Sequence alignment for CL0273

PF02940

CET1_ASHGO/207-426DDDLTKSVQDWVYATLLS............IPPEQRQYVEVEMKFGILMDRS...SDSQRVTPPVSSQTVYMEA....DA
CET1_DEBHA/192-431PPSVTRTIAEWIYANFTE............IPDDQRKYVELELKFGTIIDKR....AGHRIDINVSTECIFTDN...SNT
CET1_CRYNJ/151-362RNPFTSVVGDFIM.................NAAMGHSNVEIELKLGTFMTPSMPGQQPRRINMPTLSEMIIPHD..YPNG
Q4N969_THEPA/58-291NNHFIKSGYNMNSGS...............VFSKPECQLEVEVRLGFIQNIR....SEHRFTLPVTTDTLLASR...APV
Q4XX79_PLACH/19-339IDKITYELSQNIILAFDNN.........EHIKRSKDVQIEIEARIGLVVDKN.....KHRLKLPIYTDAIVENN....FS
Q7S0G4_NEUCR/767-1020QDTMAKVMADFFFHYIVLNEN......MGEIQSRG.IQFEIEAKFGELIDRN....TNQRIDLGVLSPAILKED..DYVY
Q2GQC7_CHAGB/526-765NSTLVKSKA.........AA........SSLRSK........AKLGMLVDKS....TNQRVELPVQSECVLSDN..GNWL
CTL1_YEAST/60-278ATEFHKHVCKLAWKYLAC............IDKSSISHIEIEMKFGVITDKR....THRRM.TPHNKPFIVQNR....NG
Q6FW21_CANGA/6-218YDEFVGFLGKWVTQEYKK............IPLECYQQVEIEAKFGRINSKS......NSTEFKESKKIIVLNN....DY
A0A0D1DYL2_USTMA/18-219LDDFVTIVGDWIY.................TKGRGRSNLEIEAKIGQIISQE....TGERIHLPVRNETIVDLS....HT
CET1_SCHPO/54-263VPDTTKVISNFLTHY...............LITEPVEHVEIEAKLGTLIDLE....TQNRFEFPVMNETILNPEF.NLRT
CET1_KLULA/281-505EDDLTKSVQDWIYATLIA............VEPELRQFIEVEMKYGLIIDPS....TSNRVNPPVSSQCVFTDL....DS
CET1_CANAL/260-477PSSITRKIAEWVYANFSN............VEEKSKRNVELELKFGKIIDKR....SGNRIDLNVVTECIFTDH...SSV
Q2UGU4_ASPOR/464-711HEEVTKTVCDFLFQHVVMRNDATAAPAGATATGQG.AMIEVEAKLGQLVDMD....RGERLLLPISTEGIVNKENTRLRT
Q5BCN3_EMENI/479-724FEEITKTICDFLFQHVVLRNDAIAGPPGATAQGQG.AIVEVEAKLGHIIDLD....RGERLRLPIMTESIITRE..RIRT
CET1_CANGA/331-550DDDLTKSVQDWVYATLYS............IDPDLRPFIELEMKFGVLLESK....SPDRVNPPVSSQAVYTDM....DA
CET1_YARLI/144-345FESVTRTVTSWLHAHLST............MSPEQLQTVELEAKIGTIQHKKA.GADRARLDLPIVTEAVVNQQYVQAQC
CET1_YEAST/279-497.DDLTKSVQDWVYATIYS............IAPELRSFIELEMKFGVIIDAK....GPDRVNPPVSSQCVFTEL....DA

PF01928

A9CGR0_AGRFC/2-143-----------------------------------AKEIERKFLVA.............GGEWRDEVTHSMAFR----QA
THTPA_MOUSE/5-192-----------------------------------LIEVERKFAP.....GPDTEER..LQELGATLEHRVTFR----DT
THTPA_BOVIN/5-179-----------------------------------LIEVERKFVPGPSTE.......ERLQELGGTLEHRVTFR----DS
Q9K901_BACHD/4-186-----------------------------------EIEIERKTLVS.KETFKRL.....ISQLHIGEGDFKLQR----NH
Q9A2N4_CAUCR/20-204-----------------------------------DHEIELKFLIP.PEAAEAIL......DVLDGEGAVRQLD----AT
Q8TIU7_METAC/1-167-----------------------------------MIEVEVKVRA.....DHS.KIRPLLEKIGANKIGVEEQS----DT
Q8XKP2_CLOPE/1-169-----------------------------------MKELETRIIDIDVEKLR.....ETLNKLGAKNVKRENQT----ND
O59483_PYRHO/1-170-----------------------------------MYEVELKGYA....N..D.EIFEKVRET.FEFMRKEIHE----DI
O58740_PYRHO/1-159-----------------------------------M.EIEVKFRV....NFED..IKRKIEGLGAKFFGIEEQE----DV
Q8TX10_METKA/1-172-----------------------------------MYEVEVKVKL....KNPE.DVRKRLEEL.GEKVRTVRQR----DL
Q55960_SYNY3/2-142-----------------------------------AIEIERKFLVK.............DDRWRDLAQGYL.YR----QG
Q8XVE5_RALSO/2-212-----------------------------------AREIELKLAVP.AGAHDALAGW...LDAHAQPAGSVALA----NV
Q8ZYD0_PYRAE/1-164-----------------------------------MLEVEVKYRA....D.LS.LVKNRLQHLGFSPVSVVYEE----DV
UCKD_DICDI/290-454-----------------------------------EPVYVCKAKYDNNKQFFDQFLS.....SLNVVPVKKNFS----DM
Q8Y8D9_LISMO/4-186-----------------------------------ELEIEFRNLLT.KEEYDTL.....IENFRVKEDDFFEQT----NY
Q8U2H2_PYRFU/1-159-----------------------------------M.EVEIKFKI....KLED..FLHTLNTFNPEFVRYEEQE----DV
Q980N7_SULSO/1-167-----------------------------------MIEKEVKIVV....EYPSLEELRESLGKDMKLLDVEKQE----DV
O28291_ARCFU/1-161-----------------------------------M.EVEAKFPYREGVEEKVKEIA........ELIIEKFEH----DI
Q8TUI3_METAC/18-218-----------------------------------NMEIESKFLVPEEIDFKALENLSKLASYTISEAQIQVIE----DT
A0A0E0VMT2_STAA5/4-186-----------------------------------NHEIEFKQMIT.ASIYNKL.....QEKY.FKDSVLFKQI----NY
Y240_METJA/1-169-----------------------------------MIEVEIKVKI....DDKN.KVVEQLKKLGFKFIKKKFQE----DI
Q9KPD2_VIBCH/2-197-----------------------------------ETEIELKFFVS.PDFSTILRAK..ISETKVLQHSCRELG----NT
Q9PAY8_XYLFA/2-149-----------------------------------AIEIERKFLVV.............GEGWRAAAHRVIPMT----QG
TTM3_ARATH/1-202-----------------------------------M.EVEVKLRLLTAAAHLRLTTL.....LTPYHLKTLHQR----NT
Q9HQ74_HALSA/1-195-----------------------------------MYEVEVKVPG....EYET..VRAALADVDAAEHTTVAQA----DT
CYAB_AERHY/9-174-----------------------------------RFEVEFKYRLS.DVDAFTCALA..ALNPEVMLEDNQ.EQ----DS
YJBK_BACSU/4-183-----------------------------------EIEIEFKNMLT.KQEFKNI.....ASALQLTEKDFTDQK----NH
Q9CP17_PASMU/2-195-----------------------------------GNEVELKLAVT.PKFADLLHQE..LTNFRILAHNTIFLA----NT
Q8S3R9_ORYSJ/242-398-----------------------------------NPMYILKSPRTITPTDIKVALG......EDHTESIEETY----DI
Q9C9B9_ARATH/248-404-----------------------------------NPTYILKSSKAVTPEQMKAALS......EDFKERTEETY----DI
O27666_METTH/1-168-----------------------------------MIEVEVKAKI....HDRD.EMVDRILSVGGVHVSDEEQH----DL
Q98DQ9_RHILO/2-143-----------------------------------GKEVERKFLVS.............STAWRGLVEADIRIL----QF
Q8DPU3_STRR6/3-183-----------------------------------HLEIELKTLLK.KDEYNRL.......KDQFTGVTPVLQT----NY
Q92LX7_RHIME/2-143-----------------------------------AKEIERKFLVA.............TDGWRQHADKGIRLR----QA
H8FIE5_XANCI/2-149-----------------------------------PTEIERKFLVT.............GDGWRDAAHAVIPMA----QG
Q8YN76_NOSS1/2-141-----------------------------------AQEIERKFLVN.............GDDWRQLAEGSA.YR----QG
Q9HTY1_PSEAE/2-201-----------------------------------QKETEIKLRVS.RATLEALQEHPLLKKRNKSGWERRELY----NQ
Q9CIJ7_LACLA/4-189-----------------------------------NLEIEYKSLLS.LAEYDQL.......KKLFTHVTPVRQT----NH
Q9C664_ARATH/248-404-----------------------------------SPTYILKSRKEVSVDQIKAVLS......DGHTETKEETY----DI
Q9FBV9_STRCO/159-301-----------------------------------LAEMVRRLL.............RWPRGKRGLRSCPRVIT----DR
Q8XZK6_RALSO/2-163-----------------------------------ARNVEIKARVRDAAALS.....ARAAALTDAGPEHIEQD----DT
Q975X8_SULTO/3-168-----------------------------------HIEREIKIKL....ISPNIEELEKILNIKYKLFNEEHQI----DI
A0A0C9FAX8_SALTM/2-196-----------------------------------AQEIELKFIVN.HDAVDALRNH..LHTLGGEHHAPSQLL----NI
A0A0E1EN75_STRPY/3-183-----------------------------------NLEIEYKTLLT.KNEYNRL.......LSQMKHVTPVTQT----NY
Q9W3U9_DROME/10-178-----------------------------------QRNVEVKARIPGGSEGFEQRLILARNLSGSQDAQLIEQR----DV
3PASE_HAEIN/6-197-----------------------------------LQEIELKLAIS.PQIGIELPQY..LAKFTILEHQNLFLG----NT
Q982E5_RHILO/18-205-----------------------------------MQETELKLELS.QSGAGSLLRK....NPFGSSPTILQQR----SI
Q20034_CAEEL/2-168-----------------------------------SRNVEIKAKV....QNLD.ETVRRAVEISGKQPTILKQH----DI
Q9RK66_STRCO/5-197-----------------------------------KRETERKYEPPAGGLAGLPDLTGVGPVASVTAAGPEELD----AV
Q9V028_PYRAB/1-158-----------------------------------M.EIEIKFRV....S.ED..IKERLESLNAKFVGLEVQE----DV
Q97LB2_CLOAB/1-169-----------------------------------MKEAETRIIDIDVENIR.....TILKSVNAINIKKENQV----ND

PF02940

CET1_ASHGO/207-426RMKPD---VDERVFVELN-RYVKGIS......................................................
CET1_DEBHA/192-431YFDMG---VHEVGWNDMC-KFLDDLEKSYQDE................................................
CET1_CRYNJ/151-362PFVST---INHLHHRTLN-ELLNRAVE.....................................................
Q4N969_THEPA/58-291KFVPG---VTEDQYNAAR-NFLIETS......................................................
Q4XX79_PLACH/19-339DFQSG---VDKDSFQYLL-NYLHNMTRRNNTQPCKSNNDTNLNDNNKEGSINLNSTNKNDISSIGDSTNNGIDELGKKKN
Q7S0G4_NEUCR/767-1020PFRSI---MTEAQHRSYN-EFLNH.QVVVSK.................................................
Q2GQC7_CHAGB/526-765GFRSS---MTEVQHKSFN-GFLNF.LVQQTHP................................................
CTL1_YEAST/60-278RLVSN---VPEQMFSSFQ-ELLRSKSE.....................................................
Q6FW21_CANGA/6-218HMIPR---ISKFDFDRLR-NKYINTK......................................................
A0A0D1DYL2_USTMA/18-219RFESQ---MSASQHAHYN-RILNSLALR....................................................
CET1_SCHPO/54-263RFESD---MTASEHKYLN-EFLNQAFR.....................................................
CET1_KLULA/281-505TMKPD---VDERVFDEFN-RYIKNLS......................................................
CET1_CANAL/260-477FFDMQ---VEEVAWKEIT-KFLDELEK.....................................................
Q2UGU4_ASPOR/464-711AFEST---MTIAQHQAMN-NFLNE.AVKM...................................................
Q5BCN3_EMENI/479-724SFESN---MTLAQHRAMN-NFLNE.AVKN...................................................
CET1_CANGA/331-550HLTPN---VDETVFKELS-KYIQSLS......................................................
CET1_YARLI/144-345SFSSQ---LPESLLEEAK-RILDAAD......................................................
CET1_YEAST/279-497HLTPN---IDASLFKELS-KYIRGIS......................................................

PF01928

A9CGR0_AGRFC/2-143YVASL.....EN.......RSVRVR.-------------------------------------.................
THTPA_MOUSE/5-192YYDTS.....ELSLMLSD.HWLRQR.-------------------------------------.................
THTPA_BOVIN/5-179YYDTP.....ELSLMRAD.YWLRQR.-------------------------------------.................
Q9K901_BACHD/4-186YFETD.....DFQLKKQS.SALRIR.-------------------------------------.................
Q9A2N4_CAUCR/20-204YYDTA.....DHALRRAG.FGLRVR.-------------------------------------.................
Q8TIU7_METAC/1-167YFSAP.....YRDFANTD.EALRIR.-------------------------------------.................
Q8XKP2_CLOPE/1-169IFDFP.....DRKLLDKK.GYARIRT-------------------------------------V................
O59483_PYRHO/1-170YYQHP.....CRDFSKTD.EALRIRI-------------------------------------.................
O58740_PYRHO/1-159YFELP.....SPKL.......LRVR.-------------------------------------.................
Q8TX10_METKA/1-172YYQHP.....CRDFAETD.EALRLR.-------------------------------------.................
Q55960_SYNY3/2-142YIATK.....DL.......TTVRVR.-------------------------------------.................
Q8XVE5_RALSO/2-212YYDTP.....EQALARNR.AALRVR.-------------------------------------.................
Q8ZYD0_PYRAE/1-164YFQHP.....CRDFSATD.EALRVR.-------------------------------------.................
UCKD_DICDI/290-454YLYPPKYGVDGISQADKR.NWIRIR.-------------------------------------.................
Q8Y8D9_LISMO/4-186YLDTT.....NFGLKERH.SALRIR.-------------------------------------.................
Q8U2H2_PYRFU/1-159YFEVP.....RPKL.......LRIR.-------------------------------------.................
Q980N7_SULSO/1-167YFNYV.....YRNFKITD.EAVRIR.-------------------------------------.................
O28291_ARCFU/1-161YFSHP.....CRDFASSD.EALRIR.-------------------------------------.................
Q8TUI3_METAC/18-218FLDTK.....NKDIMAAG.YYLRVR.-------------------------------------.................
A0A0E0VMT2_STAA5/4-186YIDTP.....DFKLKEHR.SALRIR.-------------------------------------.................
Y240_METJA/1-169YFNGI.....DRDFRETD.EALRIR.-------------------------------------.................
Q9KPD2_VIBCH/2-197YFDTP.....DNWLRQHD.IGLRIR.-------------------------------------.................
Q9PAY8_XYLFA/2-149YINDQ.....KALGKGTQKASVRVR.-------------------------------------.................
TTM3_ARATH/1-202FFDTP.....KNDLSLRR.AVLRLR.-------------------------------------.................
Q9HQ74_HALSA/1-195YYDAP.....HRAFEQTD.EAFRLRR-------------------------------------VATAARGFERGDDLTAD
CYAB_AERHY/9-174YFDTP.....EHSLAAEG.KSLVIR.-------------------------------------.................
YJBK_BACSU/4-183YFDTD.....SFALKQKH.AALRIR.-------------------------------------.................
Q9CP17_PASMU/2-195YYDTA.....DRVLAKHK.MGLRVR.-------------------------------------.................
Q8S3R9_ORYSJ/242-398YLLPP.....GEDPESCQ.SYLRMR.-------------------------------------.................
Q9C9B9_ARATH/248-404YLLPP.....GEDPEACQ.SYLRMR.-------------------------------------.................
O27666_METTH/1-168YFNAP.....HRDFARTD.EALRIR.-------------------------------------.................
Q98DQ9_RHILO/2-143YLATA.....PG.......RTVRIR.-------------------------------------.................
Q8DPU3_STRR6/3-183YIDTP.....DFELREKK.VAMRIR.-------------------------------------.................
Q92LX7_RHIME/2-143YVVTM.....ED.......RSVRVR.-------------------------------------.................
H8FIE5_XANCI/2-149YINDQ.....AALRSGTQHASVRVR.-------------------------------------.................
Q8YN76_NOSS1/2-141YIPSQ.....G........ATVRIR.-------------------------------------.................
Q9HTY1_PSEAE/2-201YYDTP.....GRELARAK.VALRMR.-------------------------------------.................
Q9CIJ7_LACLA/4-189YLDSK.....DFKLRKKK.LALRIR.-------------------------------------.................
Q9C664_ARATH/248-404YLLPP.....GEDPESCQ.SYLRMR.-------------------------------------.................
Q9FBV9_STRCO/159-301YVNGT.....RLRLRRAD........-------------------------------------.................
Q8XZK6_RALSO/2-163FFACA.............HGRLKLR.-------------------------------------.................
Q975X8_SULTO/3-168YYNSP.....VRDFRKTD.EALRLR.-------------------------------------.................
A0A0C9FAX8_SALTM/2-196YFETP.....DNWLRRHD.MGLRIR.-------------------------------------.................
A0A0E1EN75_STRPY/3-183YIDTK.....AFDLKANK.MSLRIR.-------------------------------------.................
Q9W3U9_DROME/10-178FFESP............LGGRLKLR.-------------------------------------.................
3PASE_HAEIN/6-197YYDYP.....DHFLAKQK.MGLRIR.-------------------------------------.................
Q982E5_RHILO/18-205YFDTP.....GWDLSKRS.LSLRIR.-------------------------------------.................
Q20034_CAEEL/2-168FYESP.....N........GRLKMRS-------------------------------------V................
Q9RK66_STRCO/5-197YHDTV.....DLRLAGSS.ATLRRR.-------------------------------------.................
Q9V028_PYRAB/1-158YFDVP.....LPKL.......LRVR.-------------------------------------.................
Q97LB2_CLOAB/1-169IYDFE.....NGKLLDNK.GYARIRI-------------------------------------V................

PF02940

CET1_ASHGO/207-426........ELTENTGKFNIIESHNKDEMYRAGI................NTQRPRFLRMSK...DVK...TGRVGEF..-
CET1_DEBHA/192-431.LRRSPQANSNSPKRKFNILESDITDNFYQITS................RNEQPKSIRISK...DNL..LDPPRYTA..-
CET1_CRYNJ/151-362.......SQSTHPTGRLYFSRSKLADSFYDHS..................EHGHGKVRVSR...DMD...NGHVVQA..-
Q4N969_THEPA/58-291.......EEDDPKNEWTTCLNSCTINRFFEIQ.................GYDELVRISVSN...DSNSPVNRQQKEPVD-
Q4XX79_PLACH/19-339NNNNFMNEKENSVYEFVALKAYKSVDKYYILK..................NENNSRIRVTTNMDESENEKNQSMTKS..-
Q7S0G4_NEUCR/767-1020..NPKSNIGRERPRVPISYEHKYEIDRFYAIPPQIRDKHLPVTVANLLASKGRDAKVRVSY...KENKDGSREQIAK..-
Q2GQC7_CHAGB/526-765.GNKAANAALPRPRLPIDYRHRREVDKFFELPASVRDRLLPVCVAKPIAAKGHSVKVRVSY...DQK...TNKVLDK..-
CTL1_YEAST/60-278.......NPSKCAPRVVKQVQKYTKDSIYNCNNA..............SKVGKLTSWRCSE...DLR...NKELKLT..-
Q6FW21_CANGA/6-218...............FNKLKKSSTKNSNNLSL..................SDYSVSTSLPAPLDKGRLRLNNETAKLDS-
A0A0D1DYL2_USTMA/18-219......SSEGSYTGAKISYHRRKEIDYFH.....................PAPKGKVRVTR...DA....ETLAIKPDG-
CET1_SCHPO/54-263.......DSQKPGRLPFAYKHTKQVDLFYETE..................DNSRDKIRVSK...NQS...DNQVLAC..-
CET1_KLULA/281-505........ELNENMGKFNIIDSHASDLSYRVRT................HTERPKFLRMTR...DVN...TGRIAQF..-
CET1_CANAL/260-477......SFQEGKKGRKFKTLESDNTDSFYQLGR................KGEHPKRIRVTK...DNL..LSPPRLVA..-
Q2UGU4_ASPOR/464-711.....SMPQANPGRIPLSYTHKKERDTFYEISPSELPP.....VIRQNLNPRHKPKVRVTL...DQR...TGEVLAK..-
Q5BCN3_EMENI/479-724.....SMPQANPKRIPLSYAHKKERDSFYEVSPAELPP.....VIRQNLNPRHKPKVRVTV...DQR...TGEVLAK..-
CET1_CANGA/331-550........EITENAGKFNVIEAQTKDAVYRVGT................STQRPRFLRMSS...DVK...TGRIGAF..-
CET1_YARLI/144-345............PKFIKSTEHTIHRDEIYEG...................QQDKGNLRITR...DDV...TGRQVAK..-
CET1_YEAST/279-497........EVTENTGKFSIIESQTRDSVYRVGL................STQRPRFLRMST...DIK...TGRVGQF..-

PF01928

A9CGR0_AGRFC/2-143.......IVDGRDAT.LTIKIGA............SALV.RDEYEYSIP........................LKDAEE.
THTPA_MOUSE/5-192.........EGSGWE...LKCPGVTG.......VSGPHN...EYVEVTS...............EAAI..VAQLFELLGS
THTPA_BOVIN/5-179.........EGSGWE...LKCPGAAG.......VSGPHT...EYTELTAEPSIVAQLCEVLGAEVPGAGGVAAVLGPLG.
Q9K901_BACHD/4-186.......EK.EAIFT.FTLKQPHPAG....LLETNQTLS.KQEAKLALESAH........FPSGEVMD..ALRDLSIPIS
Q9A2N4_CAUCR/20-204.......DG.EGGRK.QTLKSA..........SAGGVFS.RGEWEETIAGPTPDR...DALARTPVGE.....MLAEAA.
Q8TIU7_METAC/1-167.........SLGGQAVLTYKGPKLDKVSKTREELETPV..........................DEAT..TAKIFRALG.
Q8XKP2_CLOPE/1-169.....EDLINNKTVYFMTTKKMLSQDKFKVMEENETIIE.........................DGAM..GKNIFKSLG.
O59483_PYRHO/1-170......KRFNGHNEVFLTYKGPKIDEKSKTRLEIEVEIQ........................EDVDK..YFELLDRLG.
O58740_PYRHO/1-159.......KINNTGKSYITYKEI.LDKRNEEFYELEFEVQ.........................DPEG..AIELFKRLG.
Q8TX10_METKA/1-172.........CSDDKVALTYKGPKVGREK.SRVELEVVVD.........................DFET..TDAILRHLG.
Q55960_SYNY3/2-142.......TI.GNRAY.LTIKGKN............TGMA.RLEFEYEIP........................AVDANQI
Q8XVE5_RALSO/2-212.......RH.GNQWL.QTLKTAGDGG....QGGHAGLSA.RHEWEVPLDGDALSV...EAFAARDAAE..AADFVRPHAD
Q8ZYD0_PYRAE/1-164.........ISEGRVTVTYKGPRMGAGAKTRLEVSAQAS...........................GE..VVELLNRLG.
UCKD_DICDI/290-454........RSEHGQFNITFYNEMMDGAVNTRPSLNFEIS................................VKTLGGLL.
Q8Y8D9_LISMO/4-186.......QL.ETQYQ.LTLKTPEARG....LMETTQILG.EDQASAIISGAN........IPVGPVRD..TLKELGINHE
Q8U2H2_PYRFU/1-159.......GVHNLKKYYLTFKEI.LDENNEEFYEVEFEIG.........................DFEK..AVEVFKRLG.
Q980N7_SULSO/1-167.........INNKGIELTYKGPKLHSSLKAREEISITVN.........................DLNK..TIELLRKIG.
O28291_ARCFU/1-161.........QDVEGITLTYKGPKVDVETKSREEVKLKVE.........................NFEA..AKQILEKLG.
Q8TUI3_METAC/18-218.......KAAGEKGKWVTIKSLG........GFEGGTHR.REEYASFLPEGLSVL...ECPSLRIRDM..IFDFTSGLD.
A0A0E0VMT2_STAA5/4-186.......VK.DNQYE.MTLKTPAKVG....LLEYNYIVDIKPEMNLIISNDN........LPDDIRQI..IVEQFGVKDT
Y240_METJA/1-169.........DEDGNFFVTYKGPKIDKISKTREEIEVKIE.........................DKEK..MRQIFKKLG.
Q9KPD2_VIBCH/2-197.......RF.DEVYV.QTVKTAG........RVVAGLHQ.RPEFNAEHHSNEPDL...SLHPADIWPQ..GK.ELTQLQA
Q9PAY8_XYLFA/2-149.......IQ.EDAAY.LNLKSAA............FGHT.RQEFEYAIP........................LSDARDL
TTM3_ARATH/1-202.................FLQNAAVSAASPSPPRCIVSLKAKPTLANGISRVEEDE...EEIEYWIGKE..CVESPAKLSD
Q9HQ74_HALSA/1-195IDAVLSGPARADGESRVTYKGPLVEAESKTREEFETAVG.........................DDAQ..MAAIIEQLG.
CYAB_AERHY/9-174.......TMQPSGIQLWIVKGPEADRC....EAVNIT...........................DADK..AASMLRTLG.
YJBK_BACSU/4-183.......RK.NGKYV.LTLKEPADVG....LLETHQQLS.EVS...DLAGFS........VPEGPVKD..QLHKLQIDTD
Q9CP17_PASMU/2-195.......QE.NQQYT.LTLKTDG........EVHGGLHI.RPEYNVTLPDAQPNI...SLLVEKYALT.....LPNYAQW
Q8S3R9_ORYSJ/242-398.........NREGKYNLMFEEWVTDNPFIISPRITFEVS................................VRLLGGLM.
Q9C9B9_ARATH/248-404.........NRDGKYNLMFEEWVTDRPFIISPRITFEVS................................VRLLGGLM.
O27666_METTH/1-168.........RSGGRTFITYKGPKIDEESKTRKELETEVA.........................DPGT..AAEILESLG.
Q98DQ9_RHILO/2-143.......ISDGASAE.LTLKFGS............GVRE.RDEFEYPIP........................LADALEM
Q8DPU3_STRR6/3-183.......TF.EDWAE.LTLKVPQSVG....NMEYNQKLQ.LKDAENYLSKEE........LPQGLVLD..ELAKHGIQSK
Q92LX7_RHIME/2-143.......IHGNKRAR.LTIKIGK............SALV.RNEYEYDLP........................MNDAREL
H8FIE5_XANCI/2-149.......IQ.GESAF.LNLKSRE............VGHT.RQEFEYPIP........................LADARAL
Q8YN76_NOSS1/2-141.......VV.GNQGY.LTIKGPT............VNFS.RSEFEYLIP........................LADAQEM
Q9HTY1_PSEAE/2-201.......RD.GEQYI.QTLKSRG........QSVAGLSE.RNEWDWYLEKNKLDL...KKLDDKCWPA...A.LKDLDKK
Q9CIJ7_LACLA/4-189.......TF.DKSAE.MTLKVPQEVG....NIEYNIDLS.LEEAQQLLGERNIVC...GETDLSEICE..LLTARDINLE
Q9C664_ARATH/248-404.........NKDGKYSLMFEEWVTDTPFVISPRITFEVS................................VRLLGGLM.
Q9FBV9_STRCO/159-301.......FADGRCELKLTQKVPVLLSGAIQGLITNTYLS.PAEYDVLASLPATML...SKTRFSVPPL..GVDVFDGRL.
Q8XZK6_RALSO/2-163.......RFSAEHGHLIHYFRADVAGPRLSDFHIVPT...........................DAPD..ALRETLTAA.
Q975X8_SULTO/3-168.........LVNNEVELTYKGPKLSSESKSREEITVKID.........................NLDS..MDLILQRLG.
A0A0C9FAX8_SALTM/2-196.......GE.NGRYE.MTMKIAG........RVTGGLHQ.RPEYNVALSEPVLDL...TQLPAEVWPD..GN.LPDGLAS
A0A0E1EN75_STRPY/3-183.......TF.ANSAE.LTLKVPEKVG....NREYNVPLF.LEQAKDMIKHGN........LPESTALD..IIISKGIKPS
Q9W3U9_DROME/10-178......YLQTPSRSQLVYYDRPDVAGPKLSKFNKTEV...........................DEPE..VLEKILSQS.
3PASE_HAEIN/6-197.......QE.DQELT.LTLKTNG........KVVSGLHS.RPEYNLPLIEKETPT...NAQLRGLYPF..EQ.LPSST..
Q982E5_RHILO/18-205.......QS.GNEKI.QTLKAAD........GTAAGSFT.RQEWERPVAGDTP......IVDDPQIRD.....LRAGAGP
Q20034_CAEEL/2-168....EENGV.AHTEL.IWYDRSDVAGPKLSNFNKFDVPS.........................EVLD..AL.KLSLQSS
Q9RK66_STRCO/5-197.........TGGPDAGWHLKLPLTGDT.............REEVWAPLSDDV.........PAALREL..VLSRTRGAP.
Q9V028_PYRAB/1-158.......RISNLGKSYITYKEI.MDRNNEEFYEVEFEVS.........................DFNL..AIEVFKRLG.
Q97LB2_CLOAB/1-169.....ENMLDKKNHYFMTVKKMLSQEKFKVMDEHEIEIS.........................DPSE..GEEIFKALG.

PF02940

CET1_ASHGO/207-426--------------------------.IEKRRISQLLL----FSPKDSY...............................
CET1_DEBHA/192-431--------------------------.INKQRLSSLFI----HNPSSMY...............................
CET1_CRYNJ/151-362--------------------------.VEKRRIADLNV----YCPGMAY...............................
Q4N969_THEPA/58-291--------------------------AIRKVNLLTWNI----SSGSTEEPSEESEE........................
Q4XX79_PLACH/19-339--------------------------.LHKENINTWNV----YLGNNKDYFDDDDEEEDNEDDETTKNKYNKNMNKQNNS
Q7S0G4_NEUCR/767-1020--------------------------.IVKARLKDLSI----HFPEHRL...............................
Q2GQC7_CHAGB/526-765--------------------------.IIKARIADLSM----HFPDLPL...............................
CTL1_YEAST/60-278--------------------------YIKKVRVKDFLI----RYPQSSL...............................
Q6FW21_CANGA/6-218--------------------------LIHKEKISNILL----SIPNSTY...............................
A0A0D1DYL2_USTMA/18-219--------------------------IIQKQRIADLDI----YCPYRLF...............................
CET1_SCHPO/54-263--------------------------.VKKRRVADLFL----YCPNDAF...............................
CET1_KLULA/281-505--------------------------.IEKRKISQILL----YSPKDSY...............................
CET1_CANAL/260-477--------------------------.IQKERVADLYI----HNPGSLF...............................
Q2UGU4_ASPOR/464-711--------------------------.IVKCRIADLDV----YSPRTCV...............................
Q5BCN3_EMENI/479-724--------------------------.IVKCRVADLDI----HSPLTAV...............................
CET1_CANGA/331-550--------------------------.IEKRHISQLLI----YSPKDSY...............................
CET1_YARLI/144-345--------------------------.IRKKAIAHIMI----HCPTDPF...............................
CET1_YEAST/279-497--------------------------.IEKRHVAQLLL----YSPKDSY...............................

PF01928

A9CGR0_AGRFC/2-143...................LMASA..PGVVIEKTRHTV....DH.....-------------------------------
THTPA_MOUSE/5-192GEQKPAG....VAAVLGSLKLQEV..ASFITTRSSWKLALSGAHGQ...-------------------------------
THTPA_BOVIN/5-179....................LQLV..ASFVTKRSAWKLVLSGADGE...-------------------------------
Q9K901_BACHD/4-186...................QLKHI..GTLSTSRAEISY....EQ.....-------------------------------
Q9A2N4_CAUCR/20-204....................LAPV..FTARVERTIRMV....AAGE...-------------------------------
Q8TIU7_METAC/1-167....................FSEA..GAVRKKREIFRA....GE.....-------------------------------
Q8XKP2_CLOPE/1-169....................LELF..ETIKKYRESYKY....KD.....-------------------------------
O59483_PYRHO/1-170....................FKEV..LKVVKTREKYYV...EKG.....-------------------------------
O58740_PYRHO/1-159....................FKVQ..GVVKKRRWIYKL....NN.....-------------------------------
Q8TX10_METKA/1-172....................FEPLEHAEVKKLRTVYTLEVNGEK.....-------------------------------
Q55960_SYNY3/2-142...................LTELC..SPPLIEKYRYCL....DY.....-------------------------------
Q8XVE5_RALSO/2-212...................RLVPL..FRTDFTRRLWHT....A.AD...-------------------------------
Q8ZYD0_PYRAE/1-164....................FKAV..AVIKKRREYYRN....GD.....-------------------------------
UCKD_DICDI/290-454....................SLGY..QIGAILNRTVEVWYDKNG.....-------------------------------
Q8Y8D9_LISMO/4-186...................DLQVF..GSLKTIRAEKDY....KK.....-------------------------------
Q8U2H2_PYRFU/1-159....................FKIQ..ATIKKKRWVYKL....NG.....-------------------------------
Q980N7_SULSO/1-167....................FYPV..ITIKKTRINYLD....KS.....-------------------------------
O28291_ARCFU/1-161....................FRAV..AEVKKLRRIYGL....CE.....-------------------------------
Q8TUI3_METAC/18-218....................LTPL..ITLKQKRIIRQL....NLEK...-------------------------------
A0A0E0VMT2_STAA5/4-186...................TLSIL..GALTTYRQETKY....KG.....-------------------------------
Y240_METJA/1-169....................FKEV..PPIRKIREIYKK....ED.....-------------------------------
Q9KPD2_VIBCH/2-197...................ELMPL..FSTNFTREQWLI....SMAD...-------------------------------
Q9PAY8_XYLFA/2-149...................L.TLC..VGGLIDKRRHLV....RY.....-------------------------------
TTM3_ARATH/1-202IGSRVLKRVKEEYGFNDFLGFVCL..GGFENVRNVYEW....RG.....-------------------------------
Q9HQ74_HALSA/1-195....................FESA..AVVRKLRTKHHF....EG.....-------------------------------
CYAB_AERHY/9-174....................YRQV..LAISKRRSIYFV....GP.....-------------------------------
YJBK_BACSU/4-183...................AIQYF..GSLATNRAEKET....EK.....-------------------------------
Q9CP17_PASMU/2-195...................ELKPV..FSTDFERESWLI......ECG.N-------------------------------
Q8S3R9_ORYSJ/242-398....................ALGY..TIAAILKRKSRVFSDGK......-------------------------------
Q9C9B9_ARATH/248-404....................ALGY..TIATILKRKSHIFDDDK......-------------------------------
O27666_METTH/1-168....................FRMV..REVVKERRIYSV....GE.....-------------------------------
Q98DQ9_RHILO/2-143...................L.DFA..IGRVIEKTRHHV....RH.....-------------------------------
Q8DPU3_STRR6/3-183...................NWQVL..GCLTTLRYEMKT....AI.....-------------------------------
Q92LX7_RHIME/2-143...................L.TQA..IGIVIEKRRFRI....PH.....-------------------------------
H8FIE5_XANCI/2-149...................L.ALC..VGGLIDKRRHLV....AY.....-------------------------------
Q8YN76_NOSS1/2-141...................LDTLC..DRPFIEKIRYKI....EV.....-------------------------------
Q9HTY1_PSEAE/2-201...................QLKPI..FSTDFVRQRAEI....AWGRGKA-------------------------------
Q9CIJ7_LACLA/4-189...................EITLI..GSLTTIRYEQHL....PI.....-------------------------------
Q9C664_ARATH/248-404....................ALGY..TIATILKRNSHVFATDK......-------------------------------
Q9FBV9_STRCO/159-301.................................................-------------------------------
Q8XZK6_RALSO/2-163....................LGAT..GRVIKTRRLYIA....GQ.....-------------------------------
Q975X8_SULTO/3-168....................FIKV..LKIEKIRKNYKI....NN.....-------------------------------
A0A0C9FAX8_SALTM/2-196...................SVQPL..FSTDFYREKWCL....DVDG...-------------------------------
A0A0E1EN75_STRPY/3-183...................ALVTF..GNLTTVRRETVI....PI.....-------------------------------
Q9W3U9_DROME/10-178....................NGVL..GVLAKRRHLFLC....GQ.....-------------------------------
3PASE_HAEIN/6-197....................LQPI..FSTDFNRTFWLV....EFQQ...-------------------------------
Q982E5_RHILO/18-205...................ELAPL..FEVHVKRHRWNV....VDGD...-------------------------------
Q20034_CAEEL/2-168...................M.GVK..GEVKKTRTLVLH....GQ.....-------------------------------
Q9RK66_STRCO/5-197....................LRPV..VRIRSTRAVRRLHDAEGG.....-------------------------------
Q9V028_PYRAB/1-158....................FDVK..ASIKKERLIYKL....GD.....-------------------------------
Q97LB2_CLOAB/1-169....................LVKK..QSIKKYRESYKY....KN.....-------------------------------

PF02940

CET1_ASHGO/207-426...........DVKISINVELPVPEND....PPEKYMGQAPLNSRTKERISYI.HNDSCTRIDITKV.......TNHNKG
CET1_DEBHA/192-431...........DLRLSLSYENPIADNN....IDGIIKKNQPTLTRIKKRNSWT.HRPTVTRFDMTRVLSP.RESKNKSGK
CET1_CRYNJ/151-362...........DFRISVNTETP...........CEVPTGNAKSVRYKDRACYR.HQV..CRVDLTSVF......SSNPRN
Q4N969_THEPA/58-291...FSTGLEGLDYRIAVNLEYKVPLT.......NLPTTSNAKYCRRRLRDSFI.HTESKMRFDLSKV........EDVTE
Q4XX79_PLACH/19-339KNKDNNIDDCLDYRISINLEHTKSIS......KLFLSKITPVYERYKERTSFI.NKYMGIQFDLTKI.............
Q7S0G4_NEUCR/767-1020...........DCRISINLEMPWEGPLEELEAYATSANKGQSPDRRKNRLSYG.HCS..YQFDLTQVV.....ENVSG..
Q2GQC7_CHAGB/526-765...........DCRISVNLEMDWDGTVEDLEKMASSTGRPPIPARMKDRLSYK.HGC..YQIDLTQVT.....QSVAGVT
CTL1_YEAST/60-278...........DAKISISLEVPEYET.......SAAFRNGFILQRTKSRSTYTFNDKMPLHLDLTKV.........TTTR
Q6FW21_CANGA/6-218...........GCKISFNLEIELPKAV....YINTDLDKCYRRHKLGNRISMP.RSK..NTLELFKV.........CTEN
A0A0D1DYL2_USTMA/18-219...........DYRISINVELP...........APEPTSDHVSIREKNRLSYA.HQN..FIVDLTQV...........TL
CET1_SCHPO/54-263...........DIRISISDELPVS.........MPSGNQQPSLTRLKDRVGYV.HQE..IKIDLTKTT.....QNDPV..
CET1_KLULA/281-505...........DTKISISLELPVPEND....PPEKYKNHTPTGHRLKKRTSYI.HNDSCTRFDITRVENKPIRVNNKN.E
CET1_CANAL/260-477...........DLRLSMSLEIPVPQGN....IESIITKNKPEMVREKKRISYT.HPPTITKFDLTRV.............
Q2UGU4_ASPOR/464-711...........DWRISVNLEMSYEGDVS..HLPVVDPGRGRGGERNKDRMSYR.HLA..YQIDLTQVA.....KSEPP..
Q5BCN3_EMENI/479-724...........DWRVSVNLEMNYDGDIS..HLTPADTGRGRASDRNKDRMSYR.HLA..YQVDLTQVA.....RSEPS..
CET1_CANGA/331-550...........DVKLSINLELPVPEND....PPEKYQHQTPVSERTKERVSYI.HNDSCTRFDITKVQ.....NHNKG.I
CET1_YARLI/144-345...........DIRLSLATESP...........TDDVPQGVCRTRRKDRISYL.YDG..FRADLTKV.............
CET1_YEAST/279-497...........DVKISLNLELPVPDND....PPEKYKSQSPISERTKDRVSYI.HNDSCTRIDITKVE.....NHNQN.S

PF01928

A9CGR0_AGRFC/2-143-----------...GGFTWEVDVFEGQY.....RGLVVAEVEMNDEN-------ANPDLPSWLGRE..............
THTPA_MOUSE/5-192-----------EPQLTIDLDSADFG............YAVGEVEAMV-------HEKAEVPAALEK.........IITVS
THTPA_BOVIN/5-179-----------ERLLRVDLDTADFG............YAVGEVEALV-------HKEAEVPAALEK..............
Q9K901_BACHD/4-186-----------...GILCLDHSSYL...........GIEDYEIEFEG-------TSEEHATVTFQE.........ILKTF
Q9A2N4_CAUCR/20-204-----------.TLIEVALDRGELSAGE.....RQATVCELELELKT-------GEPQALFDLART..........LARH
Q8TIU7_METAC/1-167-----------...VIVCLDAVEGL............GEFLEVELDV-------EDEKDLESSREK.........LFEFL
Q8XKP2_CLOPE/1-169-----------...SLIEIDINDPS...........FCPFPYIEIET-------SSEEKLNEILID..............
O59483_PYRHO/1-170-----------...VTITLDEVEGL............GKFIEIETLV-------KEKDEIPEAVEK.........LEKIL
O58740_PYRHO/1-159-----------...VTFELNRVEKA............GDFLDIEVIT-------SNPEE...GKKI.........IWDVA
Q8TX10_METKA/1-172-----------...VVAALDEVEGL............GTFLELECKA-------DDESEVDEKEKL.........LVSIL
Q55960_SYNY3/2-142-----------...QGKTWEVDEFLGDN.....QGLILAEVELSQAD-------EKISLPPWIGKE..............
Q8XVE5_RALSO/2-212-----------GGEIEIALDAGAILVPGT...DAHEAIDELEVEWKP-------AAGNTLDESAIAERLHAWTQTLRTAV
Q8ZYD0_PYRAE/1-164-----------...VLLSLDYVEGL............GEFVEIEKMV-------EEESQIASAIEE.........IRRLA
UCKD_DICDI/290-454-----------...VVITKEYIKEL.............EKHFIQIKG-------HSRREVLDSAEK..............
Q8Y8D9_LISMO/4-186-----------...GLLVFDKNFYG...........SISDFDLEYEV-------SDYDKGKEVFDK.........LLKEY
Q8U2H2_PYRFU/1-159-----------...VTLEVNRVEGI............GDFVDIEVIS-------DSPEE...AKEK.........IWEVA
Q980N7_SULSO/1-167-----------...FIVSLDLVKDL............GQFIEIEAIN-------EISDQ..EIQNY.........TSNFI
O28291_ARCFU/1-161-----------...AIICLDDVEGL............GKFVEIEVEA-------DNIDAKEK.............VFSIA
Q8TUI3_METAC/18-218-----------KLVAEIYLDRVNLKSES.....RKKFYNEFEVELKS-------EGTVKDLEAVRD.........FLLDN
A0A0E0VMT2_STAA5/4-186-----------...DLLVLDKSEYF...........DTTDYELEFEV-------KDYNQGLQKFQS.........LLNEL
Y240_METJA/1-169-----------...IEASIDDVEGL............GLFLELEKSI-------SDINEKDKVLEE.........MMEIL
Q9KPD2_VIBCH/2-197-----------GSQVEVAFDQGLVVAGD.....RQEPICEVELELKS-------GQTDALFTLARQ..........LCEH
Q9PAY8_XYLFA/2-149-----------...AGHLWEVDEFLGDN.....AGLVVAEIELDSAH-------EGFVWPDWLGVE..............
TTM3_ARATH/1-202-----------...VKLEVDETKYD...........FGNCYEIECET-------EEPERVKTMIEE...........FLT
Q9HQ74_HALSA/1-195-----------...FTVLLDAVEDV............GEYVEIETTV-------EAEHAVSGARED.........AYAVL
CYAB_AERHY/9-174-----------...FHVTRDHLEGI............GDFAELAIMT-------DDEALLPDYRQQ.........LQDLA
YJBK_BACSU/4-183-----------...GLIVLDHSRYL...........NKEDYEIEFEA-------ADWHEGRQAFEK.........LLQQF
Q9CP17_PASMU/2-195-----------GTHIEVAFDQGKIVAGE.....KQTPICEVEFELKS-------GLPIDLLRFVQT..........LTLE
Q8S3R9_ORYSJ/242-398-----------...ATVKIDWLEQL.............NRNYIQVQG-------RDRNHVKFVAEK..............
Q9C9B9_ARATH/248-404-----------...VIVKTDWLEQL.............NRTYVQVQG-------KDRTFVKNVADQ..............
O27666_METTH/1-168-----------...FTVSIDTVMGL............GTYLEIERDL-------PDGSDYAGALRE.........IFELY
Q98DQ9_RHILO/2-143-----------...RGYLYEVDVFGGAL.....AGLVVAELETPEDV-------PDEMLPDWLGRE..............
Q8DPU3_STRR6/3-183-----------...GLMALDQSRYF...........DITDYELELEV-------ENHEQGKQDFRQ.........FLEKN
Q92LX7_RHIME/2-143-----------...KGFTWEVDVYEGAL.....EGLTVAEVEMKRET-------DLPNLPAWLGRE..............
H8FIE5_XANCI/2-149-----------...QGHVWEVDEFLGDN.....AGLIVAEIELERPD-------EAFATPEWLGTE..............
Q8YN76_NOSS1/2-141-----------...AGLVWEIDEFAGVN.....QGLILAEVELTDEA-------QQIEIPHWIGTE..............
Q9HTY1_PSEAE/2-201-----------RVVVEAALDLGKVVAGD.....NQEEICELELELRQ-------GDAAALLELAAE..........LAAD
Q9CIJ7_LACLA/4-189-----------...GLAALDKNDYL...........GHTDYELELEV-------DDSKQGKKDFFD.........FLDKN
Q9C664_ARATH/248-404-----------...VFVKIDWLEQL.............NRHYMQVQG-------KDRQLVQSTAEQ..............
Q9FBV9_STRCO/159-301-----------...QGLVLGEAEFT.............TDEEVQAFV-------PPAECVAEVTDD..............
Q8XZK6_RALSO/2-163-----------...TRIHVDAVQGL............GDFVELEVML-------RDDQSEADGTRI.........AHAWM
Q975X8_SULTO/3-168-----------...FTVSLDRVFDL............GDFVEIEGID-------ITDEELINFVNN............FL
A0A0C9FAX8_SALTM/2-196-----------.SRIEIALDLGDVKAGE.....FAEPICELELELLR-------GDTRAVLKLAKQ..........LLSQ
A0A0E1EN75_STRPY/3-183-----------...GKLALDYNLYA...........NTKDYELELEV-------SDALQGKIDFDS.........FLSEH
Q9W3U9_DROME/10-178-----------...TRIHLDEVKDL............GYFMELEVCL-------TEDQTLEEGQAI.........AEKLS
3PASE_HAEIN/6-197-----------.SKIEVAFDQGKIIAGE.....YEQPISEIEFELKS-------GNVQDLFDFVET..........LPFE
Q982E5_RHILO/18-205-----------.ATLEVTLDLGKVVAAD.....REAPLCEIELEKKA-------GSPTALFALARK..........VDLI
Q20034_CAEEL/2-168-----------...TRIHIDRVDGL............GDFMELEVCL-------SPEETPEHGEKI.........AHEIR
Q9RK66_STRCO/5-197-----------...VLAELSLDEVRADATAAGGGRGEWGELEVELAE-------GVHAGLLDAVEK.........KLRKK
Q9V028_PYRAB/1-158-----------...VTFELNKIPGL............GNFLDIEVIS-------DDPEE...AKRK.........IWEVA
Q97LB2_CLOAB/1-169-----------...SLIEIDINDKD...........FCPFPYIEIET-------AFENELEDIVKL..............

PF02940

CET1_ASHGO/207-426KRDDAEVTHEIELEL
CET1_DEBHA/192-431KIVEQDQSFEVELEV
CET1_CRYNJ/151-362ADVPPSRSFELEIEV
Q4N969_THEPA/58-291NKDPTTSKFEIEIEL
Q4XX79_PLACH/19-339KTKDNNEFYEIEIEI
Q7S0G4_NEUCR/767-1020...RDEKKHELEIEL
Q2GQC7_CHAGB/526-765NTQRTEKDHELEVEI
CTL1_YEAST/60-278RNSHQYTSHEVEVEM
Q6FW21_CANGA/6-218RAGKTFENYEVEIEL
A0A0D1DYL2_USTMA/18-219PEKPSDHINELEIEI
CET1_SCHPO/54-263..YDTTERHELEVEF
CET1_KLULA/281-505KEPESDTTYEVELEI
CET1_CANAL/260-477IGNKTEDKYEVELEA
Q2UGU4_ASPOR/464-711..SKGEFEHELEVEI
Q5BCN3_EMENI/479-724..AKGEFEHELEVEV
CET1_CANGA/331-550KSNDVEITHEIELEI
CET1_YARLI/144-345..SGSSMSSELEMEA
CET1_YEAST/279-497KSRQSETTHEVELEI

PF01928

A9CGR0_AGRFC/2-143.......VTGDKRFS
THTPA_MOUSE/5-192SMLGVPA..QEEAPA
THTPA_BOVIN/5-179..........IHHLS
Q9K901_BACHD/4-186SISQVPTENKIQRFF
Q9A2N4_CAUCR/20-204APLRLSLISKAERGY
Q8TIU7_METAC/1-167SQFGVDEKDSIRTSY
Q8XKP2_CLOPE/1-169..LGYSMEDTTSKTI
O59483_PYRHO/1-170RELGVEKFE..RRSY
O58740_PYRHO/1-159RRLGLKEEDVEPKLY
Q8TX10_METKA/1-172EELRVEGKR.VRHSY
Q55960_SYNY3/2-142.......VTDDARYY
Q8XVE5_RALSO/2-212PGLAPLDASKALRGY
Q8ZYD0_PYRAE/1-164STLGLAEE..VRETY
UCKD_DICDI/290-454...LKITGNHVPQTF
Q8Y8D9_LISMO/4-186QITNQPAENKVARFY
Q8U2H2_PYRFU/1-159KMLGLKEEDVEPRLY
Q980N7_SULSO/1-167RKYKIKGKL.TTKSY
O28291_ARCFU/1-161EQLGYSRNESIRDSY
Q8TUI3_METAC/18-218YNLEESRFSKFERAY
A0A0E0VMT2_STAA5/4-186NLEHHQPLNKVQRFF
Y240_METJA/1-169KALNISKDNIIRKSY
Q9KPD2_VIBCH/2-197GGMRLGNLSKAARGY
Q9PAY8_XYLFA/2-149.......VTDDARYY
TTM3_ARATH/1-202EEKIEFSNSDMTKFA
Q9HQ74_HALSA/1-195RRLGLDPTDQIRTSY
CYAB_AERHY/9-174TRLGLSSAQLETRSY
YJBK_BACSU/4-183SIPQRETKNKILRFY
Q9CP17_PASMU/2-195NEIRLSSASKAKRGY
Q8S3R9_ORYSJ/242-398...LGLDGSYIPRTY
Q9C9B9_ARATH/248-404...LGLEGSYVPHTY
O27666_METTH/1-168RKLGIED.GFERRSY
Q98DQ9_RHILO/2-143.......VTGEQKFY
Q8DPU3_STRR6/3-183QISYQKAPSKLVRFV
Q92LX7_RHIME/2-143.......ITGDRRYS
H8FIE5_XANCI/2-149.......VTDDVRYY
Q8YN76_NOSS1/2-141.......VTGDNRYF
Q9HTY1_PSEAE/2-201LPLMPCDISKAERGY
Q9CIJ7_LACLA/4-189RVEYRFSKSKVVRFL
Q9C664_ARATH/248-404...LGLEGSFIPRTY
Q9FBV9_STRCO/159-301...........ARFA
Q8XZK6_RALSO/2-163TSLGIAEADLLDVAY
Q975X8_SULTO/3-168KEYNIEGEK.TLKSY
A0A0C9FAX8_SALTM/2-196TGLRQGSLSKAARGY
A0A0E1EN75_STRPY/3-183HIAFKYAKSKVARCI
Q9W3U9_DROME/10-178RELGIQEADLMIGSY
3PASE_HAEIN/6-197RDIYFSSASKAKRGY
Q982E5_RHILO/18-205TPAHLGVLSKAERGY
Q20034_CAEEL/2-168ELLAVPETDLLTGAY
Q9RK66_STRCO/5-197GIVRSDSPSKLARAL
Q9V028_PYRAB/1-158EKLGLKKKDVEPRLY
Q97LB2_CLOAB/1-169..LGYSMEDTSSKTI

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window