Sequence alignment for CL0272

PF09128

ARHGC_MOUSE/368-558QCSCFQSIELL....KSRPAHLAVFLHHVVSQF.DPATLLCYLYS.DLYKQ.------------------------.TNS
Q7PMK0_ANOGA/664-859ENSPFRSLTQLLEADKS..VYLAVFLNFVLTNS.DPSALLFYMIT.MLYKE.------------------------.GTV
ARHGB_HUMAN/307-486SDIIFQDLEKL....KSRPAHLGVFLRYIFSQA.DPSPLLFYLCA.EVYQQ.------------------------.ASP
Q6KAM6_MOUSE/59-249QNSQFQSLEQV....KRRPAHLMALLQHVALQF.EPGPLLCCLHA.DMLSS.------------------------.LGP
Q6T5A2_CAEEL/199-396QGGPFSNLAEL....KTHPAHLAVFINYLLLHG.NPSSLFFYLIT.DAYQSA------------------------YGTA
Q4SEN6_TETNG/279-481ECSSFQSVDLL....KSRPAHLAVFLHHVISQF.DPAPVLCYLYA.DMHKL.------------------------.ATS
Q6XS95_XENLA/356-546QCSCFQNMDLL....KSHPAHLAVFIHHVVSQF.DPAALLCYLHA.DLYQQ.------------------------.TNS
Q4SQQ5_TETNG/377-587TDGPFQDIELL....KLRPAHMTVFMRYIFTQLLDPNPLVAVLLSVEAYLG.------------------------.SSS
Q4SPD4_TETNG/284-474QCNSFNSIEQL....KSRPAHLAAFLHHVISQF.DPAPVLCYLYA.DFYKQ.------------------------.TNS

PF00615

Q7QG26_ANOGA/380-498---SLRELL------NDPI.GREQFTKFLDKEFSG..ENLKFWEAIQDMKAL..........................PQ
Q7Q4R5_ANOGA/402-517---SLADIL------STVG.GRRALTAFLEPLNAA..SLVGYYTTVEELRRA..........................AR
Q7QEZ6_ANOGA/445-560---SIEEVV------SDPT.GLQEFTHYLKKEYSH..ENIRFWMAVNDLRRS..........................SH
Q7PYV4_ANOGA/57-178---KLAYLL------EDGD.GAELFKRYVELEGEEPSNRLKFYFACEGLKQQ.........................TDA
GRK7A_DANRE/52-170---DFESLC------EKQPIGKKLFRQYLSQGGPECTTAAEFLDDLNEWELS..........................ES
Q29C79_DROPS/57-174---TLNHLL------EDRD.GVELFKKYVEEEAPAYNDHLNFYFACEGLKQQ.........................TDP
RGS1_HUMAN/85-199---SLEKLL------ANQT.GQNVFGSFLKSEFSE..ENIEFWLACEDYKKT..........................ES
Q6BM88_DEBHA/437-576---TLLDIL------NNSV.GLKFFTEFMNDRSRS..QLFQLWLAIDEIRAPLEDIDIE...........EDGEARLSLS
Q29I26_DROPS/414-528---TLEEIL------NTAV.GRRYFTLFLEPLKAS..ALVGFYLAVEEIKHA..........................HK
GRK4_HUMAN/52-171---DYSSLC------DKQPIGRRLFRQFCDT.KPTLKRHIEFLDAVAEYEVA..........................DD
Q7SA69_NEUCR/605-751---RLDKIL------NENS.LRLLFRENLRETHCE..ENLAFYLDTDEFVRQCRAAIDLAQ.......RSPNSAASLDGI
GRK7_SPETR/53-170---HFHSLC------EQQPIGRRLFRDFLAT.VPKYSQAVAFLEDVQNWELA..........................EE
RCKA_DICDI/487-602---KFIETI------TDPT.TLNSFRSFMENTQSN..ENLEFFLEVKRFNTI...........................Q
Q4V7I3_XENLA/208-323---SLEILL------SHTY.GRALFRVFLQSEFSD..ENLDFWLACEEYKDT.........................HPN
ARBK2_HUMAN/54-174---TFDKIF------.NQKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKL.........................DNE
Q6GP01_XENLA/85-200---SFDKLL------SHKD.GIEAFKKFLKMEFSD..ENLEFWLECEEYKQI.........................KTN
Q7KS58_DROME/294-409---SFERML------QDAA.GMQTFSEFLKKEFSA..ENIYFWTACERYRLL.........................ESE
RGS19_HUMAN/90-205---SFDKLM------HSPA.GRSVFRAFLRTEYSE..ENMLFWLACEELKAE.........................ANQ
Q9N2R0_LOLPE/54-178---TFDHIF------.DQRIGFVLFKDYCNNGSDVPILEINFYEEIKKFQGM.........................DKD
RGS3_HUMAN/1073-1188---SLEKLL------VHKY.GLAVFQAFLRTEFSE..ENLEFWLACEDFKKV.........................KSQ
RGS8_DANRE/46-161---SFDILL------SNKY.GLAAFRTFLKTEFSD..ENIEFWLACEDYKKI.........................KSP
A8XJK3_CAEBR/757-874---SFDSLL------NNKF.GCALFRQFLKKEFSD..ENMDFWLECEEFKKM........................KDGK
Q6GPB2_XENLA/61-177---SFERLL------QDPL.GVEYFTEFLKKEYSE..ENINFWKACEKFHAIS.......................NDDS
SNX25_HUMAN/287-400---QFEDIL------ANTF.YREHFGMYMERMDKR..ALISFWESVEHLKNA..........................NK
EGL10_CAEEL/421-536---SFEELL------ADSL.GRETLQKFLDKEYSG..ENLRFWWEVQKLRKC..........................SS
GRK5_BOVIN/52-170---DYCSLC------DKQPVGRLLFRQFCET.RPGLESYIQFLDSVAEYEVT..........................PD
Q69FB0_CRYNV/410-577---RLKQIL------EEPA.LRSLFREFLRSNFCE..ENLSFWLDVQDFKRRFQTTSSAVAAPGSKQAKLSGHAAMEKHQ
Q5A9K1_CANAL/354-489---NLKDIL------TDKN.NFQVFKEFMESEGRS..KLVEFWKAVEMIKAPLEGEEN............DDETDPLALS
Q6P300_XENTR/63-178---SLENLI------NNEC.GLAAFRAFLQSEYSE..ENIDFWLACENYKKV.........................KTP
Q4S6N8_TETNG/73-188---SLDTLL------SNKY.GKTAFCIFLKSEFSE..ENIEFWTACEDFRLH.........................TSQ
Q4SSQ1_TETNG/48-163---SVDKVL------GCKA.GQIAFREFLKSEYSE..ENILFWLACEEHKKI.........................KTV
GRK4_RAT/51-170---DFSSLC------DQQPIGRLLFRQFCNT.KPDLKRCIEFLDAAAEYEVT..........................IE
GRK6_HUMAN/52-170---DYHSLC------ERQPIGRLLFREFCAT.RPELSRCVAFLDGVAEYEVT..........................PD
Q567A3_DANRE/57-174---SFDSMC------VRQPIGKRLFQQYLES.EADYKNPVDLWKDIEDYIVA..........................QE
A8WU05_CAEBR/114-226---NCTNVL------NDDK.GKQLFRVFLFQSLAE..ENLGFLEAMERLKKM........................KNGD
Q2I697_EISFO/45-169---TFEKIF------.NQRLGYLLFKDFCENVSDEQVPQLSFFDEIKKFEKL.........................ESD
O17589_CAEEL/287-406---SVQELV------KDPI.GRQVLETFLESEFSS..ENIRFWIAIQDLKYA..........................PN
RK_BOVIN/57-171---GFEGMC------LEQPIGKRLFQQFLRT.HEQHGPALQLWKDIEDYDTA..........................DD
Q28DL5_XENTR/52-170---DYTSLC------EKQPIGRRLFRQFCDT.REHFLRCINFLDAVADYEVS..........................PD
Q7SXC7_DANRE/86-202---CFEHLL------EDHV.GVRYFTEFLRSEVSA..ENILFYQACEKFKKIP.......................PSRL
RGS12_HUMAN/715-831---SFERLL------QDPV.GVRYFSDFLRKEFSE..ENILFWQACEYFNHVP.......................AHDK
RGS5_CAEEL/81-204---SLDRLL------IDSS.ALSYFIQYLDSTDKL..NLIKFWMHVEGFKSSFSE...................QIQAAQ
Q7T2D3_DANRE/65-180---SLDKVL------SNSY.GLATFKSFLRSEFSE..ENIEFWEACEDFKKT.........................KNP
Q5I0R8_XENTR/41-155---SLESLL------DDPK.GVGEFTDFLKKEFSE..ENLLFWLACEDFKGT.........................RDK
GRK2_CAEEL/54-174---KFDKIF------.NQKLGFLLLKDYAENVSESPCPQIKFYEAIKEYEKM.........................ETP
Q6TEM0_DANRE/70-184---SFTNLI------KNDD.GRKAFASFLQSEYSQ..ENIEFWVACEDFKQT..........................PA
Q5NUF5_ORYLA/57-174---AFDSVC------VEQPIGKRLFREFLEA.NQEYHGACRLWKDIEDYDLA..........................ED
RGS11_CAEEL/139-255---GL..LA------ASKY.GCALFIQFLKQQTSE..NEVDFWLDCQKFRSS........................TAKI
RGS10_CAEEL/135-251---SPETLA------ASEY.GCNLFIQFLKEQTSE..NEVDFWLDCQKFRSS..........................KM
SNX12_SCHPO/390-528---SLLQIL------SDSA.AVSCFLEFMERKNRS..RYLHFWLVVEGLKESQDDPL..............NAHMIAPFS
Q4V987_DANRE/49-164---SLDNLL------SSKC.GLNFFRLFIKSELCE..ENLDFWLACEEFRKI.........................RSR
RGS9_CAEEL/106-222---SPHSLA------ASEYGGSDLLVQFLKQQTSD..DYVDFWLESGEYRWT.........................RTK
A8X817_CAEBR/215-337---SLGDIL------KVQP.LLLSFLEFIKEKEDH..DMVQFLLGCESFEANL......................DLMED
Q9P459_SCHCO/373-541---RLRYIL------EDPP.LRSLFREFLRGNFCE..ENLSFWLEVQDFKRKFNITSSAQANNPRGARNTPGQAAMERHH
Q641H3_XENLA/72-190---SLNLLL------DDQD.GATLFRMYLEGEGLG..DLLSFWFACNGFRAM........................DPSE
RGS9_BOVIN/299-413---NFSELI------RDPK.GRQSFQHFLRKEFSG..ENLGFWEACEDLKYG..........................DQ
Q4SML4_TETNG/89-206---SLHSLL------DDQE.GIHLFRNFLCQEGCA..DLLDFWFACSGFRKT..........................SQ
Q4SSQ1_TETNG/182-297---SLERLL------SSKN.GIKVFQAFLKSEFSD..ENIEFWLVCEDYKKI.........................GSS
Q4TC95_TETNG/903-1019---SFHLSS------DWPD.GVTVFRHFLRSEFSE..ENLDFWLAVERFKQT.........................RSI
RGS18_HUMAN/86-201---SFDKLL------SHRD.GLEAFTRFLKTEFSE..ENIEFWIACEDFKKS.........................KGP
Q59Q05_CANAL/55-176---NLDSHK------SNQ..SLLSFHEYLMSRHCS..ENLQFIIDINKYLFTHNS...................TNSSCN
Q6TLV9_CHICK/85-203---SLHSLL------GDQD.GAYLFRTFLEREKCV..DTLDFWFACNGFRQM........................DLKD
A8WU05_CAEBR/242-360---SFEGLL------NNHV.GRHHFRLFLRSIHAE..ENLRFWEAVVEFRST........................RHKA
Q4SP51_TETNG/52-170---DFSSVC------ERQPIGKRFFRDFLAT.KAEYKVAADFLDDLYDWDLA..........................EQ
Q6IUG6_LYTVA/91-209---SLHALL------SDED.GIQLFKHYLIQEGAE..NPLLFWLATQGFKKK........................SDSD
Q4SSQ0_TETNG/65-180---SFEELL------SHSD.GVEVFSQFLRKEFSE..ENIEFWLACEEYKTI.........................DSE
FLBA_EMENI/544-685---RLNHIL------QDPA.LRLLFREFLRFSLCE..ENLSFYIDVSEFTTQYHKFDK............VGHFKKPDAV
Q568M8_DANRE/50-165---SFHELL------LHKD.GLCAFTTFLSSEYSE..ENIAFYLACEDFRNT.........................KSS
RGS7_HUMAN/333-447---GMDEAL------KDPV.GREQFLKFLESEFSS..ENLRFWLAVEDLKKR..........................PI
Q52KZ3_XENLA/50-166---QFENIC------VKQPIGKKIFQEFLET..TEFAHIVEIWNDIEDYDVA..........................ED
RGS13_HUMAN/34-149---SFENLM------ATKY.GPVVYAAYLKMEHSD..ENIQFWMACETYKKI.........................ASR
O73685_CHICK/90-204---SFRWQC------VEQPIGKRLFRQFLQA.TPGLAAAGALWEELEAFECC..........................EE
Q54LD1_DICDI/262-386---NFKDLL------DMPI.YLKAFRIFAEKQHCL..ENLLFWLDATTLKDLET.....................NNYPR
Q6DCK4_XENLA/63-178---SFSHLL------RSKE.GRSAFHTFLQTEFSE..ENLEFWEACEDYKKT.........................RSV

PF09128

ARHGC_MOUSE/368-558KETRRV--FLEFHQFFLDRSA.HLKVPVPEEISVDL..........................EKRRPELIPEDLHRLYIQ
Q7PMK0_ANOGA/664-859KDMRKW--AYEIHSTFLVPGAPLLCANVDEALARDIDD......................VL...QKENDKAEILRMVFW
ARHGB_HUMAN/307-486KDSRSL--GKDIWNIFLEKNA.PLRVKIPEMLQAEI.............................DSRLRNSEDARGVLC
Q6KAM6_MOUSE/59-249KEAKKA--FLDFYHSFLEKTA.VLRVPVPPSVAFEL..........................DRTRPDLISEDVQRRFIQ
Q6T5A2_CAEEL/199-396KEFRRW--AFEIFSTFIIPNS.PMCIPNSNQSVIQPIDK...................IMCMTAEHIGDSDTDTLKRIFV
Q4SEN6_TETNG/279-481KESRRF--FMEFHSLFLDRTARNAGWSCSRRICADR..........................SRRRCRKRCCRTCTNIWR
Q6XS95_XENLA/356-546KETRRV--FMEFNQFFLERAA.NLKVPVPDDVALEL..........................EKRRPELIPEELHRQYIQ
Q4SQQ5_TETNG/377-587KEARAL--APQICSHFLDPDA.PLKIKAKEEFLSDIGATADGFSSFLDECQYYFQRCDYASVLPSDSRLHAQEDIRGPLS
Q4SPD4_TETNG/284-474KETRRV--FMDLHNFFIDRGA.NLKVPVPDSISADL..........................DRRRTELIPEEINRQLVQ

PF00615

Q7QG26_ANOGA/380-498SQIKEA..AQAIWNEYLAPDA-----------------------------------------------------A.CPV.
Q7Q4R5_ANOGA/402-517SAWHQL..GAEIFYTYV.RAP-----------------------------------------------------S.SEI.
Q7QEZ6_ANOGA/445-560SQISRK..VKEIYEEFLEPGA-----------------------------------------------------P.CEI.
Q7PYV4_ANOGA/57-178DKVTQL..IGAIYRRFLKKAQ-----------------------------------------------------PGSEL.
GRK7A_DANRE/52-170AARDKA..RTNIINKFCKEGS-----------------------------------------------------K.SSLT
Q29C79_DROPS/57-174EKVKQI..IGAIY.RFL...R-----------------------------------------------------K.SQL.
RGS1_HUMAN/85-199DLLPCK..AEEIYKAFVHSDA-----------------------------------------------------A.KQI.
Q6BM88_DEBHA/437-576LEFSNLGDIVEIYREFF...Q-----------------------------------------------------N.SSL.
Q29I26_DROPS/414-528SATHQL..GTEIFYTYI.RVP-----------------------------------------------------K.PEI.
GRK4_HUMAN/52-171EDRSDC..GLSILDRFFNDKL-----------------------------------------------------A.APLP
Q7SA69_NEUCR/605-751KEIMAQ..AYGIYNAFLAPGS-----------------------------------------------------P.CEL.
GRK7_SPETR/53-170GPAKTS..TLQQLAATCARDP-----------------------------------------------------G.PQ.S
RCKA_DICDI/487-602DQVLLKHTCDDIWRRFF.DDL-----------------------------------------------------AVTQL.
Q4V7I3_XENLA/208-323FILHSR..ARKIYQLYIALQS-----------------------------------------------------P.KEV.
ARBK2_HUMAN/54-174EDRLCR..SRQIYDAYIMKEL-----------------------------------------------------L.SCSH
Q6GP01_XENLA/85-200KLMNDK..AKSLHEKYIQMDS-----------------------------------------------------P.REV.
Q7KS58_DROME/294-409ADRVAQ..AREIFAKHLANNS-----------------------------------------------------S.DPV.
RGS19_HUMAN/90-205HVVDEK..ARLIYEDYVSILS-----------------------------------------------------P.KEV.
Q9N2R0_LOLPE/54-178EDRIKQ..ARDIYDQFIMREL-----------------------------------------------------L.AQCH
RGS3_HUMAN/1073-1188SKMASK..AKKIFAEYIAIQA-----------------------------------------------------C.KEV.
RGS8_DANRE/46-161AKMMSK..ANKIYKEFIDVHA-----------------------------------------------------P.REV.
A8XJK3_CAEBR/757-874KSTTQK..AIEIYSEFVAEHA-----------------------------------------------------P.KEV.
Q6GPB2_XENLA/61-177AKLLQE..SRKIYNEYLSSSS-----------------------------------------------------Q.CPV.
SNX25_HUMAN/287-400NEIPQL..VGEIYQNFF..VE-----------------------------------------------------S.KEI.
EGL10_CAEEL/421-536RMVPVM..VTEIYNEFIDTNA-----------------------------------------------------ATSPV.
GRK5_BOVIN/52-170EKLGEK..GKEIMTKYLTPKS-----------------------------------------------------P.VFIT
Q69FB0_CRYNV/410-577QDLIAM..AFVIYNTYLAPAS-----------------------------------------------------P.CEL.
Q5A9K1_CANAL/354-489LEFGNNDDVYNIYTKFI....-----------------------------------------------------KTNEIP
Q6P300_XENTR/63-178EKLLEK..AQKIYEDFISVEA-----------------------------------------------------T.REV.
Q4S6N8_TETNG/73-188EELLSR..ANSIYEEFVKSEA-----------------------------------------------------P.KEI.
Q4SSQ1_TETNG/48-163PEMISS..ANRIYSEFVQTEA-----------------------------------------------------P.KQI.
GRK4_RAT/51-170EEQREF..GLSIYSRFFKENS-----------------------------------------------------E.VSLP
GRK6_HUMAN/52-170DKRKAC..GRQLTQNFLSHTG-----------------------------------------------------P.DLIP
Q567A3_DANRE/57-174NDRAKK..AQKIVNKYYESSS-----------------------------------------------------K.NFCD
A8WU05_CAEBR/114-226E.KVQF..AKDTLNTYQ....-----------------------------------------------------..GSI.
Q2I697_EISFO/45-169DERIKT..GRAIYDQYIMREL-----------------------------------------------------L.SQSH
O17589_CAEEL/287-406EQIYQK..AERIREEFLAQGA-----------------------------------------------------P.AQV.
RK_BOVIN/57-171ALRPQK..AQALRAAYLEPQA-----------------------------------------------------Q.LFCS
Q28DL5_XENTR/52-170EKRKET..GDEIISRFFNPES-----------------------------------------------------S.DYMP
Q7SXC7_DANRE/86-202EEMKKE..ARLIYDTFLSESS-----------------------------------------------------L.HAV.
RGS12_HUMAN/715-831KELSYR..AREIFSKFLCSKA-----------------------------------------------------T.TPV.
RGS5_CAEEL/81-204ELSLRD..AKSIYDKYIDDGS-----------------------------------------------------T.SSL.
Q7T2D3_DANRE/65-180LKMATK..AKKIYEDFIQTGG-----------------------------------------------------P.KEV.
Q5I0R8_XENTR/41-155EQMLKK..AHDIYTTFLSSKA-----------------------------------------------------P.AQV.
GRK2_CAEEL/54-174DERLTK..AREIYDHHIMVEM-----------------------------------------------------L.AHAH
Q6TEM0_DANRE/70-184DKMNLK..ARNIFERYIEADS-----------------------------------------------------P.REV.
Q5NUF5_ORYLA/57-174SERAKK..ASKIVQRYMDPSA-----------------------------------------------------K.HFCP
RGS11_CAEEL/139-255SWKNKE..VHRILDQFLSSSA-----------------------------------------------------P.RKI.
RGS10_CAEEL/135-251SSRQNE..ARRIFDEYFAMGS-----------------------------------------------------P.KKI.
SNX12_SCHPO/390-528DIVSDHTDFTAIVKSYF.ESV-----------------------------------------------------D.NPL.
Q4V987_DANRE/49-164SKLKSK..AKSIYNEFIKPDS-----------------------------------------------------P.KEI.
RGS9_CAEEL/106-222PGRKRDIEAQRIYDKFVYGEC-----------------------------------------------------P.RKIA
A8X817_CAEBR/215-337SEALGD..AMALYEKYFSMQA-----------------------------------------------------T.NMI.
Q9P459_SCHCO/373-541ESLINT..VFVIYNTYLAPSS-----------------------------------------------------Q.CEL.
Q641H3_XENLA/72-190PKTSKT..AKAIYRWYV.QNS-----------------------------------------------------SAVLC.
RGS9_BOVIN/299-413SKVKEK..AEEIYKLFLAPGA-----------------------------------------------------R.RWI.
Q4SML4_TETNG/89-206EKRAKL..AKAIYRKYIVDGG-----------------------------------------------------GIVSR.
Q4SSQ1_TETNG/182-297FRMSSR..ARKIFKRYIQADA-----------------------------------------------------A.REI.
Q4TC95_TETNG/903-1019CKMAAR..AKKIYNEFVSTSA-----------------------------------------------------A.RQV.
RGS18_HUMAN/86-201QQIHLK..AKAIYEKFIQTDA-----------------------------------------------------P.KEV.
Q59Q05_CANAL/55-176SGLVNL..WNFIYEKYLTFDA-----------------------------------------------------D.LEI.
Q6TLV9_CHICK/85-203TKTSRV..AKAIYKRYI.ENN-----------------------------------------------------SIVSK.
A8WU05_CAEBR/242-360SAMNNL..GRVILNTYLAEGT-----------------------------------------------------A.NEV.
Q4SP51_TETNG/52-170AAKNKA..RQNIMQNYCKADS-----------------------------------------------------K.KFLS
Q6IUG6_LYTVA/91-209PVRTDL..AKLIYRRFI.KKD-----------------------------------------------------GQQVV.
Q4SSQ0_TETNG/65-180TKLLSK..AKYIYTVFCEPDS-----------------------------------------------------P.KEI.
FLBA_EMENI/544-685RETLAA..AYGLYNAFLAPGS-----------------------------------------------------P.CEL.
Q568M8_DANRE/50-165SKLCAK..AKKIYEEFICSDA-----------------------------------------------------P.REV.
RGS7_HUMAN/333-447KEVPSR..VQEIWQEFLAPGA-----------------------------------------------------P.SAI.
Q52KZ3_XENLA/50-166EDRLRK..ARAIINKYLDSDS-----------------------------------------------------K.QFCH
RGS13_HUMAN/34-149WSRISR..AKKLYKIYIQPQS-----------------------------------------------------P.REI.
O73685_CHICK/90-204GERSAA..AANIRKRFFTEGG-----------------------------------------------------A.EHCA
Q54LD1_DICDI/262-386NRIRTL..FLNMYGNYIANDC-----------------------------------------------------K.YEI.
Q6DCK4_XENLA/63-178KKLPSK..AQDIFQEFLQFSS-----------------------------------------------------P.REV.

PF09128

ARHGC_MOUSE/368-558TMQERVHPEVQRHLED.............FRQKRSMGLTLAESELTKLDAERDKDRGT.LEKERACA.E-QIVTKI...E
Q7PMK0_ANOGA/664-859RSRLKAKEMINQQLQQ.............FQTKRTAGLGTMYGPNDQQLQMAKGDKV....KEQRIIDE-TLLPKLQQYL
ARHGB_HUMAN/307-486EAQEAAMPEIQEQIHD.............YRTKRTLGLGSLYGENDLLD..LDGDPL....RERQVA.E-KQLAAL...G
Q6KAM6_MOUSE/59-249EVVQSQQAAVSRQLED.............FRSKRLMGMTPWEQELSLLEPWIGKDRGNYEARERHVA.E-RLLSHL...E
Q6T5A2_CAEEL/199-396PGRQRAVTDINMYLND.............FRQKKQLG.GQVSESTNQLTHMVRGDMT....MEHRVG.E-QMLFRC...L
Q4SEN6_TETNG/279-481ISGHRVGLELSRLPFSEVHPPSLVCVTWLCRQKRSMGLTLAEDELSRLDSEPGKELS...DRECSCA.E-HILSKI...E
Q6XS95_XENLA/356-546TVQERLSEDVKKNLED.............FKQKRSMGLTLAEGELSKLDTERFRDRNT.IDKERACA.E-QIVQKI...E
Q4SQQ5_TETNG/377-587ELQQLVLPEIQDQIQD.............YRNKQMMGLGNLFGQEDLQP..LDGDPA....KERQVV.D-KQVIAL...W
Q4SPD4_TETNG/284-474TLQDSLLPDIQKNLED.............FRQKRSMGLTVAEGELSRLDQERIRDRVT.LERERSYA.E-NIISKI...E

PF00615

Q7QG26_ANOGA/380-498NIDSKSLELARDVVKE-------------GA........................AQ----PSRWCF-D.VAADHV---F
Q7Q4R5_ANOGA/402-517PLDKATRKRMEAFLVG-------------D..........................V----GGPDVF-Y.EVQREC---L
Q7QEZ6_ANOGA/445-560NIDGKTMEKVQLGLKN-------------............................----PSRFAF-D.AAAEHI---Y
Q7PYV4_ANOGA/57-178YVNESLRNFIKAGLKN-------------E.........................LE----LTPDIF-D.QMQADV---A
GRK7A_DANRE/52-170FLTGDVATKCKAVSDK-------------............................----DFEEVM-G.QVKTAT---K
Q29C79_DROPS/57-174SISDDLRTQIKAIKSN-------------PE........................LP----LSPHIF-D.PMQHHV---E
RGS1_HUMAN/85-199NIDFRTRESTAKKIKA-------------............................----PTPTCF-D.EAQKVI---Y
Q6BM88_DEBHA/437-576EIDRDVFNRVESFVNN-------------KDPIY.................KLELYQ----KSRKAL-F.KLQNNI---Y
Q29I26_DROPS/414-528QIDKHERKLIETFLLG-------------...........................D----ADPDIF-Y.DIQRNI---L
GRK4_HUMAN/52-171EIPPDVVTECRLGLKE-------------E..........................N----PSKKAF-E.ECTRVA---H
Q7SA69_NEUCR/605-751NIDHQLRNNLATRMTK-------------AVGQDV...............TMIDTLR----EVMALF-E.DAQNAV---F
GRK7_SPETR/53-170FLSQDLATKCRAASTD-------------...........................E----ERKTLV-E.QAKAET---M
RCKA_DICDI/487-602CVESSLKKLINNRREN-------------............................----PTHSMF-N.EVLDLL---L
Q4V7I3_XENLA/208-323NLDAGTRELTEHNLLL-------------............................----PTRTTF-D.EAQHRI---Y
ARBK2_HUMAN/54-174PFSKQAVEHVQSHLSK-------------K..........................Q----VTSTLF-Q.PYIEEI---C
Q6GP01_XENLA/85-200NLDFTTKEITKKSIEH-------------............................----PAQTSF-D.LAQTKI---Y
Q7KS58_DROME/294-409NVDSQARSLTEEKLAD-------------............................----AAPDIF-A.PAQKQI---F
RGS19_HUMAN/90-205SLDSRVREGINKKMQE-------------............................----PSAHTF-D.DAQLQI---Y
Q9N2R0_LOLPE/54-178DFTKTAVNNVQDALTK-------------ARK......................TKK----LDVVVF-N.KYKEEL---R
RGS3_HUMAN/1073-1188NLDSYTREHTKDNLQS-------------............................----VTRGCF-D.LAQKRI---F
RGS8_DANRE/46-161NIDHRTREETKNRLLE-------------............................----PTPHSL-N.EVQAKV---Y
A8XJK3_CAEBR/757-874NLDSDTRAATRAAVEA-------------...........................G----CKPDTF-A.LAQNRV---E
Q6GPB2_XENLA/61-177NVDQQAL.ITEDMLET-------------............................----PSPDLF-N.AQQLQI---F
SNX25_HUMAN/287-400SVEKSLYKEIQQCLVG-------------...........................N----KGIEVF-Y.KIQEDV---Y
EGL10_CAEEL/421-536NVDCKVMEVTEDNLKN-------------............................----PNRWSF-D.EAADHI---Y
GRK5_BOVIN/52-170QVGRDLVSQTEEKLLQ-------------...........................K----PCKELF-S.ACVQSV---H
Q69FB0_CRYNV/410-577NIDHNLRAELVSYMNQ-------------ITADKEAGVKGHI.EPGVGNTLHASQLQ----TMVKLY-E.RIQVYI---F
Q5A9K1_CANAL/354-489QPDTHIVEVLSNSGNS-------------ANV.....................RTYQ----EARTYL-F.KMQRDC---F
Q6P300_XENTR/63-178NLDSATREETSNNIIQ-------------............................----PTHSTF-D.EAQHRI---F
Q4S6N8_TETNG/73-188NLDFHTKNAIVQNLHQ-------------............................----PNASIF-L.AAQRKV---Y
Q4SSQ1_TETNG/48-163NIDCGTRENITKNICQ-------------............................----PSLTSF-D.TAQKLI---Y
GRK4_RAT/51-170QIPPDLVKECKCNLKQ-------------S..........................S----PSQNVF-Q.DCAGVI---Y
GRK6_HUMAN/52-170EVPRQLVTNCTQRLEQ-------------...........................G----PCKDLF-Q.ELTRLT---H
Q567A3_DANRE/57-174FLGDKAVSRVKEDFKN-------------............................----IRGDLF-K.ESGQQL---L
A8WU05_CAEBR/114-226NLSSGSMKALRNAINT-------------E..........................T----LDPEEM-G.PAIKEV---K
Q2I697_EISFO/45-169AYTKAAVDKVQEALTQ-------------AQK......................SRV----LAQNIF-E.PYVEEI---K
O17589_CAEEL/287-406NVDNRTLDQTLECISK-------------AK.......................DAS----QMRFAF-Y.HSEEHV---F
RK_BOVIN/57-171FLDAETVARARAG...-------------............................----AGDGLF-Q.PLLRAV---L
Q28DL5_XENTR/52-170EIPDAYMEECSENLGK-------------...........................N----PSKEIF-T.KCISQL---H
Q7SXC7_DANRE/86-202NIDDTAQ.TEERELET-------------............................----PTPDMF-N.KAQAQI---F
RGS12_HUMAN/715-831NIDSQAQ.LADDVLRA-------------............................----PHPDMF-K.EQQLQI---F
RGS5_CAEEL/81-204ALPRKIKQIVDDKLSA-------------S..........................P----LQKSCF-D.EAQDFV---K
Q7T2D3_DANRE/65-180NIDHFTKDVTLRNLVD-------------............................----LSSSTF-E.LAQSRI---Y
Q5I0R8_XENTR/41-155NVEGQSR.VSEKMLEE-------------............................----PHPLMF-Q.KHQDQI---F
GRK2_CAEEL/54-174NYSKESLQHVQYHLLK-------------Q..........................N----VPPDLF-H.RYVLEI---C
Q6TEM0_DANRE/70-184NLDSVTREQTRKNLEM-------------............................----CDVSCF-D.EAQSKI---F
Q5NUF5_ORYLA/57-174FLPEDIIAKVKENLEV-------------............................----VGDDLF-A.AALAKT---L
RGS11_CAEEL/139-255DMETSILARCMEYVEH-------------I..........................E----GWKYTF-D.VAQAYV---G
RGS10_CAEEL/135-251YIERYLWCVVQAYLVN-------------D..........................P----GWRHTF-D.VAQAYV---G
SNX12_SCHPO/390-528DIPKPLTNTINKFVNQ-------------SKDNL.................NPDLWV----EARNAM-L.MAQEHV---F
Q4V987_DANRE/49-164NLDYNTREMLQQSLLI-------------............................----PTPCTF-K.VAQHRV---L
RGS9_CAEEL/106-222HLEKMCFVSRQGP...-------------............................----TGRDVF-I.CAQAYV---G
A8X817_CAEBR/215-337DLGGAIRAEIESLICE-------------ES........................GR----PNRKAF-R.TAKTAC---F
Q9P459_SCHCO/373-541NIDHNLRNELAKYLED-------------VVTNLTGKAFSGRVEPEQANAFNATQLQ----NMIRLY-E.RIQTHV---F
Q641H3_XENLA/72-190RLKPSTRTQVKECVKN-------------QQ........................LN----..KTVF-D.QAQQEI---Q
RGS9_BOVIN/299-413NIDGKTMDITVKGLKH-------------............................----PHRYVL-D.AAQTHI---Y
Q4SML4_TETNG/89-206QIKAATKSFIRDCVGR-------------PH........................PD----..PAMF-E.QAQIEI---Q
Q4SSQ1_TETNG/182-297NIDHKTRDLIRRNVAA-------------............................----PTRVCF-D.DAQRIV---Y
Q4TC95_TETNG/903-1019NMDSSVRETTLQSLRL-------------...........................G----VSPASF-Q.LAQDRI---F
RGS18_HUMAN/86-201NLDFHTKEVITNSITQ-------------............................----PTLHSF-D.AAQSRV---Y
Q59Q05_CANAL/55-176NLPCRLKSQLKLNQL.-------------............................----PELNVL-K.NCQKYI---Y
Q6TLV9_CHICK/85-203QLKPATKTYIRDSIKK-------------QQ........................ID----..SIMF-D.QAQTEI---Q
A8WU05_CAEBR/242-360FLPFGVRQVIERRIQD-------------N..........................N----IDITLF-D.EAIKHV---E
Q4SP51_TETNG/52-170FLSGEIAEKCKGVTEA-------------............................----NFEEVM-KGKVQDGV---R
Q6IUG6_LYTVA/91-209RLHGSTRNHVAESIRT-------------NK........................VD----..SNLF-D.ASQMEV---E
Q4SSQ0_TETNG/65-180NIDYNTRMAIQRGVAK-------------............................----PTKGCF-E.AAQLQV---Y
FLBA_EMENI/544-685NIDHALRNSLASRMTK-------------AVGDDD...............SMLKSLQ----EVVQLF-E.MAQTSV---F
Q568M8_DANRE/50-165NLDHETRTVTLKNMEQ-------------............................----PTSSCF-N.FAQSKI---Y
RGS7_HUMAN/333-447NLDSKSYDKTTQNVKE-------------............................----PGRYTF-E.DAQEHI---Y
Q52KZ3_XENLA/50-166YLDEKAIIKVVQDCNK-------------............................----VSDMLF-K.QLLKST---T
RGS13_HUMAN/34-149NIDSSTRETIIRNIQE-------------............................----PTETCF-E.EAQKIV---Y
O73685_CHICK/90-204FLSAAATAPPAD....-------------...........................S----GAPDDF-E.PTRREL---L
Q54LD1_DICDI/262-386NIDSESKQLIENRKNT-------------VE.......................EDQ----PFYSSL-V.LAVENV---Y
Q6DCK4_XENLA/63-178NIDHRTRELIHKKMAV-------------............................----PCRNCF-D.AAQEQI---R

PF09128

ARHGC_MOUSE/368-558EVLMTAQAVE..EERSSTMQYVILMYMKYLGVK
Q7PMK0_ANOGA/664-859DELERESPKE..DPKKSALCSALSTVLMRIFVT
ARHGB_HUMAN/307-486DIL...SKYE..EDRSAPMDFALNTYMSHAGIR
Q6KAM6_MOUSE/59-249ETQHTIST.D..EEKSAAVVTAISLYMRHLGVR
Q6T5A2_CAEEL/199-396EQCSNSTDFDSCEIRTQSIISSLATVIKIVLGK
Q4SEN6_TETNG/279-481DILSASQPTE..EEKCQTTQYVILTYMKYLGVK
Q6XS95_XENLA/356-546EILFTSQTPE..DEKSNTIQYVILTYMKHLGVK
Q4SQQ5_TETNG/377-587EIL...SKHE..EDRSSPLAWAVLLYLRHSGIK
Q4SPD4_TETNG/284-474DILLTTQTTE..EEKCTTMQYVIYTYMKHLGVR

PF00615

Q7QG26_ANOGA/380-498Y.LMKSDSYS------RFLRS..DMYKDC----
Q7Q4R5_ANOGA/402-517A.LLEQKYYR------PFLLS..DEYGRL----
Q7QEZ6_ANOGA/445-560TLLLKKDCYP------RFVRS..EHYKNL----
Q7PYV4_ANOGA/57-178N.IIAETTYP------HFLQS..DLYLQY----
GRK7A_DANRE/52-170E.FLKGKPFT------EYQAS..PFFDKF----
Q29C79_DROPS/57-174T.TIRDNIYP------TFLCS..EMYILY----
RGS1_HUMAN/85-199T.LMEKDSYP------RFLKS..DIYLNL----
Q6BM88_DEBHA/437-576E.SISNDDFP------PFKKS..ELFLKL----
Q29I26_DROPS/414-528R.TLEEKYYP------PFVLS..GQYRQL----
GRK4_HUMAN/52-171N.YLRGEPFE------EYQES..SYFSQF----
Q7SA69_NEUCR/605-751K.LMASDSVP------KFLRN..PKYEQT----
GRK7_SPETR/53-170S.FLQEQPFQ------DFLAS..PFYDRF----
RCKA_DICDI/487-602D.DIVCDAFR------NYISS..PFNPEW----
Q4V7I3_XENLA/208-323G.LMERDSYP------RFLRS..DLYQSL----
ARBK2_HUMAN/54-174E.SLRGDIFQ------KFMES..DKFTRF----
Q6GP01_XENLA/85-200T.LMEKDSYP------RFLKS..NIYSDM----
Q7KS58_DROME/294-409S.LMKFDSYQ------RFIRS..DLYKSC----
RGS19_HUMAN/90-205T.LMHRDSYP------RFLSS..PTYRAL----
Q9N2R0_LOLPE/54-178R.KLNKEVFS------KFIES..DRYTRY----
RGS3_HUMAN/1073-1188G.LMEKDSYP------RFLRS..DLYLDL----
RGS8_DANRE/46-161S.LMEKDSYP------RFIRS..KIYQDL----
A8XJK3_CAEBR/757-874Q.LMSKDSYR------RFLRD..RLFLDL----
Q6GPB2_XENLA/61-177N.LMKFDSYA------RFVKS..PLYQDC----
SNX25_HUMAN/287-400E.TLKDRYYP------SFIVS..DLYEKL----
EGL10_CAEEL/421-536C.LMKNDSYQ------RFLRS..EIYKDL----
GRK5_BOVIN/52-170D.YLRGEPFH------EYLDS..MYFDRF----
Q69FB0_CRYNV/410-577R.LMATDSVP------KFCKT..ELFLTL----
Q5A9K1_CANAL/354-489D.QMQSHDLP------VFVNS..EMYLRL----
Q6P300_XENTR/63-178I.LMEKDSYR------RFLKS..KFYLDL----
Q4S6N8_TETNG/73-188S.LMENNSYP------RFIHS..DLYREL----
Q4SSQ1_TETNG/48-163S.LMARDCYP------RFLKS..DIYQGL----
GRK4_RAT/51-170K.YLSEKPFE------EYQES..TYYNRF----
GRK6_HUMAN/52-170E.YLSVAPFA------DYLDS..IYFNRF----
Q567A3_DANRE/57-174V.HLEAKALT------GFKDS..MYFLRY----
A8WU05_CAEBR/114-226R.LLENDQFP------RFRRS..ELYLQY----
Q2I697_EISFO/45-169S.TLRGELFE------KFLES..EKFTRF----
O17589_CAEEL/287-406T.LMAKDSYP------RFVRS..QIYKAV----
RK_BOVIN/57-171A.HLGQAPFQ------EFLDS..LYFLRF----
Q28DL5_XENTR/52-170E.FLSGSPFR------EFQDS..MYFDRF----
Q7SXC7_DANRE/86-202K.LMKMDSYT------RFVRS..PLYQNC----
RGS12_HUMAN/715-831N.LMKFDSYT------RFLKS..PLYQEC----
RGS5_CAEEL/81-204S.LFEYRYFD------EFQNS..VYYKKH----
Q7T2D3_DANRE/65-180T.LMEKDSFG------RFLRS..DQYQEL----
Q5I0R8_XENTR/41-155N.LMKYDSYS------RFLKS..ETFLKL----
GRK2_CAEEL/54-174D.QLRGDIFQ------RFLES..DKFTRF----
Q6TEM0_DANRE/70-184T.LMEKDSYR------RFLRS..RLFLEL----
Q5NUF5_ORYLA/57-174D.YLREAPYV------FFLES..MYLKRF----
RGS11_CAEEL/139-255L.KFPKESHK------KFLED..PLYLDL----
RGS10_CAEEL/135-251L.KLAKKSHK------KFLED..PLYLDL----
SNX12_SCHPO/390-528D.IMQNSDYS------EFVNS..EIYYRF----
Q4V987_DANRE/49-164Y.LMEHNSYP------RFLES..ELYQTL----
RGS9_CAEEL/106-222T.NFPKDSYK------KFLQD..PIYLNL----
A8X817_CAEBR/215-337F.RLHDKYLS------DFLKT..IFYHNY----
Q9P459_SCHCO/373-541R.LMATDSVP------KFIKT..PKFLAM----
Q641H3_XENLA/72-190R.AMEQEAFT------SFLQS..DICKEY----
RGS9_BOVIN/299-413M.LMKKDSYA------RYLKS..PIYKEM----
Q4SML4_TETNG/89-206S.MMEENTYP------LFLKS..DLYLEY----
Q4SSQ1_TETNG/182-297S.LMEKDSYP------RFLRS..DIYHRL----
Q4TC95_TETNG/903-1019T.LMETDSYP------RFLKS..RLYIQL----
RGS18_HUMAN/86-201Q.LMEQDSYT------RFLKS..DIYLDL----
Q59Q05_CANAL/55-176D.NLLISLYR------EFTKSMKQQYDKE----
Q6TLV9_CHICK/85-203T.VMEENAYQ------MFLTS..DIYLEY----
A8WU05_CAEBR/242-360Q.VLRNDPYV------RFLQS..AQYNTL----
Q4SP51_TETNG/52-170E.FLKGKPFT------EFQTS..LFFDKF----
Q6IUG6_LYTVA/91-209E.YMRETSYP------MFLKS..DVYVQY----
Q4SSQ0_TETNG/65-180N.LMKKDSYP------RFLLS..DTYLRL----
FLBA_EMENI/544-685K.LMSSDSVP------KFLRD..PKYSAI----
Q568M8_DANRE/50-165T.LMEKDCYP------RFLKS..TVYQEL----
RGS7_HUMAN/333-447K.LMKSDSYP------RFIRS..SAYQEL----
Q52KZ3_XENLA/50-166D.YLKENTFS------LYKES..KYFSKF----
RGS13_HUMAN/34-149M.HMERDSYP------RFLKS..EMYQKL----
O73685_CHICK/90-204A.HLEGTAWA------PYLSS..PYFGRF----
Q54LD1_DICDI/262-386N.ILNLSMFP------LFMTS..PLYHSA----
Q6DCK4_XENLA/63-178I.LMEKDSYP------RFLKS..PIYNKL----

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window