ3_SULAO/30-300----RTML.....QKASARL..........------------........................-.............
N0BC98_9RHIZ/43-337----FKLM.....RATC.SS......L...------------.........ALHCDVVSAPD...A-V............
PDXA_XANCP/28-315----PDTL.....HSAAKAL..........------------...........CLSVRLLDP...D-Q............
F2NA55_CORGP/35-342----ASMI.....EMAC.GI......A...------------GH........PEMRVRRV.....E-R............
B4RBS3_PHEZH/33-326----AQAL.....ASAP.AG......G...------------.A..........GLVRTIQS...P-D............
K0NNW0_DESTT/36-328----SHII.....KKAL.SL......L...------------.N........ISNNINII.....D-N..PEQGKYQS..
M1FJA7_9ALTE/30-319----QPLL.....EARARLL..G...L...------------...........SVQIIAWQP...G-M............
K4RKJ5_HELHE/29-301----RDLL.....VQANALL..........------------........................-.............
C0ZNI3_RHOE4/384-675----AKRL.....RLAA.TV......L...------------.G........IDVDVVAI.....E-E............
Q65VM2_MANSM/32-323----IPIL.....ERAA.KV......R...------------.G........VSIKFNKIQD...P-S............
A6H263_FLAPJ/36-324----VKIL..SFLKKEL.RL..........------------...........EAPLHGIDR...L-D............
B5YL57_THEYD/32-311----KAVI.....KELIKVI..........------------.GMDFDLDNIEMLNLNEIKN...P-S............
PDXA_PROA2/35-326----AEAL.....LYYS.KR......L...------------.G........LSIDI...RT...I-D............
B1WU75_CYAA5/40-358----RSLL.....HQTYQQL..........------------........................-.............
I0IQ54_LEPFC/42-330----PEIM.....KDVA.RR......Y...------------.E........PSLVVRTI.....T-D............
B7K1J6_CYAP8/40-344----RSLL.....QDTYQRL..........------------........................-.............
K9VBC1_9CYAN/53-351----RRVL.....QETYDRL..........------------........................-.............
C6VZ75_DYAFD/37-328----LRVL..NQYRNLL.EM..........------------.........K.DWTLHGIQK...A-E............
A3DDY3_CLOTH/32-324----KDAI.....CQAL.EI......C...------------.G........LDSRINVVDE...T-L............
B0UIV0_METS4/30-326----PDFM.....AERA.AR......L...------------.G........LAVPVAA.AA...P-E............
K8GJQ6_9CYAN/32-348----EYLL.....EKTYHQL..........------------........................-.............
F6ILZ0_9SPHN/44-324----AAAV.....ERALDMTG.VKARV...------------........................-.............
A2TY27_9FLAO/35-323----TKAI..SYHKKTL.GL..........------------...........ETPVHGITS...I-N............
PDXA_OCEIH/33-325----TKML.....ERAA.KI......L...------------.D........VDVSFDKKT....K-D............
D2UFS9_XANAP/28-315----PDTL.....RAAAAAL..........------------...........SLPLQLLPE...S-S............
E6X8R2_CELAD/35-320----NKTI..SFQKSEL.NL..........------------...........EINYHGVQE...A-S............
PDXA_SYMTH/33-323----SRVM.....ARAF.ET......T...------------.G........VKLNLNPVAT...P-A............
B5Y706_COPPD/31-322----SIPL.....QKAM.KV......S...------------.G........VALEINRIDN...P-E............
F8EQB4_RUNSL/37-328----MRLL..NRYRNQM.DM..........------------.........K.EWNLFGLQK...I-E............
I3YUG2_AEQSU/35-321----VKLM..SFFKKHY.EI..........------------...........DINFHGIDK...I-E............
B8ET21_METSB/41-335----ADHL.....GALA.RS......L...------------.G........IEAPIARVAS...A-A............
F8GL31_NITSI/33-321----SDLL.....LARAQQL..K...L...------------...........PLKLIDISV...T-N............
PDXA_GEOLS/34-329----RRAM.....QRAL.TV......C...------------.N........SPLELITV.....S-S............
E4PQY6_MARAH/32-319----RPLL.....EARAKQM..N...L...------------...........AVELRAWQP...G-E............
Q5WKA6_BACSK/32-321----AAVL.....EKLL.PV......V...------------.K........ADLTINKVNT...P-A............
C1D5J7_LARHH/29-317----ASLL.....ADRAATL..G...L...------------...........LARFAAYDP...A-A............
F4B1R1_KROS4/36-321----AKTL..SYIKKSL.SL..........------------...........QAEFHGIDA...F-A............
D6Z2T8_DESAT/51-341----LGVL.....AQCA.R...........------------........................-....QLGVKVE..
C9LXC2_SELS3/37-327----KGTM.....EQAI.GV......C...------------.G........VKARIHTVEE...P-A............
G4QFQ7_GLANF/29-320----ADML.....QERATLL..G...V...------------...........PLDIIPYDA...G-S............
PDXA2_PSEAE/35-329----EAEM.....RRGMRIAG.CEF.....------------..........PYRRIDALET...L-D....FADATPLL
Q0RWE6_RHOSR/36-321----RCVV.....EPLAHRAG.MTVRE...------------........................-.............
PDXA_CYAP7/30-337----RSLL.....EESYHQL..........------------........................-.............
M4ZUB5_9FLAO/36-325----QKLC..FYYKKIL.NM..........------------.........E.INNIREIKN...F-K............
R7G4X4_9FIRM/35-326----IAIM.....ERAA.KV......L...------------.G........KELKYNKIED...P-S............
D3RQF4_ALLVD/35-326----PDLL.....AERAARL..G...L...------------...........SLTIAPFDP...A-Q............
D8JA34_HALJB/30-324----ADVV.....ESAR.GI......C...------------.G........SDLGVERI.....A-S............
D3SLG0_THEAH/28-312----YKIL.....RACASHL..........------------.G........MDWEFPTVEK...V-E............
F0SBZ7_PEDSD/33-323----TKVA..SFHRKAA.GI..........------------.........N.EFVFQVIND...A-E............
D3SBX0_THISK/44-331----PDVL.....EQRAQQL..G...Q...------------...........SIHLIPFDP...A-R............
A8IH54_AZOC5/35-332----NAAL.....HGAQ.KA......L...------------.G........STVAIPEVSA...D-.............
F8KS88_HELBC/29-303----SQLL.....EQANALL..........------------........................-.............
U5RZ60_9CLOT/33-326----PKFL.....KKAI.EI......T...------------.N........SDVSLNLI.....N-D............
B0SWM5_CAUSK/34-324----AQLL.....AS...AG......G...------------.G..........VKVRPVTG...P-A............
PDXA_SULSY/29-314----KKAL.....EKAKKLT..........------------.G........VDLNIKEIKS...I-N............
V4LB68_9GAMM/33-335----PRLL.....YERAEHL..H...L...------------...........PIQLLPFDP...Q-K............
B3ENY2_CHLPB/30-323----AEAL.....RFYT.VK......L...------------.G........LGVNIAAFTS...F-D............
R5Q2C0_9BACT/34-312----PKIA..AYHRKAL.DI..........------------...........QANFSIINS...A-E............
G2Z4E3_FLABF/35-323----VKII..SFVKKII.GS..........------------...........NSMIQGIDH...L-D............
C6XKP9_HIRBI/31-329----SDIL.....KNSQ.EL......S...------------.G........VDGNIQIIQT...P-A............
Q0K4F5_CUPNH/34-323----VRRL.....EVAG.RL......V...------------.G........SPLKLRAI.....Q-A............
W0BBF6_9GAMM/27-315----KSLL.....AQRAEQL..G...L...------------...........NIVLKDYSV...R-E............
K9XSR0_STAC7/33-337----RDYL.....QTTYKHL..........------------........................-.............
B6JGM3_OLICO/32-326----ADLI.....RRRA.ER......L...------------.G........VRIEIAE.TS...P-Q............
D5SV98_PLAL2/38-331----AEVL.....EAAAAST..........------------.......GQKLATPVISLSE...F-T............
PDXA_SERP5/29-321----PALL.....LERARQL..D...L...------------...........PLQLRTYQP...Q-Q............
C7RNL8_ACCPU/39-326----RSLL.....VETAAAL..N...L...------------...........SVVFRDWHP...A-S............
R6WFT1_9BACT/34-321----PKVA..AYHRNAL.GI..........------------.........Q.A.NFTIINK...V-E............
PDXA_PSEA6/27-318----AELM.....RTRANEL..N...I...------------...........PLTLLPYDA...S-R............
J7Q941_METSZ/35-329----PAFI.....ARVA.AA......L...------------.A........LEIQIES.TT...A-A............
PDXA_METCA/29-318----PDLL.....ESRARLL..G...V...------------...........PIELRRVVS...G-D............
R5FA16_9BACT/34-322----PKVA..AYHHKAL.GI..........------------...........PGNFTIIKS...A-E............
PDXA_AZOSB/30-318----ADLI.....AARAAAV..G...S...------------...........PIAVRHYSR...G-Q............
D3HPI6_LEGLN/27-314----RDVL.....EARAKEL..K...L...------------...........DISFTSYMG....-.............
C6D3S5_PAESJ/31-322----AKIL.....ERAA.RV......V...------------.N........SELKVRPI.....A-S............
C4ZNQ2_THASP/34-328----IGLM.....RARAAAL..D...S...------------...........AVGVVEFDA...A-R............
Q1ART0_RUBXD/32-322----GARL.....ERAA.AL......L...------------.R........LPLRIETV.....S-G............
A0KGT9_AERHH/28-320----PALL.....RERAALL..G...L...------------...........PIELQPYDA...D-Q............
PDXA_PASMU/32-326----KDEL.....EKGMEIAK.AQFVY...------------..........EEVSFHQLGQ...Y-E....FKTGVPVL
Q5QVN8_IDILO/29-320----KNLL.....KQRAEQL..N...L...------------...........PITLHRYRK...G-E............
I2F8G1_9THEM/47-340----FGTL.....QREI.DR......N...------------.H........LGMKIETVSE...I-T............
D7DN38_METV0/32-322----ANML.....QARAKAL..D...V...------------...........SIQIQEYSA...K-S............
K4IU70_PSYTT/35-320----SKMM..SFFGNQF.NI..........------------...........KLQFNGITD...A-S............
F2KU47_PREDF/35-321----PKIA..AYHRNAL.GI..........------------...........EANFTIIKD...A-K............
D9QLJ7_BRESC/29-321----RALL.....EA...........Q...------------.G..........VRVVEIGA...P-G............
B0BZ85_ACAM1/36-343----RSLF.....EAVYEHL..........------------........................-.............
Q8KEU1_CHLTE/31-322----LKAL.....EFYR.DL......L...------------.G........LPVELRRIEG...P-E............
A5G9E3_GEOUR/36-328----METL.....ERGI.KI......V...------------.G........AQLRIETM.....G-T............
F0RGS0_CELLC/35-323----NKTI..SFQKKEL.NI..........------------...........NINYNGVPD...A-D............
Q2G9Z1_NOVAD/34-325----ARVV.....EEAA.RR......R...------------.G........ITVPVCAVKT...T-D............
Q3IWS4_RHOS4/37-320----RETL.....LRAR.........A..A------------CG........LDLALHEF......-.............
E4RPK4_HALHG/32-334----SNFL.....KDAV.NL......I...------------.P........SNLKINPV.....E-S............
Q82W16_NITEU/32-321----RDVL.....DQRAEKL..R...L...------------...........PLQLHEDDP...D-N............
D5QAY7_KOMHA/32-316----PAIL.....AR...............------------..........AGGAVCEVAD...V-A............
R5CC16_9BACE/34-324----PKVA..AYHRKSL.DL..........------------.........P.T.NFSIVES...A-E............
R5P6P7_9BACT/34-321----PKVA..AYHRNAL.NM..........------------...........QANFTIISN...A-D............
A4FIE2_SACEN/34-325----AARL.....RQAA.EI......L...------------.G........RPAEVVAV.....E-S............
B9LZ80_GEODF/35-326----RSVL.....QRAI.DL......L...------------.A........ADLRITTV......-E............
A3U5N8_CROAH/35-320----SKVL..SFIKKHL.NI..........------------...........DLQFQGISD...L-N............
PDXA_CAMJE/28-357----ESLL.....NKALKLL..........------------........................-.............
R5GSB3_9BACT/34-324----PKAA..AYHRKAI.DS..........------------.........Q.V.AFTTVAS...A-E............
Q479U5_DECAR/29-319----RSLL.....EARAAQL..G...L...------------...........NVAFRDYTA...G-Q............
R6AA64_9BACT/49-340----VKVA..NFHRKTL.GL..........------------.........N.T.PLQVIAR...A-E............
PDXA_NEIMB/28-321----KNLL.....RARAEAL..G...K...------------...........SVVLRDFDP...E-S............
D1B2K3_SULD5/28-299----ENML.....GWGAALL..........------------........................-.............
K9PX21_9CYAN/31-332----RRLL.....EQAYEQL..........------------........................-.............
F2GA18_ALTMD/29-320----GDML.....KDRAATL..G...L...------------...........PLTLIDYDE...N-N............
B4EGN0_BURCJ/39-337----RWLW.....EAGQRVAG.VTI.DVEP------------VASLAAVRGRPSTARAAFVA...V-D............
M1WYQ3_DESPC/31-331----ESALVREMERYTVEPF..........------------........................-.............
E8V3H9_TERSS/35-313----GPSI.....AAAE.KS......T...------------........................-.............
E7ABT4_HELFC/29-301----RELL.....EQANTLL..........------------........................-.............
PDXA3_RHIME/42-334----RRIL.....DEGARVAG.VTL.....------------DLEAASLDALDNAGTARHVF...V-D............
E6WY24_NITSE/28-307----REML.....EQAAELL..........------------........................-.............
C6XUZ6_PEDHD/33-321----TKVA..SYHRKAL.GL..........------------.........T.DFAFNVINE...P-A............
B4SF48_PELPB/31-318----YRVM.....EYYR.NA......L...------------.D........LPVELELIES...A-T............
I5B2I7_9DELT/36-328----FKIL.....KQAD.FN......Y...------------.K........ILQKLVIT.....D-DLISDFSNFPK..
Q65EJ5_BACLD/32-325----MKML.....KKAA.FQ......I...------------.G........SEVVINKV.....G-H............
D3QBQ2_STANL/35-328----AGAL.....RRGA.AA......A...------------.G........LDVDVRVVND...F-S............
I6ZML4_MELRP/28-311----ANVF.....ERYRKKF......N...------------..........IGVSYEIIED....-.............
Q5LKY3_RUEPO/32-322----RHLW.....EQGAAQAG.QEV.....------------..PLNSLDPRAIPIQTGLAH...L-N............
Q2RKJ4_MOOTA/32-333----AGLM.....GEAI.KI......A...------------.G........VNLSVRAV.....T-S............
R5EF26_9GAMM/29-323----KELI.....AQRIALF..NSNHT...------------..........ESVKITDYSK...D-N............
W0E2J5_MARPU/29-320----PHLL.....RARARAL..G...L...------------...........ALETLPFDP...D-Q............
H1Y4I7_9SPHI/33-321----TKVA..SFHRKAL.NL..........------------.........S.DFSFNVVAA...P-D............
E3GDT1_EUBLK/31-337----KKVL.....ENAL.KI......T...------------.K........IKKKLIAVKE...G-S............
E0WS58_9ENTR/33-325----EQLL.....NQRAEQL..K...L...------------...........PLILREYQC...D-R............
W8F8Y2_9BACT/31-322----AAVLFDDFPQDAS.HE..........------------...........PLTFRQVRE...A-A............
B3QV85_CHLT3/26-321----FKVL.....QHYV.DV......L...------------.S........LPVQLKRIKN...I-E............
A8LS85_DINSH/31-321----AHLW.....RRGADQAG.LEI.....------------..PLDTIDPRDSGSFTGLAH...L-D............
A0Q399_CLONN/32-323----KDVI.....KQAI.GF......C...------------.D........LKLNINTITD...A-K............
K7YNJ0_9PROT/35-327----PQRV.....AKRA.RL......L...------------.G........LSISFEIMED...P-S............
R7EVF6_9BACT/42-333----AKLI..GYYRKVL.GM..........------------.........E.PFSANQITD...A-S............
I3Z6X6_BELBD/36-323----GKAI..TFYRKQL.EM..........------------.........E.DFNFMQIKS...I-D............
PDXA_HYDS0/28-302----EYIL.....KHASSVL..........------------.G........QNFYYEKVNS...V-D............
W0EZ35_9SPHI/35-325----NKVV..NFYRKTV.TE..........------------.........S.SFSFYHTRE...F-D............
D5CTH9_SIDLE/30-349----KSLL.....LHRAALL..G...T...------------...........GVRLHDYAA...D-R............
R7LG84_9BACT/48-339----VKVA..TYHRKAL.GL..........------------.........N.T.PFTVIKS...V-D............
D3E9G4_GEOS4/31-324----AKIL.....ERVL.PI......I...------------.G........SSLKVNAI.....Q-E............
E3FNJ1_STIAD/27-308----GPTL.....ERFALFRR.YARTTPAT------------LGRATEPTVCEVTALAEKDR....-.............
X5D8G7_9BACT/35-325----PKVA..AYHRKAL.DI..........------------.........N.DVSFNHIRS...T-K............
G8PQZ0_PSEUV/36-329----PELL.....KARA.KH......L...------------.G........FKIPIKV.VE...P-E............
L0DE58_SINAD/36-336----KSVL.....ERALACV..........------------.........GGQAVVQSISR...P-E............
G8QYY1_SPHPG/33-336----VTIL.....HRAL.SF......P...------------GI........PQVALNAI.....Q-N............
W8KS11_HALHR/35-325----PQVL.....LDRAEQL..G...I...------------...........HLTLTPLDP...D-Q............
G8TP28_NIAKG/36-322----NKVI..NFYRKSV.PD..........------------.........I.NFSYQSIKE...L-N............
PDXA_VIBCH/28-321----KALL.....AQRATQL..G...I...------------...........QVKLLDYQR...D-N............
T2KID2_9FLAO/35-320----VKVM..SFYKNHF.KM..........------------...........DINFNGINQ...I-N............
U5LJV8_9BACI/34-327----RKIL.....ERAK.GF......V...------------.D........SQLTIETVNE...Q-D............
PDXA_PERMH/27-312----YKII.....EKVSSIL..........------------.D........KKTEINIIDS...P-E............
PDXA_RHILO/36-329----PALI.....ASRA.SR......L...------------.G........VSVPIVE.TT...P-A............
Q89M19_BRADU/33-325----RRIF.....DEGAHVAG.AKP.....------------DLTMVEQGADLRSAQGDALF...V-D............
K9VZP3_9CYAN/50-362----KSLL.....QETYLHL..........------------........................-.............
PDXA_FUSNN/31-321----KKVL.....EKAT.KI......C...------------.Q........VDLKIHTIKN...I-E............
E0SNM5_IGNAA/34-327----PNVF..........NI......VRDR------------CDIDVDIVEVSENRIKDLEY...R-V............
G0AAS4_COLFT/40-342----AAFL.....AMIAAEI..D...P...------------...........QIRLVALSQ...Q-A............
A6Q3Y7_NITSB/29-300----YKII.....QQAANIL..........------------........................-.............
A7HYG3_PARL1/38-330----PALY.....RTAS.ER......L...------------.G........AGAAIREISD...P-S............
G4STZ3_META2/32-323----PDLL.....MQRAESL..G...L...------------...........KLEIKSFDP...L-S............
R4W4P1_9EURY/25-318----ASVL.....RAAV.EC......C...------------.D........SSLSVEAV.....D-D............
E4TVA5_MARTH/35-325----GKIL..SYYRKAL.NI..........------------.........R.DFNYFQLKK...L-E............
R5IKT1_9CLOT/33-336----ACVM.....EAAL.PI......V...------------GH........TEMKIHAI.....K-D............
R7CXE5_9BACE/34-324----PKVA..AYHRKAM.EL..........------------.........Q.A.NFSIVNS...A-S............
G8QPR5_AZOSU/28-330----KELL.....HQRAAQL..G...M...------------...........DVPLHDYAP...D-R............
PDXA_HERAR/30-332----AAFL.....AMIAGAI..N...P...------------...........DIHLSALSW...Q-A............
Q7VQK2_BLOFL/37-330----LNLL.....LDRAKKL..Q...L...------------...........PLTLQPYYI...N-T............
C7M3J3_CAPOD/34-323----NKLV..SFQKKHF.NT..........------------...........TANFQGIES...V-E............
R6TUF4_9FIRM/17-307----VRMF.....EHGLKVVG.GDV.....------------..........PHYVISDLSE...C-DWERGYPVLDLKD
D1CHU7_THET1/34-324----TSTM.....ERQL.TC......A...------------PG.........VRSVRQVGE...P-D............
PDXA_CAMFF/30-301----NELL.....NSAANIL..........------------........................-.............
I4BXC4_ANAMD/32-320----INVI.....KKAA.TI......V...------------.G........YDSEINLI.....E-D............
E1R632_SPISS/37-339----SKMF.....EDSI.RI......L...------------KE........KKIKVRRV.....S-L............
C4ZHF2_EUBR3/32-338----AACM.....EEAV.KI......AG..------------KE........GQIKIHAI.....N-D............
B8I6T9_CLOCE/32-323----AGVI.....EKAA.RI......C...------------.G........IQTKVNPVAG...A-D............
F4CNN9_PSEUX/26-309----RHVL.....AGHAAAAG.........------------........................-.............
C5B7P2_EDWI9/30-321----PGLL.....EARAHAL..G...L...------------...........PLTLRRYDS...A-L............
PDXA_SYNFM/34-329----PSAL.....QRSM.AL......S...------------.G........ASKKVLVL.....R-E............
F2I3R8_PELSM/32-321----RSIL.....EDGEKTSG.VKTDLIPA------------KNFDEIDFSKGSKFFIDITN...G-KNRAY........
K7VXY6_9NOST/36-337----RTLL.....TKSYENI..........------------........................-.............
R5D0H0_9BACT/34-324----PKVA..AYHRNAL.GI..........------------.........Q.G.NFTIINS...A-A............
H6L3Q9_SAPGL/32-322----AKIL..AYHKNIV.KL..........------------.........R.SFQFHTIEE...G-E............
R6F1V4_9BACT/34-322----PKVA..AYHKKVM.NT..........------------...........PAQFTIIHK...A-E............
Q2S3U3_SALRD/96-387----AHVL..RVHADVL.GF..........------------.........S.DLDIHIVDE..VP-E............
H2FZ12_OCESG/28-320----PELI.....QARAQAQ..G...R...------------...........DITLLPYRQ...Q-A............
L0K3J5_9EURY/33-327----ASVM.....RAGV.DV......S...------------.G........ADLEIEPV.....D-T............
G8R4P5_OWEHD/35-324----SKVA..SYHRKAL.NM..........------------.........D.HFNFHICND...F-G............
I1YL39_METFJ/29-320----PDLV.....AQRAAQL..D...L...------------...........DVQIVAVDL...S-M............
PDXA_COLP3/27-319----KALL.....QERSKAL..S...L...------------...........PLTIIDYDQ...H-A............
Q215S3_RHOPB/38-329----RAFL.....QARA.AT......L...------------.G........LNVPFAE.VR...P-D............
I0DWR7_PROSM/32-323----PELL.....LARAKQL..N...L...------------...........PLSLKNYQS...G-N............
D3DGU5_HYDTT/29-313----RKII.....ERAMRLL..........------------.G........KEHTLRDIYV...I-D............
C6X2C9_FLAB3/36-324----GKLF..TYQKNIF.KL..........------------...........QINFNYITE...A-L............
Q02C14_SOLUE/41-313----GEVL.....EQAS.RI......T...------------.G........IGLQAKLHDA...R-A............
G0G667_AMYMS/33-323----AIVL.....ERLV.RH......L...------------.G........LHLEINPIAT...V-A............
A9GKN1_SORC5/15-317----EAIT.....RRAARLV..........------------........................-.............
Q1QKW1_NITHX/32-325----RAFI.....AARA.KL......L...------------.G........VDLPLAD.AD...P-G............
H1XYD5_9BACT/33-325----LPVL.....KKYL.TL......F...------------.G........MEASLISIND...F-K............
D4GUQ8_HALVD/34-328----ADVI.....RHAV.DQ......C...------------.D........SDLSVEAV.....E-S............
PDXA_BEII9/33-322----PLVM.....EHAI.AN......L...------------.G........VAVQIRRI.....A-T............
F9Z465_ODOSD/33-319----SKVA..AYHRKAL.NI..........------------..........ENFSLNSIQN...A-R............
A6VPP4_ACTSZ/32-327----RDEL.....CKGLTIAE.VSFEY...------------..........NEIVPENLPN...Y-S....FKPGIPAL
I0KFB6_9BACT/263-588----MRVL..NRYRNLL.NL..........------------.........K.DWNLNGIQQ...V-D............
B5E8C6_GEOBB/32-324----RGAM.....ERGI.AV......A...------------.G........VKLAIASA.....P-D............
Q4FMQ9_PELUB/32-317----KKLL.....QEQMKKL..........------------.........DFYFKINDIDK...E-L............
A5FM92_FLAJ1/36-324----AKIL..SFVKKSF.TS..........------------...........TVQFHGVDK...L-D............
E3H6A7_ILYPC/32-321----YEII.....EFFN.KK......L...------------.G........LNVKLEKL.....I-N............
A6QAX9_SULNB/28-306----KEML.....LQAAEKL..........------------........................-.............
A9BT55_DELAS/23-315----TGRL.....QRAA.DM......L...------------.G........VRPRIQAI.....D-A............
C3M9C3_RHISN/34-330----PSVL.....SARA.RV......L...------------.G........QPVRIEE.TD...C-L............
Q5LQN1_RUEPO/27-312----PAHL.....P................------------..........SGTPVTLLDD...P-A............
E8UEJ0_TAYEM/35-326----MKCL.....ETYASRL......G...------------.........YVDVKFKLIHE...I-G............
R5UVJ1_9PORP/33-321----SKVA..AYHRKTL.NI..........------------..........ENFNLNSIQT...P-Q............
PDXA_ERYLH/36-326----ANVL.....RSAT.EA......L...------------.G........VPCPIQEIDD...I-A............
I0IDK7_PHYMF/40-342----NELM.....AYAADLAE.IEPFWHRV------------QHGADRTRHELTHDVVVVDF....-.............
A8MJU3_ALKOO/32-323----KDTL.....EQAM.KF......T...------------.N........TTLEINVIEN...V-E............
R6WM45_9PORP/34-325----SKIA..AYHRKVL.DL..........------------.........P.AVNLSIIAQ...A-E............
Q3ARA5_CHLCH/34-329----MRVM.....EFYR.NL......L...------------.Q........LPLTLQPIER...V-E............
G8X7V7_FLACA/36-324----VKIV..SYLKKQL.NL..........------------...........NVNLHGIDK...I-D............
D3UFK7_HELM1/31-300----RELL.....DSMAEIL..........------------........................-.............
D9SID5_GALCS/30-319----KHLL.....QQRAQQL..G...I...------------...........DLKIREWDR...A-K............
K9WP18_9CYAN/130-441----PSLL.....QTTYTQL..........------------........................-.............
PDXA_PSEHT/27-319----ANML.....KQRAKHL..G...L...------------...........SIKLIEFDQ...H-A............
A1AWJ1_RUTMC/26-312----PDVL.....LNRAKQL..........------------...........NLNIKIVES...E-Q............
PDXA_STRMK/28-315----PDTL.....RAAAAAL..........------------...........NLPLQLLPE...G-A............
Q3V8D3_GEOSL/34-325----EFAM.....SRGI.AL......T...------------.G........TGFRIETS......-E............
B6IN68_RHOCS/40-329----PARL.....AALA.GS......L...------------.G........WDVPLVTVAD...P-A............
D4M806_9BACT/32-348----ASSI.....RYAA.AA......ARTL------------SG........ADLEVRPV.....K-A............
I4A0Q6_ORNRL/35-323----HKLW..GYLSAVV.DK..........------------...........NFTYHKIND...L-S............
V4JCI5_9DELT/37-338----TDIM.....ADAV.SF......S...------------.G........LSLDIAPV.....D-N............
I1XKV7_METNJ/29-321----PELL.....QQRADEL..S...L...------------...........PLKLVEFDP...N-S............
U6B4X5_9RHIZ/39-331----PDIL.....MFRA.KQ......L...------------.N........IDIPIYE.TD...C-A............
G8UPW0_TANFA/30-320----LKIA..LSYQKVL.GF..........------------.........E.PLGFKVIQK...A-E............
B0TBI8_HELMI/32-323----AGVL.....RQAM.AF......C...------------.G........LELAVHTVTE...P-A............
F4HD17_GALAU/31-322----KKMM.....QRAL.DL......L...------------.Q........SPLKINVV.....E-N............
J9QT86_RIEAN/36-321----GKLF..SYQKNIF.KI..........------------...........QANFNYINK...A-T............
PDXA1_PSEAE/27-320----RTLL.....QERAGQL..G...L...------------...........AIDLKDVSP...A-A............
F4KTC5_HALH1/42-332----SKIV..SYHKNIV.GL..........------------...........DLLFQQIRN...A-E............
V9VUT8_9RHOB/30-316----PRHL.....P................------------..........EGTPVKEITA...P-S............
A1WVT6_HALHL/30-323----PALL.....RERSRVLD.G...P...------------...........ELDTPAWTP...D-A............
C5CPN5_VARPS/44-335----PVVL.....AAGERVAG.VKL.....------------..........DPLRIDGLDD...L-R....FEHGRPTL
A8FHA9_BACP2/32-324----TSIL.....NRAK.DF......V...------------.K........ANIEIVRI.....T-E............
I4AG95_FLELS/65-362----ARVF..SHYKKLL.NI..........------------.........DFTFQQHFIDDENIA-S............
F6GFQ1_LACS5/35-322----VKTM..NFVKNHF.KL..........------------...........NVHLNSIQH...L-N............
D9S1Z9_THEOJ/31-320----GPVL.....RYYA.DL......L...------------.K........LSVPLRSI.....N-S............
U3U9G2_9BACT/29-322----GELL.....QYRATQL..G...L...------------...........PLTLLKYQS...T-L............
C5ZY06_9HELI/27-295----KPLL.....KKAARIL..........------------........................-.............
W0HX00_9ENTR/29-321----PALL.....TARARQL..N...L...------------...........PLRLHPYRP...E-E............
L0KAL8_HALHC/32-321----KKTL.....EQAL.EI......T...------------.E........VGLDINIIQK...I-.............
F9ZTS3_ACICS/32-320----HACL.....QRRAADL..G...L...------------...........GLRLRRWSA...D-Q............
W0PD12_9BURK/38-333----AGAV.....SRAV.AQ......L...------------.G........LSLPVTAH.....D-S............
I2EZC0_EMTOG/35-326----SKII..NRYRQLL.EM..........------------.........K.DWQFFTIHK...I-E............
R7PD86_9BACT/34-324----AKAA..TYHRKAI.SS..........------------.........E.T.NFHIVKS...A-T............
Q2S9C2_HAHCH/25-319----PEVL.....LKRAESL..G...I...------------...........LLKVEIYSP...G-D............
R7DEZ6_9PORP/35-326----SKVA..AYHRKAL.DL..........------------.........P.TINFNIITN...A-E............
D0L089_HALNC/37-327----RGVF.....DERAKLL..G...L...------------...........TYDWPDHDA...E-A............
K9WWL5_9NOST/42-342----RELL.....TQTYHKL..........------------........................-.............
E1V6Y8_HALED/34-339----PALL.....EERAHAI..G...R...------------...........SVTVRTLSP...G-E............
D7AYM9_NOCDD/33-324----ADAL.....RNAV.AA......V...------------GG........DPEAVNTVAS...P-A............
G8M1K4_CLOCD/32-322----KDSI.....LKAL.SV......C...------------.G........LKTELTILSD...I-F............
Q13RP4_BURXL/47-338----AFVI.....RRYARQCC.PELML...------------........................-.............
B1XQD4_SYNP2/31-333----RPLL.....EKTYQHL..........------------........................-.............
K9PRQ4_9CYAN/33-337----LDLL.....TQTYERL..........------------........................-.............
B2JVC5_BURP8/44-333----AKRL.....ERAN.QI......V...------------.G........GEMKIRRI.....E-D............
E6U0H3_BACCJ/33-324----TAIL.....NKAI.AL......T...------------.G........VNLKVNEVSS...L-E............
I3TLQ2_TISMK/41-330----PDRL.....AGIA.RK......L...------------.G........WTVPIREIAS...A-G............
U3U6Y7_9ENTR/31-323----GDVL.....RQRAAQL..G...L...------------...........PLTLRDYQP...G-V............
D8PAQ2_9BACT/40-332----RPVM.....ERTI.AW......L...------------.K........LPLQVVDF.....N-P............
A6WG90_KINRD/420-711----AARL.....RQAA.DV......L...------------.G........VDAEIVPV.....Q-G............
Q6AJE3_DESPS/35-321----IGIL.....KKAA.Q...........------------........................-....ELGLNVP..
D8IZA6_HERSS/29-330----AALL.....AQSAYEI..D...A...------------...........QMRVAAISI...Q-A............
PDXA_HELPY/30-306----GELL.....ERANQLL..........------------........................-.............
E0UJK2_CYAP2/32-338----RALL.....ISTYERL..........------------........................-.............
H6LGK9_ACEWD/32-322----RKVL.....QQAI.AF......S...------------.K........VDLQINCVQD...P-R............
E4T4J1_PALPW/35-325----SKVA..AYHRKNL.DI..........------------.........Q.GLNLNVVNS...I-E............
I1YT17_PREI7/35-321----PKVA..TYHRNAL.EI..........------------...........EATFTIIND...I-S............
Q1GZB9_METFK/29-319----RDVL.....ASRAHAL..G...L...------------...........PLNIHVYDP...A-H............
W0DQ96_9GAMM/30-322----RQLL.....LDRAQQL..N...L...------------...........PLTLHDYQA...D-E............
S6ADC8_9PROT/41-329----RSLL.....AERAAQL..G...L...------------...........PLELVDFSP...A-A............
Q3ACP1_CARHZ/32-323----AKIL.....QRAE.TI......I...------------.H........TGLHIKPI.....Q-S............
C4K4L0_HAMD5/30-322----PDLL.....SARAKQM..N...L...------------...........PLTLKQYHP...K-K............
PDXA_ECOLI/29-321----ATLL.....TNRAAML..G...L...------------...........PLTLRPYSP...N-S............
F4LW28_TEPAE/34-336----AEVM.....KQAI.KI......A...------------.K........VNMQINPV.....T-N............
R5A8A6_9CLOT/34-337----RAIL.....ERAC.RL......V...------------GA........EEIQIHPV.....S-D............
V5SD81_9RHIZ/47-343----AEAL.....AARA.RA......L...------------.G.....FGGLPVEIVS.DD...L-R............
D0MJ80_RHOM4/43-335----AEVL..RKHAEVL.EL..........------------.........P.LPELQVVGD..VP-E............
M9WW13_PASHA/31-320----RKII.....QRAL.PI......V...------------.H........SELKLRIL.....N-N............
PDXA_SULDN/30-300----SYML.....NQASTLL..........------------........................-.............
M4UJW4_9GAMM/32-323----KNLL.....AIRIKQL..N...N...------------...........QIELIDYAL...N-T............
A9IK05_BORPD/40-331----AAAL.....RRAA.QA......L...------------GA........DASRVRVVEG...P-E............
Q5E864_VIBF1/34-327----KQVL.....AERAAQL..G...I...------------...........QIQIEDYNA...Q-L............
H8XRP0_FLAIG/36-322----AKIV..SFLKKTY.QL..........------------...........NANINGIDK...I-E............
K1WRA1_MARBU/43-327----RSEL.....DSAITDAGNVQVFLS.D------------IAGPKGAQLLDDNTAALYPT....-.............
PDXA_SHEDO/27-319----PELL.....LARAAKL..G...L...------------...........PLRLIPYHS...E-N............

PF00180

LEU3_BACMD/4-351----TEVT-----KGAVAVL------------------------------------------------------------
LEU3_BACSU/4-352----PEVL-----ESATDVL------------------------------------------------------------
LEU3_ECOLI/6-355----PEVM-----TQALKVL------------------------------------------------------------
IDHC_SOYBN/8-403----DEMT-----RVIWKSI------------------------------------------------------------
LEU3_AGRT5/5-361----PEAM-----TEVRKLI------------------------------------------------------------
IDH3A_BOVIN/33-358----PEIS-----AAVMKIF------------------------------------------------------------
LEU3_SCHPO/5-363----PEIV-----ASALEVL------------------------------------------------------------
LEU3_LEPIN/3-354----PEVM-----EIAISVL------------------------------------------------------------
LEU3_NEUCR/5-358----PEVV-----LEAIKVL------------------------------------------------------------
LEU3_LACLA/4-340----PEIM-----SAGLSVL------------------------------------------------------------
IDH_THET8/21-351----PECV-----EATLKVL------------------------------------------------------------
LEU3_YARLI/14-367----PEVI-----AEAVKVL------------------------------------------------------------
IDH2_YEAST/38-365----PEIS-----KSVKKIF------------------------------------------------------------
IDH_BACSU/21-418----PDIW-----NAASKVL------------------------------------------------------------
LYS12_YEAST/25-367----KEVI-----PAGKQVL------------------------------------------------------------
D5A186_ARTPN/6-352----PEIM-----AVAVDVL------------------------------------------------------------
G2TK86_BACCO/4-350----PEVM-----DAAIRVL------------------------------------------------------------
M4CW66_BRARP/45-394----PEVI-----SIAKNVL------------------------------------------------------------
Q480C2_COLP3/29-412----VDVT-----PPMLKVV------------------------------------------------------------
LEU3_THET8/2-339----PEVT-----EAALKVL------------------------------------------------------------
R4KBV6_CLOPA/5-353----PDIM-----REAVKVM------------------------------------------------------------

PF03971

D5CQ42_SIDLE/5-737----ANIIKLPNISASVPQLKAAIKELQSQGYKVPDFP....ENPQNEAEKEIKARYGKVLGSAVN-PVLREGNSDRRAA
A6Q387_NITSB/6-736----ANIIKLPNISASIPQLVATIKELQAQGYDIPDFP....EEPKTAEEVELRNRFAKLLGSAVN-PVLRQGNSDRRLS
I6WPR8_PROPF/3-733----ANIIKLPNISASAPQLKAAIAELRAKGFPLPDYP....EEPATPEEREIRSRYDRIKGSAVN-PVLREGNSDRRAP
D9SIT7_GALCS/5-738----ANIIKLPNVSATPPQLKAAIAELQSQGFDIPDYP....DEPQDDAQKAIKARYSRVLGSAVN-PVLREGNSDRRAA
D5V1Z1_ARCNC/3-729----VNIVKLPNISASIPQLKAAIAELQSKGYNVPNYD....ESP......EITARYSKILGSAVN-PVLREGNSDRRAP
D1B1Z3_SULD5/7-741----ANIIKLPNISASLPQLNAAIKELQDKGYLIPSYP....ENPANEKEQEIKARYAKVLGSAVN-PVLREGNSDRRAP
K7SLX7_PROA4/3-736----ACIIKLPNISASVPQLKAAIAELRAQGFDIPEYP....ARIATEEDREIVARYAAVLGSAVN-PVLRQGNSDRRAP
A3U876_CROAH/5-738----ANIIKLPNISASVPQLNAAVLELQAKGFDIPTYP....EDAETEEDKALRAKFAKCLGSAVN-PVLREGNSDRRAP
A1S7A8_SHEAM/7-739----ANIIKLPNISASIPQLKACIKELQAQGYDIPNYP....EEPKTDEEKSIKARYDKIKGSAVN-PVLREGNSDRRAP
L0FYJ1_ECHVK/23-756----ANIVKLPNISASIPQLKAAIKELQEKGYALPDYP....DEPKDQEEKGVKAKYDKIKGSAVN-PVLREGNSDRRAP
F6FT01_ISOV2/6-736----ANIIKLPNISASVPQLKAAIAELQSQGYAIPDYP....EEPRTDEEREIRARYDKVKGSAVN-PVLREGNSDRRAP
F2II47_FLUTR/7-740----ANIIKLPNISASIPQLKEAIAELQKLGFKVPNFV....ENPTTEEEKTAKAKYDKIKGSAVN-PVLREGNSDRRAP
V9VSX7_9RHOB/9-736----ANVIKLPNVSASVPQLVAAVTELQGQGYAIPDYP....AEPATDAEKEIRARYDAIKGSAVN-PVLREGNSDRRAA
Q9I0L4_PSEAE/6-738----ANIIKLPNISASVPQLKGAIAELQGLGYKVPDFP....EDPQTDEEKEVRARYAKILGSAVN-PVLREGNSDRRAP
A1R425_ARTAT/3-735----ANIIKLPNISASVPQLKAAIAELQAQGYALPDYP....DNPSSDTETDIRSRYDKIKGSAVN-PVLREGNSDRRAP
B1VF46_CORU7/3-734----ANILKLPNISASVPQMRAAIGELQKAGYDLPDFP....LEVNTEEEKDAYARYSSVMGSAVN-PVLREGNSDRRAP
A7HAP6_ANADF/7-741----ANIVKLPNISASIPQLKEAIKELQGKGYKIPDYP....EAPKDEAEKAIQTRYAKCLGSAVN-PVLREGNSDRRSP
F2LTW4_HIPMA/7-743----ANIIKLPNISASVVQLKEAIKELQEKGYNVPDYP....EEPKDEKEKEIKERYAKVLGSAVN-PVLRQGNSDRRLP
D2UG49_XANAP/6-738----ANIIKLPNISASVPQLKAAIKELQQQGYALPDYV....DEPKNAQERDAKARYDRVKGSAVN-PVLREGNSDRRAP
B0BZF4_ACAM1/9-741----AIIIKLPNISASIPQLTAAIQELQAKGYNIPDYP....ASPQNEQEITIKNRYAKVLGSAVN-PVLREGNSDRRVA
E1STT1_FERBD/3-736----ANIIKLPNISASIPQLKAAIAELQSQGFDVPNYP....EEPANDAERAIQARYAKVLGSAVN-PVLREGNSDRRVA
Q0A9L5_ALKEH/8-739----ANIIKLPNISASIPQLNACIRELQSQGYDVPSYP....AEPKNDEEQAIHDRYAKVLGSAVN-PVLREGNSDRRAP
B3QVP5_CHLT3/7-740----ANIIKLPNISASVPQLKAAIKELQEKGYNLPDYP....EDPKNEAEKEIKARYAKVLGSAVN-PVLREGNSDRRAP
H8XU75_FLAIG/5-736----ANIIKLPNISASVIQLKEAIAELQKHGFAVPNYP....EEPQNDTEKEIKTKYSKVLGSAVN-PVLREGNSDRRAP
A5WH85_PSYWF/3-737----TNIIKLPNISASVQQLKAAIKELQDKGYAIPDFP....EDPKTEEEETLRKRYGKALGSAVN-PVLREGNSDRRAP
D7BKH3_ARCHD/4-733----ANIIKLPNISASLPQLQAAIAELQNQGYPLPDYP....LNPHTEAERDVRVRYDSVKGSAVN-PVLREGNSDRRAP
A3QD82_SHELP/6-738----ANIIKLPNISASIPQLKACIKELQDKDYALPNYP....DEPQNDAEADIKARYDKIKGSAVN-PVLREGNSDRRAP
Q31GM7_THICR/4-737----ANIIKLPNISASVPQLNAAIKELQSQGYDIPDYP....ATPQNAEEEKIKAAYAKVLGSAVN-PVLREGNSDRRAP
C7M412_CAPOD/4-735----ANIIKLPNISASVPQLKAAIAELQSQGYALSDYP....ENPTNEAETAIKQRYDKVKGSAVN-PVLREGNSDRRAP
E1V4K9_HALED/6-739----ANIIKLPNISASMPQLKAAIKELQGQGYPLPDYP....DEPSDDAERDIKARYDRVKGSAVN-PVLREGNSDRRAP
Q88FS1_PSEPK/6-739----ANIIKLPNISASVPQLKAAIKELQGKGFNIPDYA....DEPATAEEKESRARYDRIKGSAVN-PVLREGNSDRRAP
K4KV52_SIMAS/7-739----ANIIKLPNISASIPQLKAAIKELQSQGYGLPDYP....DSPANEKEQDIKARYAKVLGSAVN-PVLREGNSDRRAP
F2JWD6_MARM1/5-737----ANFIKLPNISASIPQLTATIKELQSQGYEIPDYP....EAPATDEEKEINSRYSKVLGSAVN-PVLRQGNSDRRAP
F0S094_DESTD/6-733----ANIMKLPNISASIPQLIDAVKELQSQGYDLPDFP....ENPQTEEEKEIRAKYDKCIGSVVN-PVLRQGNSDRRIA
D3UGP7_HELM1/2-738----ANLIKTPNISASIPQLKNAIAELQAKGYNVPNYP....DNPKNQEEEEIKENYQKILGSAVN-PVLRQGNSDRRST
W0J5H7_9BACT/9-742----ANIIKLPNISASVPQLKSAIAELQAKGYALPDYP....ESPKNDAEKDAKARYDRIKGSAVN-PVLREGNSDRRAP
B9L5J0_NAUPA/5-736----ANVIKLPNISASVPQLVATIKELQSQGYPLPDFP....EEPQNAEEEKIKLKYLKCVGSNVN-PVLREGNSDRRLA
T2KNT3_9FLAO/6-739----ANIIKLPNISASVPQLHAAIKELQSQGYKLPNYP....DEPKTDAEKEIKSRYDKIKGSAVN-PVLREGNSDRRAP
A0LZ01_GRAFK/6-739----ANIIKLPNISASVPQLKNAISELQSKGFQIPDYP....DEPSNDKEKEVQSRYDKIKGSAVN-PVLREGNSDRRAP
C7MEJ9_BRAFD/4-740----ANIIKLPNISASVPQLKAAVAELQGQGIALPDYP....ESPSTEEEKDIRARYNSVMGSAVN-PVLREGNSDRRAP
A8EUE7_ARCB4/3-729----ANIIKLPNISASIPQLKAAIAELQSKGYKIPDYD..........SSEEVNARYAKILGSAVN-PVLREGNSDRRAP
M1MV91_9CORY/3-734----ANIIKLPNISASVPQLQAAIKELQEQGYDLPDYP....ANPETDEEKDVRARYDAVKGSAVN-PVLREGNSDRRAP
Q21K35_SACD2/7-740----ANIIKLPNISASIPQLVAAIKELQAKGYALPDYP....EEPKDEKEASIKARYDSVKGSAVN-PVLREGNSDRRAP
A0L819_MAGSM/7-741----ANVIKLPNVSASMPQLKAAIKELQEQGYALPDYV....DSPSSEEEKDNQARYDKIKGSAVN-PVLREGNSDRRAP
E6X675_CELAD/3-737----ANIIKLPNISASVPQLKEAITELQEKGYELPNYP....DEPKSDEEKQIKSRYDKIKGSAVN-PVLREGNSDRRAP
D5EP32_CORAD/6-738----ANIIKLPNISASIPQMKAAIAELQAQGYKLPDYP....EEASSDEEQSIKARYDKIKGSAVN-PVLREGNSDRRAA
D8IWJ4_HERSS/7-740----ANIIKLPNISASILQLQAAIRELQSRGYKLPDYP....ENPTTEEEKALQKRYAKVTGSAVN-PVLREGNSDRRAP
Q480C1_COLP3/7-740----ANIIKLPNISASIPQLELAIKELQAKGYDLPHYP....AEPQNEAEESIKLTYAKVLGSAVN-PVLREGNSDRRAP
J9R9T1_RIEAN/5-736----ANIIKLPNISASIPQLNEAIEELQKKGFNVPNYP....AEPKTEEEKEIKAKYAKVLGSAVN-PVLREGNSDRRAP
I1XFF5_METNJ/3-736----TIIIKLPNISASVPQLKAAIKELKAKGYDLPDYP....DNPKTIAEQTIKDRYARVLGSAVN-PVLREGNSDRRAP
H9UIG1_SPIAZ/5-737----ANIIKLPNISASLPQLRAAIAELQAKGFDIPDYP....EKPQNDEQRDWQARYDRVKGSAVN-PVLREGNSDRRAA
C1N5W5_MICPC/17-758----ANIIKLPNVSASVPQLESCVAELKSKGYDLPKYPGKANAETMDAETLSIATRYAKVIGSAVN-PVLREGNSDRRVA
D8PBJ4_9BACT/7-740----ANIIKLPNISASLPQLQAAIKELQSQGYKLPEYP....ENPKDDKEKDIKFRYDKVKGSAVN-PVLREGNSDRRAP
H1Z8C0_MYROD/6-737----ANIIKLPNISASIPQLNAAIKELQAHGFAVPNYP....AEPKNDEEKEIKAKYAKILGSAVN-PVLREGNSDRRAP
E1WXB0_BACMS/7-740----ANIVKLPNISASIPQLKACIAELQSQGFDIPNYP....ESATTDSEKDIKARYAKVLGSAVN-PVLREGNSDRRVA
Q9KSW5_VIBCH/7-740----ANIIKLPNISASVPQLKAAIKELQDKGYALPNYP....EEPSSYEEEAIKATYDKIKGSAVN-PVLREGNSDRRAP
I3YS17_AEQSU/6-739----ANIIKLPNISASLPQLNEAIEELQKKGFNIPDYP....EAATSSEQKEIKAKYDKIKGSAVN-PVLREGNSDRRAP
A1STK8_PSYIN/7-740----ANIIKLPNVSASVPQLHAAIKELQSHGFDIPNYP....EDPKTEAEKEAKARYAKVLGSAVN-PVLREGNSDRRVA
D7WAL0_9CORY/3-734----ANIVKLPNISASLVQLKNAIKELQDAGFKIPDYP....ANPSSDEEKDIKSRYDAVKGSAVN-PVLRQGNSDRRAP
B2GKD0_KOCRD/3-733----ANIVKLPNISASIPQLKAAIKELQADGYDLPDYP....EDASSDEAKDVRARYDRVKGSAVN-PVLREGNSDRRAP
W6EER3_SULMU/7-741----ANIIKLPNISASLPQLQAAIKELQDKGYNIPNYP....ENPTNEAEKEIKTRYAKVLGSAVN-PVLREGNSDRRAP
M4U620_9GAMM/7-740----ANIIKLPNVSASIPQLKTAIKELQAHGYALPDYP....ETQSSDEERDIAARYAQVLGSAVN-PVLREGNSDRRVA
A1K4K8_AZOSB/7-741----ANIIKLPNISASVAQLKAAIKELQGKGYKIPDFP....EDPKNDEEKAIKTRYSKCLGSSVN-PVLREGNSDRRAP
C5BIJ2_TERTT/8-740----ANIIKLPNISASVPQLQATIKELQAKGYKLPDYP....ADPSTEEEKSVKARYDKIKGSAVN-PVLREGNSDRRAP
E4PIW6_MARAH/7-740----ANIIKLPNISASIPQLRAAIKELNEQGYNVPEYK....ENPENDEEKEIQSRYAKVLGSAVN-PVLREGNSDRRAP
E4RUN8_LEAB4/17-750----ANIIKLPNISASIPQLVAAIKELQAKGYAVPDYP....EEPKTGEETFIKAKYDKIKGSAVN-PVLREGNSDRRAP
F8JJ69_STREN/5-736----ANIIKLPNISASIPQLKAAVAELREQGYALPEYP....DDPKTDEEREIRARYDKVKGSAVN-PVLREGNSDRRAP
C7NKD1_KYTSD/3-736----ANIIKLPNISASVPQLKEAITELQGQGYAIPDYP....EDPQTDEDRAVRATYDAVKGSAVN-PVLREGNSDRRAP
Q9JZS1_NEIMB/6-739----ANVIKLPNISASVPQLTAAIKELQSKGFAVPDYP....ADPQTDEEKAVRERYDRIKGSAVN-PVLREGNSDRRAP
C5ZYN4_9HELI/2-724----ANLIKTPNISASIPQLKAAIAELQQKGFKIPNFP....DEPKNDAEKTIKEKYQKVLGSAVN-PVLRQGNSDRRST
C1DL01_AZOVD/5-737----ANIIKLPNISASVPQLKAAIKELQQQGYKLPDYP....EEPKTDTEKDVKARYDKIKGSAVN-PVLREGNSDRRAP
E6S9C5_INTC7/5-731----ANIIKLPNVSASIPQLKAAVKELQDEGHAVPDYP....DNPTTDEEKAARAAYDKIKGSAVN-PVLREGNSDRRAP
Q2SHA1_HAHCH/6-738----ANVIKLPNISASIPQLKATIKELQQQGFNVPNYP....EEAVTEEEKKIEQTYTKVLGSAVN-PVLREGNSDRRAP
C4LKD9_CORK4/3-734----ANIVKLPNISASVPQLKATIKELQAAGYELPDYP....EEPSTDEERDARARYDSVKGSAVN-PVLREGNSDRRAP
F8E409_FLESM/8-745----ANIIKLPNISATIPQLRAAIDELQNKGFNVPDYP....WDPQNEKEREIQERYGKVLGSAVN-PVLRQGNSDRRPP
W8S0Q0_9RHOB/9-733----ANVIKLPNISASVPQLVAAIKELQSQGYALPDYP....ETPQTDAEKETRARYDAIKGSAVN-PVLREGNSDRRAA
W0JIX7_DESAE/6-742----TNVIKLPNISASVPQLVAAIKELQNKGYNVPDYP....EDPKTEEEKKIKETYSKVLGSAVN-PVLREGNNIRAIS
B3E9R4_GEOLS/7-740----ANIIKLPNVSASIPQLKAAIKELQEQGYKLPDYP....EEPKTDAEKELHARYAKCLGSAVN-PVLREGNSDRRSA
M1E507_9FIRM/6-743----TILIKLPNISASLPQLKDAIKELQAKGFNIPDYP....DELKSAQDEKIRERYSKILGSAVN-PVLRQGNNIRAVP
Q0PAY5_CAMJE/3-729----ANLIKTPNISASIPQLKAAIKELQDKGYMLPNYP....DEPKNDEELQIKTKYQKVLGSAVN-PVLRQGNSDRRST
A3HX33_9BACT/7-740----ANIVKLPNISASIPQLKAAIKELQGKGYALPNYP....EEPKNEEEKNIKATYDKIKGSAVN-PVLREGNSDRRAP
A8LP43_DINSH/9-721----ANVIKLPNISASQPQLDAAIAELQSQGHDIPAYP....ANPTTPEEERIKAAYDAVKGSAVN-PVLREGNSDRRAA
E4TZB1_SULKY/3-729----GVIIKLPNISASIPQLKACIEELQSQGYDLPNYP....EEPKNDEEKEIQARYSACLGSAVN-PVLREGNSDRRAA
K0C4Y6_CYCSP/7-740----TNIIKLPNISASVPQLKAIINELQGKGFDIPNYP....EDPQTDEEKALQQKYGKVLGSAVN-PVLREGNSDRRAP
A0RPF0_CAMFF/4-728----ANIIKLPNISASLPQLNAAIAELQSKGYAVPNYI....ENPTNDKEESIKARYARVLGSAVN-PVLREGNSDRRCA
B3ENX3_CHLPB/3-736----ANIIKLPNISASIPQLQAAIKELQEHGYAIPDYP....EDPKTDAEKELRARFAKVLGSAVN-PVLREGNSDRRAA
F9YPD0_CAPCC/6-739----ANIIKLPNISASVPQLVAAIKELQSKGYDLPNYP....EEPKTEAEKLIKARYDKIKGSAVN-PVLREGNSDRRAP
B3PL57_CELJU/5-738----ANIIKLPNISASIPQLKAAIKELQSQGYKLPDYP....ESPASDEEKSIKSRYDKVKGSAVN-PVLREGNSDRRAP
C1FF99_MICSR/20-749----ANIIKLPNVSASVYQLEQAISELNRKGFDVPKYP...SGDALSPEDAAIKARYGKVIGSAVN-PVLREGNSDRRVA
H2G1D1_OCESG/7-738----ANIIKLPNISASVPQLRACIKELQSQGYNVPDFP....EEPKTDEDKAIREAYSKILGSAVN-PVLRQGNSDRRAP
E6W3A0_DESIS/5-739----ANIIKLPNISASIPQLQDAIKELQSQGYKVPDYP....ANPKNDEEKKIQEQYSKVLGSAVN-PVLREGNSDRRAA
D5VA96_MORCR/5-738----ANIIKLPNISASMPQLLAAIKELQAKGYQLPDYP....TNPQTDQEKDIQKRYDKIKGSAVN-PVLREGNSDRRAP
Q5QZT7_IDILO/7-738----ANIIKLPNISASIPQMTACIKELQNQGYKLPDYP....FDPQTDEEKDVRSRYDKVKGSAVN-PVLREGNSDRRAP
D5BKK7_ZUNPS/6-738----ANIIKLPNISASIPQLKAAIKELQEKGYKLPEYP....DEPATEEEKEIRAKYDKVKGSAVN-PVLREGNSDRRAP
E2SFF0_9ACTO/5-735----ANIIKLPNVSASIPQLKAAVAELQQQGYALPNYP....DSPQTDEERDVRARYDKVKGSAVN-PVLREGNSDRRAP
I6YVP5_MELRP/4-738----ANIIKLPNISATIPQLKAAIKELQEKGYSVPDFP....DEPGSDEDKKIRERYSKILGSAVN-PVLREGNSDRRAA
W0I0L2_9ENTR/6-739----ANIIKLPNISASLPQLKAAIKELQTQGYAVPDYV....DEPNTDAQKEAKARYDKIKGSAVN-PVLREGNSDRRAP
C9RMQ9_FIBSS/4-740----ANIIKLPNISASVPQLKAAIAELQKNGYALPDYP....DAPANDEEKAIRARYDKVKGSAVN-PVLRQGNSDRRAP
I5AYK9_9DELT/4-736----GNIIKLPNISASVPQLKGAIKELQAAGYDVPDYP....DEPKNAEEEAIKTKYSKNLGSAVN-PVLREGNSDRRAA
Q3IH53_PSEHT/4-737----ANIIKLPNISASVPQLRAVIKELQAKGYALPEYP....VEPKNDEEKAIQAAYDKIKGSAVN-PVLREGNSDRRAP
V5WJE7_9SPIO/3-736----ANIIKLPNISASIPQIKRAVSELQAAGFAVPDYP....DEPQSDTEREIRKRYDRVKGSAVN-PVLREGNSDRRAP
B2V8Q7_SULSY/5-744----ANIMKLPNISASVPQLIATIKELQSQGYNLPDFP....EDPKTEEEKAIRERYMKAVGSVVN-PVLRQGNSDRRLS
Q30RQ6_SULDN/3-727----GNIIKLPNISASVGQLIECITELQAQGYDVPNYP....EDAKTDEEKALKEIYSTCLGSAVN-PVLREGNSDRRAA
E8UGI5_TAYEM/3-734----ANIIKLPNISASIPQLNEAIAELQKQGFAIPDYP....ADPQNDEEKKVKALYAKVLGSAVN-PVLREGNSDRRAP
M1P925_DESSD/6-739----ANIVKLPNISASIPQLTGAIKELQDKGYDIPDYP....AEPRNDKEKELHVRYSRVLGSAVN-PVLREGNSDRRAA
H1XS30_9BACT/5-740----ANIIKLPNISASVPQLQDAIKELQQQGYDIPDYP....EEPKTEEEKAIQARFSKVLGSAVN-PVLREGNSDRRPA
Q5NET6_FRATT/12-745----ANIIKLPNISASIPQLTAAIKELQSKGYKIPDYP....YEPKDDKEQEIKARYAKVLGSAVN-PVLREGNSDRRVA
R7XUF3_9ACTO/3-734----ANIIKLPNVSASIPQLKAAIKELQDKGYDLPDYP....ENPQSDEDKATRAKYDKVKGSAVN-PVLREGNSDRRAP
S5R118_9PROT/7-741----INIIKLPNISASLPQLINVISELQLHGYKIPNFP....ENPKTEKEKLIKIKYSQLLGSVVN-PILREGNSDRRIP
Q7UX35_RHOBA/8-739----ANVIKLPNISASIPQLVEAITELQAQGYDIPDFP....QDPKTDEEKSVRATYAKVLGSAVN-PVLREGNSDRRVA
F6GBX4_LACS5/6-738----ANIIKLPNISASIPQLKAAIEELQEQGFKIPNYP....DEPENDSEKDIKSRYDKIKGSAVN-PVLREGNSDRRAP
A4AQ16_MARSH/3-736----ANIIKLPNISASVPQLNEAIEELQQKGYALPEYP....DDPKNDEEKDIKARYNKIKGSAVN-PVLREGNSDRRAP
D3PCR7_DEFDS/7-744----ANIIKLPNISASIPQLKAAIEELQRQGYNVPDYP....EEPKTEEEKKIQERYAKVLGSAVN-PVLRQGNSDRRAP
Q0VQ19_ALCBS/5-738----ANIIKLPNISASIPQLREAIAELNEHGYAVPEYP....DEPQNEKEKDIQARYTKILGSAVN-PVLREGNSDRRAP
Q6A6Z7_PROAC/3-732----ANIIKLPNISASVPQLKAAIAELQSQGYELPDFP....DKPSTDEEREIAARYATVLGSAVN-PVLRQGNSDRRAP
I0AFK0_IGNAJ/4-739----ANIIKLPNISSTVPQLKAAIKELQSKGYNIPDYP....DEPKTDEEKAIKGRYSKVLGSAVN-PVLREGNSDRHAA
I0IE50_PHYMF/4-736----ATIVKLPNISASIPQLREAIAELQAAGFDVPDHH....DDPQNDEQRATNATYAKVLGSAVN-PVLREGNSDRRVA
M5AMA5_9ACTN/5-738----ANIIKLPNISASIPQLKAAIAELQGLGYDLPDFP....DDPETDDERAIRAKYSVALGSAVN-PVLRQGNSDRRAP
K4IX24_PSYTT/7-740----ANIIKLPNISASVPQLTEAIKELQDKGYKIPSYP....EDPQNDKEKDVKNRFAKVLGSAVN-PILREGNSDRRVA
A4SVS2_POLSQ/7-740----TNIIKLPNISASVPQLLAAIKELQSKGYKIPNFP....EDPKTDEEKSIRTRYSKCLGSSVN-PVLREGNSDRRAP
G7UU97_PSEUP/6-738----ANIIKLPNISASMPQLKAAIKELQDQGYPLPDYP....DEPRTEAEKDIKARYDRTKGSAVN-PVLREGNSDRRAP
K9UP30_9CHRO/7-740----ANIIKLPNISASTPQLTAAIQELQVQGYDIPDYP....AQPQNEVEVEIKARYAKILGSAVN-PVLREGNSDRRVA
F0S4K1_PEDSD/6-737----ANIIKLPNISASIPQLKGAIAELQADGYAVPNYP....DDPQTEEDKAIKAKYAKVLGSAVN-PVLREGNSDRRAP
I3ZAR1_BELBD/7-739----ANIVKLPNISASMPQLLAAIKELKEKGYALPEYP....LNPKNDQEKEVKSRYDKVKGSAVN-PVLREGNSDRRAP
A1SMP0_NOCSJ/3-734----ANIIKLPNVSASVPQLKTAIKELQEQGYDLPDYP....ENPQTDEDRDVRARYDKVKGSAVN-PVLRQGNSDRRAP
C5C942_MICLC/3-736----ANVIKLPNISASVPQLRAAIKELQAHGYALPEYP....DEPKTDAEKDAKARYDSVKGSAVN-PVLREGNSDRRAP
A4CN95_ROBBH/3-737----ANIIKLPNISASIPQLEEAITELQGQGYAIPDYP....AEASSDEEKAIKARYDKIKGSAVN-PVLREGNSDRRAP
A9GTS3_SORC5/41-773----ANIIKLPNISASIPQLVAAIKELQQQGYAVPDYP....SEPKTEEEKAIKARYAKVLGSAVN-PVLREGNSDRRAS
B1XIH1_SYNP2/14-747----AYIIKLPNISASIPQLTAAIKELQTKGYNMPDYP....ADPKTEAEKEIKAKYAKVLGSAVN-PVLREGNSDRRVA
I4B3K5_TURPD/7-740----ANVIKLPNISASIPQLKAAIKELQSQGYKVPDYP....EEPKTEDEKAIKARYAKVLGSAVN-PVLREGNSDRRVA
B0UWC0_HISS2/4-735----ANIIKLPNISASIPQLNAAIKELQQQGFAVPDYP....TEPQTEEEKKIKAAYTKVLGSAVN-PVLREGNSDRRAP
E8ND12_MICTS/5-736----ANIIKLPNISASIPQLKAAIAELQAQGYDIPDYP....DEASTVEDKDVRARYDRIKGSAVN-PVLREGNSDRRAP
E6WXM1_PSEUU/6-738----ANIIKLPNISASVPQLKAAIRELQSQGYPLPDYP....DAPKDEKEKDIQARYDRVKGSAVN-PVLREGNSDRRAP
G0HFV7_CORVD/3-741----ANIIKLPNISASVPQLKAAIAELQADGYALPNFP....DEPATDEEKDARARYDSVKGSAVN-PVLREGNSDRRAP
G8R0B4_OWEHD/6-739----ANIIKLPNISASIPQLEAAIKELQSKGYNLPDYP....KDPQTEAEKAIRAKYDKVKGSAVN-PVLREGNSDRRAP
Q167P5_ROSDO/9-739----ANVIKLPNISASVPQLVAAIEELQAQGYPVPDYP....ENPQTEADKDARARYDTIKGSAVN-PVLREGNSDRRAA
Q5E3X6_VIBF1/7-740----ANIIKLPNISASIPQLHAVIKELQAKGYALPNYP....EEAKTDEEKAVKAVYDKIKGSAVN-PVLREGNSDRRAP
B7FVA8_PHATC/76-804----CAIVKLPNISAPLNQLLECVNELRHKGYDVPLYP....HEPSNVEETDVKHRYDKLMGSAVN-PVLREGNSDRRVA
D6Z308_DESAT/5-739----TNIIKLPNISASIPQLKDAIKELQGQGYRVPDYP....DEPQSEADHEIQQRYAKVLGSAVN-PVLREGNSDRRAP
A4GAN1_HERAR/6-739----ANIIKLPNISASIPQLKAAIKELQQQGYKLPAYP....DDAQTDAERDAKARYDKIKGSAVN-PVLREGNSDRRAP
D0LWU8_HALO1/6-739----AIIIKLPNISASIPQMKACIAELQGKGYKIPDYP....EEPKNDAEKAAKARYDAVKGSAVN-PVLREGNSDRRAP
Q9PA20_XYLFA/23-756----ANIIKLPNISASMPQLKAAIKELQEQGYLLPDYP....DEPKNSAQKDVKIRYDRVKGSAVN-PVLREGNSDRRAP
G2PQU0_MURRD/3-736----ANIIKLPNISASIPQLKEAIEELQKKGYNLPNYP....DEPKTDEEKVIKAKYDKIKGSAVN-PVLREGNSDRRAP
F5XPH8_MICPN/8-738----ANIIKLPNISASIPQLKAAIRELQEKGFDLPDYP....DDPKSDEDRSIRARYDKVKGSAVN-PVLREGNSDRRAP
Q15T95_PSEA6/7-740----TNIIKLPNISASKPQLKAAIKELNDKGFNVPAYP....EDPATDEEKDIEARYSKVLGSAVN-PVLREGNSDRRAP
Q74D54_GEOSL/5-738----ANIIKLPNISASVPQLKEAIKELQDQGYNVPDYP....EDPKNDAEKEIKERYAKVLGSAVN-PVLREGNSDRRAP
L7W579_NONDD/6-738----ANVIKLPNISASVPQLVAAIKELQAKGYDIPDYL....EDPETEEEKESKKRYDKIKGSAVN-PVLREGNSDRRAP
C6X4T6_FLAB3/30-761----ANIIKLPNISASAPQLDAAIAELQKHGYAVPNYP....GEPKNAEEESIKAKYAKVLGSAVN-PVLREGNSDRRAP
F4AZL1_KROS4/7-740----ANIIKLPNISASIPQLTAAIKELQSDGYDIPDFP....EEPKTDEEKSIRARYAKVLGSAVN-PVLREGNSDRRAP
E3F024_KETVY/9-740----ANVIKLPNISASVPQLVAALKELQAQGYDLPDYP....TAPATPAEAEIRARYDAIKGSAVN-PVLREGNSDRRAA
A5FHV4_FLAJ1/6-737----ANIIKLPNISASVPQLKAAIAELQSHGYNVPNYP....EDPQNDSEKEIKAKYAKVLGSAVN-PVLREGNSDRRAP
E3I1D3_RHOVT/8-741----ANIIKLPNISASLPQLKAAIKELQGKGYDLPDYP....EEPKTDAEREIKARYAKVLGSAVN-PVLREGNSDRRSA
A1BEA8_CHLPD/6-739----ANIIKLPNISASLPQLQAAIKELQSHGYNIPDYP....EAPENDAEKEIQLRYAKVLGSAVN-PVLREGNSDRRAP
Q2L0N5_BORA1/6-739----ANIIKLPNISASMPQLKAAIKELQEQGYKLPDYP....DEPKTDAERDIKARYDKVKGSAVN-PVLREGNSDRRAP
D1BZX3_XYLCX/6-737----ANIIKLPNVSASVPQLKAAIAELQAQGFDVPDYP....EAPATDEEREIRARYDRVKGSAVN-PVLRQGNSDRRAP
E6WZW7_NITSE/6-726----ANIIKLPNISASLTQLKECIAELQEHGHDIPDYP....ENPQTEEEKQIAAKYATCLGSAVN-PVLREGNSDRRSA
A2U0V2_9FLAO/3-736----ANIIKLPNISASVSQLTEAISELQKLGYNIPDYP....ENATTEEEKSILALYNKVKGSAVN-PVLREGNSDRRAP
A1WFK0_VEREI/7-741----ANIIKLPNISASVGQLIACIKELQDKGHALPDYP....NDPQTGEEKALRARYAKCIGSAVN-PVLREGNSDRRAP
A6W0E3_MARMS/6-738----ANIVKLPNISASLPQLNATIKELNAEGYGLPEYP....ENPQTDEEKEVQARYSKVLGSAVN-PVLRQGNSDRRAP
F4C4X4_SPHS2/6-739----ANIIKLPNISASVPQLKAAIKELQAKGYKLPDYP....EEPKNDQEKDIKAKYDKVKGSAVN-PVLREGNSDRRAP
E4TNZ2_MARTH/6-739----ANIVKLPNISASIPQLKAAIRELQSLGYDLPDYP....DEPENDDEKKVKAKYDNVKGSAVN-PVLREGNSDRRAP
F0RFA8_CELLC/3-734----ANIIKLPNISASIPQLKEAIAELQEKGYAIPSYP....DDPKDAKEQEIKRRYDKIKGSAVN-PVLREGNSDRRAP
A6Q7S1_SULNB/5-725----ANIIKLPNISASIGQLKECIAELQSQGFDIPDFP....ENPETEEEKAIRAKYNPCLGSAVN-PVLREGNSDRRAA
E4TEW9_CALNY/5-739----ANIIKLPNISASIPQLKAAIKELQEKGFAVPDYP....EDPQTPEEKAIHARYAKVLGSAVN-PVLRQGNSDRRAP
F5Z8R7_ALTSS/5-738----ANIIKLPNVSASIPQLRATIAELNEKGFNVPAFP....DSPKTDEDQEIRERYGKVLGSAVN-PVLREGNSDRRAP
A7ZDM4_CAMC1/4-723----ANIIKLPNISATLVQLKAAIEELRSKGINVPFYP....DEIITDYDEEIAKKYAKVLGSAVN-PVLRQGNSDRRVL
C7RB77_KANKD/5-738----ANIIKLPNISASIPQLKATIKELQDKGYALPDYP....DNASSDEEKDIRNRYDKIKGSAVN-PVLREGNSDRRAP
M5DRS5_9GAMM/7-740----ANIIKLPNISASLPQLKDALKELRKKGYALPLYP....NDPVTEADFELRARYDKIKGSAVN-PVLREGNSDRRAP
L0GSZ1_9GAMM/6-739----ANVIKLPNISASIPQIKACIKELRGKGYPLPDYP....DEPKTDAERDIKARYDKVKGSAVN-PVLREGNSDRRAP
I3ZX83_ORNRL/7-736----ANIIKLPNISASVKQLEDAIAELQSHGYNVPNYP....LEPKNDEEKDIKKRYAVVLGSAVN-PVLREGNSDRRAP
X4QUI6_9ACTO/4-731----ANIIKLPNISASIPQLKAAVAELQSQGYALPDYP....EDPQTDAEREVRARYDAVKGSAVN-PVLREGNSDRRAP
A5WH86_PSYWF/3-738----ANIIKLPNISASIPQLKAAIKELQDKGFAVPDFP....DTSSTDKEKEVRARFDKIKGSAVN-PVLREGNSDRRAP
A7I2F0_CAMHC/4-731----ANIIKLPNISASIPQLIACIKELREKGFDVPQFP....AEPKNANEKEIFTRYQKILGSAVN-PVLREGNSDRRSA
F6I9T7_ZOBGA/3-737----ANIIKLPNISASVPQLNEAIKELQDKGYALPNYP....DEPSNDTEKDIKSRYDKIKGSAVN-PVLREGNSDRRAP
G8MDD3_9BURK/7-743----TNIIKLPNISASLHQLTSAIKELQSKGYKLPDYP....EEPKNDEEKAIRARYGKCLGSAVN-PVLREGNSDRRAP
F2J468_POLGS/28-761----ANVIKLPNISASQPQLNAAIKELQAQGYKLPDYP....SEPATEEEKSVKARYDAIKGSAVN-PVLREGNSDRRAP
C0QS34_PERMH/5-743----ANIMKLPNISASVPQLKEAIKELQEQGYPLPDYP....ENPQTEEEKKIKERYDRCVGSVVN-PVLRQGNSDRRLA
O53611_MYCTU/7-741----TNIIKLPNISASVPQLVAAIKELQDKGYAVPDYP....ADPKTDQEKAIKERYARCLGSAVN-PVLRQGNSDRRAP
G4QH54_GLANF/7-739----ANIIKLPNISASIPQLQAALKELRAKGYALPNYP....EEAKTEEEKIIKATYAKVLGSSVN-PVLREGNSDRRAP
W0DU46_9GAMM/6-739----ANIIKLPNISASIPQLTGAIAELQAQGYAVPDYP....ANPQNEQERDIKARYAKVLGSAVN-PVLREGNSDRRVA
C3PLB9_CORA7/3-723----ANIIKLPNISASLVQLKKAIAELQAAGYDLPEY.............EEAQEKYDAVKGSAVN-PVLREGNSDRRAP
Q4JTI7_CORJK/3-736----ANIIKLPNISASIPQLQAAIAELQKAGYDLPDYP....SEPKTDEERDAQARYDSVKGSAVN-PVLREGNSDRRAP
D1BGD8_SANKS/3-734----ANIIKLPNVSASLPQLKAAIAELQAQGYDLPDHP....DAPATDADEDVRARYDKIKGSAVN-PVLREGNSDRRAP
Q1R071_CHRSD/6-739----ANIIKLPNISASGPQLKAAIKELQSQGYPLPDYP....DEPSSDEEKAIKAAYDKAKGSAVN-PVLREGNSDRRAP
D4H3K7_DENA2/6-741----ANIIKLPNISASIPQLQEAIKELQEKGYDVPDYP....EEPKNDEEKSIKERYAKVLGSAVN-PVLREGNSDRRAA
Q7VGX2_HELHP/2-729----ANLIKTPNISASIPQLKAAIKELQGKGYDVPNFP....DEPQNDTEKAIKEKYQKVLGSAVN-PVLRQGNSDRRST
Q2W9R4_MAGSA/37-771----ANIIKLPNVSASVPQLKAAIKELQSQGYKIPDFP....EDPKTDAEKELKARFGKVLGSAVN-PVLREGNSDRRAA

PF02504

PLSX_SYNY3/6-328LNR...HPHQGINLTI--------VDAEGVV---EMEEDA----------------------------------------
PLSX_HELPY/1-317ISK.....ELASKVEM--------IHTQDYI---KMEEAA----------------------------------------
PLSX_CHLTR/3-311MNS.....PLSRSVRI--------VTAEDFV---SMEDSL----------------------------------------
PLSX_ECOLI/4-331LAK..ADFEQRSRLQI--------IPAQSVI---ASDARP----------------------------------------
PLSX_BACSU/1-321LTT.....TSDR.ITV--------LHADEVI---EPTDEP----------------------------------------
PLSX_AQUAE/2-322LEKA..KEHNNSLLEV--------VHAPDKV---EMHEPP----------------------------------------
D5AUL6_RHOCB/12-337VKAR....RLKSCVTI--------RHATGVV---TMHDKP----------------------------------------
I3VW60_THESW/1-316VRE.....KD..GLTI--------VHAKDVI---TNNEPP----------------------------------------
W8T1H7_EUBAC/28-365VVEVATEEEAHKKMEE--------LLDSGYI---HSCVTV----------------------------------------

PF01515

PTAS_BACSU/3-319AKAKELNLTLGG.VKI--------YDPHTYEGM.EDLVQA----------------------------------------
EUTD_ECOLI/1-320QFALSHGVAMDG.LQV--------IDPHGNLAMREEFAHR----------------------------------------
PTAS_CLOTH/2-324S..LAGDIDLEG.VMI--------EDSLNSEKL.EDYANT----------------------------------------
MAO1_RHIME/441-763LRRYGLRIRPDVDFEV--------VNPEGDPRY.RDYVDD----------------------------------------
PTAS_CORGL/5-322ERATELGLHLNT.AYL--------VNPLTDPRL.EEFAEQ----------------------------------------
PTA_SYNY3/374-693VKINHIDLDLSK.VRL--------INPKTSPDR.ERYAET----------------------------------------
PTB_CLOB8/4-295................--------........D.KQQIHE----------------------------------------
PTAS_BORBU/10-350LKEFSNCNDILGRIEV--------VDPNSFPDI.EMYLDE----------------------------------------
PTAS_MYCPN/2-315AGFNTA.......IKH--------YVIEEMD.L.TKYANF----------------------------------------
MAO2_HAEIN/429-750IKKLGLRLTAGVDFEI--------VDNEDNPRY.EECWKH----------------------------------------
PTAS_CLOAB/2-326EKASELNLDISK.AEI--------MDPETSLKT.ETYARD----------------------------------------
MAO2_RHIME/438-756AEREGIDLDRAG.IQI--------VNARLSKRV.GAYTDF----------------------------------------
A1B2J3_PARDP/4-314G............AGR--------IDPAGAPDL.AELADH----------------------------------------
I3VW55_THESW/3-324N..AAKDLDISK.AEI--------IDPVKSEMF.DRYAND----------------------------------------
PTB_CLOAB/4-295................--------........D.HDEIVS----------------------------------------
PTA_MYCTU/365-682LRAAELGVDLDG.ATV--------IEPCASELH.DQFADQ----------------------------------------
Q32DP2_SHIDS/392-707RVAASQGVELGAGIEI--------VDPEVVR...ESYVGR----------------------------------------
Q6MTX6_MYCMS/5-317SEIKNN.......SSI--------KTICLDEFDTKEFSEE----------------------------------------
Q8TK18_METAC/4-325A..LAGDLDLSK.AKI--------VNPKTYEKK.DEYINT----------------------------------------

PF04166

F9D1K6_PREDD/35-324..............EA--------QEDRVNLLTVFD-EDI...................................K....
D7BZZ5_STRBB/44-335...PEE..AE.FT.PG--------R...........-..I...................................N....
K9XHU5_9CHRO/45-341................--------.CQCCRDNFANP-EEL...................................K....
K9Z747_CYAAP/38-335................--------.QPFTSQELIHP-DSL...................................N....
F3ZVB4_MAHA5/32-323........QGVYK.HG--------I...........-..I...................................D....
D4G8G2_RIEPU/43-336..............LE--------YARQDK......-GSI...................................Y....
E3I1T8_RHOVT/40-335..............DA--------APVFD.......-DAL...................................P....
F0R264_BACSH/34-324..............EA--------QEGRLSIVNCTE-DEL...................................K....
Q1LSS1_BAUCH/32-325...............V--------RLNNI.......-GEL...................................T....
D5WYG1_THIK1/23-322...VEL..DE.LA.EW--------KKVPR.......-GAI...................................P....
Q10ZN5_TRIEI/41-337................--------....SLEKLVYW-ENL...................................K....
Q7MTA8_PORGI/34-326..............EA--------VEGRVNLVNCIP-EDA...................................K....
G2TI06_BACCO/34-325...PEE..GK.YQ.SG--------T...........-..I...................................D....
Q3V872_LEGPH/26-315..............SF--------KKKA........-GYL...................................T....
B1ZNR3_OPITP/35-329..............QG--------FAEVIQPSVLDL-GLL...................................A....
K9SRP6_9SYNE/31-333................--------..KKYDLQLADP-DSL...................................E....
Q3B5B9_PELLD/30-323...........ALEHL--------PSCSC.......-GVL...................................P....
R6EJC4_9BACE/37-325..............DA--------KVKKINILNCLP-DNV...................................Y....
M4Q2H5_LIBAS/32-328..............NA--------VSIFK.......-KAL...................................P....
PDXA1_BRADU/37-333....DREWPN......--------............-..L...................................C....
PDXA_XANP2/36-328..............DA--------AGHFA.......-EAL...................................P....
D3EPC7_ATETH/40-355................--------..PIKKEKLANP-ETL...................................S....
X2H9I6_9NEIS/29-319..............NK--------PV..S.......-GVL...................................E....
L0ETE9_LIBCB/39-331..............NA--------ISIFR.......-DHL...................................P....
B4F2I1_PROMH/31-324..............PP--------TAHIP.......-GQI...................................C....
V5UBQ7_9BURK/58-340................--------............-DRV...................................R....
A6VU54_MARMS/37-327..............DV--------TAHQQ.......-GSI...................................S....
C4XST4_DESMR/41-331..............WT--------RLSDYDAVAEAA-PGI...................................Y....
M7SPY7_EUTLA/39-323................--------............-...........................................
Q0K4Q7_CUPNH/34-327YHWQLPERPAY.....--------............-...........................................
D4J4Q1_9FIRM/33-335...VKE..AK.FE.FG--------I...........-..I...................................D....
A0JTQ9_ARTS2/490-781...VED..AV.FT.PG--------R...........-..V...................................N....
W0DDM8_9AQUI/28-311................--------...EVNAPGVYL-IDL...................................N....
G4RBH1_PELHB/33-315................--------...TDPESWGRS-GSV...................................D....
D2R6V9_PIRSD/43-337..............RA--------PSAIVRPTVVHL-PSL...................................D....
G7Z7B0_AZOL4/38-329..............EA--------VDLFA.......-QAL...................................P....
I7HG37_9HELI/28-302................--------............-.GL...................................S....
R6SBC2_9BACE/34-324..............EA--------QDGRVNIVNCTA-DEL...................................K....
D9RAU4_CLOSW/32-323........EGVFE.EG--------I...........-..L...................................N....
F0NYL8_WEEVC/36-325..............KA--------VEGKINVVNLWK-NPI...................................E....
F2IC16_FLUTR/45-335..............EA--------VNRKINIVNVWN-EEV...................................Q....
M1PE68_DESSD/26-315IIPWLP..GDAIP.AG--------Q...........-......................................N....
H1Z8Q7_MYROD/36-324..............QI--------VTGKLNVLNLWK-ENV...................................N....
PDXA_BACHD/33-324........EAMFE.YG--------T...........-..I...................................D....
Q3SGF8_THIDA/30-317..............SV--------PEHRP.......-GAL...................................H....
R5KK03_9BACT/34-324..............EA--------HSGKLNLLTTFD-EEV...................................K....
B8IWD3_METNO/40-332..LCNLDPADI.....--------............-...........................................
K9TXI9_9CYAN/42-377..............RQ--------SPYCPLDSYIHP-DEL...................................N....
PDXA_SYNJB/34-331................--------.RDRSPAPLAHP-AGI...................................P....
Q1QSM0_CHRSD/42-333MPIDSISRDET.....--------............-...........................................
K9SMQ8_9CYAN/47-343................--------.NKLSCEPLADP-EII...................................T....
PDXA_PROAC/35-325........HIEPE.SN--------V...........-..I...................................N....
L0DWB4_THIND/35-324..............PR--------APTPP.......-GTL...................................E....
H8GMF2_METAL/35-325..............PP--------SPHRH.......-GEL...................................S....
PDXA_GEOMG/34-325...TLN..WEESK.EG--------V...........-..L...................................P....
R4I106_9ENTR/29-321..............SV--------QPQCA.......-GRL...................................L....
E1SLK8_FERBD/27-319..............PA--------REQQA.......-GTL...................................T....
A1AU02_PELPD/36-329...VEE..ARRVE.NG--------A...........-..I...................................P....
PDXA_RALSO/37-328................--------............-AAL...................................T....
PDXA_THISH/31-321..............PA--------APDPA.......-GCL...................................T....
Q3V808_RHISN/34-320...VVD..AK..P.DG--------ALN.........-...........................................
D3VCQ4_XENNA/32-324..............TS--------SSQSA.......-GTL...................................T....
PDXA_AGRT5/37-329..............SA--------VSLFE.......-RAF...................................P....
G7URF7_PSEUP/27-304..............RA--------VPRASQV..THS-HTI...................................D....
G0IUL6_CYCMS/36-326..............DV--------HHRKINVINVVQ-ESP...................................E....
R7J8E6_9PORP/34-325..............EA--------GLNRVNIINCVE-DDI...................................K....
J3Z564_9ENTR/29-321..............AP--------TLRPS.......-GEL...................................S....
I1F0R6_AMPQE/348-642..............LP--------SACEIAP.....-GEL...................................P....
K7AU99_9ALTE/28-319...............E--------HTLPA.......-GQL...................................F....
PDXA_SYNY3/35-336................--------LAQNPGLNLADP-ETI...................................N....
E1VLH2_9GAMM/30-317..............TP--------LPK.........-GQL...................................R....
R4KFZ8_CLOPA/32-323........EGKYT.LG--------T...........-..I...................................D....
R5Y392_9BACE/33-324..............QC--------AAGKINMINCFD-DEL...................................K....
W0PFJ8_9BURK/36-327........EASNE.VG--------T...........-..I...................................E....
R6YA75_9BACT/37-327..............DA--------KPKKINIVNCLP-DNV...................................F....
R5TI46_9CLOT/31-334...PSD..GL.YR.SG--------C...........-..I...................................D....
A5FXM2_ACICJ/38-335...PREALPP......--------............-..C...................................A....
PDXA_RHOBA/37-349................--------.......GCDCP-GTI...................................S....
R6W392_9BACT/35-320..............EA--------KDGRVNLVAVTN-DEI...................................K....
K9QGD1_9NOSO/46-349.............NLS--------GNL...VALANP-NSL...................................K....
PDXA_XYLFA/29-316................--------LAERP.......-GDL...................................P....
F2LWP1_HIPMA/33-327......EIPSLYK.DG--------E...........-..L...................................N....
PDXA_CAUCR/30-324..............EA--------AQVFP.......-DAL...................................P....
F5YGA4_TREAZ/37-343...ING..TQ.SK.PG--------T...........-..V...................................D....
K9RH38_9CYAN/45-348................--------KTNGNIDFLPNP-ADL...................................S....
R5P2E5_9PORP/33-319..............EA--------NPKRCNVINCID-DAV...................................K....
D2QDF7_SPILD/236-527..............QI--------SHKLTNVITCWP-DQNQ..................................D....
C4LDY8_TOLAT/35-322........EAKYE.FG--------T...........-..I...................................D....
K9T599_9CYAN/41-347..............QQ--------IFTSKEKTLANP-DEF...................................P....
PDXA_WIGBR/31-321..............SP--------KVREK.......-GEL...................................T....
F4LQ79_TREBD/32-322........ECRYA.QG--------T...........-..I...................................N....
E3HED3_ACHXA/32-321...ANV..GQ.AA.PG--------ADH.........-..I...................................N....
E6WQK3_PSEUU/29-316................--------VARQP.......-GDL...................................P....
I3Y835_THIV6/27-318..............TP--------VASPP.......-GHL...................................T....
PDXA2_BRADU/38-337..............EA--------AAAFT.......-EAL...................................P....
Q12FB7_POLSJ/51-359...........LADAA--------SVPPHCIGVLQK-CEL...................................D....
G4L110_OSCVS/33-352...VAE..AK.FQ.YG--------V...........-..I...................................D....
K9UJS8_9CHRO/31-336...............C--------QQVPSTVTLANP-SDL...................................K....
H8KWR5_SOLCM/37-327..............QA--------NPKRANLINCWD-EEV...................................K....
F2K4J5_MARM1/33-323..............DC--------PVHKS.......-GSI...................................D....
S6BVY4_9GAMM/29-317..............PP--------APP.........-GAL...................................H....
A7I3Y6_CAMHC/27-298................--------............-.GL...................................N....
F0SPW7_PLABD/43-344.............NSP--------CDSHKTPLLVDM-ASI...................................A....
D5MIQ8_9BACT/37-328...PAE..IT.GD.PG--------C...........-..L...................................E....
F2NDA2_DESAR/37-329...............G--------T...........-..I...................................D....
A4CID9_ROBBH/38-321..............GA--------IPGKVNVVNVWK-EHP...................................E....
B3PKV3_CELJU/31-323..............PV--------QPSQP.......-GEL...................................V....
Q2YBP4_NITMU/30-318..............EH--------RPGE........-GIL...................................H....
Q145L2_BURXL/43-326................--------............-KRV...................................R....
C7PP38_CHIPD/38-328..............RL--------NHKQVNVFNCWE-EEV...................................Q....
D5BRI0_PUNMI/31-320..............DA--------FSPDC.......-GAL...................................Q....
K0C9N5_ALCDB/29-316..............AP--------PT..........-GPV........................................
F6ACQ2_PSEF1/33-324...PRQ..AR.FQ.PG--------V...........-..V...................................D....
W8WYV9_CASDE/45-334...........DA.PG--------AGTTQ.......-GVI...................................G....
A1BHC0_CHLPD/30-323...........AIDEI--------AANNN.......-RTL...................................P....
L0FWR6_ECHVK/32-334...VQA..AN.FD.PQ--------V...........-..I...................................E....
B8CSX4_SHEPW/8-300..............AP--------KAQEA.......-GTL...................................T....
F7YI45_VIBA7/28-321..............AP--------KPQQA.......-GRL...................................V....
Q2W0V4_MAGSA/33-323..............EA--------EAAFA.......-VAL...................................P....
Q11UL9_CYTH3/38-329..............EV--------QPKKINLLVCWE-DDF...................................E....
D7A738_STAND/37-327..............EA--------SRLFL.......-TAL...................................P....
W0ERT9_9PORP/33-324..............LA--------DDNKINLITCVD-DEV...................................K....
R6ZD40_9FIRM/33-335........ELTGK.FG--------T...........-..I...................................E....
Q0VMV3_ALCBS/33-325..............LL--------PV..........-GSL...................................P....
M1LX07_9CLOT/31-321...ASE..CK.FN.MG--------T...........-..I...................................D....
Q6LV40_PHOPR/30-323..............PA--------QPHQA.......-GTL...................................V....
I4WVN0_9GAMM/31-318..............PP--------MRRP........-GTL...................................R....
R5AZH6_9BACE/43-334..............DT--------IDGDYNIINVIP-EDT...................................K....
A8ESJ0_ARCB4/32-303................--------............-.KI...................................R....
D5C4K3_NITHN/29-320..............PP--------EPGIP.......-GRL...................................K....
D4LRH6_9FIRM/31-357...VKE..AK.FE.PG--------I...........-..I...................................D....
PDXA_DESAH/34-326...............G--------T...........-..M...................................D....
Q7VHV2_HELHP/28-304................--------............-.DY...................................P....
C5BPB7_TERTT/27-316..............PA--------TAAP........-GEL...................................C....
K0C3B1_CYCSP/29-319..............AS--------SAHKP.......-GTI...................................N....
PDXA_AQUAE/29-313................--------...EAKERGVYL-IDL...................................N....
Q3V7R0_BARHE/29-325..............NP--------VKNFQ.......-EAL...................................P....
F0S0E1_DESTD/33-310.....P..INEPG.TH--------L...........-..I...................................N....
X4ZK45_9BORD/30-329....TLEQETV.....--------............-...........................................
Q31F25_THICR/26-318..............PP--------CANQA.......-GEL...................................K....
D5A6D6_ARTPN/31-330................--------..RKTTQAIANP-DHL...................................N....
Q1LRA2_RALME/46-333................--------............-GDV...................................I....
A4FFA9_SACEN/36-326........QARFE.PG--------A...........-..I...................................D....
PDXA_CHRVO/29-318..............PA--------PA..........-GAL...................................E....
R6FKU7_9BACE/34-324..............EA--------MPDKLSVVNCTD-DEV...................................K....
K9V9D2_9CYAN/37-340...........KFVVD--------ADL.....LVNP-DEI...................................K....
R6XPS3_9BACT/34-324..............DA--------QDGRINLLAAVE-EEV...................................K....
K9YBG1_HALP7/36-336................--------...NDVSDLVSV-DQI...................................P....
A1STS2_PSYIN/28-319..............AA--------KANQI.......-GSL...................................K....
A1WLE5_VEREI/41-335....TIQASQV.....--------............-...........................................
R6F0Q9_9BACT/34-321..............DA--------VDGRVNLLACFD-EEV...................................K....
PDXA_RHOPA/35-328..............DA--------AAAFA.......-TTL...................................P....
PDXA_DESOH/33-325ISMFSP..APPLS...--------............-...........................................
G2PNX1_MURRD/35-323..............QA--------LEGKVNIVNVWK-EVP...................................K....
G7UQC7_PSEUP/28-315................--------SAAAP.......-GDL...................................P....
PDXA_SACD2/29-320..............AV--------TTSA........-QHI...................................S....
E6VTD1_DESAO/30-339..............FE--------VLENPETIGRQE-AGV...................................Y....
Q24RU8_DESHY/36-320..TRKFDAADL.....--------............-...........................................
R5L6M7_9SPIR/33-320........EA....EG--------I...........-..N...................................N....
K9TNE7_9CYAN/53-349................--------...KSQTAIADP-EQF...................................L....
D3IAQ7_9BACT/34-319..............EA--------TDGKVNLLTCFD-EEI...................................K....
D5BDL9_ZUNPS/47-332..............HA--------IDGKVNIVNVWK-ESV...................................T....
Q2IHP1_ANADE/33-321........GLPVVEPG--------APLPPGGALVAT-TAL...................................P....
R6CJV8_9BACT/34-324..............DA--------EDGRINLLPAVD-EEV...................................K....
R6WB32_9FIRM/32-323........EGDYR.KG--------I...........-..L...................................N....
E4RQ40_LEAB4/33-324..............QA--------QQKHSNLINCGK-GEFF..................................D....
W6RZF2_9RHIZ/33-317........ADTAG.AG--------K...........-..I...................................A....
Q11HH0_CHESB/29-325..............TA--------AAHFG.......-RAL...................................P....
E6SJ78_THEM7/43-331........HGAYT.PG--------T...........-..L...................................D....
F9ZZH4_METMM/31-322..............PA--------SPTPA.......-GSL...................................S....
L7W827_NONDD/35-323..............QI--------VHGKFNVLRLIK-EPF...................................N....
F3ZNL8_9BACE/34-324..............EA--------EDNKLSVLNCAD-DDI...................................R....
R7HMN9_9BACT/35-323..............DA--------ADGVNNLVEVVD-GEV...................................R....
W0JF83_DESAE/33-320......NI....K.EE--------A...........-..L...................................N....
PDXA_RUEST/31-317..............EA--------LQVSA.......-DAL...................................P....
C7R7U0_KANKD/33-321..............EA--------LAHRI.......-GHL...................................W....
Q0AC81_ALKEH/31-319..............PA--------GPHRP.......-GVL...................................P....
PDXA_DESAA/33-325...............G--------R...........-..V...................................D....
A4YT91_BRASO/34-325..............EA--------SQAFA.......-SAL...................................P....
K4KQ47_SIMAS/25-316..............TR--------RSQAP.......-GEL...................................A....
F9YQW3_CAPCC/34-322..............NA--------VEGKLNVLNCWK-DSP...................................N....
D5V304_ARCNC/38-309................--------............-.NL...................................E....
D4MSX7_9FIRM/33-348...VSD..AL.FE.SG--------T...........-..I...................................D....
M5DPJ7_9GAMM/27-319..............PI--------RASGN.......-GTL...................................T....
A6TJU5_ALKMQ/33-334...VKE..AK.FA.FG--------T...........-..I...................................D....
E0URZ3_SULAO/30-300................--------............-.HV...................................T....
N0BC98_9RHIZ/43-337..............AA--------ADVFP.......-HAL...................................P....
PDXA_XANCP/28-315................--------HARLP.......-GDL...................................P....
F2NA55_CORGP/35-342...PDQ..AR.FE.PG--------V...........-..I...................................D....
B4RBS3_PHEZH/33-326..............EA--------ARVFP.......-EAL...................................P....
K0NNW0_DESTT/36-328...............G--------T...........-..L...................................D....
M1FJA7_9ALTE/30-319..............VA--------STAA........-GEL...................................S....
K4RKJ5_HELHE/29-301................--------............-NHT...................................Y....
C0ZNI3_RHOE4/384-675...IKD..AE.FI.DG--------R...........-..I...................................N....
Q65VM2_MANSM/32-323........EAKYE.LG--------T...........-..F...................................D....
A6H263_FLAPJ/36-324..............QM--------VIGKINVLNVWR-EGV...................................N....
B5YL57_THEYD/32-311................--------............-......................................K....
PDXA_PROA2/35-326...........APEKA--------AAYPQ.......-GVL...................................P....
B1WU75_CYAA5/40-358................--------..YSTVQPLADP-DSF...................................P....
I0IQ54_LEPFC/42-330....AE..EFSKD.PG--------V...........-..M...................................D....
B7K1J6_CYAP8/40-344................--------..HSQGVSLAHP-DTL...................................D....
K9VBC1_9CYAN/53-351................--------RSSNPAAQAANP-ETL...................................N....
C6VZ75_DYAFD/37-328..............QA--------NHKLTNVITCWH-DHQT..................................E....
A3DDY3_CLOTH/32-324........SKVVSDSS--------T...........-..I...................................N....
B0UIV0_METS4/30-326..............EA--------AAAFS.......-RAL...................................P....
K8GJQ6_9CYAN/32-348................--------.VRETDAPLAHP-SQL...................................S....
F6ILZ0_9SPHN/44-324..............RR--------M.RSFEAPSDEA-GVI...................................D....
A2TY27_9FLAO/35-323..............QI--------NHNKINVLNIWK-EEV...................................K....
PDXA_OCEIH/33-325...EEL..MD.TE.FG--------K...........-..I...................................T....
D2UFS9_XANAP/28-315................--------AALAP.......-GDL...................................R....
E6X8R2_CELAD/35-320..............KA--------LAGKINVVNVWR-EIP...................................N....
PDXA_SYMTH/33-323........EGKYA.HG--------T...........-..V...................................D....
B5Y706_COPPD/31-322........EGLYR.HG--------T...........-..V...................................D....
F8EQB4_RUNSL/37-328..............QA--------NPKVTNVITCWP-NTDE..................................D....
I3YUG2_AEQSU/35-321..............DL--------VPKKINVLNVWK-EHV...................................D....
B8ET21_METSB/41-335..............EA--------LEAFS.......-RSL...................................P....
F8GL31_NITSI/33-321...............P--------SPHKA.......-GSL...................................H....
PDXA_GEOLS/34-329...PAE..AADLP.DS--------V...........-..I...................................P....
E4PQY6_MARAH/32-319..............SP--------EMEA........-GLL...................................S....
Q5WKA6_BACSK/32-321........EARGE.YG--------T...........-..I...................................D....
C1D5J7_LARHH/29-317..............PA--------PAA.........-GVL...................................E....
F4B1R1_KROS4/36-321..............KA--------LDNKINVYNLWK-EPV...................................E....
D6Z2T8_DESAT/51-341LNPWQP..GQPLG.SG--------A...........-..L...................................N....
C9LXC2_SELS3/37-327........AALDE.AG--------V...........-..I...................................N....
G4QFQ7_GLANF/29-320...............N--------YIQQP.......-GQL...................................I....
PDXA2_PSEAE/35-329HPWLSQGGDEF.....--------............-...........................................
Q0RWE6_RHOSR/36-321................--------..TADGLATPMA-DVV...................................D....
PDXA_CYAP7/30-337..............RS--------LPHVNHSDLVDP-ANL...................................L....
M4ZUB5_9FLAO/36-325..............EV--------VDYKINVFNIWK-EDI...................................K....
R7G4X4_9FIRM/35-326........EAKYE.FG--------T...........-..V...................................D....
D3RQF4_ALLVD/35-326..............AA--------CPSEP.......-GRL...................................N....
D8JA34_HALJB/30-324...PTE..AT.FS.PD--------A...........-..I...................................P....
D3SLG0_THEAH/28-312................--------...DIKEPGVYV-IDL...................................N....
F0SBZ7_PEDSD/33-323..............SA--------QAGKPNMINCWE-EDV...................................K....
D3SBX0_THISK/44-331..............PR--------TATPR.......-GTL...................................E....
A8IH54_AZOC5/35-332....DAEWPA......--------............-..L...................................A....
F8KS88_HELBC/29-303................--------............-NNG...................................Y....
U5RZ60_9CLOT/33-326...IKD..AE.FS.YG--------K...........-..I...................................D....
B0SWM5_CAUSK/34-324..............EA--------IKVFG.......-EAL...................................P....
PDXA_SULSY/29-314................--------...DVVKSGIYL-INL...................................Y....
V4LB68_9GAMM/33-335..............PP--------CSQPP.......-GTL...................................Y....
B3ENY2_CHLPB/30-323...........AIRNA--------SLSPD.......-.TL...................................P....
R5Q2C0_9BACT/34-312..............EA--------CEGRINMLACFD-EEV...................................K....
G2Z4E3_FLABF/35-323..............QI--------VLGKINVLNVWK-EGV...................................N....
C6XKP9_HIRBI/31-329..............DA--------EKAFH.......-TSL...................................P....
Q0K4F5_CUPNH/34-323...PEE..AR.FQ.SG--------T...........-..I...................................D....
W0BBF6_9GAMM/27-315..............KT--------VTDS........-NQL...................................A....
K9XSR0_STAC7/33-337..............QQ--------NSNLKPQDLANP-ENL...................................D....
B6JGM3_OLICO/32-326..............SA--------AEIFP.......-RAL...................................P....
D5SV98_PLAL2/38-331..............KG--------MS.VTGPTVIDC-GAI...................................E....
PDXA_SERP5/29-321..............PA--------QPQRA.......-GTL...................................T....
C7RNL8_ACCPU/39-326..............SP--------QA..........-GVL...................................D....
R6WFT1_9BACT/34-321..............DA--------VDGKVNLLTAFD-EDV...................................K....
PDXA_PSEA6/27-318...............T--------DIQPA.......-GSL...................................Y....
J7Q941_METSZ/35-329..............QA--------RDVFS.......-RAL...................................P....
PDXA_METCA/29-318..............VV--------PPHEP.......-GVL...................................H....
R5FA16_9BACT/34-322..............NA--------EPGKLNLLPVFD-EDV...................................K....
PDXA_AZOSB/30-318..............AQ--------AA..........-GVL...................................E....
D3HPI6_LEGLN/27-314..............EP--------LKSKP.......-GCL...................................S....
C6D3S5_PAESJ/31-322...VTE..AQ.YE.YG--------T...........-..V...................................D....
C4ZNQ2_THASP/34-328..............PA--------P..E........-GAV...................................E....
Q1ART0_RUBXD/32-322...PEE..AR.FR.PG--------SVD.........-...........................................
A0KGT9_AERHH/28-320..............PA--------RPQRA.......-GTL...................................T....
PDXA_PASMU/32-326ISHKSSHPKPF.....--------............-...........................................
Q5QVN8_IDILO/29-320..............EL--------PQHEP.......-GHL...................................W....
I2F8G1_9THEM/47-340........DQTEFSPG--------T...........-..L...................................S....
D7DN38_METV0/32-322..............HT--------AHLGN.......-GSI...................................T....
K4IU70_PSYTT/35-320..............EA--------IEGKINVVNVWK-ENV...................................K....
F2KU47_PREDF/35-321..............DA--------QEGRLNLLPVFD-DEI...................................K....
D9QLJ7_BRESC/29-321..............DA--------ASVFA.......-RGL...................................P....
B0BZ85_ACAM1/36-343.............QKQ--------TGLDVDQTLANP-KNL...................................D....
Q8KEU1_CHLTE/31-322...........AIAKI--------AAEPG.......-.VL...................................H....
A5G9E3_GEOUR/36-328...GVP..PEATT.PG--------V...........-..L...................................Y....
F0RGS0_CELLC/35-323..............KA--------VDNKINVVNVWK-EIP...................................K....
Q2G9Z1_NOVAD/34-325..............EV--------ADRFA.......-DAL...................................P....
Q3IWS4_RHOS4/37-320........GDGAP.EG--------S...........-..V...................................A....
E4RPK4_HALHG/32-334...VDD..IK.GE.YG--------T...........-..I...................................D....
Q82W16_NITEU/32-321...............V--------QPHRA.......-GQL...................................S....
D5QAY7_KOMHA/32-316..............AA--------RAAFA.......-DAI...................................P....
R5CC16_9BACE/34-324..............DA--------APDRLSIVNCND-DEV...................................K....
R5P6P7_9BACT/34-321..............EA--------KEDKLNIITAFD-EEV...................................K....
A4FIE2_SACEN/34-325...VAD..AV.FA.PG--------R...........-..V...................................N....
B9LZ80_GEODF/35-326...EMP..DRDPA.SG--------E...........-..L...................................Y....
A3U5N8_CROAH/35-320..............KI--------IDGKVNVYNVWK-ENV...................................N....
PDXA_CAMJE/28-357................--------............-.NL...................................KLFNA
R5GSB3_9BACT/34-324..............DI--------AEGRLNMVECYP-EEV...................................K....
Q479U5_DECAR/29-319..............AQ--------AP..........-GSL...................................D....
R6AA64_9BACT/49-340..............DA--------VAGKLNIVNCSD-DEI...................................N....
PDXA_NEIMB/28-321..............GG--------AA..Y.......-GEL...................................E....
D1B2K3_SULD5/28-299................--------............-.GL...................................D....
K9PX21_9CYAN/31-332................--------.RLKTTEPLADP-ATL...................................D....
F2GA18_ALTMD/29-320...............P--------QVQAA.......-GSL...................................F....
B4EGN0_BURCJ/39-337....TIGAAQV.....--------............-...........................................
M1WYQ3_DESPC/31-331..............YE--------RVTQPETLGDRP-TGV...................................Y....
E8V3H9_TERSS/35-313...............G--------VNFVA.......-LGV...................................D....
E7ABT4_HELFC/29-301................--------............-DHA...................................Y....
PDXA3_RHIME/42-334..LAHLDPADV.....--------............-...........................................
E6WY24_NITSE/28-307................--------............-.GL...................................E....
C6XUZ6_PEDHD/33-321..............TA--------NPKKPNLINCWE-EDV...................................K....
B4SF48_PELPB/31-318...........APVRH--------GA..........-..L...................................P....
I5B2I7_9DELT/36-328...............G--------F...........-..L........................................
Q65EJ5_BACLD/32-325...PDE..GG.FV.HG--------K...........-..I...................................D....
D3QBQ2_STANL/35-328........VAPAG.PG--------T...........-..I...................................D....
I6ZML4_MELRP/28-311..............EE--------QASDK.......-YNI...................................H....
Q5LKY3_RUEPO/32-322..MQTIDPSEI.....--------............-...........................................
Q2RKJ4_MOOTA/32-333...PGE..GR.YE.YG--------T...........-..I...................................D....
R5EF26_9GAMM/29-323..............FV--------PQTK........-GTL...................................C....
W0E2J5_MARPU/29-320..............AP--------APNQP.......-GTI...................................R....
H1Y4I7_9SPHI/33-321..............QV--------NPKRANLINCWE-EDV...................................K....
E3GDT1_EUBLK/31-337...LKETLAH.LE.KD--------A...........-..L...................................P....
E0WS58_9ENTR/33-325..............TN--------ALSSK.......-GTL...................................T....
W8F8Y2_9BACT/31-322..............DI--------APGKHNAVTCWD-EDY...................................H....
B3QV85_CHLT3/26-321...........AISTM--------DAAQK.......-.VL...................................P....
A8LS85_DINSH/31-321..LDTIAPEDV.....--------............-...........................................
A0Q399_CLONN/32-323........DGKYE.AG--------T...........-..L...................................D....
K7YNJ0_9PROT/35-327..............YA--------SNAFP.......-SAL...................................P....
R7EVF6_9BACT/42-333..............QA--------RDGVVNLVNISD-KEF...................................K....
I3Z6X6_BELBD/36-323..............EV--------HHKKINLINVID-ESP...................................E....
PDXA_HYDS0/28-302................--------...DVKDKGIYL-ISL...................................S....
W0EZ35_9SPHI/35-325..............KI--------NPKQVTIFNCWD-EEV...................................N....
D5CTH9_SIDLE/30-349..............PL--------EN..........-GKL...................................S....
R7LG84_9BACT/48-339..............EA--------VDGQLNFVNVSD-DEI...................................K....
D3E9G4_GEOS4/31-324...PAE..AT.YE.FG--------T...........-..V...................................D....
E3FNJ1_STIAD/27-308................--------............-...........................................
X5D8G7_9BACT/35-325..............EL--------LPKKANIINCVD-ENI...................................R....
G8PQZ0_PSEUV/36-329..............AA--------CDCFD.......-EAL...................................P....
L0DE58_SINAD/36-336..............DA--------RPTARLIPCLEA-TDE...................................D....
G8QYY1_SPHPG/33-336...VSD..AK.FE.QG--------T...........-..I...................................D....
W8KS11_HALHR/35-325..............PP--------QANAP.......-GQL...................................H....
G8TP28_NIAKG/36-322..............RV--------NYKQINIFNCWE-EEV...................................G....
PDXA_VIBCH/28-321..............PV--------QAQQA.......-GTL...................................L....
T2KID2_9FLAO/35-320..............QL--------VIGKVNVLNCWK-ENV...................................S....
U5LJV8_9BACI/34-327...LEG..LD.YQ.LG--------T...........-..V...................................Y....
PDXA_PERMH/27-312................--------...EAEKEGVYL-INV...................................Y....
PDXA_RHILO/36-329..............LA--------AQVFA.......-RAL...................................P....
Q89M19_BRADU/33-325..LRHLDPRDV.....--------............-...........................................
K9VZP3_9CYAN/50-362..............QR--------QNHQNSDLLIDP-AKL...................................T....
PDXA_FUSNN/31-321........EGKYE.KG--------I...........-..L...................................N....
E0SNM5_IGNAA/34-327................--------............-GKV...................................Y....
G0AAS4_COLFT/40-342..............LR--------NNGLPNFPP...-GQI...................................A....
A6Q3Y7_NITSB/29-300................--------............-.KV...................................Q....
A7HYG3_PARL1/38-330..............EA--------AEVFP.......-GAL...................................P....
G4STZ3_META2/32-323..............EL--------VEQSA.......-GSI...................................S....
R4W4P1_9EURY/25-318...VAE..AS.FA.DD--------A...........-..V...................................S....
E4TVA5_MARTH/35-325..............EL--------SDKKLNVLNLWE-ETV...................................N....
R5IKT1_9CLOT/33-336...VSE..AK.YE.YG--------T...........-..I...................................D....
R7CXE5_9BACE/34-324..............EA--------SHGKLSVVNCAN-DEV...................................K....
G8QPR5_AZOSU/28-330..............PA--------PA..........-GSL...................................E....
PDXA_HERAR/30-332..............VR--------NSGLPAFPR...-DQI...................................T....
Q7VQK2_BLOFL/37-330..............TT--------SYKS........-HSA...................................S....
C7M3J3_CAPOD/34-323..............AA--------IDGKLNVLNCWK-ETP...................................T....
R6TUF4_9FIRM/17-307QDPEQV..........--------............-...........................................
D1CHU7_THET1/34-324........EAVCE.YG--------T...........-..L...................................E....
PDXA_CAMFF/30-301................--------............-.KF...................................T....
I4BXC4_ANAMD/32-320...TDQ.....CK.EG--------K...........-..L...................................N....
E1R632_SPISS/37-339...VED..AR.FE.YG--------T...........-..I...................................D....
C4ZHF2_EUBR3/32-338...IKA..AK.FE.YG--------T...........-..I...................................D....
B8I6T9_CLOCE/32-323........MPASD.KS--------T...........-..I...................................N....
F4CNN9_PSEUX/26-309..............VR--------LREHVPDVPPEA-GVL...................................D....
C5B7P2_EDWI9/30-321..............SP--------QAQQA.......-ATL...................................T....
PDXA_SYNFM/34-329..PAEL..PDDPG.SD--------R...........-..I...................................P....
F2I3R8_PELSM/32-321................--------............-...........................................
K7VXY6_9NOST/36-337...............S--------KNIDNSLALANP-VDL...................................S....
R5D0H0_9BACT/34-324..............EA--------HNNKVNLLTTFD-QEI...................................K....
H6L3Q9_SAPGL/32-322..............QP--------EEGQINVVNCWS-DNV...................................R....
R6F1V4_9BACT/34-322..............DA--------MEGRLNLLAAIE-DEV...................................K....
Q2S3U3_SALRD/96-387..............EV--------PHGDVAVLDVAE-DPEP..................................P....
H2FZ12_OCESG/28-320..............EP--------VPQKA.......-GTL...................................T....
L0K3J5_9EURY/33-327...VAD..AT.FA.AD--------A...........-..I...................................P....
G8R4P5_OWEHD/35-324..............QI--------SDRKANLLNCWN-DEV...................................N....
I1YL39_METFJ/29-320..............PA--------TPSRA.......-GMI...................................K....
PDXA_COLP3/27-319..............PA--------KSQKS.......-GSL...................................T....
Q215S3_RHOPB/38-329..............QA--------AATFA.......-DAL...................................P....
I0DWR7_PROSM/32-323..............EH--------DAQVP.......-GTL...................................S....
D3DGU5_HYDTT/29-313................--------...EVKAPGTYI-ADL...................................D....
C6X2C9_FLAB3/36-324..............QA--------QSDKINMVNLTA-DNV...................................N....
Q02C14_SOLUE/41-313................--------............-...........................................
G0G667_AMYMS/33-323........DARFT.TG--------V...........-..I...................................D....
A9GKN1_SORC5/15-317................--------............-......................................R....
Q1QKW1_NITHX/32-325..............DV--------SGIFT.......-EAL...................................P....
H1XYD5_9BACT/33-325........KAPEK.LF--------Q...........-..N...................................D....
D4GUQ8_HALVD/34-328...VAD..VR.SD.PS--------T...........-..L...................................F....
PDXA_BEII9/33-322...VEE..AG.CE.DG--------VLN.........-...........................................
F9Z465_ODOSD/33-319..............DA--------NPKRCNIVNCVD-DAI...................................K....
A6VPP4_ACTSZ/32-327IHHKCSHPVPF.....--------............-...........................................
I0KFB6_9BACT/263-588..............QA--------SHKMTNVITCFS-ENTPPPVPQPTVAEGDPPADGEAETPAPVVEKPAPLPVD....
B5E8C6_GEOBB/32-324...LLP..PLDAS.PH--------T...........-..L...................................Y....
Q4FMQ9_PELUB/32-317................--------....KDFSKLTN-KKI...................................N....
A5FM92_FLAJ1/36-324..............QI--------IPGKVNVYNLWK-EGV...................................D....
E3H6A7_ILYPC/32-321...IDN..IN.FS.KD--------V...........-..L...................................S....
A6QAX9_SULNB/28-306................--------............-.NL...................................P....
A9BT55_DELAS/23-315...PAQ..VP.AT.VP--------PAT.........-..L...................................F....
C3M9C3_RHISN/34-330..............NA--------AAVFA.......-NAL...................................P....
Q5LQN1_RUEPO/27-312..............RA--------VAASD.......-SAL...................................P....
E8UEJ0_TAYEM/35-326..............DV--------HEHCQ.......-NEI...................................P....
R5UVJ1_9PORP/33-321..............EA--------NAKRCNVINCVD-DAV...................................K....
PDXA_ERYLH/36-326..............EA--------NSAFL.......-EAL...................................P....
I0IDK7_PHYMF/40-342................--------............-DEL...................................S....
A8MJU3_ALKOO/32-323........DGRYE.VG--------I...........-..L...................................N....
R6WM45_9PORP/34-325..............DA--------GANRVNIINCVD-DET...................................K....
Q3ARA5_CHLCH/34-329...........DIANL--------PTTFD.......-GVL...................................P....
G8X7V7_FLACA/36-324..............QV--------VVGKVNVLNVWR-EGV...................................N....
D3UFK7_HELM1/31-300................--------............-...........................................
D9SID5_GALCS/30-319..............WE--------GACA........-GRL...................................D....
K9WP18_9CYAN/130-441...............R--------QTLENQEALVDP-EHL...................................S....
PDXA_PSEHT/27-319..............AA--------TPAPA.......-GSL...................................Y....
A1AWJ1_RUTMC/26-312..............AS--------SA..........-YEL...................................P....
PDXA_STRMK/28-315................--------EARVP.......-GDL...................................R....
Q3V8D3_GEOSL/34-325...SVP..FEEPA.DG--------V...........-..I...................................T....
B6IN68_RHOCS/40-329..............EA--------PALFG.......-SAL...................................P....
D4M806_9BACT/32-348...VSE..AA.FT.PG--------V...........-..I...................................D....
I4A0Q6_ORNRL/35-323..............KI--------VAGKVNILDIEA-PDI...................................L....
V4JCI5_9DELT/37-338...IET..AP.YR.HG--------A...........-..I...................................D....
I1XKV7_METNJ/29-321..............DP--------KPGEA.......-GRI...................................V....
U6B4X5_9RHIZ/39-331..............NA--------VAVFD.......-KYF...................................P....
G8UPW0_TANFA/30-320..............DA--------AEGKLNIINCMP-AEL...................................T....
B0TBI8_HELMI/32-323........MGKFE.PG--------V...........-..I...................................D....
F4HD17_GALAU/31-322...LDN..LN.TK.YG--------T...........-..I...................................D....
J9QT86_RIEAN/36-321..............EA--------SAGKINIVNLWK-DNV...................................N....
PDXA1_PSEAE/27-320.............WPE--------RPAKA.......-GQL...................................Y....
F4KTC5_HALH1/42-332..............RV--------FPDRVNVVNCWQ-ENV...................................N....
V9VUT8_9RHOB/30-316..............AA--------ATACA.......-DSF...................................P....
A1WVT6_HALHL/30-323..............PR--------QAHRV.......-GRL...................................P....
C5CPN5_VARPS/44-335LQRDWMQGREP.....--------............-...........................................
A8FHA9_BACP2/32-324...PEE..AEQVK.AG--------A...........-..V...................................P....
I4AG95_FLELS/65-362..............SI--------HQQKTNIVNCSS-AKI...................................E....
F6GFQ1_LACS5/35-322..............QV--------SNKKVNVFNCWK-EDV...................................H....
D9S1Z9_THEOJ/31-320...PED.....YL.DG--------F...........-..V...................................N....
U3U9G2_9BACT/29-322..............EP--------KPQKS.......-GSL...................................T....
C5ZY06_9HELI/27-295................--------............-.DI...................................K....
W0HX00_9ENTR/29-321..............PA--------TPRQA.......-GEL...................................T....
L0KAL8_HALHC/32-321.........GDYK.KE--------V...........-..I...................................N....
F9ZTS3_ACICS/32-320..............AW--------PKAEA.......-GTL...................................A....
W0PD12_9BURK/38-333...VAQ..WK.AA.HQ--------NMAIS.......-SEI...................................P....
I2EZC0_EMTOG/35-326..............QI--------NHKQVNVINCMN-DQAL..................................E....
R7PD86_9BACT/34-324..............EA--------QAGMLNLVNCFD-DEV...................................K....
Q2S9C2_HAHCH/25-319............DSPP--------HTRQP.......-GSA...................................L....
R7DEZ6_9PORP/35-326..............QI--------SDMKLNMINCID-EEV...................................K....
D0L089_HALNC/37-327..............PS--------EA..........-GTI...................................R....
K9WWL5_9NOST/42-342.............NLT--------ENV...VPLANP-AEL...................................S....
E1V6Y8_HALED/34-339..............AP--------PPPRA.......-GVL...................................P....
D7AYM9_NOCDD/33-324........EAADE.PG--------V...........-..I...................................D....
G8M1K4_CLOCD/32-322........DGNPS.PD--------T...........-..L...................................Y....
Q13RP4_BURXL/47-338...............R--------LVQLDDLPSAEP-NAI...................................D....
B1XQD4_SYNP2/31-333................--------.KTRTESDLLDP-SEL...................................E....
K9PRQ4_9CYAN/33-337.............NLA--------ENL...TPLVNP-AQL...................................S....
B2JVC5_BURP8/44-333...ASE..AR.YE.QG--------T...........-..I...................................D....
E6U0H3_BACCJ/33-324........EAKYE.FG--------T...........-..V...................................D....
I3TLQ2_TISMK/41-330..............DA--------LTAFD.......-DAL...................................P....
U3U6Y7_9ENTR/31-323..............AP--------QPQQA.......-GTL...................................T....
D8PAQ2_9BACT/40-332....SN..GLRLK.AG--------Q...........-..V...................................A....
A6WG90_KINRD/420-711...VAD..AV.FE.PG--------R...........-..I...................................N....
Q6AJE3_DESPS/35-321ITAWQP..GEQIE.QQ--------S...........-..L...................................L....
D8IZA6_HERSS/29-330..............WR--------NSGLPHFPT...-DCL...................................T....
PDXA_HELPY/30-306................--------............-HNA...................................YE...
E0UJK2_CYAP2/32-338..............RS--------LSHLKPEDLAEP-DSL...................................S....
H6LGK9_ACEWD/32-322........EGLFE.SG--------I...........-..L...................................N....
E4T4J1_PALPW/35-325..............EI--------NLKRVNIVNCVD-DEI...................................K....
I1YT17_PREI7/35-321..............EV--------QDNRINFIPVFD-EEI...................................K....
Q1GZB9_METFK/29-319..............WA--------PHQGQ.......-SRL...................................V....
W0DQ96_9GAMM/30-322..............AQ--------AALPP.......-GEL...................................Y....
S6ADC8_9PROT/41-329..............AA--------PDRA........-GVL...................................E....
Q3ACP1_CARHZ/32-323...IDE..AE.FK.FG--------I...........-..V...................................E....
C4K4L0_HAMD5/30-322..............DS--------QPCLP.......-STL...................................S....
PDXA_ECOLI/29-321..............PA--------QPQTA.......-GTL...................................T....
F4LW28_TEPAE/34-336...VED..CK.YE.YG--------T...........-..I...................................D....
R5A8A6_9CLOT/34-337...PAQ..GL.YQ.AG--------T...........-..I...................................D....
V5SD81_9RHIZ/47-343..............SV--------ADIFT.......-TRF...................................P....
D0MJ80_RHOM4/43-335..............RI--------TPERLVVVDVTG-GKAP..................................E....
M9WW13_PASHA/31-320...LDN..FV.AE.YG--------V...........-..I...................................D....
PDXA_SULDN/30-300................--------............-.NY...................................K....
M4UJW4_9GAMM/32-323..............PL--------ETLGL.......-GQL...................................Y....
A9IK05_BORPD/40-331........QVRNT.PG--------I...........-..I...................................E....
Q5E864_VIBF1/34-327..............AA--------TSHKA.......-GTL...................................L....
H8XRP0_FLAIG/36-322..............QL--------VQGKINVLNVWK-EGV...................................N....
K1WRA1_MARBU/43-327................--------............-...........................................
PDXA_SHEDO/27-319..............KP--------QPQAA.......-GTL...................................T....

PF00180

LEU3_BACMD/4-351--------------KA--------IGERFD...HQF-EFT-----------------------------------Y----
LEU3_BACSU/4-352--------------KS--------VAERFN...HEF-EFE-----------------------------------Y----
LEU3_ECOLI/6-355--------------DA--------VRNRFA...MRI-TTS-----------------------------------H----
IDHC_SOYBN/8-403--------------KD--------KLILPF...LEL-DIK-----------------------------------Y----
LEU3_AGRT5/5-361--------------EY--------MNSAHN...AGF-TVS-----------------------------------E----
IDH3A_BOVIN/33-358--------------DA--------AK..AP.....I-QWE-----------------------------------E----
LEU3_SCHPO/5-363--------------KV--------VEKKRP..ELKL-EFE-----------------------------------E----
LEU3_LEPIN/3-354--------------KK--------ALGAKV...SEF-QFK-----------------------------------E----
LEU3_NEUCR/5-358--------------KA--------IETNSPS.AGKF-NLQ-----------------------------------N----
LEU3_LACLA/4-340--------------KA--------VSKKID...FEY-ELE-----------------------------------A----
IDH_THET8/21-351--------------EA--------AK..AP.....L-AYE-----------------------------------V----
LEU3_YARLI/14-367--------------KS--------VAEASG...TEF-VFE-----------------------------------D----
IDH2_YEAST/38-365--------------SA--------AN..VP.....I-EWE-----------------------------------S----
IDH_BACSU/21-418--------------EA--------AVEKAYKGEKKI-TWK-----------------------------------E----
LYS12_YEAST/25-367--------------EN--------LNSKHG...LSF-NFI-----------------------------------D----
D5A186_ARTPN/6-352--------------KA--------VGKQLD...LSF-EFK-----------------------------------E----
G2TK86_BACCO/4-350--------------KT--------VLDNYG...HEA-VFE-----------------------------------N----
M4CW66_BRARP/45-394--------------QQ--------AGSLEG...LEF-SFQ-----------------------------------E----
Q480C2_COLP3/29-412--------------NA--------AVAKAYAGEREI-AWM-----------------------------------E----
LEU3_THET8/2-339--------------RA--------LDEAEG...LGL-AYE-----------------------------------V----
R4KBV6_CLOPA/5-353--------------TK--------VGKKYD...TKF-DFV-----------------------------------E----

PF03971

D5CQ42_SIDLE/5-737ASVKQYARKHPHR.MG....KWA.ANSRTRVAHMSS.GDF-----------------------------------YGSER
A6Q387_NITSB/6-736KAVKEYAKKFPHK.MR....DVS.PDSKSYVAHMDK.NDF-----------------------------------YQNEQ
I6WPR8_PROPF/3-733ESVKNYARTNPHR.LG....AWA.PDSRTRVATMAS.GDF-----------------------------------RHNER
D9SIT7_GALCS/5-738GAVKQFAKNNPHK.MG....AWS.PESKTHVAHMNA.HDF-----------------------------------YGSEK
D5V1Z1_ARCNC/3-729SAVKNYAKNNPHR.MG....EWT.KDSKTEVAHMDH.GDF-----------------------------------YGSEL
D1B1Z3_SULD5/7-741LCVKEYVRKNPHR.MG....EWH.QNSRSHVAYMHE.GDF-----------------------------------YGNEK
K7SLX7_PROA4/3-736AAVKAYAKAHPHR.LG....PWS.PQVRARVAHMDS.GDF-----------------------------------FGHEE
A3U876_CROAH/5-738KPVKQYAKNNPHR.MG....EWS.SDSKSHVSTMDH.GDF-----------------------------------RHNEK
A1S7A8_SHEAM/7-739LSVKNYARKNPHS.MG....KWA.SDSKSHVSHMEA.GDF-----------------------------------YGSEQ
L0FYJ1_ECHVK/23-756QAVKQFARNNPHS.MG....EWS.ADSKSHVASMSE.GDF-----------------------------------YGSEQ
F6FT01_ISOV2/6-736AAVKNYARTHPHR.MG....AWS.PESRTNVATMGH.DDF-----------------------------------FSNEK
F2II47_FLUTR/7-740RAVKNYAKKHPHS.MG....AWS.ADSQTKVASMPN.GDF-----------------------------------YGSEK
V9VSX7_9RHOB/9-736KAVKNYARKNPHS.MG....EWS.AGSKTKVSSMPG.NDF-----------------------------------YANEK
Q9I0L4_PSEAE/6-738AAVKAYARKHPHS.MG....KWS.MASRSHADYMRG.GDF-----------------------------------FSSEQ
A1R425_ARTAT/3-735LSVKNYARQNPHS.MG....AWS.ADSKTNVATMGE.NDF-----------------------------------RSNEK
B1VF46_CORU7/3-734KAVKNYVRTHPHT.MG....EWT.AESKTNVATMEA.NDF-----------------------------------RHNEQ
A7HAP6_ANADF/7-741LSVKAFSKKNPHK.LG....AWT.QDSKSHVAHMTD.GDF-----------------------------------YGSEN
F2LTW4_HIPMA/7-743TSVKEFAKKYPDS.MGLPLKPWP.EDSKTHVAHMDG.GDF-----------------------------------YEHEK
D2UG49_XANAP/6-738ASVKQYARKHPHR.MG....AWS.AQSKSHVAHMDA.GDF-----------------------------------YGSER
B0BZF4_ACAM1/9-741AAVKQYAQKNPHS.VG....PWT.SDSKSHVAHMDT.GDF-----------------------------------YGTEQ
E1STT1_FERBD/3-736DAVKQYAKANPHS.MG....AWS.ADSRSHVAHMSE.GDF-----------------------------------YGSEQ
Q0A9L5_ALKEH/8-739RAVKNFVRKHPHS.MG....KWS.KASRTHADYMRG.GDF-----------------------------------YSAEQ
B3QVP5_CHLT3/7-740LSVKNYAKKFPHS.MG....AWS.QDSKSHVSTMNS.DDF-----------------------------------RSNEK
H8XU75_FLAIG/5-736KAVKNYAKVNPHR.MG....TWA.NDSKTEVAHMNA.GDF-----------------------------------YGTEN
A5WH85_PSYWF/3-737KAVKNYARKHPHS.MG....EWK.QWSSTHVSHMHS.GDF-----------------------------------YHGEQ
D7BKH3_ARCHD/4-733QAVKNYARTHPHT.MA....PWS.PQSRTRVATMPR.GDF-----------------------------------KHNEV
A3QD82_SHELP/6-738TSVKNYAKKNPHS.MG....AWS.SDSKSHVAHMEA.GDF-----------------------------------YGSEQ
Q31GM7_THICR/4-737TSVKNFAKKHPHS.MG....AWS.EDSKSKVAHMTE.GDF-----------------------------------YGSEK
C7M412_CAPOD/4-735KSVKQYAQTHPHS.MG....AWS.AESLTEVATMQA.GDF-----------------------------------YHNEQ
E1V4K9_HALED/6-739GSVKNYARKYPHR.MG....EWQ.ADSRSHVAHMSE.GDF-----------------------------------YGSEK
Q88FS1_PSEPK/6-739LSVKNYARKHPHK.MG....AWA.ADSKSHVAHMTQ.GDF-----------------------------------YGSEK
K4KV52_SIMAS/7-739RAVKEYARANPHS.MG....KWS.QASRTHVAHMRE.GDF-----------------------------------YASDI
F2JWD6_MARM1/5-737AAVKGFARKHPHS.MG....KWQ.KTSQTHADYMRD.GDF-----------------------------------FSSEQ
F0S094_DESTD/6-733PPVKEYAKKHPHR.MR....DVS.PKSLSYVAHMKS.GDF-----------------------------------YENEK
D3UGP7_HELM1/2-738KAVKQYAKKNPYK.IA....PFD.SNSKTIVSYMQE.GDF-----------------------------------FSNEK
W0J5H7_9BACT/9-742KAVKDYARKHPHS.MG....AWS.PDSKTTVGTMGR.DDF-----------------------------------YSNEK
B9L5J0_NAUPA/5-736EPVKNYAKMHPHS.MK....PVS.PDSKSYVAHMEK.RDF-----------------------------------YETEQ
T2KNT3_9FLAO/6-739KAVKNYAKKYPHS.MG....AWS.ADSKTHVATMTE.GDF-----------------------------------AHNEK
A0LZ01_GRAFK/6-739KAVKNFAKKNPHR.MG....EWS.SDSKTHVATMSE.GDF-----------------------------------RTNEK
C7MEJ9_BRAFD/4-740SAVKNFAKKHPHR.MG....EWA.KESKTSVVTMGE.NDF-----------------------------------ASNEQ
A8EUE7_ARCB4/3-729GAVKNYAKNNPHR.MG....VWA.KDSKTDVAHMNA.NDF-----------------------------------YGTEV
M1MV91_9CORY/3-734VAVKNFVKKNPHR.MG....EWS.SDSKTNVATMDA.DDF-----------------------------------RHNEK
Q21K35_SACD2/7-740ASVKAYAQKNPHS.MG....EWK.SDSKSHVASMES.GDF-----------------------------------FGSEK
A0L819_MAGSM/7-741KAVKEFAKKNPHS.MG....EWK.PDSKTHVAHMQS.GDF-----------------------------------FSHET
E6X675_CELAD/3-737RAVKNYAKKNPHS.MG....PWS.SDSKTHVATMGE.NDF-----------------------------------KTNEK
D5EP32_CORAD/6-738AAVKQYAKNNPHR.MG....AWA.SDSKSVVSSMSG.NDF-----------------------------------FGNEK
D8IWJ4_HERSS/7-740NAVKNYARKHPHS.MA....KWS.MASRTHVAHMHG.GDF-----------------------------------YAGEK
Q480C1_COLP3/7-740GSVKQYARNNPHS.MG....AWS.PESKSHVAHMES.GDF-----------------------------------YGSEK
J9R9T1_RIEAN/5-736KAVKNYAKANPHR.IG....EWK.SDSKTDVAHMNQ.GDF-----------------------------------YGTET
I1XFF5_METNJ/3-736AAVKNYARSHPHY.MG....QWN.VDSATDVAHMQA.DDF-----------------------------------YGCEQ
H9UIG1_SPIAZ/5-737RAVKEYARKYPHS.MG....TWS.PDSKSHVASMSS.GDY-----------------------------------YESEK
C1N5W5_MICPC/17-758PPVKDFAKKNPHR.LA....DWR.ADSSTRVASMSD.GDF-----------------------------------YGSEK
D8PBJ4_9BACT/7-740LSVKAHTRKHPHK.MG....AWS.SDSKSHVSHMKG.GDF-----------------------------------FSNEK
H1Z8C0_MYROD/6-737KAVKNYAKKHPHS.MG....AWA.TNSQTRVASMAD.GDF-----------------------------------YGTEK
E1WXB0_BACMS/7-740GPVKEYAKNNPHS.MG....AWS.KDSKSHVSHMND.KDF-----------------------------------FGSEK
Q9KSW5_VIBCH/7-740ASVKNYAKKNPHS.MG....AWS.KDSKSHVASMSD.KDF-----------------------------------FGSEK
I3YS17_AEQSU/6-739KAVKNYAKKHPHS.MG....AWS.SDSKSHVATMQH.GDF-----------------------------------FHNEK
A1STK8_PSYIN/7-740DAVKQYAQDHPHR.MG....AWS.KESKSHVADMSE.GDF-----------------------------------YGSEQ
D7WAL0_9CORY/3-734RSVKNFARKNPHS.MG....EWS.SDSKTNVATMED.NDF-----------------------------------RHNEK
B2GKD0_KOCRD/3-733KAVKEYAKKHPHT.MG....AWS.EDSRTNVATLGH.DDF-----------------------------------RTNEQ
W6EER3_SULMU/7-741LCVKEYARKNPHR.MG....KWT.SDSASHVAYMNE.GDF-----------------------------------YGNEK
M4U620_9GAMM/7-740DAVKQYAKDNPHR.MG....AWS.RESKSHVANMQQ.DDF-----------------------------------YGSEQ
A1K4K8_AZOSB/7-741AAVKNYAKKHPHS.MG....DWK.QWSRTHVSHMEH.GDF-----------------------------------YHGEK
C5BIJ2_TERTT/8-740ASVKQYARKNPHS.MG....AWE.SSSKSHVSAMTD.GDF-----------------------------------YGSEQ
E4PIW6_MARAH/7-740TAVKAFARKYPHS.MG....EWS.PASRTHVAHMRG.GDF-----------------------------------YSSEQ
E4RUN8_LEAB4/17-750KAVKEYARKHPHS.MG....AWS.ADSKSHVSSMTE.GDF-----------------------------------YGSEK
F8JJ69_STREN/5-736ASVKNYAKTHPHR.MG....AWT.ADSKTNVAHMTG.DDF-----------------------------------RSTEK
C7NKD1_KYTSD/3-736QAVKNFARKHPHS.MG....EWS.ADSRTRVATMGE.DDF-----------------------------------ASHEK
Q9JZS1_NEIMB/6-739KAVKNFAKKNPHS.MG....AWT.KDSKTHVATMQS.GDF-----------------------------------FHNEQ
C5ZYN4_9HELI/2-724KAVKEYAKKNPYK.VV....PFN.KDSKSRVSYMQK.GDF-----------------------------------FDNEK
C1DL01_AZOVD/5-737LSVKNYARKHPHK.MG....AWS.ADSKSHVAHMDN.GDF-----------------------------------YGSEK
E6S9C5_INTC7/5-731ASVKNYARRHPHS.MG....AWS.PDSKTNVATMDA.DDF-----------------------------------AHNEK
Q2SHA1_HAHCH/6-738AAVKQYARKHPHK.MG....KWS.QASRTHVAHMRE.GDF-----------------------------------HATEK
C4LKD9_CORK4/3-734KAVKNFARKHPHT.MG....EWS.KDSKTNVSTMES.DDF-----------------------------------RHNEQ
F8E409_FLESM/8-745LAVKKFAKKYPKS.MGLPLLDWD.KDSKTHVAHMDE.GDF-----------------------------------YANEK
W8S0Q0_9RHOB/9-733AAVKSFAQANPHR.MG....AWS.SGSKTRVASMSG.GDF-----------------------------------FSNEV
W0JIX7_DESAE/6-742KAVKESAKKYPDS.MGLPLKPWS.KDSKTHVAHMNG.GDF-----------------------------------YEHEK
B3E9R4_GEOLS/7-740KAVKEYAKKHPHK.MG....AWS.ADSKTHVSWMES.SDF-----------------------------------YENEK
M1E507_9FIRM/6-743RSIKETAKKFPDL.MGLPLKEWN.PSSKTHVSHMTD.GDF-----------------------------------YGHER
Q0PAY5_CAMJE/3-729KAVKDYAKNNPYR.VV....EFN.PNSKTRVSYMKE.GDF-----------------------------------FSNEK
A3HX33_9BACT/7-740QAVKAYAKKHPHS.MG....KWS.ADSKSHVDSMSE.GDF-----------------------------------YGSEK
A8LP43_DINSH/9-721QAVKNYARANPHR.MG....EWT.ADSKTTVMTMGA.RDF-----------------------------------CSNET
E4TZB1_SULKY/3-729VAVKNFAKKNPHK.LR....GWD.EGSKTRVAHMNS.GDF-----------------------------------YANEQ
K0C4Y6_CYCSP/7-740KAVKEYAKKNPHS.MG....KWS.QASRTHVSHMRS.GDF-----------------------------------YSSEK
A0RPF0_CAMFF/4-728GAVKAYAKEFPHK.NG....AWD.SSIKTRVAYMQD.GDF-----------------------------------YGNEK
B3ENX3_CHLPB/3-736ASVKQYARNNPHR.LR....AWD.EGSRSHVAHMES.GDF-----------------------------------YESEQ
F9YPD0_CAPCC/6-739KAVKNYAKKHPHS.MG....AWS.KDSLTKVATMSE.GDF-----------------------------------YHSEK
B3PL57_CELJU/5-738LSVKNYARKNPHK.MG....AWS.ADSKSHVAHMNA.DDF-----------------------------------YGSEK
C1FF99_MICSR/20-749GPVKDFARANPHR.LK....DWS.GDSKTEVKSMPG.DDF-----------------------------------FGSEK
H2G1D1_OCESG/7-738AAVKAFARKYPHS.MG....AWS.KASRSHADYMNG.GDF-----------------------------------FSSEQ
E6W3A0_DESIS/5-739ASVKKFAQINPHKFMK....PWP.AGSKTRVAHMAG.GDF-----------------------------------YAHET
D5VA96_MORCR/5-738KAVKNFAKKYPHS.MG....QWS.KDSQSHVATMNG.GDF-----------------------------------FANEQ
Q5QZT7_IDILO/7-738SAVKNYAKKHPHR.MG....EWS.KDSKSHVAHMNE.GDF-----------------------------------YGSEK
D5BKK7_ZUNPS/6-738KAVKNFAKKNPHS.MG....EWS.SDSKSHVATMDS.GDF-----------------------------------YHNEK
E2SFF0_9ACTO/5-735ASVKNYAKAHPHS.MG....AWS.ADSRTNVATMGA.DDF-----------------------------------AANEQ
I6YVP5_MELRP/4-738ASVKKFAQKHPHKMMK....PWS.KDSKTRVAHMNQ.KDF-----------------------------------YGSEK
W0I0L2_9ENTR/6-739LSVKNYARKHPHR.MG....EWS.ASSQSHVAHMHE.GDF-----------------------------------YGSEK
C9RMQ9_FIBSS/4-740NAVKNYARNNPHS.NG....VWN.ESVKTYVASMQA.DDF-----------------------------------YGNEK
I5AYK9_9DELT/4-736VAVKEFAKKNPHS.MG....AWS.PDSKTHVASMTE.GDY-----------------------------------YGSEI
Q3IH53_PSEHT/4-737GSVKEYARNNPHS.MG....AWS.KDSESYVASMSE.GDF-----------------------------------FGSEQ
V5WJE7_9SPIO/3-736RAVKNYAKKHPHS.MG....EWT.PESRSVVASMSE.GDF-----------------------------------YGSEE
B2V8Q7_SULSY/5-744KSVKEYAKKFPHK.MK....AVS.PNSKAHVAHMLG.GDF-----------------------------------YENEK
Q30RQ6_SULDN/3-727AAVKRFAQKNPHK.LR....AFE.SPSKAYVAHMNG.GDF-----------------------------------FSNEK
E8UGI5_TAYEM/3-734KAVKNYARKNPHS.MG....VWD.SNSKTRVLHMNK.GDF-----------------------------------FESEK
M1P925_DESSD/6-739ASVKKNGQKNPHRMMK....EWP.SASQCRVSHMDD.GDF-----------------------------------YGSEK
H1XS30_9BACT/5-740PAVKQFAKKNPHKLMK....PWPKEGSKTRVGHMEK.GDF-----------------------------------YGSEK
Q5NET6_FRATT/12-745DAVKKYAEKHPHS.MG....EWT.KDSKSHVASMSA.DDF-----------------------------------YANEK
R7XUF3_9ACTO/3-734GAVKNYAKSHPHS.MG....AWS.ADSRTNVATMDS.DDF-----------------------------------RHNEK
S5R118_9PROT/7-741VFIKNHARKNPYY.IK....KWS.STSKTHVSYMTK.GDF-----------------------------------YDNEK
Q7UX35_RHOBA/8-739APVKAYAQKNPHS.MG....DWT.ADSKSHVAHMSE.GDF-----------------------------------YGSEK
F6GBX4_LACS5/6-738KAVKNYAKKNPHS.MG....AWS.KDSKSHVSTMTQ.GDF-----------------------------------AHNEK
A4AQ16_MARSH/3-736RAVKNYAKQNPHS.MG....AWS.SSSKSHVATMDQ.GDF-----------------------------------KSNEK
D3PCR7_DEFDS/7-744LAVKKYAQKYPTS.MGLPLKPWS.PDSKCHVAHMSG.GDF-----------------------------------YENEK
Q0VQ19_ALCBS/5-738IAVKNYARKNPHS.MG....YWS.PASRTHVAHMRG.GDF-----------------------------------FSHET
Q6A6Z7_PROAC/3-732TAVKAYAKAHPHR.MG....QWT.DQVKARVAHMDH.GDF-----------------------------------FDHEE
I0AFK0_IGNAJ/4-739ASVKKFAQKHPHKMMK....PWPTSGSKCRVAHMKQ.NDF-----------------------------------YGNKK
I0IE50_PHYMF/4-736GPVKAYARAHPHA.MG....AWS.QDSKSHVSHMAG.DDF-----------------------------------YGSEQ
M5AMA5_9ACTN/5-738KAVKEYARKNPHS.MG....AWS.SDSKTHVATMSG.DDF-----------------------------------ASNEQ
K4IX24_PSYTT/7-740GPVKEYAQDHPHK.LN....EWS.KESKTHVSTMKD.GDF-----------------------------------YGSEK
A4SVS2_POLSQ/7-740PAVKRYARKNPHS.MG....EWS.QASRTHVSHMHG.GDF-----------------------------------YSSEK
G7UU97_PSEUP/6-738LSVKNYARKHPHR.MG....KWS.ADSKTHVAHMES.GDF-----------------------------------FGSEK
K9UP30_9CHRO/7-740ASVKQYAQKNPHR.VG....KWQ.QDSKTHVAHMES.GDF-----------------------------------YGSEQ
F0S4K1_PEDSD/6-737KAVKNYAKANPHS.MG....AWS.ADSKTKVAHMNE.GDF-----------------------------------YGSEK
I3ZAR1_BELBD/7-739LAVKNYAKKNPHS.MG....AWS.ADSKTHVASMQK.GDF-----------------------------------YGSEK
A1SMP0_NOCSJ/3-734ASVKQYAKAYPHR.MG....AWS.TDSKTNVATMGE.HDF-----------------------------------KTNEK
C5C942_MICLC/3-736KAVKEYAKRFPHS.MG....EWT.PDSKTAVATMGA.DDF-----------------------------------RANEQ
A4CN95_ROBBH/3-737RPVKNFARKNPHS.MG....AWS.ADSKSHVATMSS.GDF-----------------------------------KSNEK
A9GTS3_SORC5/41-773PAVKDYAKKHPHS.MG....AWS.RDSKSHVAHMSG.GDF-----------------------------------YGSEK
B1XIH1_SYNP2/14-747AAVKEYARHNPHK.VG....EWT.KNSKSHVAHMDE.GDF-----------------------------------YGSEQ
I4B3K5_TURPD/7-740RSVKEFAKKNPHK.LG....EWS.KECKSHVANMKA.GDF-----------------------------------FHNEK
B0UWC0_HISS2/4-735KAVKNYAQKNPHS.MG....DWS.AQSKTQVVSMQQ.GDF-----------------------------------YGTEK
E8ND12_MICTS/5-736LAVKNYAKKHPHR.NK....AFA.EGSKTRVATMGH.DDF-----------------------------------FSNEK
E6WXM1_PSEUU/6-738ASVKNYARKHPHR.MG....AWS.KDSKSHVAHMDA.GDF-----------------------------------YGSEQ
G0HFV7_CORVD/3-741QAVKNFARKHPHT.MG....AWD.KDSRTNVATMTE.GDF-----------------------------------RHNEK
G8R0B4_OWEHD/6-739RAVKQYAQKHPHR.MG....AWS.SDSKSHVASMSH.GDF-----------------------------------YGSEK
Q167P5_ROSDO/9-739VAVKNYAQSNPHS.MG....AWS.KDSKTRVSTMSA.NDF-----------------------------------RSNET
Q5E3X6_VIBF1/7-740GAVKQYARNNPHS.MG....AWS.SDSKSHVASMSD.GDF-----------------------------------YSSEQ
B7FVA8_PHATC/76-804APVKAYAQKNPHR.MG....LWS.KASRTHVAHMET.GDF-----------------------------------YETEQ
D6Z308_DESAT/5-739AAVKRFGQQNPHRLMK....PWP.QDSKSRVAHMSG.GDF-----------------------------------YGSEK
A4GAN1_HERAR/6-739LSVKNYARKHPHK.MG....AWS.ADSKSHVAHMDG.GDF-----------------------------------YGSEK
D0LWU8_HALO1/6-739KAVKEYARNNPHS.MG....AWS.SDSKSHVATMGA.GDF-----------------------------------FANEK
Q9PA20_XYLFA/23-756LSVKNYVRKYPHR.MG....AWS.TTSKSHVAHMEG.GDF-----------------------------------FGSER
G2PQU0_MURRD/3-736KAVKNYAKAHPHT.MG....EWS.SDSKTHVATMSH.GDF-----------------------------------KANEK
F5XPH8_MICPN/8-738LSVKNYARKHPHR.MG....AWS.GDSKTNVAHMTA.DDF-----------------------------------RSNEK
Q15T95_PSEA6/7-740KAVKSYARKNPHS.MG....AWS.QASQTHVAHMRG.GDF-----------------------------------YSGEK
Q74D54_GEOSL/5-738LSVKNFSKKNPHK.LS....PWS.PDSKAHVAHMTG.GDF-----------------------------------YGNEK
L7W579_NONDD/6-738KPVKQYARNNPHS.MG....EWS.KDSKSHVSTMSH.GDF-----------------------------------AHNEK
C6X4T6_FLAB3/30-761KAVKNYAKANPHR.MG....SWS.ADSKTKVAYMTA.GDF-----------------------------------YGTEK
F4AZL1_KROS4/7-740KPVKQYARNNPHS.MG....AWS.ADSKTHVSTMSH.GDF-----------------------------------RNNEK
E3F024_KETVY/9-740KAVKNYAMSHPHS.MG....KWS.KDSKTRVSSMDH.GDF-----------------------------------FANET
A5FHV4_FLAJ1/6-737RAVKNFAKANPHS.MG....AWS.ADSKTKVASMSN.GDF-----------------------------------YGSEK
E3I1D3_RHOVT/8-741PSVKQYAKNHPHK.MG....AWK.ASSKTNVAHMAG.GDF-----------------------------------YGSEK
A1BEA8_CHLPD/6-739LSVKQFAKKHPHK.MG....AWS.NDSQSHVAHMHS.GDF-----------------------------------YGSEQ
Q2L0N5_BORA1/6-739LSVKNYARKHPHK.MG....AWS.ADSKSHVASMES.GDF-----------------------------------YGSEN
D1BZX3_XYLCX/6-737ASVKAYAKAHPHR.MG....AWS.PSSKTNVATMTE.GDF-----------------------------------FHNEK
E6WZW7_NITSE/6-726LAVKRYAQKHPHR.LK....PFA.ENSQAKVAHMNGDGDF-----------------------------------YGNEQ
A2U0V2_9FLAO/3-736KAIKNYARKNPHS.MG....AWS.SDSKTHVASMKS.GDF-----------------------------------ANSEK
A1WFK0_VEREI/7-741KAVKEYARKNPHA.MA....EWS.QASRSHVSHMHH.GDF-----------------------------------YHGEK
A6W0E3_MARMS/6-738AAVKGYARKNPHS.MG....KWK.KTSISHADYMRD.GDF-----------------------------------YSSEQ
F4C4X4_SPHS2/6-739KAVKNYAKKHPHS.MG....AWS.AASKSHVATMSS.GDF-----------------------------------RHNEK
E4TNZ2_MARTH/6-739KAVKEFAQKHPHS.MG....EWS.KDSKSHVASMSE.GDF-----------------------------------YGSEK
F0RFA8_CELLC/3-734KAVKNYAKANPHS.MG....AWS.PDSKSQVATMSS.GDF-----------------------------------KANEK
A6Q7S1_SULNB/5-725AAVKKYAQQHPHR.LK....PFA.ENSKAYVAHMEGNGDF-----------------------------------YGNEK
E4TEW9_CALNY/5-739ISVKNYSKKNPHK.MA....AWD.PNTKAHVAHMTQ.GDF-----------------------------------YGSEK
F5Z8R7_ALTSS/5-738TAVKNFARKHPHS.MG....EWS.QASRTHVAHMRG.GDF-----------------------------------YSGEK
A7ZDM4_CAMC1/4-723PPVKEFAKKHPHS.NG....NWD.KANKTKICYMQR.GDF-----------------------------------FENEH
C7RB77_KANKD/5-738NAVKNYAKKNPHS.MG....EWS.KDSKSHVASMQS.GDF-----------------------------------FSNEK
M5DRS5_9GAMM/7-740ASVKEYARNNPHE.MG....AWS.SDSKSHVAHMSH.GDF-----------------------------------YGSEK
L0GSZ1_9GAMM/6-739ASVKTYARANPPR.MG....AWS.SDSKAHVVTMDA.GDF-----------------------------------RHNEK
I3ZX83_ORNRL/7-736KAVKNYAKAHPHR.MG....AWT.KDSKTRVAHMEY.GDF-----------------------------------YDTEK
X4QUI6_9ACTO/4-731AAVKNYAKAHPHS.MK....AWL.PESKTRVAAMSA.HDF-----------------------------------RANEV
A5WH86_PSYWF/3-738KAVKAYARANPHA.MK....PWR.RDSKTHVSTMAH.CDF-----------------------------------VDDEK
A7I2F0_CAMHC/4-731KAVKEYAKANPHK.NG....KWD.KNVKTEVMHMNG.GDF-----------------------------------YSNEK
F6I9T7_ZOBGA/3-737RAVKNYAKQNPHS.MG....AWS.PDSKTHVATMEH.GDF-----------------------------------KANEK
G8MDD3_9BURK/7-743LAVKNYAKKHPHS.MG....EWS.MASRTHVAHMKH.GDF-----------------------------------YHGEK
F2J468_POLGS/28-761KAVKEYAKKNPHS.MG....AWA.PTSRTHVATMEH.DDF-----------------------------------ASNEK
C0QS34_PERMH/5-743AVVKEYAKKHPHR.LK....EVS.PHSKSHVAHMKE.GDF-----------------------------------YQHEK
O53611_MYCTU/7-741KAVKEYARKHPHS.MG....EWS.MASRTHVAHMRH.GDF-----------------------------------YAGEK
G4QH54_GLANF/7-739ASVKQYARINPHS.MG....AWA.PDSKSHVSHMQS.GDF-----------------------------------YGSEK
W0DU46_9GAMM/6-739GPVKAYAKAHPHS.MG....AWA.KDSKSHVAHMQA.DDF-----------------------------------YGSEL
C3PLB9_CORA7/3-723IAVKNFAKKNPHK.MG....AWS.ADSKTNVATMDA.NDF-----------------------------------RHNEK
Q4JTI7_CORJK/3-736KAVKNFARKHPHS.MG....KWS.PDSKTNVATMEA.DDF-----------------------------------RHNEQ
D1BGD8_SANKS/3-734LSVKEYVRKNPHR.MG....AWT.ADSKTNVATMGH.DDF-----------------------------------FSNEK
Q1R071_CHRSD/6-739QSVKNYARKYPHR.MG....EWS.ADSQSHVAHMSE.GDF-----------------------------------YGSEQ
D4H3K7_DENA2/6-741AAVKRFGQKFPHRMMK....PWPESGSQCRVAHMES.GDF-----------------------------------YESEV
Q7VGX2_HELHP/2-729KAVKSYAQKNPYR.VV....PFS.ADSKSYVSYMKE.GDF-----------------------------------FDNEK
Q2W9R4_MAGSA/37-771ASVKAFARKNPHK.MG....AWA.ASSQSHVAHMNA.GDF-----------------------------------YGSEK

PF02504

PLSX_SYNY3/6-328-----------------------------------------------------------V.VVRR---------------
PLSX_HELPY/1-317-----------------------------------------------------------TEAIKR---------------
PLSX_CHLTR/3-311-----------------------------------------------------------LAAVRK---------------
PLSX_ECOLI/4-331-----------------------------------------------------------SQAIRA---------------
PLSX_BACSU/1-321-----------------------------------------------------------VRAVRR---------------
PLSX_AQUAE/2-322-----------------------------------------------------------S.NVLK---------------
D5AUL6_RHOCB/12-337-----------------------------------------------------------AAVMRG---------------
I3VW60_THESW/1-316-----------------------------------------------------------VAAIRK---------------
W8T1H7_EUBAC/28-365-----------------------------------------------------------HYNFPI---------------

PF01515

PTAS_BACSU/3-319-----------------------------------------------------------FVERRK---------------
EUTD_ECOLI/1-320-----------------------------------------------------------WLARAG---------------
PTAS_CLOTH/2-324-----------------------------------------------------------LYELRK---------------
MAO1_RHIME/441-763-----------------------------------------------------------YFALVG---------------
PTAS_CORGL/5-322-----------------------------------------------------------FAELRK---------------
PTA_SYNY3/374-693-----------------------------------------------------------YYQLRK---------------
PTB_CLOB8/4-295-----------------------------------------------------------IAKKIN---------------
PTAS_BORBU/10-350-----------------------------------------------------------YWSLQK---------------
PTAS_MYCPN/2-315-----------------------------------------------------------VYEKRK---------------
MAO2_HAEIN/429-750-----------------------------------------------------------YYELTK---------------
PTAS_CLOAB/2-326-----------------------------------------------------------FYELRK---------------
MAO2_RHIME/438-756-----------------------------------------------------------LYSRLQ---------------
A1B2J3_PARDP/4-314-----------------------------------------------------------WHRMRA---------------
I3VW55_THESW/3-324-----------------------------------------------------------FYELRK---------------
PTB_CLOAB/4-295-----------------------------------------------------------IALKIG---------------
PTA_MYCTU/365-682-----------------------------------------------------------YAQLRK---------------
Q32DP2_SHIDS/392-707-----------------------------------------------------------LVELRK---------------
Q6MTX6_MYCMS/5-317-----------------------------------------------------------FVKLRK---------------
Q8TK18_METAC/4-325-----------------------------------------------------------FYELRK---------------

PF04166

F9D1K6_PREDD/35-324.....--...........................................V.............................
D7BZZ5_STRBB/44-335.....--...........................................V........IDL..D......L........
K9XHU5_9CHRO/45-341.....--...........................................I........LDINTEDTI............
K9Z747_CYAAP/38-335.....--...........................................I........IEVDTPENI............
F3ZVB4_MAHA5/32-323.....--...........................................L........INT..G..D...V........
D4G8G2_RIEPU/43-336.....--...........................................I........EPIRLRTP....V........
E3I1T8_RHOVT/40-335.....--...........................................V........LPL..RAPL...A........
F0R264_BACSH/34-324.....--...........................................V.............................
Q1LSS1_BAUCH/32-325.....--...........................................I........LAINTSDI....V........
D5WYG1_THIK1/23-322.....--...........................................V........LPI..V......A........
Q10ZN5_TRIEI/41-337.....--...........................................I........LDVEFDGNLEDI.........
Q7MTA8_PORGI/34-326.....--...........................................V.............................
G2TI06_BACCO/34-325.....--...........................................I........IDL..D......L........
Q3V872_LEGPH/26-315.....--...........................................V........WPVPCAAP....V........
B1ZNR3_OPITP/35-329.....--...........................................A........DDV..................
K9SRP6_9SYNE/31-333.....--...........................................I........LDTNTHLPI............
Q3B5B9_PELLD/30-323.....--...........................................V........LSV..AEPL...S........
R6EJC4_9BACE/37-325.....--...........................................V.............................
M4Q2H5_LIBAS/32-328.....--...........................................I........ISS..P.CG...A........
PDXA1_BRADU/37-333.....--...........................................Y........LQA..D......A........
PDXA_XANP2/36-328.....--...........................................V........MPA..G.PA...S........
D3EPC7_ATETH/40-355.....--...........................................I........LDIPIKPTIQSQI........
X2H9I6_9NEIS/29-319.....--...........................................V........CHIPVQVS....V........
L0ETE9_LIBCB/39-331.....--...........................................I........IIN..S.CG...I........
B4F2I1_PROMH/31-324.....--...........................................V........LAVELTDPS...V........
V5UBQ7_9BURK/58-340.....--...........................................V........VHHPLAVA....A........
A6VU54_MARMS/37-327.....--...........................................V........LPVQLTKK....A........
C4XST4_DESMR/41-331.....--...........................................LLEPEGSAGLPL..................
M7SPY7_EUTLA/39-323.....--.........................................................................
Q0K4Q7_CUPNH/34-327.....--.........................................................................
D4J4Q1_9FIRM/33-335.....--...........................................V........YDM..K..L...V........
A0JTQ9_ARTS2/490-781.....--...........................................V........IDL..A......L........
W0DDM8_9AQUI/28-311.....--...........................................I........CDV..................
G4RBH1_PELHB/33-315.....--...........................................L........FDV..PGIDAAEV........
D2R6V9_PIRSD/43-337.....--...........................................A........ASV..................
G7Z7B0_AZOL4/38-329.....--...........................................V........LPV..R.LG...N........
I7HG37_9HELI/28-302.....--.......................MP..KDMKCVADFELCVD..I.............................
R6SBC2_9BACE/34-324.....--...........................................V.............................
D9RAU4_CLOSW/32-323.....--...........................................L........MDL..D..N...M........
F0NYL8_WEEVC/36-325.....--...........................................T.............................
F2IC16_FLUTR/45-335.....--...........................................F.............................
M1PE68_DESSD/26-315.....--...........................................I........IPV..Y..E...T........
H1Z8Q7_MYROD/36-324.....--...........................................I.............................
PDXA_BACHD/33-324.....--...........................................V........IHL..D..N...L........
Q3SGF8_THIDA/30-317.....--...........................................V........RHIPAAAA....V........
R5KK03_9BACT/34-324.....--...........................................V.............................
B8IWD3_METNO/40-332.....--.........................................................................
K9TXI9_9CYAN/42-377.....--...........................................I........LEVEAVRKMVGAV........
PDXA_SYNJB/34-331.....--...........................................M........LECDTGFRLQPG.........
Q1QSM0_CHRSD/42-333.....--.........................................................................
K9SMQ8_9CYAN/47-343.....--...........................................I........LDLATNLEV............
PDXA_PROAC/35-325.....--...........................................V........VDT..G..T...V........
L0DWB4_THIND/35-324.....--...........................................L........IPVPVAAP....V........
H8GMF2_METAL/35-325.....--...........................................I........VPVNLNAP....A........
PDXA_GEOMG/34-325.....--...........................................L........WEI..S..S...L........
R4I106_9ENTR/29-321.....--...........................................V........LPIATTYH....V........
E1SLK8_FERBD/27-319.....--...........................................I........APARMAVT....S........
A1AU02_PELPD/36-329.....--...........................................L........LTL..S..R...L........
PDXA_RALSO/37-328.....--...........................................V........VARPLGAP....V........
PDXA_THISH/31-321.....--...........................................V........MAHALNAP....V........
Q3V808_RHISN/34-320.....--....................................................ILA..A..T...R........
D3VCQ4_XENNA/32-324.....--...........................................I........LPVYLQSP....T........
PDXA_AGRT5/37-329.....--...........................................I........LPL..P.VG...F........
G7URF7_PSEUP/27-304.....--...........................................V........IEP..VEFDMAWV........
G0IUL6_CYCMS/36-326.....--...........................................V.............................
R7J8E6_9PORP/34-325.....--...........................................V.............................
J3Z564_9ENTR/29-321.....--...........................................I........LPVLTEKP....V........
I1F0R6_AMPQE/348-642.....--...........................................V........APIPLARI....P........
K7AU99_9ALTE/28-319.....--...........................................L........VDIKTKVP....V........
PDXA_SYNY3/35-336.....--...........................................L........LEVDLS..YLGKI........
E1VLH2_9GAMM/30-317.....--...........................................V........IDLALPCP....E........
R4KFZ8_CLOPA/32-323.....--...........................................F........IDL..N..N...I........
R5Y392_9BACE/33-324.....--...........................................V.............................
W0PFJ8_9BURK/36-327.....--...........................................V........IQV..G.PS...L........
R6YA75_9BACT/37-327.....--...........................................V.............................
R5TI46_9CLOT/31-334.....--...........................................V........IDM..K..N...V........
A5FXM2_ACICJ/38-335.....--...........................................L........VEV..G......P........
PDXA_RHOBA/37-349.....--...........................................LAEFLDMPKQSIPSDAPHGVIVDCGKLTTE
R6W392_9BACT/35-320.....--...........................................V.............................
K9QGD1_9NOSO/46-349.....--...........................................V........VDVQSNQNLD.EI........
PDXA_XYLFA/29-316.....--...........................................I........QAQCHVHP....T........
F2LWP1_HIPMA/33-327.....--...........................................I........IQA..T..K...L........
PDXA_CAUCR/30-324.....--...........................................V........LDI..P.VL...S........
F5YGA4_TREAZ/37-343.....--...........................................Y........YPC..G.II...I........
K9RH38_9CYAN/45-348.....--...........................................I........LDVSLEDNIKDKI........
R5P2E5_9PORP/33-319.....--...........................................V.............................
D2QDF7_SPILD/236-527.....--...........................................I.............................
C4LDY8_TOLAT/35-322.....--...........................................V........LEP..A..N...Y........
K9T599_9CYAN/41-347.....--...........................................I........LDIPIDGAIATQI........
PDXA_WIGBR/31-321.....--...........................................I........IPIKVNSN....V........
F4LQ79_TREBD/32-322.....--...........................................L........LPI..D..N...I........
E3HED3_ACHXA/32-321.....--...........................................V........IAC..S..P...A........
E6WQK3_PSEUU/29-316.....--...........................................L........HPVRNAVA....V........
I3Y835_THIV6/27-318.....--...........................................V........LPVTLRQP....A........
PDXA2_BRADU/38-337.....--...........................................V........VAT..G.ER...A........
Q12FB7_POLSJ/51-359.....--....................................................TPV..................
G4L110_OSCVS/33-352.....--...........................................I........LDM..G..L...I........
K9UJS8_9CHRO/31-336.....--...........................................I........IDVSLPPAIRDGV........
H8KWR5_SOLCM/37-327.....--...........................................I.............................
F2K4J5_MARM1/33-323.....--...........................................I........LPISASAP....V........
S6BVY4_9GAMM/29-317.....--...........................................V........LPVALRHA....A........
A7I3Y6_CAMHC/27-298.....--.......................IP..ENFKIYEVGKN.FK..I.............................
F0SPW7_PLABD/43-344.....--...........................................A........DEI..................
D5MIQ8_9BACT/37-328.....--...........................................V........LDL..K..N...T........
F2NDA2_DESAR/37-329.....--...........................................I........MVL..S..D...L........