Sequence alignment for CL0274

PF03101

FRS4_ARATH/11-97-----------LFYKDY-AKS--VGFGTAKLS-SRRS...RASKE-----F--IDAKFSC-IRYGSKQQSDDA.......
FRS8_ARATH/109-194-----------SFYNSY-ARE--LGFAIRVKS-SWTK...RNSKE-----K--RGAVLCC-NCQGFKLLKDAH.......
FRS10_ARATH/69-161-----------EYYSTF-ARK--SGFSIRKAR-STES...QNLG.-----V--YRRDFVC-YRSGFNQPRKKA.......
FRS1_ARATH/35-137-----------EFYKEY-ANS--VGFTTIIKA-SRRS...RMTGK-----F--IDAKFVC-TRYGSKKEDIDTGLG....
FRS5_ARATH/87-179-----------AFYNSY-ARR--IGFSTRVSS-SRRS...RRDGA-----I--IQRQFVC-AKEGFRNMNEKR.......
Q60DY0_ORYSJ/112-207-----------KFYKSY-AHE--AGFSVRVGQ-HKKQ.....NEE-----I--LFKRYYC-SREGYIKERVKD.......
Q7XTS2_ORYSJ/200-284-----------EYYASY-AGN--VGFSVRKGL-WDKT...VKNV.-----A--RSRVFVC-SREGFRSKNEAK.......
Q75G83_ORYSJ/99-180-----------EMYNTY-AGK--VGFSIRKSN-VKRR...SNGT.-----I--YQKHMVC-NKQGQQETSS.........
Q2QXI4_ORYSJ/11-101-----------NFWVTY-GGR--MGFDVRKKY-HNKN...QVTQK-----T--TSARFVC-SKQGFRGKDKRD.......
Q2QQ59_ORYSJ/88-167-----------NFYNSY-AKR--KGFSVRKE.-............-----.--..LRFVC-SKEGIRDPSLVK.......
Q6NLE7_ARATH/25-111-----------DFYVEY-SKR--LGFVVRMMQ-RRRS...GIDGR-----T--LARRLGC-NKQGFGPNNQRS.......
Q8S7I2_ORYSJ/428-515-----------DCYVTY-AGT--VGFSVRKGW-LEKT...ATNT.-----T--KSRAYVC-SKEGFRSKSVST.......
Q9AYR2_CARTI/58-154-----------KMYRKY-ASA--AGFDVRLSN-KKTN...KFGI.-----T--IARFFVC-NKEGHPTPKLYDS......
Q67IU6_ORYSJ/64-145-----------AFYNLY-ARF--TGFGIRRSK-NRY....KDGGV-----K--SMQEFCC-IREGRDNSV..........
Q60DS9_ORYSJ/338-446-----------DFYNGY-AYM--VGFSTCKAS-NYHS...RKTDV-----V--TRHTFKC-NRWRKPSDPKEKGLPEV..
Q6UTZ9_ORYSJ/293-415-----------GFFNFY-AYL--AGFSTVITH-HYKSTSKKRNGE-----I--TKYTYRC-NLQGKNEPEDKNAEQEEEE
FRS12_ARATH/57-133-----------EFYNAY-AAR--TGFKVRTGQ-LYRS...RTDGT-----V--SSRRFVC-SKEGFQLN...........
Q8H344_ORYSJ/116-204-----------DFYNAY-AEM--VGFFVRRST-LWTT...SKNI.-----I--TRRTFVC-SREGFREKKRGT.......
Q7XKT7_ORYSJ/54-140-----------RFYLEY-GYR--AGFGVSKRT-SHSV.....DGV-----K--YRATFVC-YKGGIARIKPGL.......
Q75L92_ORYSJ/430-528-----------NYFNFY-AYM--AGFSIVNVH-SARTTSKKRNRE-----V--IRVTFKC-YKYVKADCNTKPE......
Q5NKQ1_MAIZE/85-173-----------KFYSRY-AYE--VGFPLKRYR-ERKN........-----.--.CKWLNC-SMEGKRAERGNG.......
Q6K1Y1_ORYSJ/53-137-----------RFYRRY-ARR--VGFGVSVRR-SSFS...QEGT.-----C--LYLELMC-CKGGRPRYEPKF.......
Q93Z68_ARATH/84-172-----------GFYNAY-ATK--VGFVIRVSK-LSRS...RHDGS-----P--IGRQLVC-NKEGYRLPSKRD.......
Q9M4X4_MAIZE/39-125-----------GFYKTY-AHE--CGFSVRIGA-QGKK.....NDV-----V--EHKRFVC-SREGFTRRCAEA.......
Q8LHZ8_ORYSJ/58-145-----------QFYVSY-GCR--SGFGITRRS-NNTF.....DGF-----R--YRSTFIC-SKGGQSRLRSGA.......
Q6ESZ2_ORYSJ/64-154-----------EFYRYY-AWK--LGFSVRREY-ANKS...RKTGE-----I--TSRKFVC-SREGFKAPDKRT.......
Q2QY69_ORYSJ/36-126-----------DFWVKY-GGR--IGFDVRNNY-TNKS...DLDQL-----V--TSSRFVC-SNQGSRAEEKKY.......
Q2R8S0_ORYSJ/87-181-----------DFYNAY-ARD--MGFSIRRSS-YHYV...KDSTI-----I--KNRTFCC-SRAGTRGHDKRE.......
Q53PZ5_ORYSJ/591-683-----------QFYNKY-ARE--RGFSVRKDY-CRRD...RFSGI-----I--IHRRFTC-SREGFRKELYMD.......
FRS3_ARATH/63-137-----------SFYDEY-SRQ--LGFTSKLLP-.......RTDGS-----V--SVREFVC-SSSSKRSKRRLS.......
FAR1_ARATH/65-154-----------IFYQEY-AKS--MGFTTSIKN-SRRS...KKTKD-----F--IDAKFAC-SRYGVTPESESS.......
Q6AT58_ORYSJ/82-184-----------TFYNVY-AHR--VGFSTRISV-MHRS...RRDGS-----I--MSRQFVC-AKEGFRTYRGKNEVS....
FRS12_ARATH/225-301-----------QFYQAY-AEV--VGFRVRIGQ-LFRS...KVDGS-----I--TSRRFVC-SREGFQHP...........
Q2QXD6_ORYSJ/96-184-----------RLYCDY-GHR--MGFSVRKGK-QYYF...TGTKT-----I--RTKDYYC-SKEGLKDDEQLT.......
Q84JA7_ARATH/47-136-----------SFYDNY-ATC--MGFVMRVDA-FRRS...MRDGT-----V--VWRRLVC-NKEGFRRSRPRR.......
Q6EP19_ORYSJ/30-120-----------KFYLDY-AKG--KGFSVRKNN-LKRK.....DGE-----I--IWRQFVC-SCEGYRELKHFE.......
Q25AC7_ORYSA/379-474-----------NF...Y-ALL--ARFSIVRAH-NYHTTSKKRNGE-----V--TRVTFRC-NRQGKPTSQSKSV......
Q75LD4_ORYSJ/42-126-----------NFYKRY-ALR--TGFGVCVKK-SSFT...KAGL.-----C--RRLVLVC-NKWGDGKEDACY.......
Q6K4T2_ORYSJ/290-375-----------RFYYAH-ALL--TGFVGKRGT-NYKR........-----.--KKFHLEC-NKSGKMKLTKSS.......
Q10DV6_ORYSJ/41-131-----------VFYMAY-ASR--VGFSVRISK-SRRS...RNDES-----I--IMRRFVC-SKEGFHHKKQTD.......
Q7XUD2_ORYSJ/473-571-----------DFFNFY-ALL--AGFSVVIAH-NYHSTSKKRNGE-----V--IRVTFKC-NRHGKAKSESQEE......
Q5JMV5_ORYSJ/380-476-----------SFFNFY-AYQ--VGFSVVITH-HYKSTSKKRFGQ-----I--TKYTYQC-YRYGKNDDGQKKK......
Q53M07_ORYSJ/37-129-----------AFYCTY-AAR--AGFRVRSSK-SFAS...RIDDA-----I--IMRRFVC-TRQGLPSRKDTL.......

PF04500

FWCH1_MOUSE/402-460-----------FLKTPL.GGN--F...LVYES-FLYR---REKVA.....G-.EKVYWTC.RDQAR--------------
FWCH1_MOUSE/235-293-----------FLKTCY.GGT--F...LVHQS-FLYK---REKTV.....G-.GKVYWTC.REHAV--------------
A7UT18_ANOGA/463-522-----------IVNNAN.GRP--R...LHFDG-NLYV---RESAR....AD-.GVVVWRC.RRNYD--------------
A7UT18_ANOGA/543-605-----------LSPTWK.GGE--A...LVLNG-YRFL---KAYSR....VN-.GMSLWRC.VGSLG--------------
FWCH1_HUMAN/600-658-----------FLRTSL.GGR--F...LVHES-FLYR---KEKAA.....G-.EKVYWMC.RDQAR--------------
Q16SJ4_AEDAE/393-453-----------KMSARR.GSH--L...LVVNG-VKFF---RNRQR.....N-.DKQYWKC.HQYYK--------------
Q17CC2_AEDAE/19-83-----------FIVNNQ.GGI--Q...LSVNG-FPYI---RSKTN.....D-.DVQYWAC.SQAKV--------------
Q6IDT6_DROPS/406-467-----------FADSKKNGGK--L...LVING-FRFF---RNKKR.....G-.NLQYWKC.RNYYK--------------
Q16WE4_AEDAE/17-80-----------PSITML.SST--S...LLHNN-CIFN---RNNTVAT.QQG-.LKTYWLC.KSYRV--------------
Q6IDT7_DROPS/405-469-----------FGKGQR.GRT--V...LLHHE-EKFV---KNRSS.....A-.TRTYWIC.SKKDV--------------
Q6NP69_DROME/162-227-----------MLRRRD.GRV--M...VCIDG-HLYY---LAGKSY...KG-.DIFRWTC.VRKRD--------------
Q16SI9_AEDAE/387-448-----------FVRSRK.GKP--L...LLYKG-HQYT---LNRRR.....K-.QLGYWEC.VHRRS--------------
Q17CD4_AEDAE/347-409-----------FVLSGR.GSI--Q...LSIDG-YVFT---QELVK.....N-.NDIDWAC.SQSKA--------------
Q6IDX3_ANOGA/370-431-----------FIKGQR.GAL--K...LIYQD-HTYI---CVKQQ.....K-.GSKYWTC.SKQRS--------------
Q6IDX8_ANOGA/378-443-----------FEFTTR.GTQ--C...LVYDG-YLYS---KNKTFE...NG-.TRVNWKC.RFYHR--------------
Q6IDX0_ANOGA/458-517-----------YLTNRF.GSA--K...VVLDE-HQYV---YHFAA.....K-.GVSYYRC.DQFKR--------------
Q6IDZ2_ANOGA/392-456-----------FSRTMR.GKE--Q...LVYKG-QPFV---FEKLVLTTGGQ-.SKKIWRC.NQWWN--------------
Q17EL2_AEDAE/670-734-----------SSSAHH.LPK--F...IIHHG-YHYK---FVSTNA...ND-.RMAFWRC.SNFEA--------------
Q17CD3_AEDAE/199-260-----------HPYSYN.YRG--N...LVYDR-YTFS---KTAVQG...MG-.NIVYWRC.TGYRK--------------
Q9XWQ6_CAEEL/134-195-----------PYTPRG.IRE--R...VLFDE-HLYV---FDKCSY...DS-.KKRFFRC.ERKNT--------------
Q6IDX4_ANOGA/383-444-----------LETGSK.GRP--K...LIMGG-YAFF---RNNSS.....N-.NKTYWLC.SKNRM--------------
Q16WH6_AEDAE/7-75-----------EVLFPR.GGD--M...LYLDG-YLFY---RNKKV.....E-.DLHYWEC.RNRSH--------------
Q17EL2_AEDAE/762-821-----------IVKNWK.NRD--V...LVFQQ-CRYF---LHYVR....KD-.GRKVWRC.SAIRS--------------
Q17EL2_AEDAE/236-296-----------LVKSGQ.KRE--F...LIYQG-YRYY---FQYES....KN-.GKRSYRC.TMFRN--------------
Q70BY8_DROVI/421-485-----------FIESPW.STP--C...LVLNG-YMYN---CHSRK.....N-.NKEYWRC.HNYSK--------------
Q16FH8_AEDAE/26-95-----------ILKTSK.GKD--L...LTYEG-FIYY---ANRKP....ID-.NSHYWEC.RERAH--------------
Q7Z1Q1_CAEEL/53-119-----------IVTSFK.GYQ--K...LMYQG-YRYN---IYQIAP...ER-.NFKSWRC.VCAKK--------------
Q16SK1_AEDAE/387-448-----------FVSGVR.GMP--K...LIVDG-YSFI---RNKGN.....F-.RTTYWRC.SKLRS--------------
Q17C92_AEDAE/22-90-----------LITSQK.GKQ--M...LSVNG-TLFN---LNKQA.....N-.EHFYWEC.ASRKH--------------
Q17CD5_AEDAE/89-153-----------FVLTKR.GST--Q...LSVNG-FLYM---RNKAR.....G-.ITQFWAC.NQHKV--------------
Q6NP69_DROME/596-663-----------TLRSAK.GHE--L...LCVDG-YIYH---AKNRG....VI-.SRNYWVC.IKSRD--------------
Q6IDU1_DROPS/408-468-----------YITGFR.GSR--K...LKIGD-FTFT---RNKST.....G-.SKTYWSC.ARAGA--------------
Q70BX1_DROVI/435-497-----------YTTTQR.GRI--M...LIYNG-YRYV---VNRQS.....L-.KNVFWRC.SRYVK--------------
A0APY4_DROSI/32-92-----------FMLSQR.GKP--L...LVHDG-HTFG---IQYVR.....K-.DKKYWQC.NLSRK--------------
Q17MH0_AEDAE/8-77-----------LIKSSR.GND--M...LAIAG-YVFH---CNRKMV...EN-.NIYYWEC.RVRCH--------------
Q6IDX1_ANOGA/395-454-----------LVPCRL.GGM--K...VFYQG-YYFE---YHTSK.....S-.GIKHYRC.VHHAQ--------------
Q6IDZ9_ANOGA/372-437-----------FLGSRK.GGL--Q...LVHDN-YLYR---SNLRRQ..GRN-GDVLYWEC.IYNRG--------------
Q16SJ1_AEDAE/385-449-----------FIKSPW.STP--C...LVIND-YLYN---CHSTR.....G-.NKVYWRC.HNYSR--------------
Q17CC5_AEDAE/2-67-----------FIVSRK.GGV--L...LVHDN-HIYR---SNLRRQ..GQH-RNILYWEC.LHNRS--------------
Q17CC4_AEDAE/1-62-----------MVVGRK.GRP--M...LLMGG-HAFF---RNNTH.....K-.SKTYWLC.AKSRS--------------
Q6IDZ0_ANOGA/386-445-----------FSESSS.GTR--Q...LLYQN-HVFH---RNIKS.....G-.DTEYWRC.SKAMR--------------
Q16SK0_AEDAE/393-454-----------FTPGQR.GKP--K...LVIEN-NSFF---RTKGD.....T-.QRSYWSC.SAYKS--------------
Q16SK2_AEDAE/394-455-----------YVTGQR.GKP--K...ILYEN-HTYI---CSKHL.....K-.NRKYWTC.GKQRS--------------
Q6IDT9_DROPS/430-492-----------YIRTPA.GNC--I...LHCGE-HRYL---RNASY.....K-.DKVYWKC.SKWRK--------------
Q6IJJ6_DROME/2-63-----------IVKGTK.GKP--K...LLMGG-YEYY---RNNSR.....G-.SKTYWLC.ARNRY--------------
Q8MRZ1_DROME/2-65-----------FLISRK.GGT--L...LTINN-FVYR---SNLKFF..GKS-NNILYWEC.VQNRS--------------
Q6IDW8_ANOGA/371-432-----------LISKSR.ITN--Q...LCIDG-FPFT---RHMMK.....K-.DTIYWRC.IQFRA--------------
Q17CA9_AEDAE/249-307-----------TDEDPF.QGK--K...MMYQG-FYFY---RNGAS.....E-.RRLYWRC.ANSNT--------------
Q17CB7_AEDAE/18-77-----------YVATCR.GNT--K...IIIDG-YSYT---RHHRY.....N-.WNTYWRC.AKSRQ--------------
Q6IDZ6_ANOGA/364-419-----------FILSQR.GYP--L...LVVGN-FLFR---KNRDK......-....YWRC.IRCTK--------------
Q6IDT2_DROPS/408-472-----------FTRTRK.KKL--K...LIIDR-HEFV---MDRKL.....K-.NSVNWRC.ARYRS--------------
Q17EK9_AEDAE/1691-1752-----------IAKTSR.GES--....LIYQG-YRYW---AKNRL....AN-.GIVSLCC.TRKKM--------------
Q17IM0_AEDAE/257-318-----------YYSTKG.DRP--S...IVVNG-YRFH---KEKALSV.TFP-.SQIYWRC.SAK..--------------
Q6IDT3_DROPS/404-463-----------YSLSQK.GRT--L...LLHED-YSYV---REKTV.....N-.EKIYWRC.TQYTT--------------
Q6IDW1_ANOGA/381-442-----------FVTTKK.GKE--L...LIFRG-YVYR---VNRHR.....G-.RLRYWECASRRTK--------------
Q7QDH8_ANOGA/445-505-----------FIRSQK.KCA--Q...LVYDG-YIYN---RKMIQ....QN-.GRTTWRC.CDLLK--------------
Q7YTX4_DROME/183-246-----------SNMVML.STT--S...LLHGN-CVFN---RNNTVAT.QQG-.MKTYWLC.KSYRI--------------
Q6IDZ7_ANOGA/373-431-----------FIRSQR.GLP--L...LVKNK-FIYR---CERTR.....N-.HRSYWLC.TRYKT--------------
Q18225_CAEEL/143-204-----------EYKPRN.VRE--K...VYADG-YIMS---FDKKSC...CG-.TKEFWRC.ERKND--------------
Q17CD3_AEDAE/4-68-----------YTVSRR.GRR--Q...ICYYG-YTFE---MEKER.....T-.GSTSWRC.GQAKP--------------
Q17CD3_AEDAE/86-145-----------YSISLK.GSL--Q...LMVQG-FPYT---RHSCK.....G-.GKVYWRC.VQFKS--------------
Q6IDY5_ANOGA/394-455-----------YKQSQRSGRQ--L...LVVNG-IHFF---RNRER.....N-.GKQYWKC.NQYYK--------------
Q17EK9_AEDAE/424-486-----------ITKNQR.GND--A...LVFEG-HRFS---KEWSR....VD-.GSIIWRC..SYRS--------------
Q6IDU0_DROPS/419-479-----------FIRGQR.GCK--L...LAFNG-HNYV---RNRRS.....N-.LKTYWIC.SKKGS--------------
Q16SI1_AEDAE/384-445-----------YVMSTK.GSP--Q...LCLDG-FTFT---RHIVK.....D-.DTIYWRC.IQFRA--------------
Q6IDY6_ANOGA/439-499-----------QYTNGR.GNN--V...LMYDG-HRYI---KNNCY.....G-.GKMYWKC.SKWHT--------------
Q16SJ5_AEDAE/380-443-----------FTKSSR.GRP--A...IIIDG-IKYL---FMSEN.....H-.KRVVWRC.SSMAT--------------
Q17CB7_AEDAE/197-258-----------VGMTQR.GNS--K...LTIDG-YSYR---KKSVS.....D-.TKVYWAC.AQLHA--------------
Q70BY4_DROVI/421-485-----------YSATSR.GRM--Q...LIYGG-QPFI---FEKTLKLSTGE-.EKRYWRC.NQWWN--------------
Q6IE02_BOMMO/284-343-----------FGTSCR.GRP--V...IVYQN-YRFH---LHQKY.....G-.EKTSWRC.AKWRN--------------
A1L1L4_RAT/92-150-----------FLKTPS.GSR--L...LVHKS-FLYK---QEKAV.....G-.DKVYWKC.RQHSE--------------
A7DTF1_CAEEL/131-192-----------TDIPKK.TRL--K...VFSNG-FFMT---FDKLSS...CQ-.KKYFWRC.EYKNT--------------
Q17CD5_AEDAE/175-239-----------FVISKR.GKT--Q...LCVDG-YLYM---RVKAT.....E-.EMQYWSC.NQFRV--------------
Q70BY7_DROVI/415-476-----------ALLSYN.YRG--Q...LVHLG-FSYS---CHSRNV...PR-.CVAFWRC.TQHKK--------------
Q6IDY2_ANOGA/385-450-----------YTTTQR.GRT--M...LIFSG-YKFV---ENRQS.....K-.RNIFWRC.ARYVK--------------
Q6IDU2_DROPS/436-495-----------FIVSKY.GTR--Q...IMLKQ-HTFN---RHICR.....D-.DVTYWRC.SQFAV--------------
Q6IDV5_DROPS/431-497-----------FIEGQR.KSV--Q...LVCGN-YAYA---KNNKH.....G-.GTTYWNCRSRRHG--------------
Q6IDY1_ANOGA/404-467-----------FGVSQR.GAK--K...LIYDR-YEYI---KDREF.....P-.LSTNWRC.ALFKR--------------
Q16SI4_AEDAE/385-447-----------YVSSRK.GTP--Q...LMIDD-HCYS---RQRVR.....Q-.RTIRWRC.VQFKA--------------
Q6IDX5_ANOGA/379-440-----------FTAGQR.GKP--K...LVIEN-NSYF---RTKGD.....S-.LRAYWSC.SFYKS--------------
Q6IDX7_ANOGA/374-437-----------FSITQR.GRP--L...LVHEG-YSYI---GNGAF.....A-.DTVNWRC.SMHRK--------------
Q16SI2_AEDAE/384-446-----------YTMSRK.GTP--Q...LEIDG-YRYT---RQKIC.....K-.TTIRWEC.LQTKA--------------
Q16SJ2_AEDAE/416-472-----------YIRSRR.GHP--L...LVFRG-YKFR---RNGGC.....K-.EKGYWRC.ASF..--------------
Q17CC3_AEDAE/84-147-----------FGYTQK.GKA--M...LLYNG-YAYI---KDRQA.....M-.KSCNWKC.SLFGK--------------
Q6NP69_DROME/365-432-----------FLPSAK.GRK--V...LCLSQ-HLFH---FDSQSR...SN-.GHMFFTC.INRRD--------------
Q17EL2_AEDAE/360-420-----------IIKNYK.GKD--I...LIYNG-WRYF---VDYKK....KN-.GGQVWRC.SSHRL--------------
Q17CC0_AEDAE/72-136-----------YVTGFR.GSR--K...LKVGE-FSFT---KNKEI.....A-.NKTYWSC.ARAGM--------------
Q6IDT4_DROPS/418-482-----------FTQSLR.GRP--A...IMANG-IRFL---IMSEN.....K-.KKILWRC.SSMAT--------------
Q6IDY3_ANOGA/373-432-----------FRTSQK.GKL--Q...LSYGG-FYYC---MEKKI.....H-.HKEYWRCIYYTTK--------------
Q17CB6_AEDAE/76-137-----------TVLDNR.GRP--V...LLVDG-HAFS---RNNIG.....K-.TQTYWLC.SKNRA--------------
Q6IDX6_ANOGA/379-439-----------PLKNKI.VRK--....IYHNG-FYYC---RSKCI.....Y-.GTTYWVC.DRAKQ--------------
Q16SJ8_AEDAE/412-474-----------TVIGQR.GST--K...LLIEG-YTYI---VNKRS.....N-.GKRYWGC.AKAVP--------------
Q17CB9_AEDAE/37-98-----------FKTSQRSGRH--L...LVVNG-VTFF---RNRHR.....N-.NKQYWKC.NQYYK--------------
Q16FU8_AEDAE/997-1058-----------LVKLQR.TEQ--M...LSHEG-HLYK---MKWHN.....R-.RHSYWDC.MLRDQ--------------
Q6IDV1_DROPS/437-498-----------FTRSNR.GNN--L...LTIDG-KPFT---LNRRI.....K-.DACYWEC.VKLRC--------------
Q17EK9_AEDAE/344-403-----------ITTNVK.GRE--C...LIYEG-HQYS---KDRER....YD-.GAVLWRCRRNYDK--------------
Q6IDZ5_ANOGA/397-459-----------FVVNRR.GTQ--N...LHFRG-YVYV---RKTTH.....H-.RTMNWVC.CKGAT--------------
Q70BY0_DROVI/442-507-----------FIRNQKQGYN--....LIFNG-YMYK---KEASF.....R-.ATINWIC.SDGNG--------------
Q6IDX2_ANOGA/381-447-----------FIQGQR.EHK--L...LVIGG-YTYA---RNNFA.....G-DDTIYWACRTSYKQ--------------
Q6IDV9_DROPS/402-461-----------LIYTYR.GQ.--....LVHEG-YTYS---CNAKNS...VK-.FLAFWRC.SMYRK--------------
Q70BX7_DROVI/443-509-----------FIQGQR.KSL--Q...LVYDK-YAYA---KNNEH.....G-.ATTYWNCRIRRTG--------------
Q6IDY8_ANOGA/367-431-----------FIVGVR.GSR--K...LKVGD-YSFT---KNKEC.....T-.DKTYWSC.ARAGM--------------
Q16SI5_AEDAE/381-443-----------YIMGRR.GTV--Q...LLING-HVFT---RSQVR.....E-.KIIIWVC.SQRRA--------------
Q16SJ7_AEDAE/381-447-----------YVLSKR.GTK--H...LFYNG-NTYT---PNERPY...PG-QRSRTWKC.TLYYR--------------
Q17CD4_AEDAE/155-214-----------YVDTGR..SR--K...LIING-YGFT---RKQIR.....E-.RYTIWEC.CQSRP--------------
Q17EK9_AEDAE/1138-1199-----------LFKNQR.GQM--T...LLYQG-YRYS---IRNRN....QD-.GSSSWKC.RSNSS--------------
Q70BX4_DROVI/425-491-----------LVANRR.GGQ--N...LVYNG-HMYT---VERKY.....L-.TTINWVC.TKNSN--------------
MMD4_DROME/452-512-----------YASTTK.GGV--K...LIFNG-HLFK---FSFRK.....A-.DYSVFQC.CYREH--------------
Q17EK9_AEDAE/1463-1528-----------IVKNRV.GND--I...LIHEN-HRFR---LNYQR....ND-.GTTHWRC.VWARS--------------
Q16SI0_AEDAE/430-495-----------LYASQR.GKH--L...LVLEN-YTFS---KNNTV.....A-.DTTYWACRVVTNH--------------
Q16SB8_AEDAE/1076-1143-----------ILKTMKTGET--VTCGLVFHK-FRYV---LATVD....QN-.ETSRWTC.TKHNI--------------
Q70BY9_DROVI/420-480-----------FIRSQK.KNA--Q...LVYRD-YIYN---KKLTQ....AN-.GQTTWRC.ADVLK--------------
Q6IDT8_DROPS/449-507-----------SFDQTR.GGD--I...LNYNG-RRYK---HHGNY.....E-.DNVYWVC.CKR..--------------
Q6IDY0_ANOGA/370-433-----------FGITRR.GHQ--M...LLYRG-HRYV---REKQK.....G-.DISNWKC.SMHSK--------------
Q17CD2_AEDAE/110-170-----------FKIGNR.NSL--K...LYYSG-HFYT---RSYTS.....E-.KSSKWVC.DRKNM--------------
Q6NP69_DROME/17-87-----------VVRSAK.GVD--M...LCVDD-YLYH---FDRIG....RN-.NTYRWLC.NRRKD--------------
Q17EL2_AEDAE/459-522-----------NAYTPP.YHR--Y...ILHEG-HRFR---FATRK.....R-EGTIYWRC.AMRLD--------------
Q17CB7_AEDAE/98-160-----------YGKTQA.GGT--R...ITIDG-YSYC---KHYRT.....G-.SKTVWRC.SNANF--------------
Q16SI3_AEDAE/390-452-----------FHTTKR.GSV--Q...LEIDG-YRFT---RMKVL.....Q-.TTIHWSC.LQTKA--------------
Q16SJ6_AEDAE/386-449-----------FGYTQR.GKV--L...LLYNG-FAYI---KDRDS.....R-.TSCNWKC.SLFGK--------------
Q70BZ1_DROME/25-91-----------YVRSNR.GTD--L...VYHEG-NTYT---PNEKLR...EG-QKSRDWKC.SMYHK--------------
A8XLA6_CAEBR/145-206-----------PHRSRM.TRD--R...VFYES-HVYI---FDKSSY...DN-.KKKFYRC.EKKNT--------------
Q6IDV2_DROPS/410-473-----------LVTNRR.GGQ--N...LIYNG-HMYS---VERKY.....H-.ASINWVC.TKNSN--------------
Q16SJ0_AEDAE/390-455-----------FVGSRW.GRK--L...LVYER-YVFF---SNKRVE...AT-.NTTYWRC.TFSSN--------------
Q17EK9_AEDAE/1257-1320-----------PPEVNY.GRN--V...VEHKN-YFYR---LIVRK.....K-NGREYWRC.VHFKS--------------
Q70BX5_DROVI/426-484-----------TYRERA.GC.--....LLIDG-FRFV---ISYQQ.....R-.KRCYLKC.SNFRS--------------
Q6IDX9_ANOGA/370-433-----------FGKTRR.GQL--K...LLYDG-HAYT---RDRQS.....A-.KTCNWKC.SLFTR--------------
Q17EK9_AEDAE/94-153-----------IIMTPT.NRE--R...LVYKG-FLYC---RHFSR....RD-.GSVHWRC....RL--------------

PF03106

Q9SE29_ORYSA/129-187----------------------------ADDG-YNWR---KYGQKAVKGGE-YPRSYYKC-THL..--------------
WRK34_ARATH/371-430----------------------------LDDG-YRWR---KYGQKVVKGNP-NPRSYYKC-TAN..--------------
WRK59_ARATH/108-167----------------------------LDDG-YKWR---KYGKKPITGSP-FPRHYHKC-SSP..--------------
Q9SXP5_TOBAC/195-254----------------------------LDDG-YRWR---KYGQKVVKGNP-NPRGYYKC-TSP..--------------
WRK13_ARATH/222-281----------------------------LDDG-YRWR---KYGQKVVKNTQ-HPRSYYRC-TQD..--------------
WRKY1_ARATH/306-365----------------------------VNDG-YRWR---KYGQKSVKGSP-YPRSYYRC-SSP..--------------
Q9XFF1_AVESA/182-240----------------------------SDDG-YNWR---KYGQKQMKGSE-NPRSYYKC-SFA..--------------
WRKY1_ARATH/110-168----------------------------MEDG-YNWR---KYGQKLVKGNE-FVRSYYRC-THP..--------------
WRK41_ARATH/140-202----------------------------HDDI-FSWR---KYGQKDILGAK-FPRSYYRC-TFRNT--------------
Q9SQ04_PETCR/190-248----------------------------LDDG-YNWR---KYGQKQVKGSE-NPRSYYKC-TYL..--------------
WRK43_ARATH/29-88----------------------------LDDG-YRWR---KYGQKSVKNSL-YPRSYYRC-TQH..--------------
WRK46_ARATH/103-165----------------------------IDDG-HCWR---KYGQKEIHGSK-NPRAYYRC-THRFT--------------
WRK18_ARATH/175-235----------------------------VKDG-FQWR---KYGQKVTRDNP-SPRAYFRC-SFA..--------------
WRK20_ARATH/210-268----------------------------ADDG-YNWR---KYGQKHVKGSE-FPRSYYKC-THP..--------------
WRK39_ARATH/261-321----------------------------PPDE-YSWR---KYGQKPIKGSP-HPRGYYKC-SSV..--------------
WRK34_ARATH/177-235----------------------------ADDG-YNWR---KYGQKLVKGSE-YPRSYYKC-THP..--------------
Q9XFF0_AVESA/243-303----------------------------PADD-FSWR---KYGQKPIKGSP-YPRGYYKC-STV..--------------
WRK44_ARATH/348-407----------------------------LEDG-FRWR---KYGQKVVGGNA-YPRSYYRC-TSA..--------------
WRK23_ARATH/173-232----------------------------LEDG-YRWR---KYGQKAVKNSP-FPRSYYRC-TTA..--------------
WRK25_ARATH/165-223----------------------------SNDG-YGWR---KYGQKQVKKSE-NPRSYFKC-TYP..--------------
WRK29_ARATH/133-193----------------------------LSDA-WAWR---KYGQKPIKGSP-YPRSYYRC-SSS..--------------
Q9ZPL7_TOBAC/299-358----------------------------VNDG-HRWR---KYGQKFVKGNP-NPRSYYRC-SIA..--------------
WRK14_ARATH/216-276----------------------------PSDL-WAWR---KYGQKPIKGSP-FPRGYYRC-SSS..--------------
Q9ZPL7_TOBAC/123-181----------------------------LEDG-YNWR---KYGQKLVRGNE-FTRSYYKC-TYP..--------------
WRK44_ARATH/164-222----------------------------SVDG-YNWR---KYGQKQVKGSE-CPRSYYKC-THP..--------------
WRK56_ARATH/113-172----------------------------LDDG-YRWR---KYGQKSVKNNA-HPRSYYRC-TYH..--------------
WRK47_ARATH/238-298----------------------------VNDG-CQWR---KYGQKMAKGNP-CPRAYYRC-TMA..--------------
Q39658_CUCSA/235-293----------------------------ADDG-YNWR---KYGQKLVKGSE-FPRSYYKC-THL..--------------
WRK22_ARATH/127-187----------------------------NSDV-WAWR---KYGQKPIKGSP-YPRGYYRC-STS..--------------
WRK19_ARATH/467-525----------------------------VNDG-YNWQ---KYGQKKVKGSK-FPLSYYKC-TYL..--------------
WRK25_ARATH/327-386----------------------------LIDG-FRWR---KYGQKVVKGNT-NPRSYYKC-TFQ..--------------
WRKY3_ARATH/249-307----------------------------ADDG-YNWR---KYGQKQVKGSD-FPRSYYKC-THP..--------------
WRK32_ARATH/330-389----------------------------CGDG-YRWR---KYGQKMVKGNP-HPRNYYRC-TSA..--------------
WRK32_ARATH/167-225----------------------------ARDG-YNWR---KYGQKQVKSPK-GSRSYYRC-TYT..--------------

PF03615

Q29NA7_DROPS/62-205EFDEFSEWSDGHVRHIYALHN--EEAKKHISG-WAMR--NTNNHNVNILKK-SCLGVLVC-SQHCV--------------
Q5TQ16_ANOGA/2-145TYEKFNEWADGHVRHVYHPTD--DHARKHISG-WAMR--NTNNHNVSILKK-SCLGVLIC-TARCK--------------
GCM_DROME/46-188EFDDFNDWSNGHCRLIYSVQS--DEARKHASG-WAMR--NTNNHNVNILKK-SCLGVLLC-SAKCK--------------
Q2KT54_DANRE/36-176QYDAFQEWTDGYVRYIYSSED--KNAQGHLSG-WAMR--NTNNHNCQILKK-SCLGVVVC-SRNCS--------------
GCM1_HUMAN/29-169KTDWFQEWPDSYAKHIYSSED--KNAQRHLSS-WAMR--NTNNHNSRILKK-SCLGVVVC-GRDCL--------------
Q8MMJ4_STRPU/65-208KYDDFNEWIDGDVTMRYLPKD--IDARKHLSG-WAMR--NTNNHNKKVLKK-SCLGVFLC-SKGCR--------------

PF08731

Q6BK98_DEBHA/21-107-----------------FTNK--DDIKPWLQNYLLHK---KGIHVVIARSD-ANKIVFRCKSDKSKET.AE.........
Q59Z29_CANAL/21-112-----------------FDSK--DDIKPWLQDNLQST---KGINVVIERSD-TSKIIFKCKNKEKKTKIVE.........
AFT2_YEAST/51-137-----------------FEDR--HEIKPWLQK.IFYP---QGIDIVIERSD-SSKVTFKCRSVRSKVGLNP.........
AFT1_YEAST/108-243-----------------FEDK--SDIKPWLQK.IFYP---QGIELVIERSD-AFKVVFKCKAAKRGRNARRKRKDKPKGQ
Q6FS49_CANGA/15-125-----------------FKDK--NEIKPWLQK.IFYP---QGIEIVIERSD-SLKVVFKCKAAKRGRKSQEELTEEERLR
Q6CS78_KLULA/99-257-----------------FKDK--SEVKPWLQK.IFYP---QGIEIVIERSD-SMKIVFKCKAVKKNRNTSSISGCGHSHG
Q6FSP0_CANGA/42-131-----------------FQEK--IDVKVWLQE.MFFP---MGIDIVIERSD-KTKIIFKCKPSDYRSHEPKD........
Q755B2_ASHGO/89-206-----------------FKDK--NDIKPWLQK.IFYP---QGIEIVIERSD-KIKVVFKCKASKRTKSGSAPGSQAGAAE

PF03108

Q94HS2_ORYSJ/177-242--------NLVFKVGMVFPSV..EVLRKAITE-YSLK---ARVDIKMPRNE.QKRLRAHC.....V--------------
Q94H23_ORYSJ/164-229--------SPEFYPGMVFGTI..EELRKAVSQ-YSIT---NRVAVKPDRNN.KKRYEAHC.....A--------------
Q0DBW2_ORYSJ/8-75--------KPSLVKGTVYPNM..KVFRLAVRQ-FAIN---EEFELWVKATD.RKKYVGACK...GA--------------
Q0J5I2_ORYSJ/345-411--------TPQFAVDMCFRGK..DQLKDAIER-YALK---KKINIRYVKNE.QKRIRAVCR....W--------------
Q9SUF8_ARATH/168-235--------GIGLSLGQEFESK..QEVQDLVEK-AELL---NYFEAAIIKSS.PGLYVLKCR...GG--------------
Q84JZ9_ORYSJ/312-376--------EP..RKGLEFRSM..DDLKIWLQS-YSIR---VHRPYHVKESNASVKYTVACL....D--------------
Q9ZQK9_ARATH/327-393--------GEDVYKGKVYASK..SDCQIGLAI-YAIR---HMFHFKQTRTK.LDSFVLNCA....D--------------
O22271_ARATH/106-173--------GDKFVIGSTFFTG..IEFKEAILE-VTLK---HGHNVVQDRWE.KEKISFKCG...MG--------------
Q9FFR0_ARATH/219-284--------ESELHVGMIFRGK..DELAKAVKL-YSNR---RQREYNVFEIPITGTFQSGC.....K--------------
Q60D51_SOLDE/156-222--------ISVVEVKQMYKDK..ATLKAVMEK-YKIK---NSFNFKVKRSD.NKSYVLVCY....S--------------
Q6NKQ0_ARATH/136-205--------DDLLALHKTFNNA..NEIKYALLR-YSLK---TEYDIKMFKSS.SNRLGAKCTQ.HIE--------------
Q8LN69_ORYSJ/215-281--------ENEVIEGARYAHK..DEMKEAVKH-WAVS---LQREFRVVKST.NYVYEVRCM....K--------------
Q9C8V7_ARATH/134-202--------EELLKLGKTFSCP..EDFKIAVLR-YSLK---TRYDIKLYRSQ.TLKIGAKC.....L--------------
Q9LPT8_ARATH/341-407--------GDELFVGRVFKNK..QDCNVKLAV-HALN---RRFHFRRDRSC.KKLMTLTCI....S--------------
O22278_ARATH/233-302--------GTGIELNQEFVSK..EVVQDLVNI-VANK---YCFATATIVLD.PQRLMLRCRQ.SKT--------------
Q10M31_ORYSJ/331-397--------VHVFSLGMAFRSS..RQFKKALVK-YGLT---THRHIIFPKDE.RDKVRATCS....W--------------
Q9SJR8_ARATH/196-262--------GDKLFVGRVFKSK..FDCKIKIAI-HAIN---CKFHFRTARST.PKFMVLKCI....S--------------
Q9FH72_ARATH/102-168--------IIDFYVGQEFVSK..EKCKDTIEK-YAIR---EKVNIHFKRSE.RNKIEGVCV....Q--------------
Q6L470_SOLDE/182-249--------NPELELGMVLDNK..KEFKEAVVA-NQAK---IGKSIRWTKDD.RERARAKCR....T--------------
Q84R97_ORYSJ/298-366--------NPCIDEGEVFADT..TTCKEAVTH-HAII---YDYSFETEKKD.KHRFRAFCKK..KE--------------
Q2R0C2_ORYSJ/1370-1436--------DPPMEVGSSYVSM..NEFRLAVRQ-HAIK---GQFQLGTEKSD.KERFRGFCT....A--------------
Q25A06_ORYSA/1224-1291--------NPTFVVDATFPNG..EAFKLAMRQ-FAIK---GEFEVNVSHSS.KARYIAKCA...KT--------------
Q9M9F3_ARATH/337-408--------EILLALEKTYNSP..EDFKLALLM-YSLK---TRYDIKLYNSE.AMVVAAKCVY..VS--------------
Q65X43_ORYSJ/10-78--------DPPMTVGTVYSDM..DAFKIALAS-HAIK---HEFNYDIEKSD.TGRYRVKCAQ..RS--------------
Q9M9L2_ARATH/201-267--------NTITGVGQRFKNV..GEFREALRK-YAIA---NQFGFRYKKND.SHRVTVKCK....A--------------
Q7XWS4_ORYSJ/282-348--------VPVFELGMKFSSK..HQFKKTIIK-YALA---ERKVINFIKDD.HKRVRAKCD....W--------------
Q9ZUQ8_ARATH/373-439--------GHPLYVGSVFKNK..QVIQQTMRL-VAIK---KCFRYKQTRSC.PKRLEMFCV....D--------------
Q9M905_ARATH/37-103--------NVITGVDQRFNTF..LEFRDALHK-YSVA---HGFAYKYKKND.SHRVSVKCK....A--------------
Q9FH11_ARATH/196-263--------SGDIRIEQVFDSI..AEFKEAVID-YALK---KGVNIKFTRWG.SEKSEVRCS...IG--------------
Q9SH73_ARATH/427-493--------DHDLRVGLCFKDI..DGLKKAVDW-CSFR---GQRSCVMREAE.KDEYMFECA....R--------------
Q9ST50_MAIZE/292-359--------NIDIKVGLLFKDL..PTLRQWLQE-YSVN---RKRPFKVRHSYAQRRYTVVCE....V--------------
Q6L3K3_SOLDE/167-232--------FLELEKGMCFKDL..KEAKRIVSF-YSIV---RKVALKVEKSD.STRLRYLC.....D--------------
Q948I2_ORYSJ/282-347--------EEP.KKGLEFKSL..ELLQIWLQS-YSIS---VHRPFHVKHSNTSKKYTVACI....E--------------
Q2QQS2_ORYSJ/220-288--------ENEVIQGAIYSRA..EDMKEAVKH-FAVS---LHREFWVAKSN.RPQYEVRCVK..EK--------------
Q2QSJ6_ORYSJ/167-233--------KPCMKAGTMYPNM..KEFRLAVRQ-YAIN---EEFELHLIKTD.PERYIGCCK....V--------------
O04332_ARATH/177-243--------EHNLIVGMEFSDV..LACRRALRD-AAIA---LRFEMQTVKSD.KTRFTAKCN....S--------------
Q9SH73_ARATH/2753-2819--------DHDMHLGLCFKDR..DELKKAVDW-WCIR---RRRNCIVRETE.KEMYTFECV....R--------------
Q2QM14_ORYSJ/278-347--------KPCVDEGTFFQIV..NQCKKAFTH-HAVL---KAYGFFTKKKD.KTRLILVCKR.AKE--------------
Q2QWR3_ORYSJ/508-574--------VPKFELGMKFSCK..KQFKKVITT-YAIA---ERKVINFGKDD.GQRVRANCD....W--------------
Q9M3E4_ARATH/185-253--------GIGDLVGQEFRSK..EAVWDLINR-ASKE---EVFGVKTIKSD.TGRLMLECSQ..AS--------------
Q9ZQM3_ARATH/54-121--------NDNMFVGRTFASR..EDFRIALSI-YAIN---FIFRFKFTRYE.KHYLVVECY....D--------------
Q9M256_ARATH/213-281--------GVNLTIGQEFGSK..KAVQDLLEK-GAHK---NCFEYDIMKSD.PMLYVVKCTG..KK--------------
Q9LPE7_ARATH/628-694--------GKGIYKGKVYASK..EDCQIGLAI-YAIK---NMFHFKQTRTK.WNYFVLSCS....D--------------
A3BFR5_ORYSJ/258-324--------VPHFELGMKFNSK..AQFRAAITR-YALS---ERKVINFIKSD.PKRVRAKYD....W--------------
Q60DJ3_ORYSJ/319-384--------NPNFKVGLVFPSV..EKLRQAITE-YSVR---NRVEIKMPRND.RRRIRAHC.....A--------------
Q5GIT1_CUCME/232-298--------SEELDVGQIFFCK..RDLSMRLSV-LAMK---KNFQFVVKKST.KEVLFVRCI....D--------------
Q2QTR1_ORYSJ/168-234--------NPRIEVGVTFEDG..LCFKKCMRQ-YAVL---KEVELAVPYSE.ATRYRAYCK....A--------------
Q2QMP0_ORYSJ/171-237--------EFQLVVGQEFPDV..MSCRRAIRN-TAIA---CHFEIQTVKSD.KTRFTAKCS....A--------------
Q6F2Q5_ORYSJ/285-350--------SKQVKVGQMFHDK..GHLHDAVKR-WAFV---QKREFRVKVSN.RTTYDVKCI....Q--------------
Q9C702_ARATH/177-243--------GDTMRVGLCFKDL..AEMKKAVDW-CSIK---RRQKCLLRETE.KDVYVVECE....R--------------
Q8LNV8_ORYSJ/313-379--------DPPMEVGSLYISM..VEFRSAVRQ-HAIK---GQFELGTEKTD.TERFRGYCT....A--------------
Q9LP20_ARATH/461-527--------GDDIYIGRIFKSK..EDCATKLAI-HAIH---WKFHFIYAKSG.PNIVAAVCV....S--------------
Q10MA4_ORYSJ/305-371--------TPTFTLGQLFDCK..KEFKDAVIK-HALA---NRRYVEFVKDE.GDRVRAKCE....W--------------
Q2QP77_ORYSJ/156-223--------KLVSPKGKQLSSAAVEALRDAINE-YSVK---NRVAIKMPYND.KDRIRAHC.....D--------------
O65231_ARATH/305-371--------CETLFVGSVFKNR..KVLQQTMSL-QPIK---QCFCFKQPKSC.PKTLKMVCV....D--------------
Q60CX5_SOLTU/147-213--------NLFIAEKQIYNDK..ETLMEVMRH-YGVV---EKFKFLVTRSS.SSCYYLKCP....A--------------
Q9LN76_ARATH/167-238--------EVLLAIEKTFNSP..DDFKRAVLM-YSLK---TRYNINFYRSE.SLMVAAKCCY..VN--------------
Q7XM49_ORYSJ/288-353--------DPPMEVGTKYPSM..NEFRMAVKQ-HAIV---SEFELETEKSD.PDRFRGKCS....A--------------
Q8LNC1_ORYSJ/207-273--------NPCMDLGTAYPSM..EEFRLAMRQ-FAIN---NEFELDVVKTD.PTRYIGGCK....V--------------
Q9XEC9_ARATH/230-296--------GDAIYIGWVFNNK..VELHKTLTM-YSMK---RLFNFRIKASD.KTRVIAVCD....D--------------
Q9ZV73_ARATH/50-116--------GDNIFIGRLFKNK..EDCATKLAI-HAIR---RKFNFITAKSC.PNIVLAVCV....S--------------
Q7XKR6_ORYSJ/269-335--------TPKFEIGMTFAGR..AKFKEAVIK-YGLV---TNRHIRFPKDE.AKKIRARCS....W--------------
Q75H66_ORYSJ/284-349--------NPVFKVGMVFPSV..ELLRKTITE-YSLK---NRVDIKMPRND.RTRIKAHC.....A--------------
Q8H8H0_ORYSJ/332-398--------MPMIKEEAVFPDM..ITFRKAIRH-FAVV---TGFELSNLQTD.PTRLIAHCK....H--------------
Q9C806_ARATH/173-240--------DDRLAIGRTFFTG..FEFKEVVLH-YAMK---HRINAKQNRWE.KDKISFRCA...QR--------------
Q75KS5_ORYSJ/197-263--------DGQINLGAMFRDK..TGLQDAVKS-WSFQ---MQRQFRVVKSN.RTEYTIVCE....T--------------
Q2QQX5_ORYSJ/302-368--------VDGLRKGLEFPSM..VALKLWLQE-YAIV---HHRPYRVVNSAANRRYTVKCE....N--------------
Q9FH43_ARATH/230-296--------SLGLAVGQCFETK..DHLETRLKI-LTVL---EKFDFDVSKST.PTLYFVKCW....I--------------
Q9SI25_ARATH/208-276--------GTCIEIDQEFCSR..EAVWELVNK-AAKQ---EVFGVNTIKSE.PLRLMLRCRQ..AS--------------
Q9MAQ6_ARATH/45-111--------ADSLFIGKFFKDK..DEMVFTLRM-FAVK---HSFEFHTVKSD.LTRYVLHCI....D--------------
Q9LDY3_ARATH/190-256--------GIGLTLRQEFPSR..AALQEVVDK-GAFA---NSFDYVIKKSD.KERYVLTCS....K--------------
O80466_ARATH/196-262--------GIGLTLRQEFPNK..AALHEVVDR-AAFA---NSFGYVIKKSD.KERYVLKCA....K--------------
Q9SHN7_ARATH/496-562--------LFERLHDSLFKNK..EDCTTKLAI-HPIR---RKFHFIYAKSC.PNIVFAMCV....S--------------
Q0D1G9_ASPTN/6-73--------DIKWRRGLKFPSL..EEGRAALIQ-HTID---QQQSFRVDKSD.HKRFFTRCL...SG--------------
Q9SH73_ARATH/2030-2096--------DHDLRVGLCFKDG..DELKKAVDW-CSLK---AQQKCVVRETA.KDEYIFECI....R--------------
Q10J76_ORYSJ/148-214--------DGPINKGTMFSTK..SAFQDAVKS-WSFK---MQRQFKVLKSS.LTVYTAVCE....T--------------
Q9S9W4_ARATH/271-337--------EKGIYKGRVYASK..QDCQISLAI-HAIK---EQFYFKQSRTK.RHYFVITCA....D--------------
Q0DAT1_ORYSJ/144-210--------NVITGVGQVFDGP..KDFRDALHK-YAIA---HKFHYRFIKND.SSRVTAECT....G--------------
Q9SHU0_ARATH/252-318--------TLTLAVGQQYRSK..FELEYRLKL-LAIR---DGFDFDVPTSN.KTTVSYECW....V--------------
Q9AYI6_ORYSJ/366-432--------DIIKGVGQEFDNV..KDFRAQLCK-YAIG---KGFVYRFIKNE.TTRVTVKCV....G--------------
Q5NRP3_SOLDE/312-378--------VAIFELGMVFENA..IEFRKAVAE-YAVE---YKVKLKLRPNE.KHRVRVKCQ....H--------------
Q9LRP4_ARATH/222-288--------GLDLVIGQEFENS..DDVKYLVET-GANR---NCFGLTLLNSN.KKRYVVKCA....E--------------
Q94HK4_ORYSA/173-241--------TSQLCKGMCFTDA..GQFRKALKS-YHIV---KGRDYKYTRNK.ADRIKVKC.....S--------------
P93802_MAIZE/127-194--------NPSMQPGCLFPNM..KEFRIAMRQ-YAIK---HEFELGIEVTS.TTRYVGYCK....G--------------
Q10PZ8_ORYSJ/248-316--------DPCIDVGVVFPDV..DQCKLAVTH-HAIL---NDHAFETVKND.KKRFRAICKR..AE--------------
Q9FWH9_ORYSJ/256-321--------TPEFKVSMMFADA..VELRKAIDQ-YTIK---NRVAIKKTRNT.KTRIEAKC.....A--------------
Q8LDM6_ARATH/75-142--------SGKLKIKQVFDTL..EEFKEAMVD-YVLK---GGWNVKFTRWG.KDKSELKCA...MK--------------
Q65XP0_ORYSJ/187-257--------NPSMALGTMYPTM..EEFNLAVRQ-FAIK---EEFDLGVEKSC.KTRYRAYCK...SG--------------
O49511_ARATH/64-137--------DGFLYHKQSFFSG..VAFKEAVID-YALR---TGHNLKQYRYD.KDKIGFICVGCDGK--------------

PF03101

FRS4_ARATH/11-97........................IN.....PRASPK------------------------------------IG---CK
FRS8_ARATH/109-194.........................S.....RRKETR------------------------------------TG---CQ
FRS10_ARATH/69-161....................NVEHPR.....ERKSVR------------------------------------CG---CD
FRS1_ARATH/35-137......TDG.FNI....PQARKRGRI.....NRSSSK------------------------------------TD---CK
FRS5_ARATH/87-179........T.K.........DREIKR.....PRTITR------------------------------------VG---CK
Q60DY0_ORYSJ/112-207........V.S.........DESGKKKRKTPYMMETR------------------------------------CG---CE
Q7XTS2_ORYSJ/200-284.........................R.....PRPETR------------------------------------TG---CP
Q75G83_ORYSJ/99-180...............................SLDTTR------------------------------------TC---CK
Q2QXI4_ORYSJ/11-101.....................NLTKH.....PRAETR------------------------------------IG---CN
Q2QQ59_ORYSJ/88-167........P...........EDRARR.....ERALTR------------------------------------ME---CA
Q6NLE7_ARATH/25-111........................SS.....SSSSSR------------------------------------EG---CK
Q8S7I2_ORYSJ/428-515......................DPKK.....PRPETR------------------------------------TG---CL
Q9AYR2_CARTI/58-154.......LN.KK.......SGERRRR.....NSNLKR------------------------------------AG---CM
Q67IU6_ORYSJ/64-145...............................TGPPTR------------------------------------IG---CK
Q60DS9_ORYSJ/338-446....DEVES.CLQTN.TTSPLVKRRK.....QNKVVY------------------------------------TN---CK
Q6UTZ9_ORYSJ/293-415QEEEEEEEEEVEEEEQIEEATEQERQ.....TNVLKK------------------------------------TG---CK
FRS12_ARATH/57-133...................................SR------------------------------------TG---CT
Q8H344_ORYSJ/116-204.....................KEAKC.....PRPETR------------------------------------IG---CP
Q7XKT7_ORYSJ/54-140.......................KAR.....RRLVAK------------------------------------TG---CK
Q75L92_ORYSJ/430-528.......TV.DE.......TATGERK.....TNEVIG------------------------------------TE---CK
Q5NKQ1_MAIZE/85-173.....................TPKVR.....NTISKR------------------------------------TQ---CR
Q6K1Y1_ORYSJ/53-137.........................R.....KRASST------------------------------------TN---CP
Q93Z68_ARATH/84-172......................KVIR.....QRAETR------------------------------------VG---CK
Q9M4X4_MAIZE/39-125......................KNQK.....KHFETR------------------------------------CG---CN
Q8LHZ8_ORYSJ/58-145......................TRSA.....RKRGTK------------------------------------TG---CK
Q6ESZ2_ORYSJ/64-154.....................NHTRT.....PQPDTR------------------------------------TG---CH
Q2QY69_ORYSJ/36-126.....................VVAKR.....NRAHTR------------------------------------TG---CQ
Q2R8S0_ORYSJ/87-181.....................DQISNYGQCFSRPETR------------------------------------CM---CR
Q53PZ5_ORYSJ/591-683........V...........SNRSRE.....PQALTR------------------------------------CG---CK
FRS3_ARATH/63-137.....................................------------------------------------ES---CD
FAR1_ARATH/65-154.....................GSSSR.....RSTVKK------------------------------------TD---CK
Q6AT58_ORYSJ/82-184......PVA.AGS....GEDSGRGRR.....TRAVTR------------------------------------VG---CK
FRS12_ARATH/225-301...................................SR------------------------------------MG---CG
Q2QXD6_ORYSJ/96-184......................EANF.....NKPDTR------------------------------------TN---CK
Q84JA7_ARATH/47-136.....................SESRK.....PRAITR------------------------------------EG---CK
Q6EP19_ORYSJ/30-120........R...........TERKRE.....PRALTH------------------------------------CG---CL
Q25AC7_ORYSA/379-474.......SA.EE.......TVVSERN.....TNENDA------------------------------------TD---CK
Q75LD4_ORYSJ/42-126.........................Q.....ARPTAK------------------------------------TN---CQ
Q6K4T2_ORYSJ/290-375........E.N.........PMKKRR.....SNLVEK------------------------------------TQ---CK
Q10DV6_ORYSJ/41-131....................TGKRKR.....KRAIIR------------------------------------EG---CH
Q7XUD2_ORYSJ/473-571.......ET.EE.......TVVAERN.....NNEIKA------------------------------------TS---CN
Q5JMV5_ORYSJ/380-476........K.K........KTQQQRN.....TQVIDR------------------------------------TD---CK
Q53M07_ORYSJ/37-129........L.D.........ASKKRR.....NRASAR------------------------------------AA---CP

PF04500

FWCH1_MOUSE/402-460-------------------------------......------------------------------------MG---CR
FWCH1_MOUSE/235-293-------------------------------......------------------------------------HG---CR
A7UT18_ANOGA/463-522-------------------------------......------------------------------------.M---CG
A7UT18_ANOGA/543-605-------------------------------......------------------------------------VV---CR
FWCH1_HUMAN/600-658-------------------------------......------------------------------------LG---CR
Q16SJ4_AEDAE/393-453-------------------------------......------------------------------------RK---CP
Q17CC2_AEDAE/19-83-------------------------------......------------------------------------LG---CS
Q6IDT6_DROPS/406-467-------------------------------......------------------------------------ER---CP
Q16WE4_AEDAE/17-80-------------------------------......------------------------------------SM---CR
Q6IDT7_DROPS/405-469-------------------------------......------------------------------------TV---CR
Q6NP69_DROME/162-227-------------------------------......------------------------------------IE---CT
Q16SI9_AEDAE/387-448-------------------------------K....L------------------------------------KS---CP
Q17CD4_AEDAE/347-409-------------------------------......------------------------------------LR---CK
Q6IDX3_ANOGA/370-431-------------------------------......------------------------------------KK---CL
Q6IDX8_ANOGA/378-443-------------------------------......------------------------------------LH---CK
Q6IDX0_ANOGA/458-517-------------------------------......------------------------------------NQ---CP
Q6IDZ2_ANOGA/392-456-------------------------------......------------------------------------QK---CR
Q17EL2_AEDAE/670-734-------------------------------.....K------------------------------------MN---CQ
Q17CD3_AEDAE/199-260-------------------------------......------------------------------------HK---CK
Q9XWQ6_CAEEL/134-195-------------------------------......------------------------------------..---CP
Q6IDX4_ANOGA/383-444-------------------------------......------------------------------------MK---CR
Q16WH6_AEDAE/7-75-------------------------------TT.EQR------------------------------------RN---CS
Q17EL2_AEDAE/762-821-------------------------------......------------------------------------..---CH
Q17EL2_AEDAE/236-296-------------------------------......------------------------------------..---CP
Q70BY8_DROVI/421-485-------------------------------KV..HE------------------------------------QR---CR
Q16FH8_AEDAE/26-95-------------------------------KTKRDG------------------------------------SK---CP
Q7Z1Q1_CAEEL/53-119-------------------------------MHDGQW------------------------------------CK---CR
Q16SK1_AEDAE/387-448-------------------------------......------------------------------------LG---CK
Q17C92_AEDAE/22-90-------------------------------EK.TSD------------------------------------TG---CK
Q17CD5_AEDAE/89-153-------------------------------......------------------------------------LN---CT
Q6NP69_DROME/596-663-------------------------------P....D------------------------------------IN---CK
Q6IDU1_DROPS/408-468-------------------------------......------------------------------------HK---CK
Q70BX1_DROVI/435-497-------------------------------......------------------------------------HC---CR
A0APY4_DROSI/32-92-------------------------------......------------------------------------FN---CK
Q17MH0_AEDAE/8-77-------------------------------AA.GSN------------------------------------NK---CA
Q6IDX1_ANOGA/395-454-------------------------------......------------------------------------HD---CK
Q6IDZ9_ANOGA/372-437-------------------------------......------------------------------------QK---CR
Q16SJ1_AEDAE/385-449-------------------------------KI..KE------------------------------------ER---CR
Q17CC5_AEDAE/2-67-------------------------------......------------------------------------EK---CR
Q17CC4_AEDAE/1-62-------------------------------......------------------------------------LK---CR
Q6IDZ0_ANOGA/386-445-------------------------------......------------------------------------LK---CK
Q16SK0_AEDAE/393-454-------------------------------......------------------------------------KK---CK
Q16SK2_AEDAE/394-455-------------------------------......------------------------------------QA---CR
Q6IDT9_DROPS/430-492-------------------------------......------------------------------------.Q---CR
Q6IJJ6_DROME/2-63-------------------------------......------------------------------------MR---CA
Q8MRZ1_DROME/2-65-------------------------------......------------------------------------VK---CR
Q6IDW8_ANOGA/371-432-------------------------------......------------------------------------FR---CP
Q17CA9_AEDAE/249-307-------------------------------......------------------------------------LG---CN
Q17CB7_AEDAE/18-77-------------------------------......------------------------------------..---CR
Q6IDZ6_ANOGA/364-419-------------------------------......------------------------------------HK---CR
Q6IDT2_DROPS/408-472-------------------------------......------------------------------------AN---CK
Q17EK9_AEDAE/1691-1752-------------------------------......------------------------------------KK---CP
Q17IM0_AEDAE/257-318-------------------------------......------------------------------------.N---CL
Q6IDT3_DROPS/404-463-------------------------------.....H------------------------------------IK---CH
Q6IDW1_ANOGA/381-442-------------------------------......------------------------------------IR---CS
Q7QDH8_ANOGA/445-505-------------------------------......------------------------------------YH---CK
Q7YTX4_DROME/183-246-------------------------------......------------------------------------SM---CR
Q6IDZ7_ANOGA/373-431-------------------------------......------------------------------------HK---CT
Q18225_CAEEL/143-204-------------------------------......------------------------------------..---CN
Q17CD3_AEDAE/4-68-------------------------------......------------------------------------LK---CK
Q17CD3_AEDAE/86-145-------------------------------......------------------------------------LG---CR
Q6IDY5_ANOGA/394-455-------------------------------......------------------------------------CK---CP
Q17EK9_AEDAE/424-486-------------------------------......------------------------------------GM---CR
Q6IDU0_DROPS/419-479-------------------------------......------------------------------------TK---CN
Q16SI1_AEDAE/384-445-------------------------------......------------------------------------LR---CP
Q6IDY6_ANOGA/439-499-------------------------------......------------------------------------.N---CK
Q16SJ5_AEDAE/380-443-------------------------------S....K------------------------------------LK---CP
Q17CB7_AEDAE/197-258-------------------------------......------------------------------------KN---CR
Q70BY4_DROVI/421-485-------------------------------......------------------------------------QK---CR
Q6IE02_BOMMO/284-343-------------------------------......------------------------------------GF---CR
A1L1L4_RAT/92-150-------------------------------......------------------------------------LG---CR
A7DTF1_CAEEL/131-192-------------------------------......------------------------------------..---CK
Q17CD5_AEDAE/175-239-------------------------------......------------------------------------LG---CT
Q70BY7_DROVI/415-476-------------------------------......------------------------------------LG---CS
Q6IDY2_ANOGA/385-450-------------------------------......------------------------------------HG---CR
Q6IDU2_DROPS/436-495-------------------------------......------------------------------------LR---CR
Q6IDV5_DROPS/431-497-------------------------------.....Q------------------------------------ES---CK
Q6IDY1_ANOGA/404-467-------------------------------......------------------------------------FN---CR
Q16SI4_AEDAE/385-447-------------------------------......------------------------------------LH---CM
Q6IDX5_ANOGA/379-440-------------------------------......------------------------------------KK---CR
Q6IDX7_ANOGA/374-437-------------------------------......------------------------------------SK---CR
Q16SI2_AEDAE/384-446-------------------------------......------------------------------------LA---CK
Q16SJ2_AEDAE/416-472-------------------------------......------------------------------------CK---CP
Q17CC3_AEDAE/84-147-------------------------------......------------------------------------LK---CR
Q6NP69_DROME/365-432-------------------------------K....A------------------------------------NT---CH
Q17EL2_AEDAE/360-420-------------------------------......------------------------------------..---CR
Q17CC0_AEDAE/72-136-------------------------------......------------------------------------NK---CK
Q6IDT4_DROPS/418-482-------------------------------K....K------------------------------------LK---CP
Q6IDY3_ANOGA/373-432-------------------------------......------------------------------------IK---CH
Q17CB6_AEDAE/76-137-------------------------------......------------------------------------LK---CC
Q6IDX6_ANOGA/379-439-------------------------------......------------------------------------DN---CR
Q16SJ8_AEDAE/412-474-------------------------------......------------------------------------FR---CR
Q17CB9_AEDAE/37-98-------------------------------......------------------------------------CK---CP
Q16FU8_AEDAE/997-1058-------------------------------......------------------------------------VN---CM
Q6IDV1_DROPS/437-498-------------------------------K....Y------------------------------------IK---CT
Q17EK9_AEDAE/344-403-------------------------------......------------------------------------..---CR
Q6IDZ5_ANOGA/397-459-------------------------------K....L------------------------------------GN---CK
Q70BY0_DROVI/442-507-------------------------------KR.INE------------------------------------NK---CS
Q6IDX2_ANOGA/381-447-------------------------------......------------------------------------VR---CS
Q6IDV9_DROPS/402-461-------------------------------......------------------------------------LQ---CP
Q70BX7_DROVI/443-509-------------------------------.....L------------------------------------PA---CN
Q6IDY8_ANOGA/367-431-------------------------------......------------------------------------HR---CK
Q16SI5_AEDAE/381-443-------------------------------......------------------------------------HG---CK
Q16SJ7_AEDAE/381-447-------------------------------......------------------------------------LK---CR
Q17CD4_AEDAE/155-214-------------------------------......------------------------------------LG---CK
Q17EK9_AEDAE/1138-1199-------------------------------......------------------------------------..---CR
Q70BX4_DROVI/425-491-------------------------------V....K------------------------------------IR---CP
MMD4_DROME/452-512-------------------------------.....G------------------------------------EE---CK
Q17EK9_AEDAE/1463-1528-------------------------------......------------------------------------NH---CS
Q16SI0_AEDAE/430-495-------------------------------......------------------------------------VK---CK
Q16SB8_AEDAE/1076-1143-------------------------------Q....N------------------------------------FK---CK
Q70BY9_DROVI/420-480-------------------------------......------------------------------------LR---CK
Q6IDT8_DROPS/449-507-------------------------------......------------------------------------.K---CK
Q6IDY0_ANOGA/370-433-------------------------------......------------------------------------YH---CK
Q17CD2_AEDAE/110-170-------------------------------......------------------------------------LK---CK
Q6NP69_DROME/17-87-------------------------------K....S------------------------------------TP---CK
Q17EL2_AEDAE/459-522-------------------------------......------------------------------------TK---CP
Q17CB7_AEDAE/98-160-------------------------------......------------------------------------RK---CR
Q16SI3_AEDAE/390-452-------------------------------......------------------------------------LR---CK
Q16SJ6_AEDAE/386-449-------------------------------......------------------------------------LK---CR
Q70BZ1_DROME/25-91-------------------------------......------------------------------------AK---CR
A8XLA6_CAEBR/145-206-------------------------------......------------------------------------..---CP
Q6IDV2_DROPS/410-473-------------------------------L....L------------------------------------IR---CP
Q16SJ0_AEDAE/390-455-------------------------------RK..GP------------------------------------NR---CS
Q17EK9_AEDAE/1257-1320-------------------------------......------------------------------------KS---CR
Q70BX5_DROVI/426-484-------------------------------......------------------------------------.Q---CR
Q6IDX9_ANOGA/370-433-------------------------------......------------------------------------YR---CR
Q17EK9_AEDAE/94-153-------------------------------......------------------------------------GG---CQ

PF03106

Q9SE29_ORYSA/129-187-------------------------------------------------------------------------.S---CP
WRK34_ARATH/371-430-------------------------------------------------------------------------.G---CT
WRK59_ARATH/108-167-------------------------------------------------------------------------.D---CN
Q9SXP5_TOBAC/195-254-------------------------------------------------------------------------.G---CP
WRK13_ARATH/222-281-------------------------------------------------------------------------.K---CR
WRKY1_ARATH/306-365-------------------------------------------------------------------------.G---CP
Q9XFF1_AVESA/182-240-------------------------------------------------------------------------.G---CS
WRKY1_ARATH/110-168-------------------------------------------------------------------------.N---CK
WRK41_ARATH/140-202-------------------------------------------------------------------------QY---CW
Q9SQ04_PETCR/190-248-------------------------------------------------------------------------.N---CP
WRK43_ARATH/29-88-------------------------------------------------------------------------.M---CN
WRK46_ARATH/103-165-------------------------------------------------------------------------QD---CL
WRK18_ARATH/175-235-------------------------------------------------------------------------PS---CP
WRK20_ARATH/210-268-------------------------------------------------------------------------.N---CE
WRK39_ARATH/261-321-------------------------------------------------------------------------RG---CP
WRK34_ARATH/177-235-------------------------------------------------------------------------.N---CE
Q9XFF0_AVESA/243-303-------------------------------------------------------------------------RG---CP
WRK44_ARATH/348-407-------------------------------------------------------------------------.N---CR
WRK23_ARATH/173-232-------------------------------------------------------------------------.S---CN
WRK25_ARATH/165-223-------------------------------------------------------------------------.D---CV
WRK29_ARATH/133-193-------------------------------------------------------------------------KG---CL
Q9ZPL7_TOBAC/299-358-------------------------------------------------------------------------.G---CP
WRK14_ARATH/216-276-------------------------------------------------------------------------KG---CS
Q9ZPL7_TOBAC/123-181-------------------------------------------------------------------------.N---CL
WRK44_ARATH/164-222-------------------------------------------------------------------------.K---CP
WRK56_ARATH/113-172-------------------------------------------------------------------------.T---CN
WRK47_ARATH/238-298-------------------------------------------------------------------------VG---CP
Q39658_CUCSA/235-293-------------------------------------------------------------------------.N---CP
WRK22_ARATH/127-187-------------------------------------------------------------------------KG---CL
WRK19_ARATH/467-525-------------------------------------------------------------------------.G---CP
WRK25_ARATH/327-386-------------------------------------------------------------------------.G---CG
WRKY3_ARATH/249-307-------------------------------------------------------------------------.A---CP
WRK32_ARATH/330-389-------------------------------------------------------------------------.G---CP
WRK32_ARATH/167-225-------------------------------------------------------------------------.E---CC

PF03615

Q29NA7_DROPS/62-205---------LPNGSRINLRPAICDKARRKQEGKQCPN------------------------------------KS---CR
Q5TQ16_ANOGA/2-145---------LPNGGQINLRPAICDKARRKQQGRACPN------------------------------------RH---CK
GCM_DROME/46-188---------LPNGASVHLRPAICDKARRKQQGKQCPN------------------------------------RN---CN
Q2KT54_DANRE/36-176---------LPDGSKLQLRPAICDKARQKQQKKLCPN------------------------------------..---CN
GCM1_HUMAN/29-169---------AEEGRKIYLRPAICDKARQKQQRKRCPN------------------------------------..---CD
Q8MMJ4_STRPU/65-208---------TSSGEIVTVRPATSDRARKKQGDKKCPR------------------------------------TG---CD

PF08731

Q6BK98_DEBHA/21-107...............................................................KLSLGS....RRQISCP
Q59Z29_CANAL/21-112...............................................................SKKTASKTMIRKHTSCP
AFT2_YEAST/51-137...............................................................KSKGSS....SRSHACP
AFT1_YEAST/108-243DHEDEKSKINDDELE.......................YASPSNATVTNGPQTSPDQTSSIKPKKKRCV....SRFNNCP
Q6FS49_CANGA/15-125QEA................................................LAREHEMKRKSMGNKRCV....SRYNHCP
Q6CS78_KLULA/99-257VGSDSCNTNGKNSTKGNGSNDNKCRKKGIGKGFAECDGLETETENGNNSNSTVGGGNGSNDTDKKKRAI....GPYNSCP
Q6FSP0_CANGA/42-131.............................................................LRQKEPVD....DKRHICP
Q755B2_ASHGO/89-206DELGGQ.........................................YETLPLSPVVTASQLRKKKRAV....SPYNTCP

PF03108

Q94HS2_ORYSJ/177-242-------------------------------------------------------------------------EG...CP
Q94H23_ORYSJ/164-229-------------------------------------------------------------------------EN...CP
Q0DBW2_ORYSJ/8-75-------------------------------------------------------------------------SD...CP
Q0J5I2_ORYSJ/345-411-------------------------------------------------------------------------KG...CP
Q9SUF8_ARATH/168-235-------------------------------------------------------------------------SG...CK
Q84JZ9_ORYSJ/312-376-------------------------------------------------------------------------RH...CK
Q9ZQK9_ARATH/327-393-------------------------------------------------------------------------EK...CD
O22271_ARATH/106-173-------------------------------------------------------------------------GK...CK
Q9FFR0_ARATH/219-284-------------------------------------------------------------------------NY...CR
Q60D51_SOLDE/156-222-------------------------------------------------------------------------DD...CC
Q6NKQ0_ARATH/136-205-------------------------------------------------------------------------EK...CP
Q8LN69_ORYSJ/215-281-------------------------------------------------------------------------ED...CP
Q9C8V7_ARATH/134-202-------------------------------------------------------------------------DTDVKCQ
Q9LPT8_ARATH/341-407-------------------------------------------------------------------------ET...CP
O22278_ARATH/233-302-------------------------------------------------------------------------TG...CQ
Q10M31_ORYSJ/331-397-------------------------------------------------------------------------PG...CK
Q9SJR8_ARATH/196-262-------------------------------------------------------------------------KT...CP
Q9FH72_ARATH/102-168-------------------------------------------------------------------------DY...CK
Q6L470_SOLDE/182-249-------------------------------------------------------------------------NA...CK
Q84R97_ORYSJ/298-366-------------------------------------------------------------------------QG...CK
Q2R0C2_ORYSJ/1370-1436-------------------------------------------------------------------------DE...CP
Q25A06_ORYSA/1224-1291-------------------------------------------------------------------------KD...CT
Q9M9F3_ARATH/337-408-------------------------------------------------------------------------DEGVECP
Q65X43_ORYSJ/10-78-------------------------------------------------------------------------DG...CK
Q9M9L2_ARATH/201-267-------------------------------------------------------------------------EG...CP
Q7XWS4_ORYSJ/282-348-------------------------------------------------------------------------AS...CP
Q9ZUQ8_ARATH/373-439-------------------------------------------------------------------------RN...CS
Q9M905_ARATH/37-103-------------------------------------------------------------------------QG...CP
Q9FH11_ARATH/196-263-------------------------------------------------------------------------GN...CK
Q9SH73_ARATH/427-493-------------------------------------------------------------------------WK...CK
Q9ST50_MAIZE/292-359-------------------------------------------------------------------------SE...CN
Q6L3K3_SOLDE/167-232-------------------------------------------------------------------------IG...CP
Q948I2_ORYSJ/282-347-------------------------------------------------------------------------ES...CE
Q2QQS2_ORYSJ/220-288-------------------------------------------------------------------------DG...CP
Q2QSJ6_ORYSJ/167-233-------------------------------------------------------------------------DG...CP
O04332_ARATH/177-243-------------------------------------------------------------------------EG...CP
Q9SH73_ARATH/2753-2819-------------------------------------------------------------------------WK...CK
Q2QM14_ORYSJ/278-347-------------------------------------------------------------------------EN...CK
Q2QWR3_ORYSJ/508-574-------------------------------------------------------------------------ES...CP
Q9M3E4_ARATH/185-253-------------------------------------------------------------------------KG...CD
Q9ZQM3_ARATH/54-121-------------------------------------------------------------------------KQ..CCD
Q9M256_ARATH/213-281-------------------------------------------------------------------------FG...CK
Q9LPE7_ARATH/628-694-------------------------------------------------------------------------EK...CD
A3BFR5_ORYSJ/258-324-------------------------------------------------------------------------SS...CP
Q60DJ3_ORYSJ/319-384-------------------------------------------------------------------------EG...CP
Q5GIT1_CUCME/232-298-------------------------------------------------------------------------NK...CG
Q2QTR1_ORYSJ/168-234-------------------------------------------------------------------------KK...CK
Q2QMP0_ORYSJ/171-237-------------------------------------------------------------------------DG...CP
Q6F2Q5_ORYSJ/285-350-------------------------------------------------------------------------GG...CP
Q9C702_ARATH/177-243-------------------------------------------------------------------------WH...CK
Q8LNV8_ORYSJ/313-379-------------------------------------------------------------------------EG...CP
Q9LP20_ARATH/461-527-------------------------------------------------------------------------DT...CP
Q10MA4_ORYSJ/305-371-------------------------------------------------------------------------KL...YP
Q2QP77_ORYSJ/156-223-------------------------------------------------------------------------ET...CL
O65231_ARATH/305-371-------------------------------------------------------------------------ET...CP
Q60CX5_SOLTU/147-213-------------------------------------------------------------------------DN...CS
Q9LN76_ARATH/167-238-------------------------------------------------------------------------ELGVNCP
Q7XM49_ORYSJ/288-353-------------------------------------------------------------------------NG...CP
Q8LNC1_ORYSJ/207-273-------------------------------------------------------------------------DG...CV
Q9XEC9_ARATH/230-296-------------------------------------------------------------------------KK...CD
Q9ZV73_ARATH/50-116-------------------------------------------------------------------------HT...CP
Q7XKR6_ORYSJ/269-335-------------------------------------------------------------------------KD...CP
Q75H66_ORYSJ/284-349-------------------------------------------------------------------------EG...CP
Q8H8H0_ORYSJ/332-398-------------------------------------------------------------------------EG...CK
Q9C806_ARATH/173-240-------------------------------------------------------------------------KE...CE
Q75KS5_ORYSJ/197-263-------------------------------------------------------------------------EG...CT
Q2QQX5_ORYSJ/302-368-------------------------------------------------------------------------PR...CK
Q9FH43_ARATH/230-296-------------------------------------------------------------------------KG...CR
Q9SI25_ARATH/208-276-------------------------------------------------------------------------KG...CT
Q9MAQ6_ARATH/45-111-------------------------------------------------------------------------EN...CS
Q9LDY3_ARATH/190-256-------------------------------------------------------------------------AN...CD
O80466_ARATH/196-262-------------------------------------------------------------------------ES...CS
Q9SHN7_ARATH/496-562-------------------------------------------------------------------------HT...CL
Q0D1G9_ASPTN/6-73-------------------------------------------------------------------------RG...CP
Q9SH73_ARATH/2030-2096-------------------------------------------------------------------------WK...CK
Q10J76_ORYSJ/148-214-------------------------------------------------------------------------EG...CN
Q9S9W4_ARATH/271-337-------------------------------------------------------------------------EN...CQ
Q0DAT1_ORYSJ/144-210-------------------------------------------------------------------------ED...CP
Q9SHU0_ARATH/252-318-------------------------------------------------------------------------DR...CL
Q9AYI6_ORYSJ/366-432-------------------------------------------------------------------------EG...CT
Q5NRP3_SOLDE/312-378-------------------------------------------------------------------------KK...CK
Q9LRP4_ARATH/222-288-------------------------------------------------------------------------EG...CE
Q94HK4_ORYSA/173-241-------------------------------------------------------------------------QDKVKCD
P93802_MAIZE/127-194-------------------------------------------------------------------------GD...CP
Q10PZ8_ORYSJ/248-316-------------------------------------------------------------------------EG...CK
Q9FWH9_ORYSJ/256-321-------------------------------------------------------------------------EG...CP
Q8LDM6_ARATH/75-142-------------------------------------------------------------------------GD...CP
Q65XP0_ORYSJ/187-257-------------------------------------------------------------------------DEDCPCT
O49511_ARATH/64-137-------------------------------------------------------------------------EGGAKCE

PF03101

FRS4_ARATH/11-97-ASM------------HVKRRP...-DGKWYVYSFV.....KE---HNHDLLP------------
FRS8_ARATH/109-194-AMI------------RLRLIH...-FDRWKVDQVK.....LD---HNHSFDP------------
FRS10_ARATH/69-161-GKL------------YLTKEVVDG-VSHWYVSQFS.....NV---HNHELLE------------
FRS1_ARATH/35-137-AFL------------HVKRRQ...-DGRWVVRSLV.....KE---HNHEIFT------------
FRS5_ARATH/87-179-ASL------------SVKMQD...-SGKWLVSGFV.....KD---HNHELVP------------
Q60DY0_ORYSJ/112-207-AHI------------VVKLGS...-DKKYRISSMI.....GE---HSHGFVS------------
Q7XTS2_ORYSJ/200-284-ARI------------AIKLVS...-NGKYRVAEFV.....ED---HNHQLAA------------
Q75G83_ORYSJ/99-180-ARV------------QFSVCR...-KEIWMVQKVV.....LE---HNHDLVS------------
Q2QXI4_ORYSJ/11-101-VRM------------GLTLNR..V-NEKYEISDLE.....VM---HNHILQT------------
Q2QQ59_ORYSJ/88-167-ASL------------SIKLDK..K-RGIWFVDNFI.....DD---HNHPLTS------------
Q6NLE7_ARATH/25-111-ATI------------LVKMEK...-SGKWVVTRFI.....KE---HNHSLQF------------
Q8S7I2_ORYSJ/428-515-AHM------------TIKITV...-SGKYVVTEYV.....AD---HNHDLET------------
Q9AYR2_CARTI/58-154-ACM------------KVHYVK..S-IGRYEVYKFN.....EK---HSHMLFS------------
Q67IU6_ORYSJ/64-145-AMV------------RLNRSS..E-SQKWRVSAFV.....SE---HNHEMKR------------
Q60DS9_ORYSJ/338-446-AEM------------VITLK....-RGFWYITRLN.....LE---HNHPLSP------------
Q6UTZ9_ORYSJ/293-415-CMM------------MVEKMFA.L-GDVWQIATLD.....LK---HNHALCP------------
FRS12_ARATH/57-133-AFI------------RVQRRD...-TGKWVLDQIQ.....KE---HNHELGG------------
Q8H344_ORYSJ/116-204-ASM------------TIRLNT...-NGKYRLTEFV.....PN---HNHQLAT------------
Q7XKT7_ORYSJ/54-140-AMM------------VVKYNT..T-ENQWEVVFVE.....LE---HNHPCNP------------
Q75L92_ORYSJ/430-528-CVM------------VISER....-NLEWIITRLD.....LD---HNHELSP------------
Q5NKQ1_MAIZE/85-173-AGM------------KLKKIY..D-DAKENIISVRIDLIHLE---HNHEFFR------------
Q6K1Y1_ORYSJ/53-137-AKI------------RVKLWG...-DKLLHVELAI.....LD---HNHPVSP------------
Q93Z68_ARATH/84-172-AMI------------LIRKEN...-SGKWVITKFV.....KE---HNHSLMP------------
Q9M4X4_MAIZE/39-125-ARV------------YVRLGQ...-DKRYYIASFV.....EE---HNHGLVS------------
Q8LHZ8_ORYSJ/58-145-AKM------------IVKDAH..F-QNRWEVIVLE.....LE---HNHPLDP------------
Q6ESZ2_ORYSJ/64-154-ANL------------VIRRKN..D-TSKYEVYAFE.....AQ---HNHPLFI------------
Q2QY69_ORYSJ/36-126-VRM------------GITLLR..E-TMTYKVHDLA.....VE---HNHLLQT------------
Q2R8S0_ORYSJ/87-181-ACM------------KISLRD...-DGLYCIYEFL.....HE---HNHILAT------------
Q53PZ5_ORYSJ/591-683-AQF------------EIKLYQ..K-EGNWYVVRFV.....SK---HNHPLCK------------
FRS3_ARATH/63-137-AMV------------RIELQG...-HEKWVVTKFV.....KE---HTHGLAS------------
FAR1_ARATH/65-154-ASM------------HVKRRP...-DGKWIIHEFV.....KD---HNHELLP------------
Q6AT58_ORYSJ/82-184-AMI------------RVKKQD...-NGRWAVTKLE.....TA---HNHPLVP------------
FRS12_ARATH/225-301-AYM------------RIKRQD...-SGGWIVDRLN.....KD---HNHDLEP------------
Q2QXD6_ORYSJ/96-184-AMV------------RYRVDS...-EGHWRVIQIV.....PE---HNHELVR------------
Q84JA7_ARATH/47-136-ALI------------VVKREK...-SGTWLVTKFE.....KE---HNHPLLP------------
Q6EP19_ORYSJ/30-120-AKL------------EIERNE..E-KGVWFVKEFD.....NQ---HTHELAN------------
Q25AC7_ORYSA/379-474-CAL------------VISER....-NEIWNISMVQ.....LD---HNHQLSP------------
Q75LD4_ORYSJ/42-126-ATV------------VARLWS...-DGLLHLMDVN.....LE---HNHALNP------------
Q6K4T2_ORYSJ/290-375-ARV------------IVKLD....-KGEWEFTAVR.....HE---HNHPLCP------------
Q10DV6_ORYSJ/41-131-AMI------------EVSQKY...-YGRWVVIKLI.....KE---HNHAVAA------------
Q7XUD2_ORYSJ/473-571-CAL------------VISKR....-NLIWRITRVN.....LD---HNHKMSP------------
Q5JMV5_ORYSJ/380-476-CML------------TVRLE....-GDVWRILSMN.....LN---HNHTLTP------------
Q53M07_ORYSJ/37-129-AML------------QVNRRP...-SSRWLVSRCV.....LL---HSHPLAS------------

PF04500

FWCH1_MOUSE/402-460-SRA------------ITQ......-GRQVTVMR.------S....HCH----------------
FWCH1_MOUSE/235-293-SRA------------ITQ......-GQRVTVMR.------S....HCH----------------
A7UT18_ANOGA/463-522-VVA------------FLH......-PDGLVEVK.------GN...HDH----------------
A7UT18_ANOGA/543-605-VKV------------TTD....AD-GVAYISKN.------EQ...HLH----------------
FWCH1_HUMAN/600-658-SRA------------ITQ......-GHRIMVMR.------S....HCH----------------
Q16SJ4_AEDAE/393-453-CTV------------VIN.....E-ATSNITVK.------FD...HNH----------------
Q17CC2_AEDAE/19-83-ARA------------SVRR.REPG-QKPAVKLS.------GC...HNH----------------
Q6IDT6_DROPS/406-467-AIA------------IHD.....E-STLILRLC.------HQ...HQH----------------
Q16WE4_AEDAE/17-80-ARC------------ITH......-HGQVISST.------GV...HNH----------------
Q6IDT7_DROPS/405-469-SRV------------VTEL.DKNG-QSRVIKCS.------FD...HDH----------------
Q6NP69_DROME/162-227-ARI------------CTEA.TLAG-AHRLHAVD.------T....DAH----------------
Q16SI9_AEDAE/387-448-SRI------------TTD......-NVQIKRVK.------GE...HDH----------------
Q17CD4_AEDAE/347-409-VRA------------TTS...RDK-DRKVLSIR.------GE...HNH----------------
Q6IDX3_ANOGA/370-431-ARL------------ITD....LD-VQKICARN.------TI...HNH----------------
Q6IDX8_ANOGA/378-443-ARA------------QTRL..IDG-VEYVKVFK.------NE...HTH----------------
Q6IDX0_ANOGA/458-517-AQV------------LVV....SG-MTHAVNVE.------.....HTH----------------
Q6IDZ2_ANOGA/392-456-ARV------------YTI......-DDHITPLN.------RY...HTH----------------
Q17EL2_AEDAE/670-734-ATL------------YTT....LA-GQVIRTNN.------MM...HNH----------------
Q17CD3_AEDAE/199-260-AKL------------KTQ......-GKELIVVY.------QD...HNH----------------
Q9XWQ6_CAEEL/134-195-ARI------------HTP....FD-AERVIHKV.------QV...HNH----------------
Q6IDX4_ANOGA/383-444-ARI------------ITL....DG-CSGMILKN.------QV...HNH----------------
Q16WH6_AEDAE/7-75-SRV------------VTRF..VSG-AHILASNK.------PH...HDH----------------
Q17EL2_AEDAE/762-821-AAV------------YLG.....A-DGRVDQVK.------GE...HVH----------------
Q17EL2_AEDAE/236-296-AGA------------FLM.....P-DNTIAEAKN------FV...HTH----------------
Q70BY8_DROVI/421-485-SRC------------VLE......-NCKLKSIT.------GG..LHNH----------------
Q16FH8_AEDAE/26-95-SRV------------VTQF..QNG-QHHIISQT.------N....HNH----------------
Q7Z1Q1_CAEEL/53-119-AET------------TMD.....N-KNACTKGS.------.....HNH----------------
Q16SK1_AEDAE/387-448-AKV------------ITS....QY-DNKVSITD.------PF...HCH----------------
Q17C92_AEDAE/22-90-SRV------------ITHL..QNG-AHVLIDHK.------TA...HNH----------------
Q17CD5_AEDAE/89-153-ARA------------TTRL.DWKD-TAPKVSLR.------GF...HNH----------------
Q6NP69_DROME/596-663-SRI------------STAT.QKDG-SIRVLRVY.------NS...HSH----------------
Q6IDU1_DROPS/408-468-ARV------------VTV.....Q-DHDVTIKC.------DE...HNH----------------
Q70BX1_DROVI/435-497-ATL------------VTS...KVN-DVTLRIAG.------SP...HTH----------------
A0APY4_DROSI/32-92-ARV------------TTT.....D-TGDIIVTN.------NE...HCH----------------
Q17MH0_AEDAE/8-77-ARA------------RSTI..VNG-QHKILGIS.------E....HNH----------------
Q6IDX1_ANOGA/395-454-ARI------------IVK......-ASRVYEFV.------PM...HNH----------------
Q6IDZ9_ANOGA/372-437-GRL------------KTI....GN-QIMITNGR.------VE...HNH----------------
Q16SJ1_AEDAE/385-449-ARC------------VIV......-NGKLSALT.------GT..QHNH----------------
Q17CC5_AEDAE/2-67-GRL------------KSE....GN-NLFISNTN.------AT...HNH----------------
Q17CC4_AEDAE/1-62-ARI------------ITL....DG-SAGLILKN.------QI...HNH----------------
Q6IDZ0_ANOGA/386-445-ATI------------VTK......-.GNMMRFNG------QA...HNH----------------
Q16SK0_AEDAE/393-454-CKV------------VTH....RN-SLVVKYTH.------KS...HSH----------------
Q16SK2_AEDAE/394-455-ARL------------ITD....SE-NTMLLARQ.------LE...HTH----------------
Q6IDT9_DROPS/430-492-SRI------------ITHV..LPS-GQSRYDVS.------GV...HNH----------------
Q6IJJ6_DROME/2-63-ARI------------ITC....SV-TGELIIKN.------QQ...HNH----------------
Q8MRZ1_DROME/2-65-SRL------------KTI......-GDDLYVTN.------DV...HNH----------------
Q6IDW8_ANOGA/371-432-ARH------------RQN....RA-TGLLELVH.------SE...HNH----------------
Q17CA9_AEDAE/249-307-MRL------------HTD....RQ-GQMVEVK..------.....HQH----------------
Q17CB7_AEDAE/18-77-AKI------------TTN....AY-NAVITHNR.------CP...HSH----------------
Q6IDZ6_ANOGA/364-419-SRC------------IIK......-DKGVVVNI.------GK...HTH----------------
Q6IDT2_DROPS/408-472-VRA------------TTHK..LKS-GQEVYRIKF------AK...HSH----------------
Q17EK9_AEDAE/1691-1752-AML------------RLH.....T-NGRVVDPIG------LG...HTH----------------
Q17IM0_AEDAE/257-318-GMI------------VTT....AD-LHRFRMHK.------N....HNH----------------
Q6IDT3_DROPS/404-463-GRI------------HTL.....R-GHIIHSSK.------.....HSH----------------
Q6IDW1_ANOGA/381-442-SKC------------TTE......-FNTLRSISG------GK...HNH----------------
Q7QDH8_ANOGA/445-505-ATC------------VTK......-QNKLIGIR.------SE...HNH----------------
Q7YTX4_DROME/183-246-ARC------------ITH......-LGRIISAT.------GV...HNH----------------
Q6IDZ7_ANOGA/373-431-GRI------------ICQ.....N-NTVLKETE.------.....HCH----------------
Q18225_CAEEL/143-204-ARM------------HSD....IN-TREIVRKL.------HP...HNH----------------
Q17CD3_AEDAE/4-68-ARI------------IERI.SKYG-DPVYEIVR.------SV...HNH----------------
Q17CD3_AEDAE/86-145-SRV------------RTH......-QELIELVE.------HE...HNH----------------
Q6IDY5_ANOGA/394-455-CIV------------LIN.....T-ATSQLSIK.------HN...HNH----------------
Q17EK9_AEDAE/424-486-VKV------------VLN.....S-EAYIHRMGT------EH..EHQH----------------
Q6IDU0_DROPS/419-479-ARV------------VTNV..VDG-VHKIVLES.------......CH----------------
Q16SI1_AEDAE/384-445-ARH------------RQR....RS-TGALEVVW.------AK...HNH----------------
Q6IDY6_ANOGA/439-499-ARA------------ITS....VS-NPEQCVLK.------NA...HNH----------------
Q16SJ5_AEDAE/380-443-ARI------------LQY....KN-PERFVIHR.------ER...HIH----------------
Q17CB7_AEDAE/197-258-ARI------------TTR....TD-STKITYNL.------RP...HTH----------------
Q70BY4_DROVI/421-485-SRV------------FTI......-NDIVCPLN.------RF...HTH----------------
Q6IE02_BOMMO/284-343-SSI------------VTF......-EDIIVKLG.------KP...HNH----------------
A1L1L4_RAT/92-150-GRA------------ITR......-GFRVTEMR.------D....HCH----------------
A7DTF1_CAEEL/131-192-ARM------------HTD....IV-TEKILTFI.------HE...HNH----------------
Q17CD5_AEDAE/175-239-ARA------------TTGR.GKRG-DKPVIKLR.------GF...HNH----------------
Q70BY7_DROVI/415-476-AAL------------TTR......-RKAIVAQR.------GW...HNH----------------
Q6IDY2_ANOGA/385-450-AAC------------VTSKNCAGN-DQSIRLTG.------MT...HSH----------------
Q6IDU2_DROPS/436-495-ARL------------KTK......-SDTLTILN.------SE...HNH----------------
Q6IDV5_DROPS/431-497-ARL------------STRH.HSNG-RFIVHLTQ.------PK...HNH----------------
Q6IDY1_ANOGA/404-467-ARA------------ITKV..KNG-KTFVRLTN.------HG...HNH----------------
Q16SI4_AEDAE/385-447-ARA------------TTD...RQN-SGQLISVD.------GV...HNH----------------
Q6IDX5_ANOGA/379-440-SKL------------VTH....RG-SHTVKYTH.------RP...HTH----------------
Q6IDX7_ANOGA/374-437-AKA------------ITMK..QGG-REYMKLSH.------PT...HNH----------------
Q16SI2_AEDAE/384-446-ARA------------TTS...NSP-RGLVQYYN.------NT...HNH----------------
Q16SJ2_AEDAE/416-472-GRV------------TTV.....D-GTIVKYHV.------.....HNH----------------
Q17CC3_AEDAE/84-147-ARA------------VTKT..VND-RQMMKITK.------PL...HNH----------------
Q6NP69_DROME/365-432-VRI------------TLDP..VEN-GPVVLRIN.------GE...HTH----------------
Q17EL2_AEDAE/360-420-GAV------------HLF.....P-DGSINYAKL------VD...HNH----------------
Q17CC0_AEDAE/72-136-ARV------------LTYT.LKNG-EENLVVRY.------PT...HNH----------------
Q6IDT4_DROPS/418-482-ARI------------TML...KES-PPKFIIAK.------AE...HMH----------------
Q6IDY3_ANOGA/373-432-GRL------------HRF.....D-NKVHHMGA.------.....HNH----------------
Q17CB6_AEDAE/76-137-ARV------------TTR....SD-SAGVIFTN.------PY...HNH----------------
Q6IDX6_ANOGA/379-439-SRI------------TTF....DD-KRTYKVTN.------PV...HNH----------------
Q16SJ8_AEDAE/412-474-ARL------------ITD...DCN-FYDVTFKN.------LV...HNH----------------
Q17CB9_AEDAE/37-98-CIV------------VID.....E-INSRMNVK.------HI...HNH----------------
Q16FU8_AEDAE/997-1058-AVL------------ETV....GE-QSRHWRKF.------GS...HNH----------------
Q6IDV1_DROPS/437-498-ARV------------VTK......-SNQISALR.------GH...HNH----------------
Q17EK9_AEDAE/344-403-AVA------------IIY.....V-DGRIETSG.------D....HRH----------------
Q6IDZ5_ANOGA/397-459-ARV------------STE.....G-DSKIRFGA.------QR...HNH----------------
Q70BY0_DROVI/442-507-ARA------------ITK.....F-EGGIKLGK.------NP...HNH----------------
Q6IDX2_ANOGA/381-447-SRV------------VTTL.LDDG-MYRITITN.------PK...HNH----------------
Q6IDV9_DROPS/402-461-ARL------------TTK......-QKAIVLQH.------GS...HNH----------------
Q70BX7_DROVI/443-509-ARL------------STTR.LPKG-SYKVCLTR.------PQ...HNH----------------
Q6IDY8_ANOGA/367-431-ARV------------VTFM.HKSG-ELTYILRN.------AT...HNH----------------
Q16SI5_AEDAE/381-443-ARA------------TTK...RKP-GSAVISLR.------DD...HTH----------------
Q16SJ7_AEDAE/381-447-ARI------------VTSE..AEG-VPKLRVVV.------AE...HTH----------------
Q17CD4_AEDAE/155-214-AAA------------TSY.....G-EGSRISIR.------GT...HNH----------------
Q17EK9_AEDAE/1138-1199-AII------------FLM.....P-DDRIIQGNN------NA..GHNH----------------
Q70BX4_DROVI/425-491-ARC------------VTTA.GSSG-RNSIKLSH.------RK...HNH----------------
MMD4_DROME/452-512-VRV------------VCD......-QKRVFPYE.------GE...HVH----------------
Q17EK9_AEDAE/1463-1528-AGV------------YLF.....A-NGVLKNAAN------ESAIVHNH----------------
Q16SI0_AEDAE/430-495-ARA------------STTR.KLNG-LFRIVLGN.------AT...HNH----------------
Q16SB8_AEDAE/1076-1143-AAV------------IVE.....G-LYDSICIK.------NQ...HNH----------------
Q70BY9_DROVI/420-480-AVV------------ITK......-NGEFLDAR.------RQ...HNH----------------
Q6IDT8_DROPS/449-507-AHV------------ITH....RT-KPYSVALS.------GV...HNH----------------
Q6IDY0_ANOGA/370-433-ARA------------VSRK..RNG-REMMRLTH.------EE...HTH----------------
Q17CD2_AEDAE/110-170-GRI------------RLN.....R-DKTCVVLN.------AN...HNH----------------
Q6NP69_DROME/17-87-SRI------------CTMLPDPLD-KTRHVVVDV------VL..AHIH----------------
Q17EL2_AEDAE/459-522-VSF------------HTK....ED-TYELVSMRN------QE...HNH----------------
Q17CB7_AEDAE/98-160-AKI------------ATV...ANN-SAEVKFNF.------VA...HNH----------------
Q16SI3_AEDAE/390-452-ARA------------VTN...NDL-QGTIRRYL.------NH...HNH----------------
Q16SJ6_AEDAE/386-449-ARA------------VTKT..AFG-RQMMKITN.------PN...HSH----------------
Q70BZ1_DROME/25-91-ARL------------VTRI..TGG-GDIIHVTS.------NL...HTH----------------
A8XLA6_CAEBR/145-206-ARL------------HIP....SD-SYRVIFMT.------QE...HNH----------------
Q6IDV2_DROPS/410-473-ARC------------VTN....TN-DNSIKLSH.------RS...HNH----------------
Q16SJ0_AEDAE/390-455-VRC------------ITR......-DNHVINFH.------GL...HNH----------------
Q17EK9_AEDAE/1257-1320-AAL------------FCR....DN-GTIVTSTNG------KD...HNH----------------
Q70BX5_DROVI/426-484-ARA------------IQN....KE-TGQVQLRN.------GV...HNH----------------
Q6IDX9_ANOGA/370-433-ARA------------VTKD..IGG-FVHMKVTN.------TS...HYH----------------
Q17EK9_AEDAE/94-153-AAV------------NLN.....L-DNTITPANN------NQ...HSH----------------

PF03106

Q9SE29_ORYSA/129-187-VKK------------KVERSS.DG-QITQILYR-------GQ---HNHQR--------------
WRK34_ARATH/371-430-VTK------------HVERASDDF-KSVLTTYI-------GK---HTHVV--------------
WRK59_ARATH/108-167-VKK------------KIERDTNNP-DYILTTYE-------GR---HNHPS--------------
Q9SXP5_TOBAC/195-254-VRK------------HVERASQDI-RSVITTYE-------GK---HNHDV--------------
WRK13_ARATH/222-281-VKK------------RVERLADDP-RMVITTYE-------GR---HLHSP--------------
WRKY1_ARATH/306-365-VKK------------HVERSSHDT-KLLITTYE-------GK---HDHDM--------------
Q9XFF1_AVESA/182-240-TKK------------KVEQAP.DG-QVTEIVYK-------GT---HNHPK--------------
WRKY1_ARATH/110-168-AKK------------QLERSA.GG-QVVDTVYF-------GE---HDHPK--------------
WRK41_ARATH/140-202-ATK------------QVQRSDGDP-TIFEVTYR-------GT---HTCSQ--------------
Q9SQ04_PETCR/190-248-TKK------------KVETTF.DG-HITEIVYK-------GN---HNHPK--------------
WRK43_ARATH/29-88-VKK------------QVQRLSKET-SIVETTYE-------GI---HNHPC--------------
WRK46_ARATH/103-165-AVK------------QVQKSDTDP-SLFEVKYL-------GN---HTCNN--------------
WRK18_ARATH/175-235-VKK------------KVQRSAEDP-SLLVATYE-------GT---HNHLG--------------
WRK20_ARATH/210-268-VKK------------LFERSH.DG-QITDIIYK-------GT---HDHPK--------------
WRK39_ARATH/261-321-ARK------------HVERCIDET-SMLIVTYE-------GE---HNHSR--------------
WRK34_ARATH/177-235-AKK------------KVERSR.EG-HIIEIIYT-------GD---HIHSK--------------
Q9XFF0_AVESA/243-303-ARK------------HVERDPSDP-SMLIVTYE-------GD---HRHTP--------------
WRK44_ARATH/348-407-ARK------------HVERASDDP-RAFITTYE-------GK---HNHHL--------------
WRK23_ARATH/173-232-VKK------------RVERSFRDP-STVVTTYE-------GQ---HTHIS--------------
WRK25_ARATH/165-223-SKK------------IVETAS.DG-QITEIIYK-------GG---HNHPK--------------
WRK29_ARATH/133-193-ARK------------QVERNPQNP-EKFTITYT-------NE---HNHEL--------------
Q9ZPL7_TOBAC/299-358-VKK------------HVERASHDP-KMVITTYE-------GQ---HDHTM--------------
WRK14_ARATH/216-276-ARK------------QVERSRTDP-NMLVITYT-------SE---HNHPW--------------
Q9ZPL7_TOBAC/123-181-AKK------------QVERSH.DG-HITDVHYI-------GK---HEHPK--------------
WRK44_ARATH/164-222-VKK------------KVERSV.EG-QVSEIVYQ-------GE---HNHSK--------------
WRK56_ARATH/113-172-VKK------------QVQRLAKDP-NVVVTTYE-------GV---HNHPC--------------
WRK47_ARATH/238-298-VRK------------QVQRCAEDT-TILTTTYE-------GN---HNHPL--------------
Q39658_CUCSA/235-293-RKK------------KIEGLP.DG-EITEIIYK-------GQ---HNHEP--------------
WRK22_ARATH/127-187-ARK------------QVERNRSDP-KMFIVTYT-------AE---HNHPA--------------
WRK19_ARATH/467-525-SKR------------KVERSL.DG-QVAEIVYK-------DR---HNHEP--------------
WRK25_ARATH/327-386-VKK------------QVERSAADE-RAVLTTYE-------GR---HNHDI--------------
WRKY3_ARATH/249-307-VKK------------KVERSL.DG-QVTEIIYK-------GQ---HNHEL--------------
WRK32_ARATH/330-389-VRK------------HIETAVENT-KAVIITYK-------GV---HNHDM--------------
WRK32_ARATH/167-225-AKK------------.IECSNDSG-NVVEIVNK-------GL---HTHEP--------------

PF03615

Q29NA7_DROPS/62-205GGRLEIKPCRGHCGYPVTHFWRHSG-NAIFFQAK-------GV---HDHLRPD.PKNSSVSKRAF
Q5TQ16_ANOGA/2-145VGRLEVLPCRGHCGYPVTHYWRHTE-KAIFFQAK-------GN---HDHPKPE.SKTSGETRKMI
GCM_DROME/46-188.GRLEIQACRGHCGYPVTHFWRRDG-NGIYFQAK-------GT---HDHPRPE.AKGSTEARRLL
Q2KT54_DANRE/36-176.SALELIPCRGHSGYPVTNFWRVDG-KAIFFQAK-------GV---HDHPRPE.SKSETEARRSA
GCM1_HUMAN/29-169.GPLKLIPCRGHGGFPVTNFWRHDG-RFIFFQSK-------GE---HDHPKPE.TKLEAEARRAM
Q8MMJ4_STRPU/65-208.GKLFHMICAGKSGYPVTHFWRVTD-TVILFQSK-------GV---HDHPRPDVVKTTSQAKLAL

PF08731

Q6BK98_DEBHA/21-107-FKI------------RAN--YSIR-NHVWTLVVMNENHDHEL----------------------
Q59Z29_CANAL/21-112-FKI------------RAN--YSVR-NKVWTLSIVSDEHDHVV----------------------
AFT2_YEAST/51-137-FRI------------RAA--YSVR-LQKWNVVVMNNIHSHEL----------------------
AFT1_YEAST/108-243-FRV------------RAT--YSLK-RKRWSIVVMDNNHSHQL----------------------
Q6FS49_CANGA/15-125-FRV------------RAT--YSLK-RKKWSVVVLNNTHTHPL----------------------
Q6CS78_KLULA/99-257-FRV------------RAT--FSLK-RKKWNIVVVNNVHTHPL----------------------
Q6FSP0_CANGA/42-131-FRV------------RCT--FSTQ-LKKWKIVIINNSHSHPL----------------------
Q755B2_ASHGO/89-206-FRV------------RAA--YSLK-RKRWSIVVVNNGHSHPL----------------------

PF03108

Q94HS2_ORYSJ/177-242-WNL------------YAS--FDSR.SKSMMV---------------------------------
Q94H23_ORYSJ/164-229-WKL------------VAS--VDSR.ANCFMV---------------------------------
Q0DBW2_ORYSJ/8-75-WHV------------NGR--RQAD.ERTVMV---------------------------------
Q0J5I2_ORYSJ/345-411-WLL------------YAS--HNSR.SDWFQI---------------------------------
Q9SUF8_ARATH/168-235-WYL------------RVA--QGKN.SDRLSV---------------------------------
Q84JZ9_ORYSJ/312-376-WQI------------NAR--KSGG..DRWRV---------------------------------
Q9ZQK9_ARATH/327-393-WRV------------TAH--EMPE.SGYYEI---------------------------------
O22271_ARATH/106-173-WRV------------YCS--YDPD.RQLFVV---------------------------------
Q9FFR0_ARATH/219-284-WFL------------KAA--KTNG..NGFKI---------------------------------
Q60D51_SOLDE/156-222-WKL------------KAS--VRKN.SDIFKV---------------------------------
Q6NKQ0_ARATH/136-205-WIV------------YCS--FQKS.KSKLVI---------------------------------
Q8LN69_ORYSJ/215-281-WRV------------HAY--KGKW.NDYWKV---------------------------------
Q9C8V7_ARATH/134-202-WRC------------YCS--YDRK.KHKMQI---------------------------------
Q9LPT8_ARATH/341-407-WRV------------YIV--KLED.SDNYQI---------------------------------
O22278_ARATH/233-302-WYL------------RCA--KVKS.SDCFSV---------------------------------
Q10M31_ORYSJ/331-397-WLI------------YGS--KTSK.SEWFQV---------------------------------
Q9SJR8_ARATH/196-262-WRV------------YAS--KVDS.SDSFQV---------------------------------
Q9FH72_ARATH/102-168-WRI------------YAS--ITSR.SDKMVV---------------------------------
Q6L470_SOLDE/182-249-WRI------------LGS--LMQRDISTFQI---------------------------------
Q84R97_ORYSJ/298-366-WRF------------HAS--TSKK.YYGCKV---------------------------------
Q2R0C2_ORYSJ/1370-1436-WAI------------MAR--LMPN.EKSVRV---------------------------------
Q25A06_ORYSA/1224-1291-WRI------------YAR--KETK.SSVWKI---------------------------------
Q9M9F3_ARATH/337-408-CRV------------RCS--YEKR.KHKMQI---------------------------------
Q65X43_ORYSJ/10-78-WRL------------HAS--TGKN.GNTVKV---------------------------------
Q9M9L2_ARATH/201-267-WRI------------HAS--RLST.TQLICI---------------------------------
Q7XWS4_ORYSJ/282-348-WVC------------LLS--KTTR.SDSWQI---------------------------------
Q9ZUQ8_ARATH/373-439-WHL------------TAH--VIPN.SKCFKI---------------------------------
Q9M905_ARATH/37-103-WRI------------TAS--RLST.TQLICI---------------------------------
Q9FH11_ARATH/196-263-FRI------------YCA--YDEK.IGVYMV---------------------------------
Q9SH73_ARATH/427-493-WTL------------EAA--RMEK.HGLIEI---------------------------------
Q9ST50_MAIZE/292-359-WRV------------CAR--RQKE.TGKFKI---------------------------------
Q6L3K3_SOLDE/167-232-FEC------------LIS--EDRK.NQGFKI---------------------------------
Q948I2_ORYSJ/282-347-WQV------------RAR--KTKD..GRWRV---------------------------------
Q2QQS2_ORYSJ/220-288-WRV------------HAY--KGKW.KDYWTV---------------------------------
Q2QSJ6_ORYSJ/167-233-WHI------------VGH--KQPN.QKTVMV---------------------------------
O04332_ARATH/177-243-WRI------------HCA--KLPG.LPTFTI---------------------------------
Q9SH73_ARATH/2753-2819-WSL------------RAA--RMEE.HGLVEI---------------------------------
Q2QM14_ORYSJ/278-347-WRI------------HAS--CKRG.TKICQI---------------------------------
Q2QWR3_ORYSJ/508-574-WVC------------LLS--KNSR.SDSWQI---------------------------------
Q9M3E4_ARATH/185-253-WYL------------RVT--KTSE.TDFWCV---------------------------------
Q9ZQM3_ARATH/54-121-WRV------------RAH--QVGD.SEEYEF---------------------------------
Q9M256_ARATH/213-281-WFV------------RVA--KVKN.SECFSV---------------------------------
Q9LPE7_ARATH/628-694-WRI------------LAT--LMKG.TGYYEI---------------------------------
A3BFR5_ORYSJ/258-324-WVC------------LLS--KTSR.SDSWQI---------------------------------
Q60DJ3_ORYSJ/319-384-WNL------------YAS--EDSR.AKAFVV---------------------------------
Q5GIT1_CUCME/232-298-WRL------------RAV--RLKD.SNIFKI---------------------------------
Q2QTR1_ORYSJ/168-234-WSI------------HAS--RLSD.GRTWQI---------------------------------
Q2QMP0_ORYSJ/171-237-WRI------------HAA--KLPG.VPTFSI---------------------------------
Q6F2Q5_ORYSJ/285-350-WRV------------HGY--KPQH..DTLWV---------------------------------
Q9C702_ARATH/177-243-WSI------------CAS--RREE.DGLFEI---------------------------------
Q8LNV8_ORYSJ/313-379-WAI------------VAR--LQPD.GKSMKV---------------------------------
Q9LP20_ARATH/461-527-WRV------------YAT--KLPD.SDWFEV---------------------------------
Q10MA4_ORYSJ/305-371-WVC------------LLK--KTSR.TNSWQI---------------------------------
Q2QP77_ORYSJ/156-223-WKL------------NAS--HDSR.SKCFMI---------------------------------
O65231_ARATH/305-371-WHL------------TAC--VVKD.SESFKI---------------------------------
Q60CX5_SOLTU/147-213-WMM------------NSS--CLNQ.SKLFKI---------------------------------
Q9LN76_ARATH/167-238-WRV------------LCS--YEKK.KHKMQI---------------------------------
Q7XM49_ORYSJ/288-353-WKI------------RAK--TQAD..KSVRI---------------------------------
Q8LNC1_ORYSJ/207-273-WHI------------VGS--RQAD.LKTIKV---------------------------------
Q9XEC9_ARATH/230-296-WRV------------YAT--FHEN.SEKVEI---------------------------------
Q9ZV73_ARATH/50-116-WRV------------YAT--KLED.SERFEI---------------------------------
Q7XKR6_ORYSJ/269-335-WFI------------FAS--NGTN.CDWFQV---------------------------------
Q75H66_ORYSJ/284-349-WNM------------YAS--LDSR.VHGFIV---------------------------------
Q8H8H0_ORYSJ/332-398-WRI------------HAS--RLSD.GKTIQI---------------------------------
Q9C806_ARATH/173-240-WYV------------YAS--YSHE.RQLWVL---------------------------------
Q75KS5_ORYSJ/197-263-FRL------------HSH--VPKY.ECYWIV---------------------------------
Q2QQX5_ORYSJ/302-368-WKV------------HAT--KRSS..GTWRI---------------------------------
Q9FH43_ARATH/230-296-WRV------------RAT--PVDE.YPKFQV---------------------------------
Q9SI25_ARATH/208-276-WYL------------RVA--RTKK.SHFSSV---------------------------------
Q9MAQ6_ARATH/45-111-WRL------------RAT--RAGG.SESYVI---------------------------------
Q9LDY3_ARATH/190-256-WRI------------QAS--CVQD.TSIYSI---------------------------------
O80466_ARATH/196-262-WRL------------RAS--NIST.TDIFSI---------------------------------
Q9SHN7_ARATH/496-562-WRV------------YAT--ELEE.IDRFEI---------------------------------
Q0D1G9_ASPTN/6-73-YRV------------RLY--VRRD.TVQAQV---------------------------------
Q9SH73_ARATH/2030-2096-WSL------------GAA--RMKK.HGLVEI---------------------------------
Q10J76_ORYSJ/148-214-FRV------------HGH--VPKY.ESYWLV---------------------------------
Q9S9W4_ARATH/271-337-WRI------------MSH--EMKT.CGYYLI---------------------------------
Q0DAT1_ORYSJ/144-210-WRI------------HAS--KSPA.KKQFMI---------------------------------
Q9SHU0_ARATH/252-318-WRV------------RAC--RQGN.DPNFYV---------------------------------
Q9AYI6_ORYSJ/366-432-WRL------------HAS--ESSR.NKKFVI---------------------------------
Q5NRP3_SOLDE/312-378-WLL------------YAS--LDKD.SGDFIV---------------------------------
Q9LRP4_ARATH/222-288-WYI------------RFS--KAKD.STRFSV---------------------------------
Q94HK4_ORYSA/173-241-FFI------------RAS--QVGS.EKTFMV---------------------------------
P93802_MAIZE/127-194-WRI------------YAR--EEKKGLPTIVV---------------------------------
Q10PZ8_ORYSJ/248-316-WCF------------FAS--TSPK.YIGCKV---------------------------------
Q9FWH9_ORYSJ/256-321-WML------------SAS--MDNR.VKCLVV---------------------------------
Q8LDM6_ARATH/75-142-WRI------------YCS--FEEP.VGKWMI---------------------------------
Q65XP0_ORYSJ/187-257-WRI------------NGT--KQKG.QSTVEI---------------------------------
O49511_ARATH/64-137-WKV------------YAA--ILPS.DNMWKI---------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window