Sequence alignment for CL0272

PF09128

ARHGC_MOUSE/368-558QCSCFQSIELL....KSRPAHLAVFLHHVVSQFDP--ATLLCYLYSDLYKQ.------------------------.TNS
Q7PMK0_ANOGA/664-859ENSPFRSLTQLLEADKS..VYLAVFLNFVLTNSDP--SALLFYMITMLYKE.------------------------.GTV
ARHGB_HUMAN/307-486SDIIFQDLEKL....KSRPAHLGVFLRYIFSQADP--SPLLFYLCAEVYQQ.------------------------.ASP
F7E5L7_XENTR/337-527QCSCFQSMDLL....KSHPAHLAVFIHHVVSQFDP--AAMLCYLYTDLYQQ.------------------------.TNS
G5EFE1_CAEEL/246-443QGGPFSNLAEL....KTHPAHLAVFINYLLLHGNP--SSLFFYLITDAYQSA------------------------YGTA
H3CQS1_TETNG/354-544QCNSFNSIEQL....KSRPAHLAAFLHHVISQFDP--APVLCYLYADFYKQ.------------------------.TNS
ARHG1_MOUSE/40-230QNSQFQSLEQV....KRRPAHLMALLQHVALQFEP--GPLLCCLHADMLSS.------------------------.LGP

PF00615

Q7QG26_ANOGA/380-498------SLRELL---NDPI.GREQFTKFLDKEFSG..ENLKFWEAIQDMKAL..........................PQ
Q7Q4R5_ANOGA/402-517------SLADIL---STVG.GRRALTAFLEPLNAA..SLVGYYTTVEELRRA..........................AR
Q7QEZ6_ANOGA/445-560------SIEEVV---SDPT.GLQEFTHYLKKEYSH..ENIRFWMAVNDLRRS..........................SH
Q7PYV4_ANOGA/57-178------KLAYLL---EDGD.GAELFKRYVELEGEEPSNRLKFYFACEGLKQQ.........................TDA
GRK7A_DANRE/52-170------DFESLC---EKQPIGKKLFRQYLSQGGPECTTAAEFLDDLNEWELS..........................ES
Q29C79_DROPS/57-174------TLNHLL---EDRD.GVELFKKYVEEEAPAYNDHLNFYFACEGLKQQ.........................TDP
RGS1_HUMAN/85-199------SLEKLL---ANQT.GQNVFGSFLKSEFSE..ENIEFWLACEDYKKT..........................ES
Q6BM88_DEBHA/437-576------TLLDIL---NNSV.GLKFFTEFMNDRSRS..QLFQLWLAIDEIRAPLEDIDIE...........EDGEARLSLS
Q29I26_DROPS/414-528------TLEEIL---NTAV.GRRYFTLFLEPLKAS..ALVGFYLAVEEIKHA..........................HK
GRK4_HUMAN/52-171------DYSSLC---DKQPIGRRLFRQFCDT.KPTLKRHIEFLDAVAEYEVA..........................DD
GRK7_SPETR/53-170------HFHSLC---EQQPIGRRLFRDFLAT.VPKYSQAVAFLEDVQNWELA..........................EE
RCKA_DICDI/487-602------KFIETI---TDPT.TLNSFRSFMENTQSN..ENLEFFLEVKRFNTI...........................Q
ARBK2_HUMAN/54-174------TFDKIF---.NQKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKL.........................DNE
Q7KS58_DROME/294-409------SFERML---QDAA.GMQTFSEFLKKEFSA..ENIYFWTACERYRLL.........................ESE
RGS19_HUMAN/90-205------SFDKLM---HSPA.GRSVFRAFLRTEYSE..ENMLFWLACEELKAE.........................ANQ
RGS3_HUMAN/1073-1188------SLEKLL---VHKY.GLAVFQAFLRTEFSE..ENLEFWLACEDFKKV.........................KSQ
RGS8_DANRE/46-161------SFDILL---SNKY.GLAAFRTFLKTEFSD..ENIEFWLACEDYKKI.........................KSP
A8XJK3_CAEBR/757-874------SFDSLL---NNKF.GCALFRQFLKKEFSD..ENMDFWLECEEFKKM........................KDGK
SNX25_HUMAN/287-400------QFEDIL---ANTF.YREHFGMYMERMDKR..ALISFWESVEHLKNA..........................NK
EGL10_CAEEL/421-536------SFEELL---ADSL.GRETLQKFLDKEYSG..ENLRFWWEVQKLRKC..........................SS
GRK5_BOVIN/52-170------DYCSLC---DKQPVGRLLFRQFCET.RPGLESYIQFLDSVAEYEVT..........................PD
Q5A9K1_CANAL/354-489------NLKDIL---TDKN.NFQVFKEFMESEGRS..KLVEFWKAVEMIKAPLEGEEN............DDETDPLALS
Q6P300_XENTR/63-178------SLENLI---NNEC.GLAAFRAFLQSEYSE..ENIDFWLACENYKKV.........................KTP
GRK4_RAT/51-170------DFSSLC---DQQPIGRLLFRQFCNT.KPDLKRCIEFLDAAAEYEVT..........................IE
GRK6_HUMAN/52-170------DYHSLC---ERQPIGRLLFREFCAT.RPELSRCVAFLDGVAEYEVT..........................PD
A8WU05_CAEBR/114-226------NCTNVL---NDDK.GKQLFRVFLFQSLAE..ENLGFLEAMERLKKM........................KNGD
O17589_CAEEL/287-406------SVQELV---KDPI.GRQVLETFLESEFSS..ENIRFWIAIQDLKYA..........................PN
RK_BOVIN/57-171------GFEGMC---LEQPIGKRLFQQFLRT.HEQHGPALQLWKDIEDYDTA..........................DD
RGS12_HUMAN/715-831------SFERLL---QDPV.GVRYFSDFLRKEFSE..ENILFWQACEYFNHVP.......................AHDK
RGS5_CAEEL/81-204------SLDRLL---IDSS.ALSYFIQYLDSTDKL..NLIKFWMHVEGFKSSFSE...................QIQAAQ
Q7T2D3_DANRE/65-180------SLDKVL---SNSY.GLATFKSFLRSEFSE..ENIEFWEACEDFKKT.........................KNP
GRK2_CAEEL/54-174------KFDKIF---.NQKLGFLLLKDYAENVSESPCPQIKFYEAIKEYEKM.........................ETP
RGS11_CAEEL/139-255------GL..LA---ASKY.GCALFIQFLKQQTSE..NEVDFWLDCQKFRSS........................TAKI
RGS10_CAEEL/135-251------SPETLA---ASEY.GCNLFIQFLKEQTSE..NEVDFWLDCQKFRSS..........................KM
SNX12_SCHPO/390-528------SLLQIL---SDSA.AVSCFLEFMERKNRS..RYLHFWLVVEGLKESQDDPL..............NAHMIAPFS
RGS9_CAEEL/106-222------SPHSLA---ASEYGGSDLLVQFLKQQTSD..DYVDFWLESGEYRWT.........................RTK
A8X817_CAEBR/215-337------SLGDIL---KVQP.LLLSFLEFIKEKEDH..DMVQFLLGCESFEANL......................DLMED
RGS9_BOVIN/299-413------NFSELI---RDPK.GRQSFQHFLRKEFSG..ENLGFWEACEDLKYG..........................DQ
RGS18_HUMAN/86-201------SFDKLL---SHRD.GLEAFTRFLKTEFSE..ENIEFWIACEDFKKS.........................KGP
Q59Q05_CANAL/55-176------NLDSHK---SNQ..SLLSFHEYLMSRHCS..ENLQFIIDINKYLFTHNS...................TNSSCN
A8WU05_CAEBR/242-360------SFEGLL---NNHV.GRHHFRLFLRSIHAE..ENLRFWEAVVEFRST........................RHKA
Q4SP51_TETNG/52-170------DFSSVC---ERQPIGKRFFRDFLAT.KAEYKVAADFLDDLYDWDLA..........................EQ
FLBA_EMENI/544-685------RLNHIL---QDPA.LRLLFREFLRFSLCE..ENLSFYIDVSEFTTQYHKFDK............VGHFKKPDAV
Q568M8_DANRE/50-165------SFHELL---LHKD.GLCAFTTFLSSEYSE..ENIAFYLACEDFRNT.........................KSS
RGS7_HUMAN/333-447------GMDEAL---KDPV.GREQFLKFLESEFSS..ENLRFWLAVEDLKKR..........................PI
RGS13_HUMAN/34-149------SFENLM---ATKY.GPVVYAAYLKMEHSD..ENIQFWMACETYKKI.........................ASR
Q54LD1_DICDI/262-386------NFKDLL---DMPI.YLKAFRIFAEKQHCL..ENLLFWLDATTLKDLET.....................NNYPR
A8WGN3_DANRE/70-184------SFTNLI---KNDD.GRKAFASFLQSEYSQ..ENIEFWVACEDFKQT..........................PA
D8PLJ1_SCHCM/373-541------RLRYIL---EDPP.LRSLFREFLRGNFCE..ENLSFWLEVQDFKRKFNITSSAQANNPRGARNTPGQAAMERHH
F1QAG9_DANRE/87-202------.FEHLL---EDHV.GVRYFTEFLRSEVSA..ENILFYQACEKFKKIP.......................TSRL
F1QQ72_DANRE/76-191------SLDNLL---SSKC.GLNFFRLFIKSELCE..ENLDFWLACEEFRKI.........................RSR
F6WJ87_XENTR/64-178------SLENLL---SHTY.GRALFRVFLQSEFSD..ENLDFWLACEEYKDT.........................HPN
F7B5F5_XENTR/53-170------.YTSLC---EKQPIGRRLFRQFCDTREHF.LRCINFLDAVADYEVS..........................PD
H2MB46_ORYLA/58-174------.FDSVC---VEQPIGKRLFREFLEANQEY.HGACRLWKDIEDYDLA..........................ED
H3C4S7_TETNG/18-130------.VDKVL---GCKA.GQIAFREFLKSEYSE..ENILFWLACEEHKKI.........................KTV
H3CNA0_TETNG/88-203------SFEELL---SHSD.GVEVFSQFLRKEFSE..ENIEFWLACEEYKTI.........................DSE
H3CS40_TETNG/90-207------SLHSLL---DDQE.GIHLFRNFLCQEGCA..DLLDFWFACSGFRKT..........................SQ
H3D467_TETNG/50-165------SLDTLL---SNKY.GKTAFCIFLKSEFSE..ENIEFWTACEDFRLH.........................TSQ
J3QRK4_HUMAN/81-199------SLHSLL---GDQD.GAYLFRTFLEREKCV..DTLDFWFACNGFRQM........................NLKD
Q07G41_XENTR/72-189------SLNLLL---DDQD.GATLFRMYLEGEGLV..DLLSFWFACNGFRAM........................DPLE
Q49HN0_DANRE/57-174------SFDSMC---VRQPIGKRLFQQYLESEADY.KNPVDLWKDIEDYIVA..........................QE
Q5KPY3_CRYNJ/394-561------RLKQIL---EEPA.LRSLFREFLRSNFCE..ENLSFWLDVQDFKRRFQTTSSAVAAPGSKQAKVSGHAAMEKHQ
V5IMF6_NEUCR/575-720------RLDKIL---NENS.LRLLFRENLRETHCE..ENLAFYLDTDEFVRQCRAAIDLAQ.......RSPNSAASLDGI
W4XCG7_STRPU/91-208------SLHALL---CDED.GIQLFKHYLIQENAE..NPLLFWLATQGFKKK........................SDND

PF09128

ARHGC_MOUSE/368-558KETRRV--FLEFHQFFLDRSA.HLKVPVPEEISVDL.......EKRRPELIPEDLHRLYIQTMQERVHPEVQRHLEDFRQ
Q7PMK0_ANOGA/664-859KDMRKW--AYEIHSTFLVPGAPLLCANVDEALARDIDD...VL...QKENDKAEILRMVFWRSRLKAKEMINQQLQQFQT
ARHGB_HUMAN/307-486KDSRSL--GKDIWNIFLEKNA.PLRVKIPEMLQAEI..........DSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRT
F7E5L7_XENTR/337-527KETRRV--FLEFNQFFLEKAG.NLRVSVPDDVALEL.......EKRRPELIPEELHRQYIQTMQERLSEDVKKNLEDFKQ
G5EFE1_CAEEL/246-443KEFRRW--AFEIFSTFIIPNS.PMCIPNSNQSVIQPIDKIMCMTAEHIGDSDTDTLKRIFVPGRQRAVTDINMYLNDFRQ
H3CQS1_TETNG/354-544KETRRV--FMDLHNFFIDRGA.NLKVPVPDSISADL.......DRRRTELIPEEINRQLVQTLQDSLLPDIQKNLEDFRQ
ARHG1_MOUSE/40-230KEAKKA--FLDFYHSFLEKTA.VLRVPVPPSVAFEL.......DRTRPDLISEDVQRRFIQEVVQSQQAAVSRQLEDFRS

PF00615

Q7QG26_ANOGA/380-498SQIKEA..AQAIWNEYLAPDA------------------------------------------A.CPV.NIDSKSLELAR
Q7Q4R5_ANOGA/402-517SAWHQL..GAEIFYTYV.RAP------------------------------------------S.SEI.PLDKATRKRME
Q7QEZ6_ANOGA/445-560SQISRK..VKEIYEEFLEPGA------------------------------------------P.CEI.NIDGKTMEKVQ
Q7PYV4_ANOGA/57-178DKVTQL..IGAIYRRFLKKAQ------------------------------------------PGSEL.YVNESLRNFIK
GRK7A_DANRE/52-170AARDKA..RTNIINKFCKEGS------------------------------------------K.SSLTFLTGDVATKCK
Q29C79_DROPS/57-174EKVKQI..IGAIY.RFL...R------------------------------------------K.SQL.SISDDLRTQIK
RGS1_HUMAN/85-199DLLPCK..AEEIYKAFVHSDA------------------------------------------A.KQI.NIDFRTRESTA
Q6BM88_DEBHA/437-576LEFSNLGDIVEIYREFF...Q------------------------------------------N.SSL.EIDRDVFNRVE
Q29I26_DROPS/414-528SATHQL..GTEIFYTYI.RVP------------------------------------------K.PEI.QIDKHERKLIE
GRK4_HUMAN/52-171EDRSDC..GLSILDRFFNDKL------------------------------------------A.APLPEIPPDVVTECR
GRK7_SPETR/53-170GPAKTS..TLQQLAATCARDP------------------------------------------G.PQ.SFLSQDLATKCR
RCKA_DICDI/487-602DQVLLKHTCDDIWRRFF.DDL------------------------------------------AVTQL.CVESSLKKLIN
ARBK2_HUMAN/54-174EDRLCR..SRQIYDAYIMKEL------------------------------------------L.SCSHPFSKQAVEHVQ
Q7KS58_DROME/294-409ADRVAQ..AREIFAKHLANNS------------------------------------------S.DPV.NVDSQARSLTE
RGS19_HUMAN/90-205HVVDEK..ARLIYEDYVSILS------------------------------------------P.KEV.SLDSRVREGIN
RGS3_HUMAN/1073-1188SKMASK..AKKIFAEYIAIQA------------------------------------------C.KEV.NLDSYTREHTK
RGS8_DANRE/46-161AKMMSK..ANKIYKEFIDVHA------------------------------------------P.REV.NIDHRTREETK
A8XJK3_CAEBR/757-874KSTTQK..AIEIYSEFVAEHA------------------------------------------P.KEV.NLDSDTRAATR
SNX25_HUMAN/287-400NEIPQL..VGEIYQNFF..VE------------------------------------------S.KEI.SVEKSLYKEIQ
EGL10_CAEEL/421-536RMVPVM..VTEIYNEFIDTNA------------------------------------------ATSPV.NVDCKVMEVTE
GRK5_BOVIN/52-170EKLGEK..GKEIMTKYLTPKS------------------------------------------P.VFITQVGRDLVSQTE
Q5A9K1_CANAL/354-489LEFGNNDDVYNIYTKFI....------------------------------------------KTNEIPQPDTHIVEVLS
Q6P300_XENTR/63-178EKLLEK..AQKIYEDFISVEA------------------------------------------T.REV.NLDSATREETS
GRK4_RAT/51-170EEQREF..GLSIYSRFFKENS------------------------------------------E.VSLPQIPPDLVKECK
GRK6_HUMAN/52-170DKRKAC..GRQLTQNFLSHTG------------------------------------------P.DLIPEVPRQLVTNCT
A8WU05_CAEBR/114-226E.KVQF..AKDTLNTYQ....------------------------------------------..GSI.NLSSGSMKALR
O17589_CAEEL/287-406EQIYQK..AERIREEFLAQGA------------------------------------------P.AQV.NVDNRTLDQTL
RK_BOVIN/57-171ALRPQK..AQALRAAYLEPQA------------------------------------------Q.LFCSFLDAETVARAR
RGS12_HUMAN/715-831KELSYR..AREIFSKFLCSKA------------------------------------------T.TPV.NIDSQAQ.LAD
RGS5_CAEEL/81-204ELSLRD..AKSIYDKYIDDGS------------------------------------------T.SSL.ALPRKIKQIVD
Q7T2D3_DANRE/65-180LKMATK..AKKIYEDFIQTGG------------------------------------------P.KEV.NIDHFTKDVTL
GRK2_CAEEL/54-174DERLTK..AREIYDHHIMVEM------------------------------------------L.AHAHNYSKESLQHVQ
RGS11_CAEEL/139-255SWKNKE..VHRILDQFLSSSA------------------------------------------P.RKI.DMETSILARCM
RGS10_CAEEL/135-251SSRQNE..ARRIFDEYFAMGS------------------------------------------P.KKI.YIERYLWCVVQ
SNX12_SCHPO/390-528DIVSDHTDFTAIVKSYF.ESV------------------------------------------D.NPL.DIPKPLTNTIN
RGS9_CAEEL/106-222PGRKRDIEAQRIYDKFVYGEC------------------------------------------P.RKIAHLEKMCFVSRQ
A8X817_CAEBR/215-337SEALGD..AMALYEKYFSMQA------------------------------------------T.NMI.DLGGAIRAEIE
RGS9_BOVIN/299-413SKVKEK..AEEIYKLFLAPGA------------------------------------------R.RWI.NIDGKTMDITV
RGS18_HUMAN/86-201QQIHLK..AKAIYEKFIQTDA------------------------------------------P.KEV.NLDFHTKEVIT
Q59Q05_CANAL/55-176SGLVNL..WNFIYEKYLTFDA------------------------------------------D.LEI.NLPCRLKSQLK
A8WU05_CAEBR/242-360SAMNNL..GRVILNTYLAEGT------------------------------------------A.NEV.FLPFGVRQVIE
Q4SP51_TETNG/52-170AAKNKA..RQNIMQNYCKADS------------------------------------------K.KFLSFLSGEIAEKCK
FLBA_EMENI/544-685RETLAA..AYGLYNAFLAPGS------------------------------------------P.CEL.NIDHALRNSLA
Q568M8_DANRE/50-165SKLCAK..AKKIYEEFICSDA------------------------------------------P.REV.NLDHETRTVTL
RGS7_HUMAN/333-447KEVPSR..VQEIWQEFLAPGA------------------------------------------P.SAI.NLDSKSYDKTT
RGS13_HUMAN/34-149WSRISR..AKKLYKIYIQPQS------------------------------------------P.REI.NIDSSTRETII
Q54LD1_DICDI/262-386NRIRTL..FLNMYGNYIANDC------------------------------------------K.YEI.NIDSESKQLIE
A8WGN3_DANRE/70-184DKMNLK..ARNIFERYIEADS------------------------------------------P.REV.NLDSVTREQTR
D8PLJ1_SCHCM/373-541ESLINT..AFVIYNTYLAPSS------------------------------------------Q.CEL.NIDHNLRNELA
F1QAG9_DANRE/87-202EEMKKE..ARLIYDTFLSESS------------------------------------------L.HAV.NIDDTAQTE.E
F1QQ72_DANRE/76-191SKLKSK..AKSIYNEFIKPDS------------------------------------------P.KEI.NLDYNTKEMLQ
F6WJ87_XENTR/64-178FILHSR..ARKIYQLYIALQS------------------------------------------P.KEV.NLDASTREMTE
F7B5F5_XENTR/53-170EKRKET..GDEIISRFFNPES------------------------------------------S.DYMPEIPDAYMEECS
H2MB46_ORYLA/58-174SERAKK..ASKIVQRYMDPSA------------------------------------------K.HFCPFLPEDIIAKVK
H3C4S7_TETNG/18-130PEMISS..ANRIYSEFVQTEA------------------------------------------P.KQI.NIDCGTRENIT
H3CNA0_TETNG/88-203TKLLSK..AKYIYTVFCEPDS------------------------------------------P.KEI.NIDYNTRMAIQ
H3CS40_TETNG/90-207EKRAKL..AKAIYRKYIVDGG------------------------------------------GIVSR.QIKAATKSFIR
H3D467_TETNG/50-165EELLSR..ANSIYEEFVKSEA------------------------------------------P.KEI.NLDFHTKNAIV
J3QRK4_HUMAN/81-199TKTLRV..AKAIYKRYIENNS------------------------------------------I.VSK.QLKPATKTYIR
Q07G41_XENTR/72-189PKTSKT..AKAIYRWYVQNSS------------------------------------------A.VSC.RLKPSTRTQVK
Q49HN0_DANRE/57-174NDRAKK..AQKIVNKYYESSS------------------------------------------K.NFCDFLGDKAVSRVK
Q5KPY3_CRYNJ/394-561QDLVAM..AFVIYNTYLAPAS------------------------------------------P.CEL.NIDHNLRAELV
V5IMF6_NEUCR/575-720KEIMAQ..AYGIYNAFLAPGS------------------------------------------P.CEL.NIDHQLRNNLA
W4XCG7_STRPU/91-208PVRTDL..AKLIYRRFIKKEG------------------------------------------Q.QVV.RLQTATRNHVA

PF09128

ARHGC_MOUSE/368-558KRSMGLTLAESELTKLDAERDKDRGT.LEKERACA.EQIVT-KI...EEVLMTAQAVE..EERSSTMQYVILMYMKYLGV
Q7PMK0_ANOGA/664-859KRTAGLGTMYGPNDQQLQMAKGDKV....KEQRIIDETLLP-KLQQYLDELERESPKE..DPKKSALCSALSTVLMRIFV
ARHGB_HUMAN/307-486KRTLGLGSLYGENDLLD..LDGDPL....RERQVA.EKQLA-AL...GDIL...SKYE..EDRSAPMDFALNTYMSHAGI
F7E5L7_XENTR/337-527KRSMGLTLAEGELSKLDADRLRDRNT.MEKERVCA.EQILQ-KI...DEILFSSQTPE..DEKSNTIQYVILTYMKHLGV
G5EFE1_CAEEL/246-443KKQLG.GQVSESTNQLTHMVRGDMT....MEHRVG.EQMLF-RC...LEQCSNSTDFDSCEIRTQSIISSLATVIKIVLG
H3CQS1_TETNG/354-544KRSMGLTVAEGELSRLDQERIRDRVT.LERERSYA.ENIIS-KI...EDILLTTQTTE..EEKCTTMQYVIYTYMKHLGV
ARHG1_MOUSE/40-230KRLMGMTPWEQELSLLEPWIGKDRGNYEARERHVA.ERLLS-HL...EETQHTIST.D..EEKSAAVVTAISLYMRHLGV

PF00615

Q7QG26_ANOGA/380-498DVVKEGA........................AQPS-RWCFD.VA---ADHVFY.LMKS--DSYSRFLRS..DMYKDC---
Q7Q4R5_ANOGA/402-517AFLVGD..........................VGG-PDVFY.EV---QRECLA.LLEQ--KYYRPFLLS..DEYGRL---
Q7QEZ6_ANOGA/445-560LGLKN............................PS-RFAFD.AA---AEHIYTLLLKK--DCYPRFVRS..EHYKNL---
Q7PYV4_ANOGA/57-178AGLKNE.........................LELT-PDIFD.QM---QADVAN.IIAE--TTYPHFLQS..DLYLQY---
GRK7A_DANRE/52-170AVSDK............................DF-EEVMG.QV---KTATKE.FLKG--KPFTEYQAS..PFFDKF---
Q29C79_DROPS/57-174AIKSNPE........................LPLS-PHIFD.PM---QHHVET.TIRD--NIYPTFLCS..EMYILY---
RGS1_HUMAN/85-199KKIKA............................PT-PTCFD.EA---QKVIYT.LMEK--DSYPRFLKS..DIYLNL---
Q6BM88_DEBHA/437-576SFVNNKDPIY.................KLELYQKS-RKALF.KL---QNNIYE.SISN--DDFPPFKKS..ELFLKL---
Q29I26_DROPS/414-528TFLLG...........................DAD-PDIFY.DI---QRNILR.TLEE--KYYPPFVLS..GQYRQL---
GRK4_HUMAN/52-171LGLKEE..........................NPS-KKAFE.EC---TRVAHN.YLRG--EPFEEYQES..SYFSQF---
GRK7_SPETR/53-170AASTD...........................EER-KTLVE.QA---KAETMS.FLQE--QPFQDFLAS..PFYDRF---
RCKA_DICDI/487-602NRREN............................PT-HSMFN.EV---LDLLLD.DIVC--DAFRNYISS..PFNPEW---
ARBK2_HUMAN/54-174SHLSKK..........................QVT-STLFQ.PY---IEEICE.SLRG--DIFQKFMES..DKFTRF---
Q7KS58_DROME/294-409EKLAD............................AA-PDIFA.PA---QKQIFS.LMKF--DSYQRFIRS..DLYKSC---
RGS19_HUMAN/90-205KKMQE............................PS-AHTFD.DA---QLQIYT.LMHR--DSYPRFLSS..PTYRAL---
RGS3_HUMAN/1073-1188DNLQS............................VT-RGCFD.LA---QKRIFG.LMEK--DSYPRFLRS..DLYLDL---
RGS8_DANRE/46-161NRLLE............................PT-PHSLN.EV---QAKVYS.LMEK--DSYPRFIRS..KIYQDL---
A8XJK3_CAEBR/757-874AAVEA...........................GCK-PDTFA.LA---QNRVEQ.LMSK--DSYRRFLRD..RLFLDL---
SNX25_HUMAN/287-400QCLVG...........................NKG-IEVFY.KI---QEDVYE.TLKD--RYYPSFIVS..DLYEKL---
EGL10_CAEEL/421-536DNLKN............................PN-RWSFD.EA---ADHIYC.LMKN--DSYQRFLRS..EIYKDL---
GRK5_BOVIN/52-170EKLLQ...........................KPC-KELFS.AC---VQSVHD.YLRG--EPFHEYLDS..MYFDRF---
Q5A9K1_CANAL/354-489NSGNSANV.....................RTYQEA-RTYLF.KM---QRDCFD.QMQS--HDLPVFVNS..EMYLRL---
Q6P300_XENTR/63-178NNIIQ............................PT-HSTFD.EA---QHRIFI.LMEK--DSYRRFLKS..KFYLDL---
GRK4_RAT/51-170CNLKQS..........................SPS-QNVFQ.DC---AGVIYK.YLSE--KPFEEYQES..TYYNRF---
GRK6_HUMAN/52-170QRLEQ...........................GPC-KDLFQ.EL---TRLTHE.YLSV--APFADYLDS..IYFNRF---
A8WU05_CAEBR/114-226NAINTE..........................TLD-PEEMG.PA---IKEVKR.LLEN--DQFPRFRRS..ELYLQY---
O17589_CAEEL/287-406ECISKAK.......................DASQM-RFAFY.HS---EEHVFT.LMAK--DSYPRFVRS..QIYKAV---
RK_BOVIN/57-171AG...............................AG-DGLFQ.PL---LRAVLA.HLGQ--APFQEFLDS..LYFLRF---
RGS12_HUMAN/715-831DVLRA............................PH-PDMFK.EQ---QLQIFN.LMKF--DSYTRFLKS..PLYQEC---
RGS5_CAEEL/81-204DKLSAS..........................PLQ-KSCFD.EA---QDFVKS.LFEY--RYFDEFQNS..VYYKKH---
Q7T2D3_DANRE/65-180RNLVD............................LS-SSTFE.LA---QSRIYT.LMEK--DSFGRFLRS..DQYQEL---
GRK2_CAEEL/54-174YHLLKQ..........................NVP-PDLFH.RY---VLEICD.QLRG--DIFQRFLES..DKFTRF---
RGS11_CAEEL/139-255EYVEHI..........................EGW-KYTFD.VA---QAYVGL.KFPK--ESHKKFLED..PLYLDL---
RGS10_CAEEL/135-251AYLVND..........................PGW-RHTFD.VA---QAYVGL.KLAK--KSHKKFLED..PLYLDL---
SNX12_SCHPO/390-528KFVNQSKDNL.................NPDLWVEA-RNAML.MA---QEHVFD.IMQN--SDYSEFVNS..EIYYRF---
RGS9_CAEEL/106-222GP...............................TG-RDVFI.CA---QAYVGT.NFPK--DSYKKFLQD..PIYLNL---
A8X817_CAEBR/215-337SLICEES........................GRPN-RKAFR.TA---KTACFF.RLHD--KYLSDFLKT..IFYHNY---
RGS9_BOVIN/299-413KGLKH............................PH-RYVLD.AA---QTHIYM.LMKK--DSYARYLKS..PIYKEM---
RGS18_HUMAN/86-201NSITQ............................PT-LHSFD.AA---QSRVYQ.LMEQ--DSYTRFLKS..DIYLDL---
Q59Q05_CANAL/55-176LNQL.............................PE-LNVLK.NC---QKYIYD.NLLI--SLYREFTKSMKQQYDKE---
A8WU05_CAEBR/242-360RRIQDN..........................NID-ITLFD.EA---IKHVEQ.VLRN--DPYVRFLQS..AQYNTL---
Q4SP51_TETNG/52-170GVTEA............................NF-EEVMKGKV---QDGVRE.FLKG--KPFTEFQTS..LFFDKF---
FLBA_EMENI/544-685SRMTKAVGDDD...............SMLKSLQEV-VQLFE.MA---QTSVFK.LMSS--DSVPKFLRD..PKYSAI---
Q568M8_DANRE/50-165KNMEQ............................PT-SSCFN.FA---QSKIYT.LMEK--DCYPRFLKS..TVYQEL---
RGS7_HUMAN/333-447QNVKE............................PG-RYTFE.DA---QEHIYK.LMKS--DSYPRFIRS..SAYQEL---
RGS13_HUMAN/34-149RNIQE............................PT-ETCFE.EA---QKIVYM.HMER--DSYPRFLKS..EMYQKL---
Q54LD1_DICDI/262-386NRKNTVE.......................EDQPF-YSSLV.LA---VENVYN.ILNL--SMFPLFMTS..PLYHSA---
A8WGN3_DANRE/70-184KNLEM............................CD-VSCFD.EA---QSKIFT.LMEK--DSYRRFLRS..RLFLEL---
D8PLJ1_SCHCM/373-541KYLEDVVTNLTGKAFSGRVEPEQANAFNATQLQNM-IRLYE.RI---QTHVFR.LMAT--DSVPKFIKT..PKFLAM---
F1QAG9_DANRE/87-202RELEM............................PT-PDMFN.KA---QAQIFK.LMKM--DSYTRFVRS..PLYQNC---
F1QQ72_DANRE/76-191QSFLI............................PT-PCTFK.VA---QHRVLY.LMEH--NSYPRFLES..ELYQKL---
F6WJ87_XENTR/64-178HNLLI............................PT-RTTFD.EA---QRRIYG.LMER--DSYPRFLRS..DLYQS.---
F7B5F5_XENTR/53-170ENLGK...........................NPS-KEIFT.KC---ISQLHE.FLSG--SPFREFQDS..MYFDRF---
H2MB46_ORYLA/58-174ENLEV............................VG-DDLFA.AA---LAKTLD.YLRE--APYVFFLES..MYLKRF---
H3C4S7_TETNG/18-130KNICQ............................PS-LTSFD.TA---QKLIYS.LMAR--DCYPRFLKS..DIYQ..---
H3CNA0_TETNG/88-203RGVAK............................PT-KGCFE.AA---QLQVYN.LMKK--DSYPRFLLS..DTYLRL---
H3CS40_TETNG/90-207DCVGRP..........................HPD-PAMFE.QA---QIEIQS.MMEE--NTYPLFLKS..DLYLEY---
H3D467_TETNG/50-165QNLHQ............................PN-ASIFL.AA---QRKVYS.LMEN--NSYPRFIHS..DLYREL---
J3QRK4_HUMAN/81-199DGIKKQ..........................QID-SIMFD.QA---QTEIQS.VMEE--NAYQMFLTS..DIYLEY---
Q07G41_XENTR/72-189ECVKNQ..........................QLN-KTVFD.QA---QQEIQR.AMEQ--EAFTSFLQS..DICKE.---
Q49HN0_DANRE/57-174EDFKN............................IR-GDLFK.ES---EQQLLV.HLEA--KALTGFKDS..MYFLRY---
Q5KPY3_CRYNJ/394-561GYMNQITSDKEAGVKGHI.EPGVGDTLHASQLQTM-VKLYE.RI---QVYIFR.LMAT--DSVPKFCKT..ELFLTL---
V5IMF6_NEUCR/575-720TRMTKAVGQDV...............TMIDTLREV-MALFE.DA---QNAVFK.LMAS--DSVPKFLRN..PKYEQ.---
W4XCG7_STRPU/91-208ESIRTN..........................KVA-GKLFD.AS---QREVEE.YMRE--TSYPMFLKS..DVYVQ.---

PF09128

ARHGC_MOUSE/368-558K
Q7PMK0_ANOGA/664-859T
ARHGB_HUMAN/307-486R
F7E5L7_XENTR/337-527K
G5EFE1_CAEEL/246-443K
H3CQS1_TETNG/354-544R
ARHG1_MOUSE/40-230R

PF00615

Q7QG26_ANOGA/380-498-
Q7Q4R5_ANOGA/402-517-
Q7QEZ6_ANOGA/445-560-
Q7PYV4_ANOGA/57-178-
GRK7A_DANRE/52-170-
Q29C79_DROPS/57-174-
RGS1_HUMAN/85-199-
Q6BM88_DEBHA/437-576-
Q29I26_DROPS/414-528-
GRK4_HUMAN/52-171-
GRK7_SPETR/53-170-
RCKA_DICDI/487-602-
ARBK2_HUMAN/54-174-
Q7KS58_DROME/294-409-
RGS19_HUMAN/90-205-
RGS3_HUMAN/1073-1188-
RGS8_DANRE/46-161-
A8XJK3_CAEBR/757-874-
SNX25_HUMAN/287-400-
EGL10_CAEEL/421-536-
GRK5_BOVIN/52-170-
Q5A9K1_CANAL/354-489-
Q6P300_XENTR/63-178-
GRK4_RAT/51-170-
GRK6_HUMAN/52-170-
A8WU05_CAEBR/114-226-
O17589_CAEEL/287-406-
RK_BOVIN/57-171-
RGS12_HUMAN/715-831-
RGS5_CAEEL/81-204-
Q7T2D3_DANRE/65-180-
GRK2_CAEEL/54-174-
RGS11_CAEEL/139-255-
RGS10_CAEEL/135-251-
SNX12_SCHPO/390-528-
RGS9_CAEEL/106-222-
A8X817_CAEBR/215-337-
RGS9_BOVIN/299-413-
RGS18_HUMAN/86-201-
Q59Q05_CANAL/55-176-
A8WU05_CAEBR/242-360-
Q4SP51_TETNG/52-170-
FLBA_EMENI/544-685-
Q568M8_DANRE/50-165-
RGS7_HUMAN/333-447-
RGS13_HUMAN/34-149-
Q54LD1_DICDI/262-386-
A8WGN3_DANRE/70-184-
D8PLJ1_SCHCM/373-541-
F1QAG9_DANRE/87-202-
F1QQ72_DANRE/76-191-
F6WJ87_XENTR/64-178-
F7B5F5_XENTR/53-170-
H2MB46_ORYLA/58-174-
H3C4S7_TETNG/18-130-
H3CNA0_TETNG/88-203-
H3CS40_TETNG/90-207-
H3D467_TETNG/50-165-
J3QRK4_HUMAN/81-199-
Q07G41_XENTR/72-189-
Q49HN0_DANRE/57-174-
Q5KPY3_CRYNJ/394-561-
V5IMF6_NEUCR/575-720-
W4XCG7_STRPU/91-208-

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window