Sequence alignment for CL0274

PF03101

FRS4_ARATH/11-97LFYKDY-AKSVGFGTAKLSSR-RSRA-SK-E----------F--IDAKFSC-I---------------------------
FRS8_ARATH/109-194SFYNSY-ARELGFAIRVKSSW-TKRN-SK-E----------K--RGAVLCC-N---------------------------
FRS10_ARATH/69-161EYYSTF-ARKSGFSIRKARST-ESQN-LG-.----------V--YRRDFVC-Y---------------------------
FRS1_ARATH/35-137EFYKEY-ANSVGFTTIIKASR-RSRM-TG-K----------F--IDAKFVC-T---------------------------
FRS5_ARATH/87-179AFYNSY-ARRIGFSTRVSSSR-RSRR-DG-A----------I--IQRQFVC-A---------------------------
Q6NLE7_ARATH/25-111DFYVEY-SKRLGFVVRMMQRR-RSGI-DG-R----------T--LARRLGC-N---------------------------
Q8H344_ORYSJ/116-204DFYNAY-AEMVGFFVRRSTLW-TTSK-NI-.----------I--TRRTFVC-S---------------------------
Q7XKT7_ORYSJ/54-140RFYLEY-GYRAGFGVSKRTSH-SV..-DG-V----------K--YRATFVC-Y---------------------------
Q93Z68_ARATH/84-172GFYNAY-ATKVGFVIRVSKLS-RSRH-DG-S----------P--IGRQLVC-N---------------------------
Q6ESZ2_ORYSJ/64-154EFYRYY-AWKLGFSVRREYAN-KSRK-TG-E----------I--TSRKFVC-S---------------------------
FAR1_ARATH/65-154IFYQEY-AKSMGFTTSIKNSR-RSKK-TK-D----------F--IDAKFAC-S---------------------------
Q6AT58_ORYSJ/82-184TFYNVY-AHRVGFSTRISVMH-RSRR-DG-S----------I--MSRQFVC-A---------------------------
Q2QXD6_ORYSJ/96-184RLYCDY-GHRMGFSVRKGKQY-YFTG-TK-T----------I--RTKDYYC-S---------------------------
Q84JA7_ARATH/47-136SFYDNY-ATCMGFVMRVDAFR-RSMR-DG-T----------V--VWRRLVC-N---------------------------
Q75LD4_ORYSJ/42-126NFYKRY-ALRTGFGVCVKKSS-FTKA-GL-.----------C--RRLVLVC-N---------------------------
J3LS84_ORYBR/67-154.FYMAY-ASRVGFSVRISKSR-CSRN-DE-S----------I--IMRRFVC-S---------------------------

PF04500

Q70BY8_DROVI/421-485FIESPW.STPC...LVLNGYM-YNCH-SR-K...-.----.N-.NKEYWRC.H---------------------------
B4MBE8_DROVI/40-101FTRSNR.GNNL...LTINGKP-FTLN-RR-I...-.----.K-.DACYWEC.V---------------------------
FWCH1_MOUSE/402-460FLKTPL.GGNF...LVYESFL-YRRE-KV-A...-.----.G-.EKVYWTC.R---------------------------
FWCH1_MOUSE/235-293FLKTCY.GGTF...LVHQSFL-YKRE-KT-V...-.----.G-.GKVYWTC.R---------------------------
A7UT18_ANOGA/463-522IVNNAN.GRPR...LHFDGNL-YVRE-SA-R...-.----AD-.GVVVWRC.R---------------------------
A7UT18_ANOGA/543-605LSPTWK.GGEA...LVLNGYR-FLKA-YS-R...-.----VN-.GMSLWRC.V---------------------------
FWCH1_HUMAN/600-658FLRTSL.GGRF...LVHESFL-YRKE-KA-A...-.----.G-.EKVYWMC.R---------------------------
Q16SJ4_AEDAE/393-453KMSARR.GSHL...LVVNGVK-FFRN-RQ-R...-.----.N-.DKQYWKC.H---------------------------
Q17CC2_AEDAE/19-83FIVNNQ.GGIQ...LSVNGFP-YIRS-KT-N...-.----.D-.DVQYWAC.S---------------------------
Q6IDT6_DROPS/406-467FADSKKNGGKL...LVINGFR-FFRN-KK-R...-.----.G-.NLQYWKC.R---------------------------
Q16WE4_AEDAE/17-80PSITML.SSTS...LLHNNCI-FNRN-NT-VAT.-Q----QG-.LKTYWLC.K---------------------------
Q6IDT7_DROPS/405-469FGKGQR.GRTV...LLHHEEK-FVKN-RS-S...-.----.A-.TRTYWIC.S---------------------------
Q6NP69_DROME/162-227MLRRRD.GRVM...VCIDGHL-YYLA-GK-SY..-.----KG-.DIFRWTC.V---------------------------
Q16SI9_AEDAE/387-448FVRSRK.GKPL...LLYKGHQ-YTLN-RR-R...-.----.K-.QLGYWEC.V---------------------------
Q17CD4_AEDAE/347-409FVLSGR.GSIQ...LSIDGYV-FTQE-LV-K...-.----.N-.NDIDWAC.S---------------------------
Q6IDX8_ANOGA/378-443FEFTTR.GTQC...LVYDGYL-YSKN-KT-FE..-.----NG-.TRVNWKC.R---------------------------
Q6IDX0_ANOGA/458-517YLTNRF.GSAK...VVLDEHQ-YVYH-FA-A...-.----.K-.GVSYYRC.D---------------------------
Q6IDZ2_ANOGA/392-456FSRTMR.GKEQ...LVYKGQP-FVFE-KL-VLTT-G----GQ-.SKKIWRC.N---------------------------
Q17EL2_AEDAE/670-734SSSAHH.LPKF...IIHHGYH-YKFV-ST-NA..-.----ND-.RMAFWRC.S---------------------------
Q17CD3_AEDAE/199-260HPYSYN.YRGN...LVYDRYT-FSKT-AV-QG..-.----MG-.NIVYWRC.T---------------------------
Q9XWQ6_CAEEL/134-195PYTPRG.IRER...VLFDEHL-YVFD-KC-SY..-.----DS-.KKRFFRC.E---------------------------
Q16WH6_AEDAE/7-75EVLFPR.GGDM...LYLDGYL-FYRN-KK-V...-.----.E-.DLHYWEC.R---------------------------
Q17EL2_AEDAE/762-821IVKNWK.NRDV...LVFQQCR-YFLH-YV-R...-.----KD-.GRKVWRC.S---------------------------
Q17EL2_AEDAE/236-296LVKSGQ.KREF...LIYQGYR-YYFQ-YE-S...-.----KN-.GKRSYRC.T---------------------------
Q16FH8_AEDAE/26-95ILKTSK.GKDL...LTYEGFI-YYAN-RK-P...-.----ID-.NSHYWEC.R---------------------------
Q16SK1_AEDAE/387-448FVSGVR.GMPK...LIVDGYS-FIRN-KG-N...-.----.F-.RTTYWRC.S---------------------------
Q17C92_AEDAE/22-90LITSQK.GKQM...LSVNGTL-FNLN-KQ-A...-.----.N-.EHFYWEC.A---------------------------
Q17CD5_AEDAE/89-153FVLTKR.GSTQ...LSVNGFL-YMRN-KA-R...-.----.G-.ITQFWAC.N---------------------------
Q6NP69_DROME/596-663TLRSAK.GHEL...LCVDGYI-YHAK-NR-G...-.----VI-.SRNYWVC.I---------------------------
Q6IDU1_DROPS/408-468YITGFR.GSRK...LKIGDFT-FTRN-KS-T...-.----.G-.SKTYWSC.A---------------------------
A0APY4_DROSI/32-92FMLSQR.GKPL...LVHDGHT-FGIQ-YV-R...-.----.K-.DKKYWQC.N---------------------------
Q17MH0_AEDAE/8-77LIKSSR.GNDM...LAIAGYV-FHCN-RK-MV..-.----EN-.NIYYWEC.R---------------------------
Q16SJ1_AEDAE/385-449FIKSPW.STPC...LVINDYL-YNCH-ST-R...-.----.G-.NKVYWRC.H---------------------------
Q17CC5_AEDAE/2-67FIVSRK.GGVL...LVHDNHI-YRSN-LR-RQ..-G----QH-RNILYWEC.L---------------------------
Q17CC4_AEDAE/1-62MVVGRK.GRPM...LLMGGHA-FFRN-NT-H...-.----.K-.SKTYWLC.A---------------------------
Q16SK0_AEDAE/393-454FTPGQR.GKPK...LVIENNS-FFRT-KG-D...-.----.T-.QRSYWSC.S---------------------------
Q16SK2_AEDAE/394-455YVTGQR.GKPK...ILYENHT-YICS-KH-L...-.----.K-.NRKYWTC.G---------------------------
Q6IDT9_DROPS/430-492YIRTPA.GNCI...LHCGEHR-YLRN-AS-Y...-.----.K-.DKVYWKC.S---------------------------
Q17CA9_AEDAE/249-307TDEDPF.QGKK...MMYQGFY-FYRN-GA-S...-.----.E-.RRLYWRC.A---------------------------
Q17CB7_AEDAE/18-77YVATCR.GNTK...IIIDGYS-YTRH-HR-Y...-.----.N-.WNTYWRC.A---------------------------
Q17EK9_AEDAE/1691-1752IAKTSR.GES....LIYQGYR-YWAK-NR-L...-.----AN-.GIVSLCC.T---------------------------
Q17IM0_AEDAE/257-318YYSTKG.DRPS...IVVNGYR-FHKE-KA-LSV.-T----FP-.SQIYWRC.S---------------------------
Q7QDH8_ANOGA/445-505FIRSQK.KCAQ...LVYDGYI-YNRK-MI-Q...-.----QN-.GRTTWRC.C---------------------------
Q6IDZ7_ANOGA/373-431FIRSQR.GLPL...LVKNKFI-YRCE-RT-R...-.----.N-.HRSYWLC.T---------------------------
Q18225_CAEEL/143-204EYKPRN.VREK...VYADGYI-MSFD-KK-SC..-.----CG-.TKEFWRC.E---------------------------
Q17CD3_AEDAE/4-68YTVSRR.GRRQ...ICYYGYT-FEME-KE-R...-.----.T-.GSTSWRC.G---------------------------
Q17CD3_AEDAE/86-145YSISLK.GSLQ...LMVQGFP-YTRH-SC-K...-.----.G-.GKVYWRC.V---------------------------
Q6IDY5_ANOGA/394-455YKQSQRSGRQL...LVVNGIH-FFRN-RE-R...-.----.N-.GKQYWKC.N---------------------------
Q17EK9_AEDAE/424-486ITKNQR.GNDA...LVFEGHR-FSKE-WS-R...-.----VD-.GSIIWRC..---------------------------
Q6IDU0_DROPS/419-479FIRGQR.GCKL...LAFNGHN-YVRN-RR-S...-.----.N-.LKTYWIC.S---------------------------
Q16SI1_AEDAE/384-445YVMSTK.GSPQ...LCLDGFT-FTRH-IV-K...-.----.D-.DTIYWRC.I---------------------------
Q6IDY6_ANOGA/439-499QYTNGR.GNNV...LMYDGHR-YIKN-NC-Y...-.----.G-.GKMYWKC.S---------------------------
Q16SJ5_AEDAE/380-443FTKSSR.GRPA...IIIDGIK-YLFM-SE-N...-.----.H-.KRVVWRC.S---------------------------
Q17CB7_AEDAE/197-258VGMTQR.GNSK...LTIDGYS-YRKK-SV-S...-.----.D-.TKVYWAC.A---------------------------
A7DTF1_CAEEL/131-192TDIPKK.TRLK...VFSNGFF-MTFD-KL-SS..-.----CQ-.KKYFWRC.E---------------------------
Q17CD5_AEDAE/175-239FVISKR.GKTQ...LCVDGYL-YMRV-KA-T...-.----.E-.EMQYWSC.N---------------------------
Q6IDY2_ANOGA/385-450YTTTQR.GRTM...LIFSGYK-FVEN-RQ-S...-.----.K-.RNIFWRC.A---------------------------
Q6IDU2_DROPS/436-495FIVSKY.GTRQ...IMLKQHT-FNRH-IC-R...-.----.D-.DVTYWRC.S---------------------------
Q16SI4_AEDAE/385-447YVSSRK.GTPQ...LMIDDHC-YSRQ-RV-R...-.----.Q-.RTIRWRC.V---------------------------
Q6IDX5_ANOGA/379-440FTAGQR.GKPK...LVIENNS-YFRT-KG-D...-.----.S-.LRAYWSC.S---------------------------
Q6IDX7_ANOGA/374-437FSITQR.GRPL...LVHEGYS-YIGN-GA-F...-.----.A-.DTVNWRC.S---------------------------
Q16SI2_AEDAE/384-446YTMSRK.GTPQ...LEIDGYR-YTRQ-KI-C...-.----.K-.TTIRWEC.L---------------------------
Q16SJ2_AEDAE/416-472YIRSRR.GHPL...LVFRGYK-FRRN-GG-C...-.----.K-.EKGYWRC.A---------------------------
Q17CC3_AEDAE/84-147FGYTQK.GKAM...LLYNGYA-YIKD-RQ-A...-.----.M-.KSCNWKC.S---------------------------
Q6NP69_DROME/365-432FLPSAK.GRKV...LCLSQHL-FHFD-SQ-SR..-.----SN-.GHMFFTC.I---------------------------
Q17EL2_AEDAE/360-420IIKNYK.GKDI...LIYNGWR-YFVD-YK-K...-.----KN-.GGQVWRC.S---------------------------
Q17CC0_AEDAE/72-136YVTGFR.GSRK...LKVGEFS-FTKN-KE-I...-.----.A-.NKTYWSC.A---------------------------
Q6IDT4_DROPS/418-482FTQSLR.GRPA...IMANGIR-FLIM-SE-N...-.----.K-.KKILWRC.S---------------------------
Q17CB6_AEDAE/76-137TVLDNR.GRPV...LLVDGHA-FSRN-NI-G...-.----.K-.TQTYWLC.S---------------------------
Q16SJ8_AEDAE/412-474TVIGQR.GSTK...LLIEGYT-YIVN-KR-S...-.----.N-.GKRYWGC.A---------------------------
Q17CB9_AEDAE/37-98FKTSQRSGRHL...LVVNGVT-FFRN-RH-R...-.----.N-.NKQYWKC.N---------------------------
Q16FU8_AEDAE/997-1058LVKLQR.TEQM...LSHEGHL-YKMK-WH-N...-.----.R-.RHSYWDC.M---------------------------
Q17EK9_AEDAE/344-403ITTNVK.GREC...LIYEGHQ-YSKD-RE-R...-.----YD-.GAVLWRCRR---------------------------
Q6IDX2_ANOGA/381-447FIQGQR.EHKL...LVIGGYT-YARN-NF-A...-.----.G-DDTIYWACRT---------------------------
Q6IDV9_DROPS/402-461LIYTYR.GQ.....LVHEGYT-YSCN-AK-NS..-.----VK-.FLAFWRC.S---------------------------
Q16SI5_AEDAE/381-443YIMGRR.GTVQ...LLINGHV-FTRS-QV-R...-.----.E-.KIIIWVC.S---------------------------
Q16SJ7_AEDAE/381-447YVLSKR.GTKH...LFYNGNT-YTPN-ER-PY..-.----PG-QRSRTWKC.T---------------------------
Q17CD4_AEDAE/155-214YVDTGR..SRK...LIINGYG-FTRK-QI-R...-.----.E-.RYTIWEC.C---------------------------
Q17EK9_AEDAE/1138-1199LFKNQR.GQMT...LLYQGYR-YSIR-NR-N...-.----QD-.GSSSWKC.R---------------------------
MMD4_DROME/452-512YASTTK.GGVK...LIFNGHL-FKFS-FR-K...-.----.A-.DYSVFQC.C---------------------------
Q17EK9_AEDAE/1463-1528IVKNRV.GNDI...LIHENHR-FRLN-YQ-R...-.----ND-.GTTHWRC.V---------------------------
Q16SI0_AEDAE/430-495LYASQR.GKHL...LVLENYT-FSKN-NT-V...-.----.A-.DTTYWACRV---------------------------
Q16SB8_AEDAE/1076-1143ILKTMKTGETVTCGLVFHKFR-YVLA-TV-D...-.----QN-.ETSRWTC.T---------------------------
Q17CD2_AEDAE/110-170FKIGNR.NSLK...LYYSGHF-YTRS-YT-S...-.----.E-.KSSKWVC.D---------------------------
Q6NP69_DROME/17-87VVRSAK.GVDM...LCVDDYL-YHFD-RI-G...-.----RN-.NTYRWLC.N---------------------------
Q17EL2_AEDAE/459-522NAYTPP.YHRY...ILHEGHR-FRFA-TR-K...-.----.R-EGTIYWRC.A---------------------------
Q17CB7_AEDAE/98-160YGKTQA.GGTR...ITIDGYS-YCKH-YR-T...-.----.G-.SKTVWRC.S---------------------------
Q16SI3_AEDAE/390-452FHTTKR.GSVQ...LEIDGYR-FTRM-KV-L...-.----.Q-.TTIHWSC.L---------------------------
Q16SJ6_AEDAE/386-449FGYTQR.GKVL...LLYNGFA-YIKD-RD-S...-.----.R-.TSCNWKC.S---------------------------
A8XLA6_CAEBR/145-206PHRSRM.TRDR...VFYESHV-YIFD-KS-SY..-.----DN-.KKKFYRC.E---------------------------
Q16SJ0_AEDAE/390-455FVGSRW.GRKL...LVYERYV-FFSN-KR-VE..-.----AT-.NTTYWRC.T---------------------------
Q17EK9_AEDAE/1257-1320PPEVNY.GRNV...VEHKNYF-YRLI-VR-K...-.----.K-NGREYWRC.V---------------------------
Q17EK9_AEDAE/94-153IIMTPT.NRER...LVYKGFL-YCRH-FS-R...-.----RD-.GSVHWRC..---------------------------
B4GZB2_DROPE/96-158.VTNRR.GGQN...LIYNGHM-YSVE-RK-Y...-.----.H-.ASINWVC.T---------------------------
B4I3G6_DROSE/69-132.SATSR.GRMQ...LIYGGQP-FIFE-KT-LKLS-S----GE-.EKRFWRC.N---------------------------
B4I3H2_DROSE/2-65FLISRK.GGTL...LTINNFV-YRSN-LK-FFG.-K----SN-.NILYWEC.V---------------------------
B4I3I4_DROSE/2-63IVKGTK.GKPK...LLMGGYE-YYRN-NS-R...-.----.G-.SKTYWLC.A---------------------------
B4JS54_DROGR/8-73FVRNQK.QGYN...LIFNGYM-YKKE-AS-F...-.----.R-.ATINWIC.S---------------------------
B4R104_DROSI/89-155YVRSNR.GTDL...VYHEGNT-YTPN-EK-LR..-E----GQ-.KSRDWKC.S---------------------------
H2KZM4_CAEEL/53-119IVTSFK.GYQK...LMYQGYR-YNIY-QI-AP..-.----ER-.NFKSWRC.V---------------------------
Q5TUB5_ANOGA/339-400FVTTKK.GKEL...LIFRGYV-YRVN-RH-R...-.----.G-.RLRYWEC.A---------------------------
Q6IDT0_DROPS/406-466FIRSQK.KNAQ...LVYRDYI-YNKK-LT-Q...-.----AN-.GQTTWRC.A---------------------------

PF03106

M7ZE84_TRIUA/87-143----------------DDGYN.WRKY-GQ.KVVK-G....SD.CPRSYYKC-T---------------------------
K3XPF8_SETIT/105-165----------------KDGYQ.WRKY-GQ.KKIQ-N....CN.FSRYYYRC-.---------------------------
J3LNI8_ORYBR/48-108----------------DDGHV.WRKY-GQ.KDIQ-N....SP.HPRSYYRC-T---------------------------
M0SDB1_MUSAM/144-200----------------DDGYN.WRKY-GQ.KQIK-G....SE.NPVGYYKC-T---------------------------
M1BIZ3_SOLTU/122-182----------------EDGYS.WRKY-GQ.KNIL-G....AK.YPREYYRC-A---------------------------
K4CF00_SOLLC/138-194----------------EDGYN.WRKY-GQ.KLVR-G....NE.FTRSYYKC-T---------------------------
W1PMH6_AMBTC/119-178----------------GDRYT.WRKY-GQ.KDIL-G....AK.YPRGYYRC-T---------------------------
U5GC56_POPTR/285-341----------------NDGYR.WRKY-GQ.KMLK-G....NS.FIRSYYRC-T---------------------------
B9SRT4_RICCO/128-188----------------DDGHA.WRKY-GQ.KVIL-N....TK.FPRNYFRC-T---------------------------
M0TU82_MUSAM/44-102----------------SDSWA.WRKY-GQ.KPIK-G....SP.HPRGYYRC-S---------------------------
B9GXX9_POPTR/25-80----------------EDGHG.WKKY-GQ.KFIK-K....IG.KFRSYFKC-Q---------------------------
K7V4I1_MAIZE/134-195----------------NDRFH.WRKY-GE.KNIL-Y....SE.YPRLYYKC-G---------------------------
B9RNV8_RICCO/68-125----------------TDGYS.WRKY-GQ.KQVK-S....SR.SFRSYYRC-S---------------------------
I1QGE9_ORYGL/62-119----------------DDGFH.WRMC-GQ.STIQ-G....GLCPTVFSYQC-A---------------------------
K7LCG4_SOYBN/201-259----------------GDGCQ.WRKY-GQ.KTAK-G....NP.CPRAYYRC-S---------------------------
K7LJY1_SOYBN/143-200----------------DDGYN.WRKY-GQ.KVIK-G....HT.YPRAYYKC-I---------------------------
B4FCE6_MAIZE/44-105----------------DDGHQ.WRKY-GE.KKLS-N....SH.FPRFYYRC-T---------------------------
K3ZE24_SETIT/124-183----------------EDGFI.WRKY-GQ.KEIH-G....SK.YPRFYFRC-T---------------------------
D8RSA8_SELML/4-60----------------EDGFN.WRKY-GQ.KQVK-G....SE.FPRSYYKC-T---------------------------
C5YRA1_SORBI/118-182----------------.DGYQ.WRKY-GQ.KQIE-G....AM.YPRSYYRC-T---------------------------
K7UWT7_MAIZE/125-185----------------EDGFI.WRKY-GQ.KDIH-G....SN.YPRLYFRC-T---------------------------
T1M9Q3_TRIUA/111-176----------------.DGHH.WRKY-GQ.KKIN-G....RQ.HVRSYYKC-A---------------------------
M0VYD6_HORVD/124-188----------------SDGYQ.WRKY-GQ.KRIM-R....TS.FPRCYYRC-C---------------------------
C5X9Q6_SORBI/1487-1548----------------DDGYS.WTKY-GQ.KNIL-G....AK.HPISYYRC-A---------------------------
K7LGJ6_SOYBN/248-305----------------DDGFR.WRKY-GQ.KVVK-G....NS.NARSYYKC-T---------------------------
I1QAI9_ORYGL/25-82----------------DDSYP.WRKY-GQ.KDIL-G....AR.FARSYYRC-A---------------------------
M0YD52_HORVD/22-80----------------ADGFA.WRKY-GQ.KDIN-G....SN.HPRLYYRC-A---------------------------
I1HSW0_BRADI/124-187----------------KDGSQ.WRKY-GQ.KNIR-N....RI.FARYYYKC-M---------------------------
E0CUS7_VITVI/11-69----------------RDSWS.WRKY-GQ.KPIK-G....SP.YPRNYYRC-S---------------------------
T1NKL9_TRIUA/123-186----------------SDGYQ.WRKY-GQ.KNIH-K....RK.FARSYYKC-M---------------------------
I1NPU0_ORYGL/179-237----------------SDLWA.WRKY-GQ.KPIK-G....SP.YPRGYYKC-S---------------------------
F6H336_VITVI/139-196----------------NDGYN.WRKY-GQ.KQVK-S....TE.SSRSYYRC-T---------------------------
F4PLI3_DICFS/633-691----------------ADGYQ.WRKY-GQ.KNVK-G....TQ.FPRSYYKC-T---------------------------
K4A5N4_SETIT/641-697----------------KDGYS.WRKY-GQ.KQLK-D....AE.SPRSYYKC-T---------------------------
D7U1A8_VITVI/362-418----------------.DGYR.WRKY-GQ.KMVK-G....NP.HPRNYYRC-T---------------------------
W5CBN1_WHEAT/2-57----------------.DGYR.WRKY-GQ.KFIK-N....NP.HPRSYYKC-T---------------------------
F6HHL8_VITVI/281-338----------------NDGYR.WRKY-GQ.KLVK-G....NT.NPRSYYRC-S---------------------------
W5I4X6_WHEAT/29-88----------------DDGFS.WRKY-GQ.KDIL-G....AK.FPRGYYRC-T---------------------------
M0YE87_HORVD/134-198----------------.DGYQ.WRKY-GQ.KQIE-A....AM.HPRSYYRC-T---------------------------
W5B1V0_WHEAT/120-180----------------DDGHS.WRKY-GQ.KDIL-G....AR.HPRAYYRC-T---------------------------
K3Y972_SETIT/138-202----------------.DGRQ.WRKY-GQ.KHIN-K....AK.HPRSYYRC-T---------------------------
M0THP3_MUSAM/86-142----------------DDGYK.WRKY-GQ.KSIK-N....SP.NPRSYYRC-T---------------------------
A9SJ74_PHYPA/290-348----------------DDGHRCWKKY-GN.KAIQ-N....ST.FCRGYYKC-S---------------------------
B9IIY4_POPTR/301-358----------------GDGFR.WRKY-GQ.KIVR-G....NP.YPRSYYRC-T---------------------------
WRK59_ARATH/109-166----------------DDGYK.WRKY-GK.KPIT-G....SP.FPRHYHKC-S---------------------------
A0A096URZ3_WHEAT/1333-1392----------------EDGFS.WRKY-GQ.KDII-G....SM.HPRAYFRC-T---------------------------
K7M7W5_SOYBN/127-187----------------DDNHA.WRKY-GQ.KRIL-N....SE.FPRSYFRC-S---------------------------
M4D9M7_BRARP/278-335----------------NDGYR.WRKY-GQ.KSVK-G....SP.YPRSYYRC-S---------------------------
M1A3W0_SOLTU/224-280----------------SDGYN.WRKY-GQ.KMVK-A....SE.CPRSYYKC-T---------------------------
M0SHM4_MUSAM/124-183----------------DDGYS.WRKY-GQ.KDIL-G....SK.HPRGYYRC-T---------------------------
K3ZNU0_SETIT/123-184----------------DDGYI.WRKY-GE.KKIN-G....TH.FTRNYFRC-S---------------------------
I1MX45_SOYBN/109-166----------------KDGYQ.WRKY-GQ.KVTK-D....NA.SPRAYFRC-Y---------------------------
B9H449_POPTR/209-265----------------DDGYN.WRKY-GQ.KPIK-G....SE.YPRSYYKC-T---------------------------
M4E2W1_BRARP/156-211----------------.DGYN.WRKY-GQ.KQVK-G....SD.CPRSYYKC-T---------------------------
B9IQ67_POPTR/183-243----------------EDGFS.WRKY-GQ.KEIL-G....SK.FPRAYYRC-T---------------------------
K4CXA0_SOLLC/509-566----------------EDGYR.WRKY-GQ.KLVK-G....NP.NPRSYYKC-T---------------------------
B9SM87_RICCO/108-165----------------DDGYR.WRKY-GK.KAVK-N....SR.NPRNYFKC-L---------------------------
WRK64_ARATH/103-163----------------DDGFT.WRKY-GQ.KTIK-T....SP.YQRCYYRC-T---------------------------
D7LDZ6_ARALL/104-164----------------DDGHC.WRKY-GQ.KEIH-G....SK.NPRAYYRC-T---------------------------
B9I8F0_POPTR/132-192----------------EDSHA.WRKY-GQ.KGIL-N....AK.YPRSYFRC-S---------------------------
K4AJ90_SETIT/3-60----------------QDGYE.WKKY-GQ.KFIK-N....IQ.KNRSYFRC-R---------------------------
D7U1A8_VITVI/189-245----------------ADGYN.WRKY-GQ.KQVK-S....PK.GSRSYYKC-T---------------------------
K4C162_SOLLC/27-81----------------EDGFS.WRKY-GK.KLV.-.....QN.IP.EYYRC-A---------------------------
K3ZQ30_SETIT/1145-1205----------------DDGYF.WKEY-VR.EDIL-G....AK.YPRSYYHC-V---------------------------
D7KMZ8_ARALL/325-382----------------NDGYR.WRKY-GQ.KVVK-G....NP.NPRSYYKC-T---------------------------
K3YGF8_SETIT/55-112----------------DDGYI.WKKC-AQ.NIVP-G....CG.YPTVYYKC-T---------------------------
I1KBC5_SOYBN/112-169----------------DDGYK.WRKY-GK.KTVK-S....SP.NPRNYYKC-S---------------------------
K7M5Z1_SOYBN/77-134----------------DDGYR.WRKY-GK.KMVK-K....CP.NPRNNYRC-S---------------------------
I1IJB3_BRADI/691-747----------------DDGYN.WRKY-GQ.TQVK-G....SE.NPRSYYKC-A---------------------------
C5XNA2_SORBI/124-184----------------.DGYQ.WRKY-GQ.KRIT-K....TQ.FPRCYFKC-S---------------------------
F6GX25_VITVI/254-311----------------NDGYR.WRKY-GQ.KVVK-G....NL.HPRNYYKC-T---------------------------
K3ZNM2_SETIT/136-202----------------.DGHQ.WRKY-GQ.KQIN-G....AK.YPRSYYRC-T---------------------------
B3H4T8_ARATH/468-524----------------NDGYN.WQKY-GQ.KKVK-G....SK.FPLSYYKC-T---------------------------
K4CB36_SOLLC/203-259----------------RDGYN.WRKY-GQ.KQVK-S....PQ.GSRSYYRC-T---------------------------
I1IV03_BRADI/121-188----------------YDGHQ.WRKY-GQ.KNIN-G....MQ.HPRSYYRC-T---------------------------
K3ZVA0_SETIT/121-180----------------DDGHS.WRKY-GQ.KEIL-G....AK.YPRSYYRC-T---------------------------
B9T726_RICCO/27-84----------------DDGYK.WRKY-GQ.KVVK-N....TL.HPRSYYRC-T---------------------------
M0SWT7_MUSAM/131-193----------------DDGHS.WRKY-GQ.KDIN-S....AK.YPRSYYRC-I---------------------------
M0TJN8_MUSAM/70-132----------------EDGYQ.WRKY-GQ.KTIN-D....AM.YPRCYYKC-T---------------------------
D7KEM5_ARALL/135-192----------------EDGYR.WRKY-GQ.KAVK-N....SP.YPRSYYRC-T---------------------------
M1D7L1_SOLTU/128-184----------------EDGLN.WRKY-GQ.KLIL-G....AK.YPREYFQC-V---------------------------
J3M640_ORYBR/195-252----------------EDGYN.WRKY-GQ.KQVK-G....SE.NPRSYYKC-T---------------------------
M0RX59_MUSAM/130-188----------------SDLWA.WRKY-GQ.KPIK-G....SP.YPRSYYRC-S---------------------------
M1A9L5_SOLTU/207-265----------------NDGCQ.WRKY-GQ.KISR-G....NP.CPRSYYRC-S---------------------------
B0LUS3_SOYBN/136-196----------------DDNHA.WRKY-GQ.KEIL-N....SQ.FPRSYFRC-T---------------------------
M7YD70_TRIUA/902-962----------------SDGFN.WRKF-GQ.KTIH-D....SN.FRRDYYRC-A---------------------------
J3LCQ1_ORYBR/41-98----------------ADGYS.WRKY-GQ.KPIK-G....SP.YPRGYYKC-S---------------------------
M0TLT1_MUSAM/216-272----------------DDGCH.WRKY-GE.KQVK-G....SD.NPRSYYKC-T---------------------------
M1BJ77_SOLTU/62-118----------------ENGYN.WGKY-GQ.KLVK-G....TE.FPRSYYKY-T---------------------------
I1LDL1_SOYBN/180-238----------------ADLWA.WRKY-GQ.KPIK-G....SP.YPRNYYRC-S---------------------------
K3ZLW2_SETIT/107-166----------------EDGFA.WRKY-GQ.KNIH-G....SK.HPRLYFRC-S---------------------------
WRK25_ARATH/329-385----------------.DGFR.WRKY-GQ.KVVK-G....NT.NPRSYYKC-T---------------------------
I1HL63_BRADI/95-152----------------EDGFK.WRKY-GK.KAVK-N....SP.NPRNYYRC-S---------------------------
K4CXX4_SOLLC/88-145----------------.DSST.WRKY-GQ.KPIK-G....SP.YPRGYYRC-S---------------------------
K3XT82_SETIT/66-125----------------.DGHL.WRKY-GQ.KKIK-D....AE.YPRLYFRC-S---------------------------
K4ACF8_SETIT/124-184----------------EDGHV.WRKY-GQ.KEIQ-N....SS.YPRSYYRC-T---------------------------
I1KPJ1_SOYBN/130-190----------------EDGYN.WRKY-GQ.KDIL-G....AK.YPRSYYRC-T---------------------------
B9RDW9_RICCO/125-184----------------DDGYN.WRKY-GQ.KDIL-G....AN.FPRSYYRC-T---------------------------
A4S4Z2_OSTLU/45-105----------------ADGYR.WRKY-GQ.KNIK-G....SS.FPRSYYRC-T---------------------------
M4CUI9_BRARP/208-267----------------NDGCQ.WRKY-GQ.KTAK-T....NP.LPRAYYRC-S---------------------------
I1I889_BRADI/256-312----------------EDGYN.WRKY-GQ.KQVK-N....SD.HPRSYYKC-S---------------------------
B9IL50_POPTR/163-221----------------KDGYQ.WRKY-GQ.KVTR-D....NP.SPRAYYKC-S---------------------------
K7KV11_SOYBN/172-232----------------EDGFT.WRKY-GQ.KEIL-G....SK.FPRSYYRC-T---------------------------
I1HPN1_BRADI/101-161----------------EDGQS.WRKY-GQ.KDIQ-N....SE.HPKSYFRC-T---------------------------
K7UAL6_MAIZE/166-235----------------.DGRQ.WRKY-GQ.KHIN-N....TK.HSRSYYRC-T---------------------------
C1MHM4_MICPC/67-120----------------DDGYR.WRKY-GQ.KLIK-G....SP.FPRSYYKC-T---------------------------
K7MJ24_SOYBN/105-164----------------.DGHQ.WRKY-GQ.KEIL-N....AK.YSRNYYRC-T---------------------------
M0SJA2_MUSAM/36-92----------------.DGYA.WRKY-GQ.KFIL-K....IR.KNRSYFKC-R---------------------------
W1NXJ2_AMBTC/234-290----------------SDNYS.WKKY-SE.RTVK-G....SP.YLRLFYKC-A---------------------------
D3BE88_POLPA/1056-1111----------------DDGFN.WRKY-GQ.KAVK-G....SP.YPKSYFKC-A---------------------------
J3MP57_ORYBR/126-186----------------EDGKQ.WRKY-GQ.KHIQ-D....SP.NPRSYYRC-T---------------------------
F6HHL8_VITVI/106-162----------------EDGYN.WRKY-GQ.KHVK-G....NE.FIRSYYRC-T---------------------------
A8ITC4_CHLRE/316-373----------------DDGYR.WRKY-GQ.KQVK-G....SP.FPRAYYKC-T---------------------------
Q013H7_OSTTA/23-83----------------NDGFR.WRKY-GC.KLIA-GNMVPHP.TERSYYRC-K---------------------------
I1JJR0_SOYBN/113-169----------------KDGYN.WRKY-GQ.KHVK-G....NE.FIRSYYKC-T---------------------------
M0TK84_MUSAM/89-146----------------DDGYS.WRKY-GK.KMMK-N....SQ.NPRNYYHC-S---------------------------
A9T511_PHYPA/27-83----------------EDGYK.WRKY-GQ.KAVK-N....SP.HPRSYYRC-T---------------------------
WRKY1_DICDI/1111-1165----------------DDGFF.WRKY-GQ.KSVK-G....SP.FPKSYFKC-A---------------------------
D8R168_SELML/1-61----------------DDGYT.WRKY-GQ.KDIL-G....SR.HPKSYYRC-T---------------------------
F6H336_VITVI/353-410----------------SDGYR.WRKY-GQ.KMVK-G....NP.HPRSYYRC-T---------------------------
I1GQR9_BRADI/375-432----------------DDGYR.WRKY-GQ.KVVK-G....NP.HPRSYYKC-T---------------------------
W1P9B9_AMBTC/6-65----------------EDSFT.WRKY-GQ.KEIL-N....SK.FPKSYYRC-A---------------------------
M4DKE5_BRARP/141-201----------------EDIYA.WRKY-GQ.KEIL-N....SK.FPRSYFRC-T---------------------------
K3Y1Z6_SETIT/159-216----------------.DTWS.WRKY-GQ.KSIK-G....SP.NPRRYYKC-S---------------------------
K3Y9C1_SETIT/76-139----------------.DGYR.WRKY-GQ.KQIE-G....AM.YARSYYRC-T---------------------------
W5DIT2_WHEAT/219-278----------------DDGFS.WRKY-GQ.KDIL-D....AK.HPRAYFRC-T---------------------------
M0YYV8_HORVD/86-146----------------NDGKT.WRKY-GQ.KCIH-A....CT.NPRSYYRC-S---------------------------
M0YJN3_HORVD/140-204----------------DDGFL.WTKY-GQ.KDIR-G....SG.HPRHYFRC-A---------------------------
K7KQN0_SOYBN/1276-1336----------------DDGYI.WRKY-GK.RQIL-G....AK.YPREYYRC-A---------------------------
K7LJY0_SOYBN/131-188----------------DDGYQ.WHQY-GL.KTMK-G....NL.FPRVYYKC-A---------------------------
Q6IES4_ORYSJ/135-192----------------DDGYK.WRKY-GK.KSVK-N....SP.NPRNYYRC-S---------------------------
K4CXA0_SOLLC/297-353----------------EDGHN.WIKY-GE.NQVK-G....SE.YPRSFYKC-T---------------------------
I1HG21_BRADI/167-225----------------DDLWA.WRKY-GQ.KPIK-G....SP.YPRGYYKC-S---------------------------
M1CUN0_SOLTU/22-82----------------DDGHA.WRKY-GQ.KQIL-N....ST.YPRHYFRC-T---------------------------
I1L6Z7_SOYBN/121-181----------------DDGHH.WRKY-GQ.KEIL-N....AK.FPRNYYRC-T---------------------------
K4BBZ0_SOLLC/387-444----------------DDGYK.WRKY-GQ.KVVK-G....TQ.HPRSYYRC-T---------------------------
M1BRE7_SOLTU/99-159----------------DDGYS.WRKY-GQ.KNIL-G....AI.HPRAYYRC-T---------------------------
I1R250_ORYGL/38-97----------------DDGFS.WRKY-GQ.KDVE-G....AV.HPRSYFRC-A---------------------------
K3ZJB7_SETIT/126-188----------------EDGYE.WRKY-GE.KKIN-G....TS.YTRSYFRC-T---------------------------
U5D8Z1_AMBTC/112-170----------------RDGCQ.WRKY-GQ.KVTR-D....NP.SPRAYYRC-S---------------------------
K3ZQ30_SETIT/1030-1090----------------DDGHS.WRKY-GQ.KEIP-G....SK.YPRAYFRC-T---------------------------
K7KIE5_SOYBN/90-148----------------KDGYQ.WKKY-GQKKVTK-D....NP.SPRAYFKC-S---------------------------
I1MKR8_SOYBN/158-216----------------SDIWA.WRKY-GQ.KPIK-G....SP.YPRGYYRC-S---------------------------
W1NWG1_AMBTC/259-315----------------EDGFN.WRKY-GQ.KQVK-G....SE.FPRSYYKC-T---------------------------
M4D1B7_BRARP/162-218----------------HDGYH.WRKY-GQ.KQVK-S....PK.GSRSYYRC-T---------------------------
I1MBG9_SOYBN/221-276----------------GDGYN.WRKY-ED.KVVK-G....SA.NQLSYYKC-T---------------------------
I1IV04_BRADI/110-179----------------YDGHQ.WRKY-GQ.KVIN-N....AK.HPRSYYRC-T---------------------------
M0SWH8_MUSAM/162-222----------------DDGQT.WRKY-GQ.KEIQ-S....AK.HPRSYFRC-T---------------------------
U5GSI9_POPTR/36-91----------------EDGFE.WKKY-GQ.KFIK-N....IG.KFRGYFRC-Q---------------------------
WRK68_ARATH/118-175----------------DDGYK.WRKY-GQ.KPVK-D....SP.FPRNYYRC-T---------------------------
F4QAR0_DICFS/125-181----------------.DEYH.WLLN-TI.KFVN-N....SK.FLCQNYTC-F---------------------------
D7MUR9_ARALL/1173-1233----------------ADLWT.WRKY-GQ.KYIL-G....SN.FPRSYYRC-T---------------------------
M4ECF8_BRARP/121-181----------------DDGFS.WRKY-GQ.KDIL-G....AK.FPRGYHRC-T---------------------------
C5XPF8_SORBI/150-208----------------NDGCQ.WRKY-GQ.KVAK-G....NP.CPRAYYRC-T---------------------------
W5CDR1_WHEAT/9-69----------------DDGFS.WRKY-GQ.KDIL-G....AK.YPRAYFRC-T---------------------------
F6H4B4_VITVI/93-150----------------DDGFK.WRKY-GK.KSVK-N....SP.NPRNYYKC-A---------------------------
K3ZN48_SETIT/373-432----------------YDGYS.WRMY-GQ.KEIP-G....AK.HPRGYYLC-M---------------------------
K3XKH8_SETIT/112-171----------------.DGFI.WRKY-GQ.KEIN-G....HK.HPRLYYRC-A---------------------------
WRK25_ARATH/166-222----------------NDGYG.WRKY-GQ.KQVK-K....SE.NPRSYFKC-T---------------------------
M0TC40_MUSAM/153-210----------------DDGYT.WRKY-GQ.KDIL-N....S....RSYYRC-T---------------------------
C5WVP7_SORBI/215-271----------------DDGYN.WRKY-GQ.KAVK-G....GE.YPRSYYKC-T---------------------------
M0TTG4_MUSAM/70-131----------------.DGYQ.WRKY-GQ.KTIN-N....AK.YPRSYYRC-T---------------------------
B9S4F2_RICCO/133-192----------------.DAHT.WRKY-GQ.KEIL-N....AK.YPRSYFRC-I---------------------------
A9U1V6_PHYPA/32-88----------------EDGYK.WRKY-GQ.KTVL-S....SP.YPRSYYKC-T---------------------------
WRK66_ARATH/86-145----------------.DGFI.WRKY-GQ.KTIK-T....SP.HQRWYYRC-A---------------------------
M0YT11_HORVD/178-234----------------DDGYN.WRKY-GQ.KQMK-G....SE.NPRSYYKC-S---------------------------
F6HC33_VITVI/111-171----------------EDGHA.WRKY-GQ.KEIL-N....AK.FPRSYYRC-T---------------------------
I1R250_ORYGL/129-189----------------DDGYS.WKRY-GQ.KNIF-G....AN.YPRCYYRC-I---------------------------
B9RNV8_RICCO/233-290----------------SDGFR.WRKY-GQ.KMVK-A....NS.YLRSYYRC-T---------------------------
M0TPC7_MUSAM/150-207----------------DDGYR.WRKY-GQ.KAVK-N....SR.FPRSYYRC-T---------------------------
U5FI33_POPTR/431-488----------------DDGYR.WRKY-GQ.KVVK-G....NP.NPRSYYKC-T---------------------------
K3ZN48_SETIT/520-580----------------DDGYS.WRKY-GQ.KKVL-G....AN.YPRAYYRC-T---------------------------
K7M257_SOYBN/138-198----------------EDGYT.WRKY-GQ.KMTS-Q....SK.YLRSYYRC-T---------------------------
M4CW62_BRARP/100-160----------------NDGFS.WRKY-GQ.KKIK-T....SS.HQRCYYRC-A---------------------------
W1PB05_AMBTC/141-201----------------DDGYA.WRKY-GQ.KDIL-N....AN.HPRSYFRC-T---------------------------
D8T390_SELML/1-56----------------.DGYN.WRKY-GQ.KQVK-G....CD.NPRSYYRC-T---------------------------
W1P843_AMBTC/109-166----------------DDGYR.WRKY-GK.KSVK-N....SP.NPRNYYRC-S---------------------------
I1IVB4_BRADI/118-173----------------.DGYN.WRKY-GQ.KQVK-G....SE.FPRSYYKC-T---------------------------
M4CSQ1_BRARP/127-187----------------DDAFS.WRKY-GQ.KEIL-N....AI.FPRSYFRC-T---------------------------
J3MMM2_ORYBR/104-160----------------DDGYS.WRKY-GQ.KAVK-G....GE.YPKSYYKC-T---------------------------
A9RC52_PHYPA/317-380----------------NDGCQ.WRKY-GQ.NTAK-G....NL.CPRGLLPL-.---------------------------
T1LAC7_TRIUA/117-183----------------.DGHH.WRKY-GQ.KNIN-G....RE.NARSYYRC-A---------------------------
I1Q2J1_ORYGL/176-232----------------PDSWA.WRKY-GQ.KPIK-G....SP.YPRGYYRC-S---------------------------
D7M6E1_ARALL/110-170----------------HDGFL.WRKY-GQ.KQIK-E....SE.YQRSYYKC-A---------------------------
K3XS92_SETIT/45-106----------------HDGYQ.WRKY-GQ.KMIR-G....NT.YPRCYYRC-T---------------------------
D8RSA8_SELML/111-168----------------DDGYR.WRKY-GQ.KIVK-G....NP.YPRSYYKC-T---------------------------
M1D2T0_SOLTU/151-208----------------DDGYK.WRKY-GK.KKVK-T....NI.YLRNYYKC-S---------------------------
B9GLD2_POPTR/244-301----------------.DDHY.WRKY-GQ.KPIK-G....SP.YPRSYYKC-S---------------------------
J3L5A9_ORYBR/122-183----------------KDGFL.WRKY-GQ.KNIQ-D....SN.YLRLYYKC-T---------------------------
A0A096SMI5_MAIZE/134-191----------------.DPWA.WRKY-GQ.KPIK-G....SP.YPRGYYRC-S---------------------------
F4Q0C8_DICFS/619-677----------------...YS.WNRM-GS.TKAD-G....IN.FTKYQYNC-S---------------------------
M4CLX3_BRARP/328-385----------------EDGFK.WRKY-GQ.KAVG-G....NA.YPRSYYRC-T---------------------------
K3YER8_SETIT/56-116----------------.DGHL.WRKY-GQ.KVIK-D....AP.YPRLYFRC-S---------------------------
T1N7Y3_TRIUA/130-195----------------.DGHQ.WRKY-GQ.KIIN-H....TK.HPRSYYKC-T---------------------------
W5GE05_WHEAT/9-68----------------DDGYT.WRKY-GQ.KDIL-G....SR.FPRSYYRC-T---------------------------
D8QTC4_SELML/4-64----------------DDGFT.WRKY-GQ.KDIL-N....SK.FPRSYYRC-T---------------------------
M1C548_SOLTU/54-110----------------DDGYT.WRKY-GQ.KQVK-G....SN.FPRSYYKC-T---------------------------
M0SMA5_MUSAM/88-145----------------DDGYK.WRKY-GR.KKMK-N....SP.YPRNYYRC-S---------------------------
M4DKE6_BRARP/150-210----------------DDNHT.WRKY-GQ.KEIL-G....SK.FPRAYYRC-T---------------------------
D7M911_ARALL/158-218----------------DDVFS.WRKY-GQ.KDIL-G....AK.FPRSYYRC-T---------------------------
I1IVB4_BRADI/275-329----------------EDAFR.WRKY-GQ.KAVN-G....NL.FPRSYYRC-S---------------------------
F6GX25_VITVI/36-92----------------EDGYN.WRKY-GQ.KSMK-G....SE.HTRSYYKC-T---------------------------
J3NAU6_ORYBR/110-173----------------.DGYQ.WRKY-GQ.KQIE-G....AK.YPRSYYRC-T---------------------------
M4F7P5_BRARP/264-321----------------DDGFR.WRKY-GQ.KVVK-G....NP.NPRSYYKC-T---------------------------
K4CIW2_SOLLC/133-193----------------DDGYS.WRKY-GQ.KDIL-R....AK.YPRSYYRC-T---------------------------
B9T8B8_RICCO/123-182----------------GDGYS.WRKY-GQ.KDIL-G....AK.FPRGYYRC-T---------------------------
WRKY1_DICDI/814-869----------------SDGYQ.WRKY-GQ.KNVK-G....SL.HPRHYYKC-T---------------------------
F4PLI3_DICFS/941-996----------------DDGFN.WRKY-GQ.KAVK-G....TH.FPKSYFKC-A---------------------------
K7VBJ3_MAIZE/118-180----------------KDGYV.WRKY-GQ.KNIQ-N....CN.FVRYYFRC-.---------------------------
Q0V871_ARATH/24-81----------------DDGYN.WRKY-GQ.KQVK-G....SE.NPRSYFKC-T---------------------------
M4F9N3_BRARP/76-133----------------DDGYK.WRKY-GK.KSVK-N....NI.NKRNYYKC-S---------------------------
A9S0E7_PHYPA/16-72----------------DDGYR.WRKY-GQ.KPVK-N....SH.HPRNYYKC-T---------------------------
M0X4S6_HORVD/138-199----------------NDGFH.WRKY-GE.KKIL-N....AV.FPRSYYRC-G---------------------------
U5FT31_POPTR/7-63----------------EDGYH.WRKY-GQ.KFVK-G....NE.FIRSYYKC-T---------------------------
M1CMZ7_SOLTU/94-155----------------EDGHA.WRKY-GQ.KVIL-N....SK.YPRCYYRC-S---------------------------
F6H3I5_VITVI/96-154----------------KDGFQ.WRKY-GQ.KITK-D....NP.SPRAYFRC-S---------------------------
K4BIZ9_SOLLC/116-177----------------NDGCA.WRKY-GQ.KKIL-N....SK.YPRCYYRC-T---------------------------
W5ET14_WHEAT/53-108----------------EDGYQ.WKKY-GQ.KFIK-N....IQ.KIRSYFRC-R---------------------------
K7KVJ1_SOYBN/74-131----------------DDGYQ.WRKY-GK.KIVK-N....NK.FPRSYYRC-S---------------------------
U5GVF5_POPTR/157-215----------------SDMWA.WRKY-GQ.KPIK-G....SP.YPRSYYRC-S---------------------------
I1LT43_SOYBN/160-216----------------SDGYN.WRKY-GQ.KQVK-N....PM.GSRSYYKC-T---------------------------
WRK34_ARATH/178-234----------------DDGYN.WRKY-GQ.KLVK-G....SE.YPRSYYKC-T---------------------------
M1D6V7_SOLTU/22-80----------------DDGYK.WRKY-GK.KTVK-S....NTNYLRNYYKC-S---------------------------
K4A5N4_SETIT/774-831----------------DDGYR.WRKY-GQ.KVVK-G....NP.RPRSYYKC-T---------------------------
I1IR53_BRADI/286-342----------------EDGYN.WKKY-GP.KQVK-S....TE.YPRSYFKC-T---------------------------
M1DN19_SOLTU/86-144----------------DDKWA.WRKY-GQ.KSIK-G....SP.FPRNYFKC-S---------------------------
W5FQQ6_WHEAT/917-977----------------DDGYS.WSKY-GQ.KDIL-G....SK.HPRGYYRC-V---------------------------
B9RAC9_RICCO/80-137----------------DDGYR.WRKY-GQ.KTVK-N....SK.FPRSYYKC-T---------------------------
M7ZW64_TRIUA/111-170----------------EDGFI.WRKY-GQ.KEIH-N....NR.HPRLYFRC-T---------------------------
U5GC56_POPTR/83-140----------------ADGYN.WRKY-GQ.KPVK-G....SK.NSRSYYRC-V---------------------------
M0VMN8_HORVD/120-183----------------KDGYK.WKKY-GQ.KNIK-N....RK.FARLYFRC-M---------------------------
J3MMM2_ORYBR/273-330----------------DDGYR.WRKY-GQ.KVVK-G....NP.FPRSYYKC-T---------------------------
A4S1F5_OSTLU/27-88----------------DDAHR.WRKY-GHKKIGK-RDKTSNDLSERSYYRC-S---------------------------
D7MKX1_ARALL/1146-1204----------------ADQWV.WRKY-GQ.KPIK-G....SP.YPRNYYKC-T---------------------------
M0T0B0_MUSAM/207-264----------------.DDFS.WRKY-GQ.KPIK-G....SP.HPRSYYKC-S---------------------------
I1PWM4_ORYGL/125-185----------------EDGFL.WRKY-GQ.KEIK-N....SK.HPRLYYRC-S---------------------------
I1R3G5_ORYGL/139-200----------------EDGYQ.WRKY-GE.KKIQ-G....TH.FTRSYFRC-T---------------------------
F6GXW4_VITVI/171-231----------------DDGYA.WRKY-GQ.KVIL-N....AK.HQRSYYRC-T---------------------------
M4CXB1_BRARP/69-126----------------DDGYR.WRKY-GQ.KAVK-N....NK.FPRSYYRC-T---------------------------
D7MF96_ARALL/373-429----------------DDGYR.WRKY-GQ.KVVK-G....NP.NPRSYYKC-T---------------------------
M1D7L8_SOLTU/129-186----------------EDGLS.WRKY-GQ.RLVL-G....EK.YPRKYYRC-A---------------------------
J3MYJ7_ORYBR/269-325----------------EDGYS.WRKY-GQ.KQVK-N....NE.NPRSYYKC-T---------------------------
C1EBM1_MICCC/10-63----------------EDGYV.WHKY-GA.KNVR-G.......RKVGYFKC-A---------------------------
M1DBE7_SOLTU/170-228----------------NDIWT.WRKY-GQ.KHIK-G....SP.FPRNYYKC-S---------------------------
K3Z832_SETIT/111-171----------------EDGHA.WRKY-GQ.KEIQ-N....SK.HPKAYFRC-T---------------------------
J3M860_ORYBR/133-194----------------NDGYH.WRKY-GE.KTIL-N....TE.FPKLYYRC-G---------------------------
M0VCG1_HORVD/220-278----------------GDKYS.WRKY-GQ.KTIK-G....SP.HPRCYYRC-G---------------------------
K3ZIR4_SETIT/69-127----------------DDGYS.WRKY-GQ.KLVK-G...IRE.HPRSYYRC-T---------------------------
I1HSW1_BRADI/41-106----------------SDGYM.WRKY-GQ.KRIM-K....TR.FPRCYYRC-S---------------------------
M7YP80_TRIUA/106-165----------------DDGRS.WRKY-GQ.KEIL-G....AQ.HPRAYYRC-T---------------------------
M0SP79_MUSAM/129-188----------------DDGYS.WRKY-GN.KNIL-G....SK.HSRSYYRC-R---------------------------
M0T4G9_MUSAM/121-181----------------DDGHS.WRKY-GQ.KEIL-G....AK.YPRSYFRC-T---------------------------
M0U1R5_MUSAM/391-448----------------TDGYR.WRKY-GQ.KFVK-G....NR.NPRSYYRC-T---------------------------
B9I7F0_POPTR/156-212----------------EDGYN.WRKY-GQ.KQVK-G....SE.YPRSYYKC-N---------------------------
WRK50_ARATH/113-170----------------DDGFK.WRKY-GK.KMVK-N....SP.HPRNYYKC-S---------------------------
E1ZGV1_CHLVA/113-170----------------DDGYR.WRKY-GQ.KIVK-G....NP.HPRSYYKC-T---------------------------
B9RND6_RICCO/52-110----------------SDFWS.WRKY-GQ.KPIK-G....SP.YPRGYYRC-S---------------------------
M4FA92_BRARP/266-323----------------NDGHR.WRKY-GQ.KIVK-G....NP.NPRSYYKC-S---------------------------
K3ZT34_SETIT/82-138----------------EDGYN.WRKY-GQ.KHVK-G....SE.NPRSYYKC-T---------------------------
M0U8S7_MUSAM/172-227----------------.DIYH.WRKY-GQ.KQVK-N....TE.NFRSYYRC-A---------------------------
M0RX59_MUSAM/291-348----------------DDGYR.WRKY-GQ.KAVK-N....SV.HPRSYYRC-T---------------------------
K3XLT9_SETIT/160-217----------------DDGYR.WRKY-GK.KLVK-N....SP.NPRNYYRC-S---------------------------
I1R3G9_ORYGL/27-91----------------NDGHQ.WRKY-GQ.KWIS-R....AK.HSRSYYRC-A---------------------------
A9TJH5_PHYPA/11-68----------------DDGYK.WRKY-GQ.KAVK-N....SP.HPRNYYRC-A---------------------------
E1ZGV1_CHLVA/4-61----------------DDGYN.WRKY-GE.KQVK-G....SP.FPRSYYKC-S---------------------------
D8R033_SELML/2-60----------------NDGCQ.WRKY-GQ.KMAK-G....NP.CPRAYYRC-T---------------------------
K4CG67_SOLLC/75-133----------------QDSWS.WRKY-GQ.KPIK-G....SP.YPRGYYRC-S---------------------------
M0TXJ2_MUSAM/6-66----------------NDGYK.WRKY-GQ.KKIL-N....SS.FPRSYYHC-N---------------------------
M0S0M4_MUSAM/331-387----------------.DGYH.WRKY-GQ.KVVK-G....NT.FPRSYYRC-T---------------------------
I1QTG0_ORYGL/63-124----------------TDGHL.WRKY-GE.KKIK-N....SS.FPRLYYRC-S---------------------------
W5FQQ6_WHEAT/802-862----------------DDGFS.WRKY-GQ.KDIL-G....SR.NPRGYYRC-T---------------------------
M4C895_BRARP/99-159----------------DDGYC.WRKY-GQ.KEIH-G....SS.NPRGYFRC-T---------------------------
C5X5M4_SORBI/126-186----------------DDGKA.WRKY-GQ.KRIH-E....SP.NPRSYYRC-T---------------------------
D7M935_ARALL/134-192----------------SDAWG.WRKY-GQ.KPIK-G....SP.YPRSYYRC-S---------------------------
M4EPX7_BRARP/108-165----------------DDGYS.WKKY-GQ.RLIM-G....NQ.NTRSYYKC-T---------------------------
A9SRR4_PHYPA/11-68----------------DDGYK.WRKY-GQ.KPVK-S....SP.HPRNYYRC-T---------------------------
E0CUJ8_VITVI/134-194----------------DDGFS.WRKY-GQ.KDIL-G....AK.YPRSYYKC-T---------------------------
M0THF1_MUSAM/136-195----------------EDGYS.WRKY-GQ.KEIL-G....AR.HPRGYYRC-S---------------------------
K7M259_SOYBN/132-192----------------EDGYA.WRKY-GQ.KITL-N....AK.YLRSYYRC-T---------------------------
W1NEF1_AMBTC/8-65----------------EDGFV.WRKY-GQ.KFIR-N....IR.KNRSYFKC-Q---------------------------
M4EPX6_BRARP/284-341----------------DDGYQ.WRKY-GR.KIVN-G....NS.NPRSYYKC-T---------------------------
I1BSM4_RHIO9/209-264----------------MDGYF.WKNN-G..NTVQ-K....KTGNKSVYYKC-S---------------------------
A8ITC4_CHLRE/117-174----------------SDGWQ.WRKY-GE.KLVK-G....SP.NPRSYYKC-S---------------------------
C5Y3H4_SORBI/132-194----------------DDGYE.WRKY-GE.KKIN-G....TL.FTRSYFRC-T---------------------------
J3N5J0_ORYBR/148-214----------------.DGHQ.WRKY-GQ.KHIN-N....SK.HPRSYYRC-T---------------------------
M0U1R5_MUSAM/220-275----------------.DVYN.WRKY-GQ.KQVK-S....SE.NARSYYRC-T---------------------------
M1DVX5_SOLTU/167-225----------------ADQWR.WRKY-GM.KRTG-D....ST.FLKSYYRC-N---------------------------
K3ZIR4_SETIT/224-280----------------DDGFR.WRKY-GK.KMVK-E....NP.YPRSYYKC-L---------------------------
M8A8S6_TRIUA/118-178----------------TDGKS.WRKY-GQ.KQIN-D....ST.NPRSYYRC-T---------------------------
K4AKU1_SETIT/30-91----------------NDGHQ.WRKY-GE.KKIN-N....TN.FPRYYYRC-T---------------------------
D3BE88_POLPA/755-813----------------SDGYQ.WRKY-GQ.KNVK-G....TQ.FPRSYYKC-T---------------------------
K4C166_SOLLC/129-185----------------EDGLS.WRKY-GQ.KVIS-G....SK.YPREYYRC-A---------------------------
WRK45_ARATH/65-122----------------DDGYR.WRKY-GQ.KAVK-N....NP.FPRSYYKC-T---------------------------
M4CDZ0_BRARP/106-165----------------.DGFL.WRKY-GQ.KSIK-N....SK.YERSYYRC-S---------------------------
C0PKA1_MAIZE/112-175----------------.DGYQ.WRKY-GQ.KQIE-G....AM.YPRSYYRC-I---------------------------
C5X581_SORBI/15-73----------------HDSYT.WRKY-GQ.KEIL-G....AR.FPRSYYKC-G---------------------------
B9T4U8_RICCO/34-91----------------.DDYS.WRKY-GQ.KPIK-G....SP.HPRGYYKC-S---------------------------
J3NA98_ORYBR/1018-1075----------------DDGFS.WRKY-GQ.KPIE-G....AM.HPRNYYRC-A---------------------------
I1J5V4_SOYBN/175-231----------------DDGYN.WRKY-GQ.KQVK-G....SE.FPRSYYKC-T---------------------------
I1PTK2_ORYGL/147-208----------------.DGHQ.WRKY-GQ.KNIN-N....SN.HQRSYYRC-T---------------------------
I1HR78_BRADI/64-122----------------TDEWA.WRKY-GQ.KPIK-G....SP.FPRAYYRC-S---------------------------
W5D9K8_WHEAT/68-128----------------.DGHL.WRKY-GQ.KNIK-D....SA.FPRLYYRC-S---------------------------
T1MEI9_TRIUA/119-182----------------SDGYQ.WRKY-GQ.KNIQ-N....RK.FARCYYKC-M---------------------------
C5X9Q6_SORBI/1354-1412----------------NDGYT.WRKY-GS.KQIL-G....SN.YPRDYYKC-T---------------------------
C1N120_MICPC/5-60----------------DDGYR.WRKY-GQ.KIIK-G....AP.FPRSYYRC-T---------------------------

PF03615

Q5TQ16_ANOGA/3-143----------------YEKFNEWADG-HV-RHVY.HPTDDHARKHISGWAMRN---------------------------
A7SSU8_NEMVE/11-147----------------FDEFNEWIDG-SC-KLRY.SAYSREAQAHISGWAMKY---------------------------
Q17NS1_AEDAE/37-177----------------LDEFNEWSDG-HC-RYIY.RSMDEMAKRHSSGWAMRN---------------------------
M9PFC8_DROME/47-186----------------FDDFNDWSNG-HC-RLIY.SVQSDEARKHASGWAMRN---------------------------
GCM1_MOUSE/30-167----------------TDWFQEWPDS-YV-KHIY.SSDDRNAQRHLSSWAMRN---------------------------
K1PSK2_CRAGI/41-180----------------VDDFQEWPDG-NN-RFVY.SSNCEDARRHISGWAMRN---------------------------
C3ZI50_BRAFL/63-202----------------LDPFHEWPDG-NV-RLVF.DASDTDARKHVSGWAMRN---------------------------
A0A068YFP9_ECHMU/176-311----------------YDPYDLWPDG-NC-RRIY.SMASERARRHQSGWAMRN---------------------------
G4VCV4_SCHMA/248-378----------------FDTFTMWPQG-HC-RYAYKKSQSEGARRHASGWAMRN---------------------------
Q8MMJ4_STRPU/66-206----------------YDDFNEWIDG-DV-TMRY.LPKDIDARKHLSGWAMRN---------------------------
W5NJR0_LEPOC/36-173----------------TDVFQEWTDS-YV-KLVY.SSEEKNAQRHLSGWAMKN---------------------------
B3MUW9_DROAN/83-223----------------FDEFNEWSDG-HV-RHIY.SLHNEEAKKHISGWAMRN---------------------------
D6WJ63_TRICA/26-165----------------FDSFSEWADG-HC-RLVY.RADNEDAKRHSSGWAMRN---------------------------
Q5TLZ9_DANRE/19-156----------------YDAFQEWTDG-YV-RYIY.SSEDKNAQRHLSGWAMRN---------------------------
H3A2B3_LATCH/38-175----------------TDWFQEWPDS-YM-KCIY.SIGDKNAQKHLSGWAMRN---------------------------
H2KV09_CLOSI/280-413----------------FDPYELWPTG-HC-RRIY.SQACERARRHQSGWAMRN---------------------------

PF08731

Q6BK98_DEBHA/21-107------------FTNKDDIKP-WLQNYLLHKKGIHVVIARSD-ANKIVFRC-KSDKSKET.AE.................
AFT2_CANAL/21-112------------FDSKDDIKP-WLQDNLQSTKGINVVIERSD-TSKIIFKC-KNKEKKTKIVE.................
AFT2_YEAST/51-137------------FEDRHEIKP-WLQK.IFYPQGIDIVIERSD-SSKVTFKC-RSVRSKVGLNP.................
AFT1_YEAST/108-243------------FEDKSDIKP-WLQK.IFYPQGIELVIERSD-AFKVVFKC-KAAKRGRNARRKRKDKPKGQDHEDEKSK
Q6FS49_CANGA/15-125------------FKDKNEIKP-WLQK.IFYPQGIEIVIERSD-SLKVVFKC-KAAKRGRKSQEELTEEERLRQEA.....
Q6CS78_KLULA/99-257------------FKDKSEVKP-WLQK.IFYPQGIEIVIERSD-SMKIVFKC-KAVKKNRNTSSISGCGHSHGVGSDSCNT
Q6FSP0_CANGA/42-131------------FQEKIDVKV-WLQE.MFFPMGIDIVIERSD-KTKIIFKC-KPSDYRSHEPKD................
Q755B2_ASHGO/89-206------------FKDKNDIKP-WLQK.IFYPQGIEIVIERSD-KIKVVFKC-KASKRTKSGSAPGSQAGAAEDELGGQ..

PF03108

Q2QMP0_ORYSJ/171-237---EFQLVVGQEFPDVMSCRR-AIRN-TAIACHFEIQTVKSD.KTRFTAKC-S---------------------------
Q9C702_ARATH/177-243---GDTMRVGLCFKDLAEMKK-AVDW-CSIKRRQKCLLRETE.KDVYVVEC-E---------------------------
Q0D1G9_ASPTN/6-73---DIKWRRGLKFPSLEEGRA-ALIQ-HTIDQQQSFRVDKSD.HKRFFTRC-L---------------------------
Q0DAT1_ORYSJ/144-210---NVITGVGQVFDGPKDFRD-ALHK-YAIAHKFHYRFIKND.SSRVTAEC-T---------------------------
I1Q5U8_ORYGL/402-465---...LRKCLEFPSMVALKL-WLQE-YAIVHHRPYRVVNSAANRRYTVKC-E---------------------------
I1QDU7_ORYGL/128-194---..EVIQGAIYSRAEDMKK-AVKH-FAVSLHREFWVAKSN.RSQYEVRC-V---------------------------
M4FGM2_BRARP/194-256---....GLGQRFKNVGEFRE-SLRK-YAIANQFGFRYKKND.SHRVTVRC-K---------------------------

PF03101

FRS4_ARATH/11-97-----------------------------------------------------------------RYGSKQQSDDA....
FRS8_ARATH/109-194-----------------------------------------------------------------CQGFKLLKDAH....
FRS10_ARATH/69-161-----------------------------------------------------------------RSGFNQPRKKA....
FRS1_ARATH/35-137-----------------------------------------------------------------RYGSKKEDIDTGLGT
FRS5_ARATH/87-179-----------------------------------------------------------------KEGFRNMNEKRT...
Q6NLE7_ARATH/25-111-----------------------------------------------------------------KQGFGPNNQRS....
Q8H344_ORYSJ/116-204-----------------------------------------------------------------REGFREKKRGT....
Q7XKT7_ORYSJ/54-140-----------------------------------------------------------------KGGIARIKPGL....
Q93Z68_ARATH/84-172-----------------------------------------------------------------KEGYRLPSKRD....
Q6ESZ2_ORYSJ/64-154-----------------------------------------------------------------REGFKAPDKRT....
FAR1_ARATH/65-154-----------------------------------------------------------------RYGVTPESESS....
Q6AT58_ORYSJ/82-184-----------------------------------------------------------------KEGFRTYRGKNEVSP
Q2QXD6_ORYSJ/96-184-----------------------------------------------------------------KEGLKDDEQLT....
Q84JA7_ARATH/47-136-----------------------------------------------------------------KEGFRRSRPRR....
Q75LD4_ORYSJ/42-126-----------------------------------------------------------------KWGDGKEDACY....
J3LS84_ORYBR/67-154-----------------------------------------------------------------KEGFHHKKQND....

PF04500

Q70BY8_DROVI/421-485-----------------------------------------------------------------NYSKKV..HEQ----
B4MBE8_DROVI/40-101-----------------------------------------------------------------KLRCK....YI----
FWCH1_MOUSE/402-460-----------------------------------------------------------------DQAR......M----
FWCH1_MOUSE/235-293-----------------------------------------------------------------EHAV......H----
A7UT18_ANOGA/463-522-----------------------------------------------------------------RNYD.......----
A7UT18_ANOGA/543-605-----------------------------------------------------------------GSLG......V----
FWCH1_HUMAN/600-658-----------------------------------------------------------------DQAR......L----
Q16SJ4_AEDAE/393-453-----------------------------------------------------------------QYYK......R----
Q17CC2_AEDAE/19-83-----------------------------------------------------------------QAKV......L----
Q6IDT6_DROPS/406-467-----------------------------------------------------------------NYYK......E----
Q16WE4_AEDAE/17-80-----------------------------------------------------------------SYRV......S----
Q6IDT7_DROPS/405-469-----------------------------------------------------------------KKDV......T----
Q6NP69_DROME/162-227-----------------------------------------------------------------RKRD......I----
Q16SI9_AEDAE/387-448-----------------------------------------------------------------HRRSK....LK----
Q17CD4_AEDAE/347-409-----------------------------------------------------------------QSKA......L----
Q6IDX8_ANOGA/378-443-----------------------------------------------------------------FYHR......L----
Q6IDX0_ANOGA/458-517-----------------------------------------------------------------QFKR......N----
Q6IDZ2_ANOGA/392-456-----------------------------------------------------------------QWWN......Q----
Q17EL2_AEDAE/670-734-----------------------------------------------------------------NFEA.....KM----
Q17CD3_AEDAE/199-260-----------------------------------------------------------------GYRK......H----
Q9XWQ6_CAEEL/134-195-----------------------------------------------------------------RKNT.......----
Q16WH6_AEDAE/7-75-----------------------------------------------------------------NRSHTT.EQRR----
Q17EL2_AEDAE/762-821-----------------------------------------------------------------AIRS.......----
Q17EL2_AEDAE/236-296-----------------------------------------------------------------MFRN.......----
Q16FH8_AEDAE/26-95-----------------------------------------------------------------ERAHKTKRDGS----
Q16SK1_AEDAE/387-448-----------------------------------------------------------------KLRS......L----
Q17C92_AEDAE/22-90-----------------------------------------------------------------SRKHEK.TSDT----
Q17CD5_AEDAE/89-153-----------------------------------------------------------------QHKV......L----
Q6NP69_DROME/596-663-----------------------------------------------------------------KSRDP....DI----
Q6IDU1_DROPS/408-468-----------------------------------------------------------------RAGA......H----
A0APY4_DROSI/32-92-----------------------------------------------------------------LSRK......F----
Q17MH0_AEDAE/8-77-----------------------------------------------------------------VRCHAA.GSNN----
Q16SJ1_AEDAE/385-449-----------------------------------------------------------------NYSRKI..KEE----
Q17CC5_AEDAE/2-67-----------------------------------------------------------------HNRS......E----
Q17CC4_AEDAE/1-62-----------------------------------------------------------------KSRS......L----
Q16SK0_AEDAE/393-454-----------------------------------------------------------------AYKS......K----
Q16SK2_AEDAE/394-455-----------------------------------------------------------------KQRS......Q----
Q6IDT9_DROPS/430-492-----------------------------------------------------------------KWRK.......----
Q17CA9_AEDAE/249-307-----------------------------------------------------------------NSNT......L----
Q17CB7_AEDAE/18-77-----------------------------------------------------------------KSRQ.......----
Q17EK9_AEDAE/1691-1752-----------------------------------------------------------------RKKM......K----
Q17IM0_AEDAE/257-318-----------------------------------------------------------------AK.........----
Q7QDH8_ANOGA/445-505-----------------------------------------------------------------DLLK......Y----
Q6IDZ7_ANOGA/373-431-----------------------------------------------------------------RYKT......H----
Q18225_CAEEL/143-204-----------------------------------------------------------------RKND.......----
Q17CD3_AEDAE/4-68-----------------------------------------------------------------QAKP......L----
Q17CD3_AEDAE/86-145-----------------------------------------------------------------QFKS......L----
Q6IDY5_ANOGA/394-455-----------------------------------------------------------------QYYK......C----
Q17EK9_AEDAE/424-486-----------------------------------------------------------------SYRS......G----
Q6IDU0_DROPS/419-479-----------------------------------------------------------------KKGS......T----
Q16SI1_AEDAE/384-445-----------------------------------------------------------------QFRA......L----
Q6IDY6_ANOGA/439-499-----------------------------------------------------------------KWHT.......----
Q16SJ5_AEDAE/380-443-----------------------------------------------------------------SMATS....KL----
Q17CB7_AEDAE/197-258-----------------------------------------------------------------QLHA......K----
A7DTF1_CAEEL/131-192-----------------------------------------------------------------YKNT.......----
Q17CD5_AEDAE/175-239-----------------------------------------------------------------QFRV......L----
Q6IDY2_ANOGA/385-450-----------------------------------------------------------------RYVK......H----
Q6IDU2_DROPS/436-495-----------------------------------------------------------------QFAV......L----
Q16SI4_AEDAE/385-447-----------------------------------------------------------------QFKA......L----
Q6IDX5_ANOGA/379-440-----------------------------------------------------------------FYKS......K----
Q6IDX7_ANOGA/374-437-----------------------------------------------------------------MHRK......S----
Q16SI2_AEDAE/384-446-----------------------------------------------------------------QTKA......L----
Q16SJ2_AEDAE/416-472-----------------------------------------------------------------SF........C----
Q17CC3_AEDAE/84-147-----------------------------------------------------------------LFGK......L----
Q6NP69_DROME/365-432-----------------------------------------------------------------NRRDK....AN----
Q17EL2_AEDAE/360-420-----------------------------------------------------------------SHRL.......----
Q17CC0_AEDAE/72-136-----------------------------------------------------------------RAGM......N----
Q6IDT4_DROPS/418-482-----------------------------------------------------------------SMATK....KL----
Q17CB6_AEDAE/76-137-----------------------------------------------------------------KNRA......L----
Q16SJ8_AEDAE/412-474-----------------------------------------------------------------KAVP......F----
Q17CB9_AEDAE/37-98-----------------------------------------------------------------QYYK......C----
Q16FU8_AEDAE/997-1058-----------------------------------------------------------------LRDQ......V----
Q17EK9_AEDAE/344-403-----------------------------------------------------------------NYDK.......----
Q6IDX2_ANOGA/381-447-----------------------------------------------------------------SYKQ......V----
Q6IDV9_DROPS/402-461-----------------------------------------------------------------MYRK......L----
Q16SI5_AEDAE/381-443-----------------------------------------------------------------QRRA......H----
Q16SJ7_AEDAE/381-447-----------------------------------------------------------------LYYR......L----
Q17CD4_AEDAE/155-214-----------------------------------------------------------------QSRP......L----
Q17EK9_AEDAE/1138-1199-----------------------------------------------------------------SNSS.......----
MMD4_DROME/452-512-----------------------------------------------------------------YREH.....GE----
Q17EK9_AEDAE/1463-1528-----------------------------------------------------------------WARS......N----
Q16SI0_AEDAE/430-495-----------------------------------------------------------------VTNH......V----
Q16SB8_AEDAE/1076-1143-----------------------------------------------------------------KHNIQ....NF----
Q17CD2_AEDAE/110-170-----------------------------------------------------------------RKNM......L----
Q6NP69_DROME/17-87-----------------------------------------------------------------RRKDK....ST----
Q17EL2_AEDAE/459-522-----------------------------------------------------------------MRLD......T----
Q17CB7_AEDAE/98-160-----------------------------------------------------------------NANF......R----
Q16SI3_AEDAE/390-452-----------------------------------------------------------------QTKA......L----
Q16SJ6_AEDAE/386-449-----------------------------------------------------------------LFGK......L----
A8XLA6_CAEBR/145-206-----------------------------------------------------------------KKNT.......----
Q16SJ0_AEDAE/390-455-----------------------------------------------------------------FSSNRK..GPN----
Q17EK9_AEDAE/1257-1320-----------------------------------------------------------------HFKS......K----
Q17EK9_AEDAE/94-153-----------------------------------------------------------------..RL......G----
B4GZB2_DROPE/96-158-----------------------------------------------------------------KNSNL....LI----
B4I3G6_DROSE/69-132-----------------------------------------------------------------QWWN......Q----
B4I3H2_DROSE/2-65-----------------------------------------------------------------QNRS......V----
B4I3I4_DROSE/2-63-----------------------------------------------------------------RNRY......M----
B4JS54_DROGR/8-73-----------------------------------------------------------------DGNGKR.INEN----
B4R104_DROSI/89-155-----------------------------------------------------------------MYHK......A----
H2KZM4_CAEEL/53-119-----------------------------------------------------------------CAKKMHDGQWC----
Q5TUB5_ANOGA/339-400-----------------------------------------------------------------SRRT.....KI----
Q6IDT0_DROPS/406-466-----------------------------------------------------------------DVLK......L----

PF03106

M7ZE84_TRIUA/87-143-----------------------------------------------------------------H.P...---------
K3XPF8_SETIT/105-165-----------------------------------------------------------------.NRH.R---------
J3LNI8_ORYBR/48-108-----------------------------------------------------------------HKVD.Q---------
M0SDB1_MUSAM/144-200-----------------------------------------------------------------Y.P...---------
M1BIZ3_SOLTU/122-182-----------------------------------------------------------------RNRS.S---------
K4CF00_SOLLC/138-194-----------------------------------------------------------------R.L...---------
W1PMH6_AMBTC/119-178-----------------------------------------------------------------HRNS.Q---------
U5GC56_POPTR/285-341-----------------------------------------------------------------S.S...---------
B9SRT4_RICCO/128-188-----------------------------------------------------------------HKYD.Q---------
M0TU82_MUSAM/44-102-----------------------------------------------------------------SWK...---------
B9GXX9_POPTR/25-80-----------------------------------------------------------------KQ....---------
K7V4I1_MAIZE/134-195-----------------------------------------------------------------YSDD.H---------
B9RNV8_RICCO/68-125-----------------------------------------------------------------H.S...---------
I1QGE9_ORYGL/62-119-----------------------------------------------------------------LP....---------
K7LCG4_SOYBN/201-259-----------------------------------------------------------------MGT...---------
K7LJY1_SOYBN/143-200-----------------------------------------------------------------S.A...---------
B4FCE6_MAIZE/44-105-----------------------------------------------------------------YKND.M---------
K3ZE24_SETIT/124-183-----------------------------------------------------------------YKED.H---------
D8RSA8_SELML/4-60-----------------------------------------------------------------S.S...---------
C5YRA1_SORBI/118-182-----------------------------------------------------------------RSAE.Q---------
K7UWT7_MAIZE/125-185-----------------------------------------------------------------YKDD.R---------
T1M9Q3_TRIUA/111-176-----------------------------------------------------------------YTE..R---------
M0VYD6_HORVD/124-188-----------------------------------------------------------------YHRE.R---------
C5X9Q6_SORBI/1487-1548-----------------------------------------------------------------HWIA.Q---------
K7LGJ6_SOYBN/248-305-----------------------------------------------------------------A.P...---------
I1QAI9_ORYGL/25-82-----------------------------------------------------------------QML...---------
M0YD52_HORVD/22-80-----------------------------------------------------------------FRG..E---------
I1HSW0_BRADI/124-187-----------------------------------------------------------------YSHE.R---------
E0CUS7_VITVI/11-69-----------------------------------------------------------------TLK...---------
T1NKL9_TRIUA/123-186-----------------------------------------------------------------FSHD.R---------
I1NPU0_ORYGL/179-237-----------------------------------------------------------------SMK...---------
F6H336_VITVI/139-196-----------------------------------------------------------------Y.S...---------
F4PLI3_DICFS/633-691-----------------------------------------------------------------V.P...---------
K4A5N4_SETIT/641-697-----------------------------------------------------------------R.D...---------
D7U1A8_VITVI/362-418-----------------------------------------------------------------S.A...---------
W5CBN1_WHEAT/2-57-----------------------------------------------------------------S.A...---------
F6HHL8_VITVI/281-338-----------------------------------------------------------------N.A...---------
W5I4X6_WHEAT/29-88-----------------------------------------------------------------YRNA.Q---------
M0YE87_HORVD/134-198-----------------------------------------------------------------NSTN.Q---------
W5B1V0_WHEAT/120-180-----------------------------------------------------------------HRNS.Q---------
K3Y972_SETIT/138-202-----------------------------------------------------------------YRQE.Q---------
M0THP3_MUSAM/86-142-----------------------------------------------------------------N.P...---------
A9SJ74_PHYPA/290-348-----------------------------------------------------------------MK....---------
B9IIY4_POPTR/301-358-----------------------------------------------------------------S.L...---------
WRK59_ARATH/109-166-----------------------------------------------------------------S.P...---------
A0A096URZ3_WHEAT/1333-1392-----------------------------------------------------------------HRHV.K---------
K7M7W5_SOYBN/127-187-----------------------------------------------------------------HKYD.Q---------
M4D9M7_BRARP/278-335-----------------------------------------------------------------S.S...---------
M1A3W0_SOLTU/224-280-----------------------------------------------------------------H.V...---------
M0SHM4_MUSAM/124-183-----------------------------------------------------------------HRIM.Q---------
K3ZNU0_SETIT/123-184-----------------------------------------------------------------YKYD.R---------
I1MX45_SOYBN/109-166-----------------------------------------------------------------MAP...---------
B9H449_POPTR/209-265-----------------------------------------------------------------H.L...---------
M4E2W1_BRARP/156-211-----------------------------------------------------------------H.P...---------
B9IQ67_POPTR/183-243-----------------------------------------------------------------NQNL.Y---------
K4CXA0_SOLLC/509-566-----------------------------------------------------------------N.S...---------
B9SM87_RICCO/108-165-----------------------------------------------------------------K.A...---------
WRK64_ARATH/103-163-----------------------------------------------------------------YAKD.Q---------
D7LDZ6_ARALL/104-164-----------------------------------------------------------------HRFT.Q---------
B9I8F0_POPTR/132-192-----------------------------------------------------------------RKYE.Q---------
K4AJ90_SETIT/3-60-----------------------------------------------------------------HK....---------
D7U1A8_VITVI/189-245-----------------------------------------------------------------Y.S...---------
K4C162_SOLLC/27-81-----------------------------------------------------------------R....H---------
K3ZQ30_SETIT/1145-1205-----------------------------------------------------------------CRHT.E---------
D7KMZ8_ARALL/325-382-----------------------------------------------------------------N.N...---------
K3YGF8_SETIT/55-112-----------------------------------------------------------------QE....---------
I1KBC5_SOYBN/112-169-----------------------------------------------------------------G.E...---------
K7M5Z1_SOYBN/77-134-----------------------------------------------------------------V.D...---------
I1IJB3_BRADI/691-747-----------------------------------------------------------------F.P...---------
C5XNA2_SORBI/124-184-----------------------------------------------------------------FHRE.R---------
F6GX25_VITVI/254-311-----------------------------------------------------------------S.T...---------
K3ZNM2_SETIT/136-202-----------------------------------------------------------------YGKE.Q---------
B3H4T8_ARATH/468-524-----------------------------------------------------------------Y.L...---------
K4CB36_SOLLC/203-259-----------------------------------------------------------------H.S...---------
I1IV03_BRADI/121-188-----------------------------------------------------------------Y.KE.R---------
K3ZVA0_SETIT/121-180-----------------------------------------------------------------HRHS.Q---------
B9T726_RICCO/27-84-----------------------------------------------------------------Q.D...---------
M0SWT7_MUSAM/131-193-----------------------------------------------------------------HRKE.Q---------
M0TJN8_MUSAM/70-132-----------------------------------------------------------------YRDD.Q---------
D7KEM5_ARALL/135-192-----------------------------------------------------------------T.Q...---------
M1D7L1_SOLTU/128-184-----------------------------------------------------------------C....R---------
J3M640_ORYBR/195-252-----------------------------------------------------------------Y.N...---------
M0RX59_MUSAM/130-188-----------------------------------------------------------------TSK...---------
M1A9L5_SOLTU/207-265-----------------------------------------------------------------VAP...---------
B0LUS3_SOYBN/136-196-----------------------------------------------------------------RKFE.Q---------
M7YD70_TRIUA/902-962-----------------------------------------------------------------HYRS.H---------
J3LCQ1_ORYBR/41-98-----------------------------------------------------------------TAH...---------
M0TLT1_MUSAM/216-272-----------------------------------------------------------------Y.P...---------
M1BJ77_SOLTU/62-118-----------------------------------------------------------------Y.P...---------
I1LDL1_SOYBN/180-238-----------------------------------------------------------------SSK...---------
K3ZLW2_SETIT/107-166-----------------------------------------------------------------YNDD.N---------
WRK25_ARATH/329-385-----------------------------------------------------------------F.Q...---------
I1HL63_BRADI/95-152-----------------------------------------------------------------A.E...---------
K4CXX4_SOLLC/88-145-----------------------------------------------------------------SLK...---------
K3XT82_SETIT/66-125-----------------------------------------------------------------YRGD.R---------
K4ACF8_SETIT/124-184-----------------------------------------------------------------HRSD.Q---------
I1KPJ1_SOYBN/130-190-----------------------------------------------------------------FRST.Q---------
B9RDW9_RICCO/125-184-----------------------------------------------------------------HRHS.Q---------
A4S4Z2_OSTLU/45-105-----------------------------------------------------------------E.R...---------
M4CUI9_BRARP/208-267-----------------------------------------------------------------MSS...---------
I1I889_BRADI/256-312-----------------------------------------------------------------H.P...---------
B9IL50_POPTR/163-221-----------------------------------------------------------------FAP...---------
K7KV11_SOYBN/172-232-----------------------------------------------------------------HQKL.Y---------
I1HPN1_BRADI/101-161-----------------------------------------------------------------HKYD.Q---------
K7UAL6_MAIZE/166-235-----------------------------------------------------------------YRQE.Q---------
C1MHM4_MICPC/67-120-----------------------------------------------------------------S.E...---------
K7MJ24_SOYBN/105-164-----------------------------------------------------------------HKYD.Q---------
M0SJA2_MUSAM/36-92-----------------------------------------------------------------EE....---------
W1NXJ2_AMBTC/234-290-----------------------------------------------------------------TAE...---------
D3BE88_POLPA/1056-1111-----------------------------------------------------------------E.H...---------
J3MP57_ORYBR/126-186-----------------------------------------------------------------HKPD.Q---------
F6HHL8_VITVI/106-162-----------------------------------------------------------------H.P...---------
A8ITC4_CHLRE/316-373-----------------------------------------------------------------H.M...---------
Q013H7_OSTTA/23-83-----------------------------------------------------------------HF....---------
I1JJR0_SOYBN/113-169-----------------------------------------------------------------H.P...---------
M0TK84_MUSAM/89-146-----------------------------------------------------------------S.E...---------
A9T511_PHYPA/27-83-----------------------------------------------------------------H.M...---------
WRKY1_DICDI/1111-1165-----------------------------------------------------------------E.L...---------
D8R168_SELML/1-61-----------------------------------------------------------------HKRE.S---------
F6H336_VITVI/353-410-----------------------------------------------------------------S.A...---------
I1GQR9_BRADI/375-432-----------------------------------------------------------------F.Q...---------
W1P9B9_AMBTC/6-65-----------------------------------------------------------------HRT..T---------
M4DKE5_BRARP/141-201-----------------------------------------------------------------HKPT.Q---------
K3Y1Z6_SETIT/159-216-----------------------------------------------------------------TDK...---------
K3Y9C1_SETIT/76-139-----------------------------------------------------------------RSAE.Q---------
W5DIT2_WHEAT/219-278-----------------------------------------------------------------YRKS.Q---------
M0YYV8_HORVD/86-146-----------------------------------------------------------------HKPD.Q---------
M0YJN3_HORVD/140-204-----------------------------------------------------------------YKLDAG---------
K7KQN0_SOYBN/1276-1336-----------------------------------------------------------------HKFV.H---------
K7LJY0_SOYBN/131-188-----------------------------------------------------------------SA....---------
Q6IES4_ORYSJ/135-192-----------------------------------------------------------------T.E...---------
K4CXA0_SOLLC/297-353-----------------------------------------------------------------H.P...---------
I1HG21_BRADI/167-225-----------------------------------------------------------------SLK...---------
M1CUN0_SOLTU/22-82-----------------------------------------------------------------HKYD.Q---------
I1L6Z7_SOYBN/121-181-----------------------------------------------------------------HKFD.Q---------
K4BBZ0_SOLLC/387-444-----------------------------------------------------------------Y.P...---------
M1BRE7_SOLTU/99-159-----------------------------------------------------------------HRNT.Q---------
I1R250_ORYGL/38-97-----------------------------------------------------------------HKMT.T---------
K3ZJB7_SETIT/126-188-----------------------------------------------------------------YKDD.T---------
U5D8Z1_AMBTC/112-170-----------------------------------------------------------------MAP...---------
K3ZQ30_SETIT/1030-1090-----------------------------------------------------------------HRNS.I---------
K7KIE5_SOYBN/90-148-----------------------------------------------------------------LAP...---------
I1MKR8_SOYBN/158-216-----------------------------------------------------------------SSK...---------
W1NWG1_AMBTC/259-315-----------------------------------------------------------------Y.P...---------
M4D1B7_BRARP/162-218-----------------------------------------------------------------Y.S...---------
I1MBG9_SOYBN/221-276-----------------------------------------------------------------Q.P...---------
I1IV04_BRADI/110-179-----------------------------------------------------------------YGQE.Q---------
M0SWH8_MUSAM/162-222-----------------------------------------------------------------HKYD.Q---------
U5GSI9_POPTR/36-91-----------------------------------------------------------------KR....---------
WRK68_ARATH/118-175-----------------------------------------------------------------T.T...---------
F4QAR0_DICFS/125-181-----------------------------------------------------------------EK....---------
D7MUR9_ARALL/1173-1233-----------------------------------------------------------------YRFT.Q---------
M4ECF8_BRARP/121-181-----------------------------------------------------------------YRKS.Q---------
C5XPF8_SORBI/150-208-----------------------------------------------------------------GAP...---------
W5CDR1_WHEAT/9-69-----------------------------------------------------------------HRHT.Q---------
F6H4B4_VITVI/93-150-----------------------------------------------------------------S.G...---------
K3ZN48_SETIT/373-432-----------------------------------------------------------------HRQS.Q---------
K3XKH8_SETIT/112-171-----------------------------------------------------------------HKQQ.Q---------
WRK25_ARATH/166-222-----------------------------------------------------------------Y.P...---------
M0TC40_MUSAM/153-210-----------------------------------------------------------------HRSY.Y---------
C5WVP7_SORBI/215-271-----------------------------------------------------------------H.A...---------
M0TTG4_MUSAM/70-131-----------------------------------------------------------------YKEG.Q---------
B9S4F2_RICCO/133-192-----------------------------------------------------------------HKYD.R---------
A9U1V6_PHYPA/32-88-----------------------------------------------------------------T.A...---------
WRK66_ARATH/86-145-----------------------------------------------------------------YAKD.Q---------
M0YT11_HORVD/178-234-----------------------------------------------------------------F.A...---------
F6HC33_VITVI/111-171-----------------------------------------------------------------RKHE.Q---------
I1R250_ORYGL/129-189-----------------------------------------------------------------HKTT.T---------
B9RNV8_RICCO/233-290-----------------------------------------------------------------S.A...---------
M0TPC7_MUSAM/150-207-----------------------------------------------------------------S.A...---------
U5FI33_POPTR/431-488-----------------------------------------------------------------S.P...---------
K3ZN48_SETIT/520-580-----------------------------------------------------------------HRHS.Q---------
K7M257_SOYBN/138-198-----------------------------------------------------------------HKND.Q---------
M4CW62_BRARP/100-160-----------------------------------------------------------------YAKD.R---------
W1PB05_AMBTC/141-201-----------------------------------------------------------------HKND.Q---------
D8T390_SELML/1-56-----------------------------------------------------------------H.P...---------
W1P843_AMBTC/109-166-----------------------------------------------------------------N.G...---------
I1IVB4_BRADI/118-173-----------------------------------------------------------------Y.P...---------
M4CSQ1_BRARP/127-187-----------------------------------------------------------------HKFT.Q---------
J3MMM2_ORYBR/104-160-----------------------------------------------------------------H.L...---------
A9RC52_PHYPA/317-380-----------------------------------------------------------------......---------
T1LAC7_TRIUA/117-183-----------------------------------------------------------------YTE..R---------
I1Q2J1_ORYGL/176-232-----------------------------------------------------------------SNK...---------
D7M6E1_ARALL/110-170-----------------------------------------------------------------YTKD.Q---------
K3XS92_SETIT/45-106-----------------------------------------------------------------FHQD.H---------
D8RSA8_SELML/111-168-----------------------------------------------------------------N.V...---------
M1D2T0_SOLTU/151-208-----------------------------------------------------------------S.G...---------
B9GLD2_POPTR/244-301-----------------------------------------------------------------STR...---------
J3L5A9_ORYBR/122-183-----------------------------------------------------------------FSRE.R---------
A0A096SMI5_MAIZE/134-191-----------------------------------------------------------------TDK...---------
F4Q0C8_DICFS/619-677-----------------------------------------------------------------VT....---------
M4CLX3_BRARP/328-385-----------------------------------------------------------------S.V...---------
K3YER8_SETIT/56-116-----------------------------------------------------------------YRED.R---------
T1N7Y3_TRIUA/130-195-----------------------------------------------------------------YKQE.Q---------
W5GE05_WHEAT/9-68-----------------------------------------------------------------HKNY.Y---------
D8QTC4_SELML/4-64-----------------------------------------------------------------HQKE.L---------
M1C548_SOLTU/54-110-----------------------------------------------------------------Q.Q...---------
M0SMA5_MUSAM/88-145-----------------------------------------------------------------T.V...---------
M4DKE6_BRARP/150-210-----------------------------------------------------------------HQKL.Y---------
D7M911_ARALL/158-218-----------------------------------------------------------------HRST.Q---------
I1IVB4_BRADI/275-329-----------------------------------------------------------------T.A...---------
F6GX25_VITVI/36-92-----------------------------------------------------------------H.L...---------
J3NAU6_ORYBR/110-173-----------------------------------------------------------------NSTD.Q---------
M4F7P5_BRARP/264-321-----------------------------------------------------------------Y.T...---------
K4CIW2_SOLLC/133-193-----------------------------------------------------------------YRHM.Q---------
B9T8B8_RICCO/123-182-----------------------------------------------------------------HRHS.Q---------
WRKY1_DICDI/814-869-----------------------------------------------------------------F.Q...---------
F4PLI3_DICFS/941-996-----------------------------------------------------------------E.P...---------
K7VBJ3_MAIZE/118-180-----------------------------------------------------------------.SRD.R---------
Q0V871_ARATH/24-81-----------------------------------------------------------------Y.P...---------
M4F9N3_BRARP/76-133-----------------------------------------------------------------S.E...---------
A9S0E7_PHYPA/16-72-----------------------------------------------------------------T.P...---------
M0X4S6_HORVD/138-199-----------------------------------------------------------------YSDE.H---------
U5FT31_POPTR/7-63-----------------------------------------------------------------H.P...---------
M1CMZ7_SOLTU/94-155-----------------------------------------------------------------HKYD.Q---------
F6H3I5_VITVI/96-154-----------------------------------------------------------------MAP...---------
K4BIZ9_SOLLC/116-177-----------------------------------------------------------------HKYD.Q---------
W5ET14_WHEAT/53-108-----------------------------------------------------------------DK....---------
K7KVJ1_SOYBN/74-131-----------------------------------------------------------------H.Q...---------
U5GVF5_POPTR/157-215-----------------------------------------------------------------SLK...---------
I1LT43_SOYBN/160-216-----------------------------------------------------------------H.S...---------
WRK34_ARATH/178-234-----------------------------------------------------------------H.P...---------
M1D6V7_SOLTU/22-80-----------------------------------------------------------------I.R...---------
K4A5N4_SETIT/774-831-----------------------------------------------------------------V.D...---------
I1IR53_BRADI/286-342-----------------------------------------------------------------H.P...---------
M1DN19_SOLTU/86-144-----------------------------------------------------------------TSG...---------
W5FQQ6_WHEAT/917-977-----------------------------------------------------------------HRPE.K---------
B9RAC9_RICCO/80-137-----------------------------------------------------------------H.N...---------
M7ZW64_TRIUA/111-170-----------------------------------------------------------------YKHD.S---------
U5GC56_POPTR/83-140-----------------------------------------------------------------H.C...---------
M0VMN8_HORVD/120-183-----------------------------------------------------------------HSHE.R---------
J3MMM2_ORYBR/273-330-----------------------------------------------------------------Y.L...---------
A4S1F5_OSTLU/27-88-----------------------------------------------------------------FE....---------
D7MKX1_ARALL/1146-1204-----------------------------------------------------------------SSK...---------
M0T0B0_MUSAM/207-264-----------------------------------------------------------------SMR...---------
I1PWM4_ORYGL/125-185-----------------------------------------------------------------YKDD.H---------
I1R3G5_ORYGL/139-200-----------------------------------------------------------------YRDD.R---------
F6GXW4_VITVI/171-231-----------------------------------------------------------------HKHD.Q---------
M4CXB1_BRARP/69-126-----------------------------------------------------------------H.G...---------
D7MF96_ARALL/373-429-----------------------------------------------------------------A.N...---------
M1D7L8_SOLTU/129-186-----------------------------------------------------------------P....C---------
J3MYJ7_ORYBR/269-325-----------------------------------------------------------------Q.T...---------
C1EBM1_MICCC/10-63-----------------------------------------------------------------HR....---------
M1DBE7_SOLTU/170-228-----------------------------------------------------------------TSK...---------
K3Z832_SETIT/111-171-----------------------------------------------------------------HKYD.Q---------
J3M860_ORYBR/133-194-----------------------------------------------------------------YSDE.R---------
M0VCG1_HORVD/220-278-----------------------------------------------------------------TVK...---------
K3ZIR4_SETIT/69-127-----------------------------------------------------------------F.P...---------
I1HSW1_BRADI/41-106-----------------------------------------------------------------HHRE.R---------
M7YP80_TRIUA/106-165-----------------------------------------------------------------YQKT.Q---------
M0SP79_MUSAM/129-188-----------------------------------------------------------------DRNT.K---------
M0T4G9_MUSAM/121-181-----------------------------------------------------------------HRNT.V---------
M0U1R5_MUSAM/391-448-----------------------------------------------------------------H.S...---------
B9I7F0_POPTR/156-212-----------------------------------------------------------------H.A...---------
WRK50_ARATH/113-170-----------------------------------------------------------------V.D...---------
E1ZGV1_CHLVA/113-170-----------------------------------------------------------------H.P...---------
B9RND6_RICCO/52-110-----------------------------------------------------------------TSK...---------
M4FA92_BRARP/266-323-----------------------------------------------------------------H.K...---------
K3ZT34_SETIT/82-138-----------------------------------------------------------------H.P...---------
M0U8S7_MUSAM/172-227-----------------------------------------------------------------D.S...---------
M0RX59_MUSAM/291-348-----------------------------------------------------------------H.H...---------
K3XLT9_SETIT/160-217-----------------------------------------------------------------S.A...---------
I1R3G9_ORYGL/27-91-----------------------------------------------------------------NSKV.Q---------
A9TJH5_PHYPA/11-68-----------------------------------------------------------------T.P...---------
E1ZGV1_CHLVA/4-61-----------------------------------------------------------------H.P...---------
D8R033_SELML/2-60-----------------------------------------------------------------MSP...---------
K4CG67_SOLLC/75-133-----------------------------------------------------------------SSK...---------
M0TXJ2_MUSAM/6-66-----------------------------------------------------------------HKSY.Y---------
M0S0M4_MUSAM/331-387-----------------------------------------------------------------N.P...---------
I1QTG0_ORYGL/63-124-----------------------------------------------------------------YRDD.R---------
W5FQQ6_WHEAT/802-862-----------------------------------------------------------------HHNT.R---------
M4C895_BRARP/99-159-----------------------------------------------------------------HRFT.Q---------
C5X5M4_SORBI/126-186-----------------------------------------------------------------HRPE.Q---------
D7M935_ARALL/134-192-----------------------------------------------------------------SSK...---------
M4EPX7_BRARP/108-165-----------------------------------------------------------------F.A...---------
A9SRR4_PHYPA/11-68-----------------------------------------------------------------T.P...---------
E0CUJ8_VITVI/134-194-----------------------------------------------------------------HRNA.Q---------
M0THF1_MUSAM/136-195-----------------------------------------------------------------HRNS.V---------
K7M259_SOYBN/132-192-----------------------------------------------------------------HKYD.Q---------
W1NEF1_AMBTC/8-65-----------------------------------------------------------------KK....---------
M4EPX6_BRARP/284-341-----------------------------------------------------------------Y.G...---------
I1BSM4_RHIO9/209-264-----------------------------------------------------------------NSN..K---------
A8ITC4_CHLRE/117-174-----------------------------------------------------------------H.P...---------
C5Y3H4_SORBI/132-194-----------------------------------------------------------------YKDD.A---------
J3N5J0_ORYBR/148-214-----------------------------------------------------------------YRQE.E---------
M0U1R5_MUSAM/220-275-----------------------------------------------------------------D.S...---------
M1DVX5_SOLTU/167-225-----------------------------------------------------------------EAN...---------
K3ZIR4_SETIT/224-280-----------------------------------------------------------------M.A...---------
M8A8S6_TRIUA/118-178-----------------------------------------------------------------HLPD.Q---------
K4AKU1_SETIT/30-91-----------------------------------------------------------------YKDN.M---------
D3BE88_POLPA/755-813-----------------------------------------------------------------Y.P...---------
K4C166_SOLLC/129-185-----------------------------------------------------------------R....R---------
WRK45_ARATH/65-122-----------------------------------------------------------------E.E...---------
M4CDZ0_BRARP/106-165-----------------------------------------------------------------YNID.H---------
C0PKA1_MAIZE/112-175-----------------------------------------------------------------QSAK.Q---------
C5X581_SORBI/15-73-----------------------------------------------------------------RRP...---------
B9T4U8_RICCO/34-91-----------------------------------------------------------------SVR...---------
J3NA98_ORYBR/1018-1075-----------------------------------------------------------------SQ....---------
I1J5V4_SOYBN/175-231-----------------------------------------------------------------H.P...---------
I1PTK2_ORYGL/147-208-----------------------------------------------------------------YKHE.Q---------
I1HR78_BRADI/64-122-----------------------------------------------------------------SSK...---------
W5D9K8_WHEAT/68-128-----------------------------------------------------------------YRED.R---------
T1MEI9_TRIUA/119-182-----------------------------------------------------------------FSHD.R---------
C5X9Q6_SORBI/1354-1412-----------------------------------------------------------------QRR...---------
C1N120_MICPC/5-60-----------------------------------------------------------------S.A...---------

PF03615

Q5TQ16_ANOGA/3-143-----------------------------------------------------------------TNNHNVSILKKSCLG
A7SSU8_NEMVE/11-147-----------------------------------------------------------------TNNHNKYVLKKTCVG
Q17NS1_AEDAE/37-177-----------------------------------------------------------------TNNHNVSILKKSCLG
M9PFC8_DROME/47-186-----------------------------------------------------------------TNNHNVNILKKSCLG
GCM1_MOUSE/30-167-----------------------------------------------------------------TNNHNSRILKKSCLG
K1PSK2_CRAGI/41-180-----------------------------------------------------------------TNNHNAHILKKSCLG
C3ZI50_BRAFL/63-202-----------------------------------------------------------------TNNHNCHILKKSCLG
A0A068YFP9_ECHMU/176-311-----------------------------------------------------------------TNNHNPQVLKKSCLG
G4VCV4_SCHMA/248-378-----------------------------------------------------------------TNNHNSQILKKSCLG
Q8MMJ4_STRPU/66-206-----------------------------------------------------------------TNNHNKKVLKKSCLG
W5NJR0_LEPOC/36-173-----------------------------------------------------------------TNNHNSRILKKSCLG
B3MUW9_DROAN/83-223-----------------------------------------------------------------TNNHNVNILKKSCLG
D6WJ63_TRICA/26-165-----------------------------------------------------------------TNNHNVHILKKSCLG
Q5TLZ9_DANRE/19-156-----------------------------------------------------------------TNNHNCQILKKSCLG
H3A2B3_LATCH/38-175-----------------------------------------------------------------TNNHNSRILKKSCLG
H2KV09_CLOSI/280-413-----------------------------------------------------------------TNNHNPQVLKKSCLG

PF08731

Q6BK98_DEBHA/21-107.......................................................KLSLGS....RRQI-----------
AFT2_CANAL/21-112.......................................................SKKTASKTMIRKHT-----------
AFT2_YEAST/51-137.......................................................KSKGSS....SRSH-----------
AFT1_YEAST/108-243INDDELE.......................YASPSNATVTNGPQTSPDQTSSIKPKKKRCV....SRFN-----------
Q6FS49_CANGA/15-125...........................................LAREHEMKRKSMGNKRCV....SRYN-----------
Q6CS78_KLULA/99-257NGKNSTKGNGSNDNKCRKKGIGKGFAECDGLETETENGNNSNSTVGGGNGSNDTDKKKRAI....GPYN-----------
Q6FSP0_CANGA/42-131.....................................................LRQKEPVD....DKRH-----------
Q755B2_ASHGO/89-206.......................................YETLPLSPVVTASQLRKKKRAV....SPYN-----------

PF03108

Q2QMP0_ORYSJ/171-237-----------------------------------------------------------------..AD-----------
Q9C702_ARATH/177-243-----------------------------------------------------------------..RW-----------
Q0D1G9_ASPTN/6-73-----------------------------------------------------------------.SGR-----------
Q0DAT1_ORYSJ/144-210-----------------------------------------------------------------..GE-----------
I1Q5U8_ORYGL/402-465-----------------------------------------------------------------..NP-----------
I1QDU7_ORYGL/128-194-----------------------------------------------------------------KEKD-----------
M4FGM2_BRARP/194-256-----------------------------------------------------------------..AE-----------

PF03101

FRS4_ARATH/11-97....-........INPRASPKIGCK---ASMH------VKRRP...------------DGKWY----VYS-FV-KE---H
FRS8_ARATH/109-194....-.........SRRKETRTGCQ---AMIR------LRLIH...------------FDRWK----VDQ-VK-LD---H
FRS10_ARATH/69-161....-....NVEHPRERKSVRCGCD---GKLY------LTKEVVDG------------VSHWY----VSQ-FS-NV---H
FRS1_ARATH/35-137DGFN-IPQARKRGRINRSSSKTDCK---AFLH------VKRRQ...------------DGRWV----VRS-LV-KE---H
FRS5_ARATH/87-179....-...KDREIKRPRTITRVGCK---ASLS------VKMQD...------------SGKWL----VSG-FV-KD---H
Q6NLE7_ARATH/25-111....-........SSSSSSSREGCK---ATIL------VKMEK...------------SGKWV----VTR-FI-KE---H
Q8H344_ORYSJ/116-204....-.....KEAKCPRPETRIGCP---ASMT------IRLNT...------------NGKYR----LTE-FV-PN---H
Q7XKT7_ORYSJ/54-140....-.......KARRRLVAKTGCK---AMMV------VKYNT..T------------ENQWE----VVF-VE-LE---H
Q93Z68_ARATH/84-172....-......KVIRQRAETRVGCK---AMIL------IRKEN...------------SGKWV----ITK-FV-KE---H
Q6ESZ2_ORYSJ/64-154....-.....NHTRTPQPDTRTGCH---ANLV------IRRKN..D------------TSKYE----VYA-FE-AQ---H
FAR1_ARATH/65-154....-.....GSSSRRSTVKKTDCK---ASMH------VKRRP...------------DGKWI----IHE-FV-KD---H
Q6AT58_ORYSJ/82-184VAAG-SGEDSGRGRRTRAVTRVGCK---AMIR------VKKQD...------------NGRWA----VTK-LE-TA---H
Q2QXD6_ORYSJ/96-184....-......EANFNKPDTRTNCK---AMVR------YRVDS...------------EGHWR----VIQ-IV-PE---H
Q84JA7_ARATH/47-136....-.....SESRKPRAITREGCK---ALIV------VKREK...------------SGTWL----VTK-FE-KE---H
Q75LD4_ORYSJ/42-126....-.........QARPTAKTNCQ---ATVV------ARLWS...------------DGLLH----LMD-VN-LE---H
J3LS84_ORYBR/67-154....-....TGKRKRKRAILREGCH---AMIE------VSQKY...------------YGRWV----VIK-LI-KE---H

PF04500

Q70BY8_DROVI/421-485----------------------RCR---SRCV------LE...--.------------..NCK----LKS-ITGGL...H
B4MBE8_DROVI/40-101----------------------KCT---ARVV------TK...--.------------..SNQ----ISA-LR.GQ...H
FWCH1_MOUSE/402-460----------------------GCR---SRAI------TQ...--.------------..GRQ----VTV-MR.S....H
FWCH1_MOUSE/235-293----------------------GCR---SRAI------TQ...--.------------..GQR----VTV-MR.S....H
A7UT18_ANOGA/463-522----------------------MCG---VVAF------LH...--.------------..PDG----LVE-VK.GN...H
A7UT18_ANOGA/543-605----------------------VCR---VKVT------TD...--.------------ADGVA----YIS-KN.EQ...H
FWCH1_HUMAN/600-658----------------------GCR---SRAI------TQ...--.------------..GHR----IMV-MR.S....H
Q16SJ4_AEDAE/393-453----------------------KCP---CTVV------IN...--.------------.EATS----NIT-VK.FD...H
Q17CC2_AEDAE/19-83----------------------GCS---ARAS------VRR.R--E------------PGQKP----AVK-LS.GC...H
Q6IDT6_DROPS/406-467----------------------RCP---AIAI------HD...--.------------.ESTL----ILR-LC.HQ...H
Q16WE4_AEDAE/17-80----------------------MCR---ARCI------TH...--.------------..HGQ----VIS-ST.GV...H
Q6IDT7_DROPS/405-469----------------------VCR---SRVV------TEL.D--K------------NGQSR----VIK-CS.FD...H
Q6NP69_DROME/162-227----------------------ECT---ARIC------TEA.T--L------------AGAHR----LHA-VD.T....D
Q16SI9_AEDAE/387-448----------------------SCP---SRIT------TD...--.------------..NVQ----IKR-VK.GE...H
Q17CD4_AEDAE/347-409----------------------RCK---VRAT------TS...--R------------DKDRK----VLS-IR.GE...H
Q6IDX8_ANOGA/378-443----------------------HCK---ARAQ------TRL..--I------------DGVEY----VKV-FK.NE...H
Q6IDX0_ANOGA/458-517----------------------QCP---AQVL------VV...--.------------SGMTH----AVN-VE......H
Q6IDZ2_ANOGA/392-456----------------------KCR---ARVY------TI...--.------------..DDH----ITP-LN.RY...H
Q17EL2_AEDAE/670-734----------------------NCQ---ATLY------TT...--.------------LAGQV----IRT-NN.MM...H
Q17CD3_AEDAE/199-260----------------------KCK---AKLK------TQ...--.------------..GKE----LIV-VY.QD...H
Q9XWQ6_CAEEL/134-195----------------------.CP---ARIH------TP...--.------------FDAER----VIH-KV.QV...H
Q16WH6_AEDAE/7-75----------------------NCS---SRVV------TRF..--V------------SGAHI----LAS-NK.PH...H
Q17EL2_AEDAE/762-821----------------------.CH---AAVY------LG...--.------------.ADGR----VDQ-VK.GE...H
Q17EL2_AEDAE/236-296----------------------.CP---AGAF------LM...--.------------.PDNT----IAE-AKNFV...H
Q16FH8_AEDAE/26-95----------------------KCP---SRVV------TQF..--Q------------NGQHH----IIS-QT.N....H
Q16SK1_AEDAE/387-448----------------------GCK---AKVI------TS...--.------------QYDNK----VSI-TD.PF...H
Q17C92_AEDAE/22-90----------------------GCK---SRVI------THL..--Q------------NGAHV----LID-HK.TA...H
Q17CD5_AEDAE/89-153----------------------NCT---ARAT------TRL.D--W------------KDTAP----KVS-LR.GF...H
Q6NP69_DROME/596-663----------------------NCK---SRIS------TAT.Q--K------------DGSIR----VLR-VY.NS...H
Q6IDU1_DROPS/408-468----------------------KCK---ARVV------TV...--.------------.QDHD----VTI-KC.DE...H
A0APY4_DROSI/32-92----------------------NCK---ARVT------TT...--.------------.DTGD----IIV-TN.NE...H
Q17MH0_AEDAE/8-77----------------------KCA---ARAR------STI..--V------------NGQHK----ILG-IS.E....H
Q16SJ1_AEDAE/385-449----------------------RCR---ARCV------IV...--.------------..NGK----LSA-LT.GT..QH
Q17CC5_AEDAE/2-67----------------------KCR---GRLK------SE...--.------------GNNLF----ISN-TN.AT...H
Q17CC4_AEDAE/1-62----------------------KCR---ARII------TL...--.------------DGSAG----LIL-KN.QI...H
Q16SK0_AEDAE/393-454----------------------KCK---CKVV------TH...--.------------RNSLV----VKY-TH.KS...H
Q16SK2_AEDAE/394-455----------------------ACR---ARLI------TD...--.------------SENTM----LLA-RQ.LE...H
Q6IDT9_DROPS/430-492----------------------QCR---SRII------THV..--L------------PSGQS----RYD-VS.GV...H
Q17CA9_AEDAE/249-307----------------------GCN---MRLH------TD...--.------------RQGQM----VEV-K.......H
Q17CB7_AEDAE/18-77----------------------.CR---AKIT------TN...--.------------AYNAV----ITH-NR.CP...H
Q17EK9_AEDAE/1691-1752----------------------KCP---AMLR------LH...--.------------.TNGR----VVD-PIGLG...H
Q17IM0_AEDAE/257-318----------------------NCL---GMIV------TT...--.------------ADLHR----FRM-HK.N....H
Q7QDH8_ANOGA/445-505----------------------HCK---ATCV------TK...--.------------..QNK----LIG-IR.SE...H
Q6IDZ7_ANOGA/373-431----------------------KCT---GRII------CQ...--.------------.NNTV----LKE-TE......H
Q18225_CAEEL/143-204----------------------.CN---ARMH------SD...--.------------INTRE----IVR-KL.HP...H
Q17CD3_AEDAE/4-68----------------------KCK---ARII------ERI.S--K------------YGDPV----YEI-VR.SV...H
Q17CD3_AEDAE/86-145----------------------GCR---SRVR------TH...--.------------..QEL----IEL-VE.HE...H
Q6IDY5_ANOGA/394-455----------------------KCP---CIVL------IN...--.------------.TATS----QLS-IK.HN...H
Q17EK9_AEDAE/424-486----------------------MCR---VKVV------LN...--.------------.SEAY----IHR-MGTEH..EH
Q6IDU0_DROPS/419-479----------------------KCN---ARVV------TNV..--V------------DGVHK----IVL-ES.......
Q16SI1_AEDAE/384-445----------------------RCP---ARHR------QR...--.------------RSTGA----LEV-VW.AK...H
Q6IDY6_ANOGA/439-499----------------------NCK---ARAI------TS...--.------------VSNPE----QCV-LK.NA...H
Q16SJ5_AEDAE/380-443----------------------KCP---ARIL------QY...--.------------KNPER----FVI-HR.ER...H
Q17CB7_AEDAE/197-258----------------------NCR---ARIT------TR...--.------------TDSTK----ITY-NL.RP...H
A7DTF1_CAEEL/131-192----------------------.CK---ARMH------TD...--.------------IVTEK----ILT-FI.HE...H
Q17CD5_AEDAE/175-239----------------------GCT---ARAT------TGR.G--K------------RGDKP----VIK-LR.GF...H
Q6IDY2_ANOGA/385-450----------------------GCR---AACV------TSKNC--A------------GNDQS----IRL-TG.MT...H
Q6IDU2_DROPS/436-495----------------------RCR---ARLK------TK...--.------------..SDT----LTI-LN.SE...H
Q16SI4_AEDAE/385-447----------------------HCM---ARAT------TD...--R------------QNSGQ----LIS-VD.GV...H
Q6IDX5_ANOGA/379-440----------------------KCR---SKLV------TH...--.------------RGSHT----VKY-TH.RP...H
Q6IDX7_ANOGA/374-437----------------------KCR---AKAI------TMK..--Q------------GGREY----MKL-SH.PT...H
Q16SI2_AEDAE/384-446----------------------ACK---ARAT------TS...--N------------SPRGL----VQY-YN.NT...H
Q16SJ2_AEDAE/416-472----------------------KCP---GRVT------TV...--.------------.DGTI----VKY-HV......H
Q17CC3_AEDAE/84-147----------------------KCR---ARAV------TKT..--V------------NDRQM----MKI-TK.PL...H
Q6NP69_DROME/365-432----------------------TCH---VRIT------LDP..--V------------ENGPV----VLR-IN.GE...H
Q17EL2_AEDAE/360-420----------------------.CR---GAVH------LF...--.------------.PDGS----INY-AKLVD...H
Q17CC0_AEDAE/72-136----------------------KCK---ARVL------TYT.L--K------------NGEEN----LVV-RY.PT...H
Q6IDT4_DROPS/418-482----------------------KCP---ARIT------ML...--K------------ESPPK----FII-AK.AE...H
Q17CB6_AEDAE/76-137----------------------KCC---ARVT------TR...--.------------SDSAG----VIF-TN.PY...H
Q16SJ8_AEDAE/412-474----------------------RCR---ARLI------TD...--D------------CNFYD----VTF-KN.LV...H
Q17CB9_AEDAE/37-98----------------------KCP---CIVV------ID...--.------------.EINS----RMN-VK.HI...H
Q16FU8_AEDAE/997-1058----------------------NCM---AVLE------TV...--.------------GEQSR----HWR-KF.GS...H
Q17EK9_AEDAE/344-403----------------------.CR---AVAI------IY...--.------------.VDGR----IET-SG.D....H
Q6IDX2_ANOGA/381-447----------------------RCS---SRVV------TTL.L--D------------DGMYR----ITI-TN.PK...H
Q6IDV9_DROPS/402-461----------------------QCP---ARLT------TK...--.------------..QKA----IVL-QH.GS...H
Q16SI5_AEDAE/381-443----------------------GCK---ARAT------TK...--R------------KPGSA----VIS-LR.DD...H
Q16SJ7_AEDAE/381-447----------------------KCR---ARIV------TSE..--A------------EGVPK----LRV-VV.AE...H
Q17CD4_AEDAE/155-214----------------------GCK---AAAT------SY...--.------------.GEGS----RIS-IR.GT...H
Q17EK9_AEDAE/1138-1199----------------------.CR---AIIF------LM...--.------------.PDDR----IIQ-GNNNA..GH
MMD4_DROME/452-512----------------------ECK---VRVV------CD...--.------------..QKR----VFP-YE.GE...H
Q17EK9_AEDAE/1463-1528----------------------HCS---AGVY------LF...--.------------.ANGV----LKN-AANESAIVH
Q16SI0_AEDAE/430-495----------------------KCK---ARAS------TTR.K--L------------NGLFR----IVL-GN.AT...H
Q16SB8_AEDAE/1076-1143----------------------KCK---AAVI------VE...--.------------.GLYD----SIC-IK.NQ...H
Q17CD2_AEDAE/110-170----------------------KCK---GRIR------LN...--.------------.RDKT----CVV-LN.AN...H
Q6NP69_DROME/17-87----------------------PCK---SRIC------TMLPD--P------------LDKTR----HVV-VDVVL..AH
Q17EL2_AEDAE/459-522----------------------KCP---VSFH------TK...--.------------EDTYE----LVS-MRNQE...H
Q17CB7_AEDAE/98-160----------------------KCR---AKIA------TV...--A------------NNSAE----VKF-NF.VA...H
Q16SI3_AEDAE/390-452----------------------RCK---ARAV------TN...--N------------DLQGT----IRR-YL.NH...H
Q16SJ6_AEDAE/386-449----------------------KCR---ARAV------TKT..--A------------FGRQM----MKI-TN.PN...H
A8XLA6_CAEBR/145-206----------------------.CP---ARLH------IP...--.------------SDSYR----VIF-MT.QE...H
Q16SJ0_AEDAE/390-455----------------------RCS---VRCI------TR...--.------------..DNH----VIN-FH.GL...H
Q17EK9_AEDAE/1257-1320----------------------SCR---AALF------CR...--.------------DNGTI----VTS-TNGKD...H
Q17EK9_AEDAE/94-153----------------------GCQ---AAVN------LN...--.------------.LDNT----ITP-ANNNQ...H
B4GZB2_DROPE/96-158----------------------RCP---ARCV------TN...--.------------TNDNS----IKL-SH.RS...H
B4I3G6_DROSE/69-132----------------------KCR---SRVF------TI...--.------------..NDV----VCP-LN.RF...H
B4I3H2_DROSE/2-65----------------------KCR---SRLK------TI...--.------------..GDD----LYV-TN.DV...H
B4I3I4_DROSE/2-63----------------------RCA---ARII------TC...--.------------SVTGE----LII-KN.QQ...H
B4JS54_DROGR/8-73----------------------KCS---ARAI------TK...--.------------.FDGG----IKL-GK.NA...H
B4R104_DROSI/89-155----------------------KCR---ARLV------TRI..--T------------GGGDI----IHV-TS.NL...H
H2KZM4_CAEEL/53-119----------------------KCR---AETT------MD...--.------------...NK----NAC-TK.GS...H
Q5TUB5_ANOGA/339-400----------------------RCS---SKCT------TE...--.------------..FNT----LRS-ISGGK...H
Q6IDT0_DROPS/406-466----------------------RCK---AVVI------TK...--.------------..NGE----FVD-AR.RL...H

PF03106

M7ZE84_TRIUA/87-143----------------------SCP...VKKK......VEH.AE..-...........DG.QI....SEI.IYKGK---H
K3XPF8_SETIT/105-165----------------------RCL...AKKK......VQQ.Q...-DG.......SLLP.PM....FEV.TYVNE---H
J3LNI8_ORYBR/48-108----------------------GCT...ATRH......IQR.C.EN-...........DP.SN....YVI.TYYGE---H
M0SDB1_MUSAM/144-200----------------------DCP...TKKK......VEM.SI..-...........DG.EI....TEI.VYKGS---H
M1BIZ3_SOLTU/122-182----------------------NCA...ATKM......VQR.SETE-...........ES.LA....FEV.SYGEN---H
K4CF00_SOLLC/138-194----------------------NCL...AKKQ......VER.SQ..-...........DG.HI....TNI.HYIAT---H
W1PMH6_AMBTC/119-178----------------------GCP...ATKQ......VQR.S.DD-...........DR.SI....FDI.TYRGK---H
U5GC56_POPTR/285-341----------------------ACP...ARKH......VER.AAD.-...........EA.TS....TTI.TYEGK---H
B9SRT4_RICCO/128-188----------------------GCQ...ATKQ......VQK.I.EE-...........DP.PK....YRT.TYYGN---H
M0TU82_MUSAM/44-102----------------------GCP...ARKQ......VER.SRL.-...........DP.AT....LVV.SYSFE---H
B9GXX9_POPTR/25-80----------------------NCV...AKKR......VEWSNPDY-....................IRI.WYEGS---H
K7V4I1_MAIZE/134-195----------------------KCP...AKKY......VQQ.QSNS-...........YP.PI....FLV.TLINE---H
B9RNV8_RICCO/68-125----------------------NCH...AKKK......VQR.CDQ.-...........SG.QV....IDT.VYIGQ---H
I1QGE9_ORYGL/62-119----------------------NCG...VRKS......ITRSA...-...........DG.QT....IET.VCKGC---H
K7LCG4_SOYBN/201-259----------------------ACP...VRKH......VQR.CFK.-...........DE.TI....LIT.TYEGN---H
K7LJY1_SOYBN/143-200----------------------GCY...VRKH......VER.DSC.-...........NR.KI....VIN.TYEGK---H
B4FCE6_MAIZE/44-105----------------------KCP...ATKQ......VQQKDSS.-...........DP.PL....FSV.TYFNQ---H
K3ZE24_SETIT/124-183----------------------GCT...ARRQ......VQR.W.EA-...........DP.SV....FLI.TYFGD---H
D8RSA8_SELML/4-60----------------------GCP...VKKK......VER.SQ..-...........DG.QV....TEI.VYKGE---H
C5YRA1_SORBI/118-182----------------------GCA...AKRT......VQR.NDDD-GG......GAAAA.PE....YTV.VYVSE---H
K7UWT7_MAIZE/125-185----------------------GCE...ARRQ......VQR.S.DT-...........DPCAA....YLI.TYFGE---H
T1M9Q3_TRIUA/111-176----------------------NCS...ATKT......IQQ.QEHN-RTL.....NCEDETPK....YIV.VYYGH---H
M0VYD6_HORVD/124-188----------------------SCP...ATKL......VQQ.Q.QP-HG.......DGDQ.TM....YNV.IYVHE---H
C5X9Q6_SORBI/1487-1548----------------------GCT...ATKR......LHR.KEDA-...........DT.LG....FDA.IYYGQ---H
K7LGJ6_SOYBN/248-305----------------------GCS...VRKH......VER.AAH.-...........DI.KA....VIT.TYEGK---H
I1QAI9_ORYGL/25-82----------------------GCT...ARKQ......VQQ.S.ND-...........DP.SR....LEI.TYIGL---H
M0YD52_HORVD/22-80----------------------GCA...ATRR......VQR.A.QE-...........EP.AA....FVI.AYYGE---H
I1HSW0_BRADI/124-187----------------------GCR...AKKQ......VQQ.Q.DN-SS.......DH.R.PM....FLI.TYVNE---H
E0CUS7_VITVI/11-69----------------------ACS...ARKQ......VEL.SQD.-...........NP.EE....YIV.SYIGD---H
T1NKL9_TRIUA/123-186----------------------GCR...AKKT......VQQ.H.DS-SS.......GH.R.PM....FQI.TYMHE---H
I1NPU0_ORYGL/179-237----------------------GCM...ARKM......VER.SPA.-...........KP.GM....LVV.TYMAE---H
F6H336_VITVI/139-196----------------------DCD...AKKK......VQQ.CHQ.-...........SG.FV....TGV.IYKGF---H
F4PLI3_DICFS/633-691----------------------GCT...VKKQ......VEKLSET.-...........DE.TK....NRV.VYKGT---H
K4A5N4_SETIT/641-697----------------------GCP...VKKV......VER.SF..-...........DG.FI....TEI.TYKGR---H
D7U1A8_VITVI/362-418----------------------GCP...VRKH......IET.AID.-...........NT.SA....VII.TYKGI---H
W5CBN1_WHEAT/2-57----------------------RCS...AKKH......VEK.STD.-...........DP.EM....LIV.TYEGS---H
F6HHL8_VITVI/281-338----------------------GCP...VKKH......VER.ASH.-...........DP.KM....VIT.TYEGQ---H
W5I4X6_WHEAT/29-88----------------------GCA...ATRQ......VQR.S.DA-...........DL.AV....FDV.TYQGA---H
M0YE87_HORVD/134-198----------------------GCP...AKRT......VQR.NDDD-GND.....NGR...PK....YTV.VYISE---H
W5B1V0_WHEAT/120-180----------------------GCP...ATKQ......VQR.A.DQ-...........DP.AL....FDI.VYHGQ---H
K3Y972_SETIT/138-202----------------------DCK...ATKT......VQQ.Q.DD-SA......GTDHP.VM....YTV.VYHGQ---H
M0THP3_MUSAM/86-142----------------------RCN...AKKQ......VER.SLE.-...........DP.ET....LIV.TYEGL---H
A9SJ74_PHYPA/290-348----------------------ECR...AKKM......VQP.TDT.-...........NP.SI....FEV.TYLGK---H
B9IIY4_POPTR/301-358----------------------KCN...VRKH......VER.ASD.-...........DP.KA....FIT.TYEGK---H
WRK59_ARATH/109-166----------------------DCN...VKKK......IER.DTN.-...........NP.DY....ILT.TYEGR---H
A0A096URZ3_WHEAT/1333-1392----------------------GCP...VTKQ......VQR.T.ST-...........DP.LL....FDV.VYHGE---H
K7M7W5_SOYBN/127-187----------------------GCR...AIKQ......VQV.D.QE-...........NP.NM....LQT.TYIGI---H
M4D9M7_BRARP/278-335----------------------GCP...VKKH......VER.SSR.-...........DT.KM....LIM.TYEGN---H
M1A3W0_SOLTU/224-280----------------------KCP...VKKK......VER.SI..-...........DG.YI....TEI.TYKGH---H
M0SHM4_MUSAM/124-183----------------------GCP...ATKQ......VQR.S.DE-...........DP.LL....FHV.TYHGA---H
K3ZNU0_SETIT/123-184----------------------GCQ...ATKQ......IQQQSSN.-...........DL.PI....FQV.TYNSE---H
I1MX45_SOYBN/109-166----------------------ICP...AKKK......VQR.CLH.-...........DK.SI....LVA.IYDGE---H
B9H449_POPTR/209-265----------------------NCL...VKKK......VER.SS..-...........DG.QI....TEI.IYKGQ---H
M4E2W1_BRARP/156-211----------------------KCP...VKKK......VER.SM..-...........GG.LV....SEI.VYQGE---H
B9IQ67_POPTR/183-243----------------------HCP...AKKQ......VQR.L.DD-...........DP.CR....LEV.VYRGE---H
K4CXA0_SOLLC/509-566----------------------GCS...VRKH......VER.SPL.-...........DQ.MS....VIT.SYDGK---H
B9SM87_RICCO/108-165----------------------GCN...VKKT......VQR.DTE.-...........DP.DY....VTT.TYEGM---H
WRK64_ARATH/103-163----------------------NCN...ARKR......VQM.IQD.-...........NP.PV....YRT.TYLGK---H
D7LDZ6_ARALL/104-164----------------------DCL...AVKQ......VQK.S.DT-...........DP.LV....YEV.KYLGN---H
B9I8F0_POPTR/132-192----------------------GCK...ATKQ......VQR.M.ED-...........NP.DL....YHT.TYIGS---H
K4AJ90_SETIT/3-60----------------------LCG...VKKK......VEW.HPS.-...........DPAGD....LRI.VYEGA---H
D7U1A8_VITVI/189-245----------------------DCY...AKK.......IEC.CDD.-...........SG.QV....IEI.IYKSR---H
K4C162_SOLLC/27-81----------------------YCG...ATKM......VQR.TET.-...........ES.LT....FEV.TYGGS---H
K3ZQ30_SETIT/1145-1205----------------------GCG...ATKQ......VQR.T.DA-...........DP.LV....FDV.IYNGE---H
D7KMZ8_ARALL/325-382----------------------ECK...VKKH......VER.GAD.-...........NN.KL....VVT.TYDGI---H
K3YGF8_SETIT/55-112----------------------GCE...VNKL......VVCSA...-...........DGHQV....FET.VLSGC---H
I1KBC5_SOYBN/112-169----------------------GCD...VKKR......VER.DRD.-...........DS.NY....VLT.TYDGV---H
K7M5Z1_SOYBN/77-134----------------------GCT...VKKR......VER.DKD.-...........DP.RY....VIT.TYEGN---H
I1IJB3_BRADI/691-747----------------------SCP...AKKK......VER.SL..-...........DN.QI....IEI.LYKGR---H
C5XNA2_SORBI/124-184----------------------NCR...ATKQ......VQQCSND.-...........DP.PQ....YVV.IYFNE---H
F6GX25_VITVI/254-311----------------------GCS...VRRH......VER.ASN.-...........NQ.KS....IIA.TYEGK---H
K3ZNM2_SETIT/136-202----------------------GCK...ATKT......VQQ.Y.DP-VTN....TASDHS.IM....YKA.IYYGR---H
B3H4T8_ARATH/468-524----------------------GCP...SKRK......VER.SL..-...........DG.QV....AEI.VYKDR---H
K4CB36_SOLLC/203-259----------------------ECC...AKK.......IEC.SDH.-...........TN.RV....MEI.IYRTQ---H
I1IV03_BRADI/121-188----------------------SCS...ATKT......VQK.Q.DH-NGSS..FSYGDEA.VN....YTV.MYYGN---H
K3ZVA0_SETIT/121-180----------------------GCA...ATKQ......VQR.A.DE-...........DP.TL....FDV.IYLGA---H
B9T726_RICCO/27-84----------------------NCR...VKKR......VER.LAE.-...........DP.RM....VIT.TYEGR---H
M0SWT7_MUSAM/131-193----------------------GCP...ATKT......VQQEDGDA-...........YP.PQ....FIV.AYSMQ---H
M0TJN8_MUSAM/70-132----------------------GCP...ATKT......VQQQDSYA-...........DP.PT....FMV.EYSMK---H
D7KEM5_ARALL/135-192----------------------KCN...VKKR......VER.SFQ.-...........DP.SI....VIT.TYEGK---H
M1D7L1_SOLTU/128-184----------------------HCD...ATKM......VQR.IQT.-...........EP.LT....FEV.TYGES---H
J3M640_ORYBR/195-252----------------------SCS...MKKK......VER.SLA.-...........DG.RI....TQI.VYKGA---H
M0RX59_MUSAM/130-188----------------------GCQ...ARKQ......VEQ.SRA.-...........DP.GM....LLI.TYTAE---H
M1A9L5_SOLTU/207-265----------------------LCP...VRKQ......VQR.CLE.-...........DM.SI....LIT.TYEGT---H
B0LUS3_SOYBN/136-196----------------------GCR...ATKQ......VQR.I.QE-...........NP.DM....YTI.TYIGF---H
M7YD70_TRIUA/902-962----------------------KCP...VIKH......MQR.T.DA-...........DP.LL....FQV.VYRHE---H
J3LCQ1_ORYBR/41-98----------------------GCP...ARKH......VER.DPG.-...........EP.AM....LIV.TYDGD---H
M0TLT1_MUSAM/216-272----------------------SCP...RKKQ......VER.SS..-...........DG.QI....TEI.VYKGT---H
M1BJ77_SOLTU/62-118----------------------NCE...VKKT......FER.SP..-...........DG.QI....TEI.VYKGF---H
I1LDL1_SOYBN/180-238----------------------GCM...ARKQ......VER.SNT.-...........EP.DM....FVV.TYTGD---H
K3ZLW2_SETIT/107-166----------------------GCR...ARRQ......VQQ.S.EA-...........DP.SV....YII.TYFDE---H
WRK25_ARATH/329-385----------------------GCG...VKKQ......VER.SAA.-...........DE.RA....VLT.TYEGR---H
I1HL63_BRADI/95-152----------------------RCG...VKKR......VER.DRD.-...........DP.RF....VVT.TYDGV---H
K4CXX4_SOLLC/88-145----------------------GCP...AKKQ......VER.CHH.-...........DP.NV....LII.TYSSG---H
K3XT82_SETIT/66-125----------------------QCL...ASKL......LQQKNGD.-...........DP.PL....YEV.TYTYE---H
K4ACF8_SETIT/124-184----------------------GCN...AKRQ......VQV.C.EA-...........DP.SK....FVV.TYYGD---H
I1KPJ1_SOYBN/130-190----------------------GCW...ATKQ......VQR.S.DE-...........DP.TM....FDI.TYRGN---H
B9RDW9_RICCO/125-184----------------------GCL...ATKQ......VQR.S.DQ-...........DP.TI....FEV.NYSGK---H
A4S4Z2_OSTLU/45-105----------------------GCP...ARKK......TELRRASE-...........DG.EM...ETVV.CYEGE---H
M4CUI9_BRARP/208-267----------------------NCP...VRKQ......VQR.CGED-...........DT.SA....YMT.TYEGN---H
I1I889_BRADI/256-312----------------------NCP...VKKK......VER.CQ..-...........DG.HI....TEI.VYKGS---H
B9IL50_POPTR/163-221----------------------SCP...VKKK......VQR.SAE.-...........DP.SI....LVA.TYEGE---H
K7KV11_SOYBN/172-232----------------------ECQ...AKKQ......VQR.L.DQ-...........NP.NI....FEV.TYRGD---H
I1HPN1_BRADI/101-161----------------------KCA...ALRQ......VQR.C.DQ-...........DP.ES....FVV.TYIGQ---H
K7UAL6_MAIZE/166-235----------------------GCK...ATKT......VQQ.Q.DD-DSSNSSSSSGTAA.LM....YTV.VYYGQ---H
C1MHM4_MICPC/67-120----------------------NSS...MQKH......VEQ.SAD.-...........NP.KL....YVV.TYHSD---.
K7MJ24_SOYBN/105-164----------------------NCQ...AIKQ......VQR.I.QE-...........DP.PL....YKT.TYLGH---H
M0SJA2_MUSAM/36-92----------------------GCK...AKKR......VEW.PPS.-...........DP.SN....VKV.TYDGV---H
W1NXJ2_AMBTC/234-290----------------------GCP...AKKQ......VEWCK...-...........DNINM....VTI.TYEGF---H
D3BE88_POLPA/1056-1111----------------------GCN...VKKQ......VIQ.QGD.-..............KK....FVN.TYNGR---H
J3MP57_ORYBR/126-186----------------------GCM...ATKQ......VQA.S.ET-...........NP.SE....FVI.SYYGE---H
F6HHL8_VITVI/106-162----------------------NCQ...VKKQ......LER.SH..-...........DG.QI....TDI.IYFGK---H
A8ITC4_CHLRE/316-373----------------------GCS...VRKH......VER.SAE.-...........DE.TR....FVV.TYEGT---H
Q013H7_OSTTA/23-83----------------------GCP...ARKR......VEV.....-..............EKVTGATRT.VYEFE---H
I1JJR0_SOYBN/113-169----------------------NCL...AKKQ......LQQ.SN..-...........NG.HI....TDS.ICIGQ---H
M0TK84_MUSAM/89-146----------------------GCN...VKKR......VER.ESE.-...........DS.RF....VIT.TYEGI---H
A9T511_PHYPA/27-83----------------------MCP...VRKR......VER.SAE.-...........DT.GL....VIT.TYEGT---H
WRKY1_DICDI/1111-1165----------------------TCP...VKKQ......VIQ.Q.D.-..............SK....YIN.TYRGK---H
D8R168_SELML/1-61----------------------GCP...AIKY......VQR.S.DS-...........NP.SS....FQI.TYRGE---H
F6H336_VITVI/353-410----------------------GCP...VRKH......VER.DTD.-...........DK.TT....IIV.TYEGK---H
I1GQR9_BRADI/375-432----------------------GCD...VKKH......IER.CSQ.-...........DS.TD....VIT.TYEGK---H
W1P9B9_AMBTC/6-65----------------------GCE...AKKY......VQR.L.DN-...........DP.QI....IEV.TYLGR---H
M4DKE5_BRARP/141-201----------------------GCK...ATKQ......VQK.L.EQ-...........NP.EM....FQI.TYIGN---H
K3Y1Z6_SETIT/159-216----------------------QCK...ARKY......VQR.CGD.-...........DP.RY....LVV.SYIRD---H
K3Y9C1_SETIT/76-139----------------------GCP...AKRT......VQR.N.DD-GDN....GGAA...PK....YTV.VCMGE---H
W5DIT2_WHEAT/219-278----------------------GCS...ATKE......VQR.T.DD-...........DP.EL....FLV.LYKGK---H
M0YYV8_HORVD/86-146----------------------GCQ...ATRQ......VQE.S.DS-...........NP.SE....YLI.SYYGQ---H
M0YJN3_HORVD/140-204----------------------GCP...ARRQ......VQR.S.EE-EE.......EDDP.YL....YVI.TYFGD---H
K7KQN0_SOYBN/1276-1336----------------------WCP...ARKR......VQR.LDE.-...........NP.AT....IEI.IYEHR---H
K7LJY0_SOYBN/131-188----------------------GCC...ARKE......VDRNSVNT-..............KH....VIT.TYVGK---H
Q6IES4_ORYSJ/135-192----------------------GCN...VKKR......VER.DKD.-...........DP.SY....VVT.TYEGT---H
K4CXA0_SOLLC/297-353----------------------NCL...VKKE......IAR.YH..-...........QG.HV....TEV.IYNGA---H
I1HG21_BRADI/167-225----------------------ACA...ARKL......VER.SPD.-...........KP.EV....LIV.TYIAD---H
M1CUN0_SOLTU/22-82----------------------KCQ...ASKQ......VQK.I.QD-...........NP.QR....FRT.TYYGH---H
I1L6Z7_SOYBN/121-181----------------------GCQ...ATKQ......VQR.V.QE-...........EP.IL....FKT.TYYGH---H
K4BBZ0_SOLLC/387-444----------------------GCN...VRKQ......VER.AST.-...........DP.KA....VIT.TYEGK---H
M1BRE7_SOLTU/99-159----------------------SCL...ATKQ......VQK.S.EQ-...........DP.LV....FEV.TYKGM---H
I1R250_ORYGL/38-97----------------------GCK...ARKK......VQH.T.DG-...........DP.LM....VDV.VYEGV---H
K3ZJB7_SETIT/126-188----------------------GCL...ATKH......VQQKDCNS-...........DP.PM....FQV.TYNNG---H
U5D8Z1_AMBTC/112-170----------------------GCP...VKKK......VQR.RAD.-...........DS.SI....LVA.AYEGV---H
K3ZQ30_SETIT/1030-1090----------------------GCN...ATKQ......VQR.T.DG-...........DP.NL....FAV.RYYGE---H
K7KIE5_SOYBN/90-148----------------------SCP...VKKR......VQR.SIQ.-...........DK.SI....LVA.TYEGK---H
I1MKR8_SOYBN/158-216----------------------GCL...ARKQ......VER.NRS.-...........DP.AM....FIV.TYTGE---H
W1NWG1_AMBTC/259-315----------------------NCQ...VKKI......MER.SL..-...........DG.RI....TDI.NYKGQ---H
M4D1B7_BRARP/162-218----------------------DCC...AKK.......IEC.SND.-...........SG.NV....IEI.VNKGS---H
I1MBG9_SOYBN/221-276----------------------TCY...VKKK......VER.TI..-...........EG.EI....VDI.HYQGT---H
I1IV04_BRADI/110-179----------------------GCK...ATKT......VQQ.K.DD-NGAG..AVYEDDQ.VM....FAV.VYYGQ---H
M0SWH8_MUSAM/162-222----------------------GCM...AHRQ......AQL.S.ED-...........DP.TD....FVI.TYIGE---H
U5GSI9_POPTR/36-91----------------------NCM...AKKR......AEWSNPEN-....................LRI.VYEGS---H
WRK68_ARATH/118-175----------------------WCD...VKKR......VER.SFS.-...........DP.SS....VIT.TYEGQ---H
F4QAR0_DICFS/125-181----------------------ECK...ATKN......VQKLSPNN-...........NN.......FRV.TYINT---H
D7MUR9_ARALL/1173-1233----------------------GCL...ATKQ......VQR.S.DT-...........NS.NM....FAI.TYISE---H
M4ECF8_BRARP/121-181----------------------GCE...ATKQ......VQR.S.NE-...........DP.ML....FEI.IYRGI---H
C5XPF8_SORBI/150-208----------------------DCP...VRKK......VQR.CAH.-...........DA.AV....LVT.TYDGA---H
W5CDR1_WHEAT/9-69----------------------GCY...ASKQ......VQR.A.HG-...........DP.LL....FDV.VYHGN---H
F6H4B4_VITVI/93-150----------------------GCN...VKKR......VER.DRE.-...........DS.SY....VIT.TYEGV---H
K3ZN48_SETIT/373-432----------------------RCT...ATKQ......VQC.R.DE-...........DS.TL....FDV.IYHGT---H
K3XKH8_SETIT/112-171----------------------GCN...ATRR......VQR.T.RD-...........HP.AA....YEI.AYYGE---H
WRK25_ARATH/166-222----------------------DCV...SKKI......VET.AS..-...........DG.QI....TEI.IYKGG---H
M0TC40_MUSAM/153-210----------------------GCE...AKKK......VQR.L.DD-...........DP.NT....FEV.IYCGT---H
C5WVP7_SORBI/215-271----------------------SCP...VKKK......VER.SA..-...........EG.YI....TQI.IYRGQ---H
M0TTG4_MUSAM/70-131----------------------GCL...AKKT......VQQEDSCA-...........DP.PS....FKV.EYSIQ---H
B9S4F2_RICCO/133-192----------------------GCK...ATKQ......VQK.V.EE-...........DP.QM....YCT.TYIGH---H
A9U1V6_PHYPA/32-88----------------------GCR...VRKQ......VSR.CVE.-...........DR.GL....VIA.SYEGE---H
WRK66_ARATH/86-145----------------------NCD...ATKR......VQK.IQD.-...........NP.PV....YRN.TYVGQ---H
M0YT11_HORVD/178-234----------------------GCP...TKKK......VEQ.AP..-...........DG.QV....TEI.VYKGT---H
F6HC33_VITVI/111-171----------------------SCR...ATKQ......VQR.M.KE-...........NP.IM....YHT.TYIGH---H
I1R250_ORYGL/129-189----------------------GCS...AEKN......AQA.T.DG-...........DP.LL....FDV.VYHGE---H
B9RNV8_RICCO/233-290----------------------GCP...SRKH......VEM.AID.-...........DA.RT....TTI.KYEGK---H
M0TPC7_MUSAM/150-207----------------------TCG...VKKR......VER.SSD.-...........DP.AV....VVT.TYEGQ---H
U5FI33_POPTR/431-488----------------------GCS...VRKH......VER.GPR.-...........NL.KH....VIT.TYEGK---H
K3ZN48_SETIT/520-580----------------------GCV...ATKQ......VQR.C.NE-...........DP.MA....FDV.IYIGI---H
K7M257_SOYBN/138-198----------------------GCQ...AIKQ......VQR.I.QD-...........NP.PL....YRT.TYYSH---H
M4CW62_BRARP/100-160----------------------NCN...ATKR......VQQ.IQN.-...........SP.SV....YRT.TYVGK---H
W1PB05_AMBTC/141-201----------------------GCA...ALKQ......VQR.M.DS-...........NQ.SF....FEV.TYIGY---H
D8T390_SELML/1-56----------------------DCS...AKKL......VER.SV..-...........SG.ET....TQI.VYKGD---H
W1P843_AMBTC/109-166----------------------GCP...VKKK......VER.DAK.-...........DS.AF....VIT.SYEGR---H
I1IVB4_BRADI/118-173----------------------TCP...VKRK......VET.TL..-...........DG.QI....AEI.VYNGE---H
M4CSQ1_BRARP/127-187----------------------GCK...ATKQ......VQK.L.EP-...........ES.KM....FNI.TYIGN---H
J3MMM2_ORYBR/104-160----------------------NCL...VRKT......VEH.SA..-...........DG.RI....VQI.IYRGQ---H
A9RC52_PHYPA/317-380----------------------YCGALLSRPQAGFCDNVQRCAHDK-..............SV....LIT.TYEGT---H
T1LAC7_TRIUA/117-183----------------------NCS...ATKT......IQQ.QDQN-GSL.....NCEEEAAK....YNV.VYYGH---H
I1Q2J1_ORYGL/176-232----------------------NCA...ARKQ......VER.CRL.-...........DP.SF....LLL.TYTGA---H
D7M6E1_ARALL/110-170----------------------NCE...AKKQ......VQK.IQH.-...........NP.PL....YST.TYFGQ---H
K3XS92_SETIT/45-106----------------------GCP...ATKH......VEQTNSQ.-...........DP.PL....FRV.IYTNE---H
D8RSA8_SELML/111-168----------------------GCP...VRKH......VER.ASN.-...........DP.KS....VIT.TYEGK---H
M1D2T0_SOLTU/151-208----------------------DCK...VKKK......VER.DGN.-...........DS.RY....LMT.TYEGK---H
B9GLD2_POPTR/244-301----------------------GCP...AREH......VER.SLE.-...........DP.TM....LAV.TYEGE---H
J3L5A9_ORYBR/122-183----------------------RCA...AKKQ......VQQ.KDDG-...........EP.PM....FLV.TYLGE---H
A0A096SMI5_MAIZE/134-191----------------------DCR...ARKQ......VER.CRT.-...........DP.ST....VIV.SYTGE---H
F4Q0C8_DICFS/619-677----------------------DCE...CIKL......VQHYPINH-...........DNNRY....IELIIYQGV---H
M4CLX3_BRARP/328-385----------------------NCR...ARKR......VER.AND.-...........DP.KA....FIT.TYEGK---H
K3YER8_SETIT/56-116----------------------HCQ...ASKL......VQQVTHD.-...........DP.PV....FEV.TYMYE---H
T1N7Y3_TRIUA/130-195----------------------DCR...ATKT......VQQ.Q.QQ-DAG.....VDDDP.AM....YAV.VYYGQ---H
W5GE05_WHEAT/9-68----------------------GCD...AKKK......VQR.L.DD-...........DP.FM....YEV.TYCGS---H
D8QTC4_SELML/4-64----------------------GCQ...ATKY......VQK.C.ED-...........EP.SM....YQV.TYIGE---H
M1C548_SOLTU/54-110----------------------NCL...VRKK......VEC.AP..-...........NG.QV....IEI.VYNGA---H
M0SMA5_MUSAM/88-145----------------------GCN...VKKT......VER.ERE.-...........DS.RF....VLT.TYEGT---H
M4DKE6_BRARP/150-210----------------------NCP...AKKQ......VQR.L.ND-...........DP.FT....FRV.TYRGS---H
D7M911_ARALL/158-218----------------------NCW...ATKQ......VQR.S.DS-...........DA.TV....FEV.TYRGT---H
I1IVB4_BRADI/275-329----------------------RCN...ARKF......VER.SSD.-...........NS.......LVT.TYEGR---H
F6GX25_VITVI/36-92----------------------DCP...MRKK......VQQ.SH..-...........DG.QI....TEI.IYKGG---H
J3NAU6_ORYBR/110-173----------------------GCG...AKKT......VQR.N.DD-GGG.....GGA...AR....YTV.AYISE---H
M4F7P5_BRARP/264-321----------------------ACD...VKKH......VER.GAE.-...........DV.KF....LLV.TYDGI---H
K4CIW2_SOLLC/133-193----------------------NCW...ATKH......VQR.S.DD-...........DP.TV....FDI.TYRGS---H
B9T8B8_RICCO/123-182----------------------GCL...AIKQ......VQR.S.DE-...........NP.SI....FEV.TYRRK---H
WRKY1_DICDI/814-869----------------------GCN...VRKQ......VERIG...-...........DT.NQ....NST.VYKGE---H
F4PLI3_DICFS/941-996----------------------GCS...VKKQ......VLQ.QSE.-..............NS....FLS.TYNGN---H
K7VBJ3_MAIZE/118-180----------------------RCE...AKKK......VQQ.Q.DD-DG.......SHLP.PM....FEV.TYLNE---H
Q0V871_ARATH/24-81----------------------NCL...TKKK......VET.SLV.-...........KG.QM....IEI.VYKGS---H
M4F9N3_BRARP/76-133----------------------GCM...VKKR......IER.DGK.-...........DA.AY....VIT.TYEGV---H
A9S0E7_PHYPA/16-72----------------------NCL...VKKQ......VER.CTE.-...........NP.SN....VMT.TYYGT---H
M0X4S6_HORVD/138-199----------------------ECP...AKKH......VQQ.QNNS-...........DP.PM....FIV.TLFND---H
U5FT31_POPTR/7-63----------------------SCQ...AKKQ......LEC.SH..-...........DG.KL....ADI.VYLGE---H
M1CMZ7_SOLTU/94-155----------------------ECY...ATKQ......VER.IKEE-...........EP.II....YRT.TYFGH---H
F6H3I5_VITVI/96-154----------------------QCP...VKKK......VQR.CME.-...........DS.SI....LVA.TYEGA---H
K4BIZ9_SOLLC/116-177----------------------ECR...ATKQ......VQI.I.QE-...........NPIIM....YHT.TYFGN---H
W5ET14_WHEAT/53-108----------------------RCG...AKKK......VEW.QPG.-...........DP..N....LRV.VYDGA---H
K7KVJ1_SOYBN/74-131----------------------DCN...VKKQ......IQR.HSR.-...........DE.QI....VVT.TYEGT---H
U5GVF5_POPTR/157-215----------------------GCL...ARKQ......VER.SST.-...........DP.SI....FII.TYTAE---H
I1LT43_SOYBN/160-216----------------------NCC...AKK.......IKF.CDH.-...........SG.HV....IEI.VYKSQ---H
WRK34_ARATH/178-234----------------------NCE...AKKK......VER.SR..-...........EG.HI....IEI.IYTGD---H
M1D6V7_SOLTU/22-80----------------------GCE...VKKR......VER.DGH.-...........DS.SN....LIT.TYEGK---H
K4A5N4_SETIT/774-831----------------------NCN...VRKQ......IER.AST.-...........DP.RC....VLT.TYTGR---H
I1IR53_BRADI/286-342----------------------NCP...VKKK......VER.SQ..-...........VG.QI....TEI.IYKGT---H
M1DN19_SOLTU/86-144----------------------SCK...ATKI......IEK.SPK.-...........NE.NY....FLV.SYSDE---H
W5FQQ6_WHEAT/917-977----------------------GCE...ATKQ......VQR.S.DS-...........DT.QL....FDV.VYHGE---H
B9RAC9_RICCO/80-137----------------------GCS...VKKQ......VQR.KSE.-...........EE.EV....VVT.TYEGK---H
M7ZW64_TRIUA/111-170----------------------GCP...ATRQ......VQQ.A.ED-...........DP.SL....YVI.TYFGD---H
U5GC56_POPTR/83-140----------------------SCY...AKKK......VQH.CCQ.-...........SG.RV....VDV.VYIGD---H
M0VMN8_HORVD/120-183----------------------GCW...AKKQ......LQQ.EDSS-I.........GSP.PL....YKV.TYLND---H
J3MMM2_ORYBR/273-330----------------------GCD...VKKQ......VER.SVE.-...........EP.NA....VIT.TYEGK---H
A4S1F5_OSTLU/27-88----------------------GCP...ARKR......VGWCPETG-..........H.........TRV.WYEFE---H
D7MKX1_ARALL/1146-1204----------------------GCS...ARKQ......VER.SRT.-...........DP.NM....LVI.TYISE---H
M0T0B0_MUSAM/207-264----------------------ECP...ARKH......VER.CLD.-...........DA.NM....LIV.TYEGY---H
I1PWM4_ORYGL/125-185----------------------GCT...ATKQ......VQQ.S.EE-...........DP.SI....YVI.TYFGD---H
I1R3G5_ORYGL/139-200----------------------GCL...ATKQ......IQQEDKN.-...........DP.PM....FQV.TYSNE---H
F6GXW4_VITVI/171-231----------------------GCM...ATKQ......VQM.T.EE-...........EP.PM....YKT.TYHGQ---H
M4CXB1_BRARP/69-126----------------------GCN...VKKQ......VQR.LTS.-...........DQ.EV....VVT.TYEGV---H
D7MF96_ARALL/373-429----------------------GCT...VTKH......VER.ASD.-...........DF.KS....VLT.SYIGK---H
M1D7L8_SOLTU/129-186----------------------CCG...ATKV......IRR.IDT.-...........EP.LT....FEV.TYGGS---H
J3MYJ7_ORYBR/269-325----------------------ACT...VRKK......VEY.AQ..-...........DG.QI....TQI.IYKGA---H
C1EBM1_MICCC/10-63----------------------GCE...ARKK......VWR.QANG-...........DE.AV........EREGT---H
M1DBE7_SOLTU/170-228----------------------HCE...AKKQ......IEK.SPK.-...........DE.NI....FLV.SYSGE---H
K3Z832_SETIT/111-171----------------------QCA...AQRQ......VQR.C.DD-...........DP.DA....FRV.TYIGV---H
J3M860_ORYBR/133-194----------------------KCQ...AKKY......VQQ.ANRK-...........HP.PE....FTV.TLTNE---H
M0VCG1_HORVD/220-278----------------------GCP...ARKH......VER.ATD.-...........DP.AM....HLV.TYEGD---H
K3ZIR4_SETIT/69-127----------------------NCP...TKKR......VER.SAL.-...........DG.QI....IEI.VYNGT---H
I1HSW1_BRADI/41-106----------------------GCP...ATKQ......VQE.QQHG-DG.......ADHP.KT....YLV.IYVHE---H
M7YP80_TRIUA/106-165----------------------GCA...ATKQ......VQR.A.DD-...........DP.AL....FDV.IYHGE---H
M0SP79_MUSAM/129-188----------------------SCF...ATKQ......VQR.S.DE-...........DP.QA....FDV.IYQGT---H
M0T4G9_MUSAM/121-181----------------------GCF...AMKQ......VQR.S.DD-...........DP.SV....FDI.TYRGE---H
M0U1R5_MUSAM/391-448----------------------GCP...VRKH......VER.VPH.-...........DA.KA....LLI.TYEGE---H
B9I7F0_POPTR/156-212----------------------NCL...VKKK......IEC.AH..-...........EG.QI....TEI.IYKGS---H
WRK50_ARATH/113-170----------------------GCP...VKKR......VER.DRD.-...........DP.SF....VIT.TYEGS---H
E1ZGV1_CHLVA/113-170----------------------GCN...VRKQ......VER.SGR.-...........NA.RM....LVT.TYEGT---H
B9RND6_RICCO/52-110----------------------GCS...AKKQ......VER.CRT.-...........DA.SV....LII.TYTSN---H
M4FA92_BRARP/266-323----------------------GCI...MKKH......VER.AAD.-...........DL.RM....LLV.TYYGK---H
K3ZT34_SETIT/82-138----------------------NCE...VKKL......LER.SL..-...........DG.QI....TEV.VYKGR---H
M0U8S7_MUSAM/172-227----------------------NCL...AKKK......VEC.YP..-...........DG.KI....CDV.IYRGK---H
M0RX59_MUSAM/291-348----------------------TCN...VKKQ......VQR.LSK.-...........DT.SI....VVT.TYEGI---H
K3XLT9_SETIT/160-217----------------------GCG...VKKR......VER.ARD.-...........DE.SF....VIT.TYDGV---H
I1R3G9_ORYGL/27-91----------------------GCP...ATKT......VQQ.M.DS-SG......NGT.S.KL....FNV.DYYGQ---H
A9TJH5_PHYPA/11-68----------------------NCP...VRKR......VER.CIE.-...........DP.GL....VAT.AYEGT---H
E1ZGV1_CHLVA/4-61----------------------GCP...AKKM......IER.EPK.-...........TG.RI....SQA.ELKNE---H
D8R033_SELML/2-60----------------------GCP...VRKQ......VQR.CAE.-...........DT.SI....LVT.TYEGT---H
K4CG67_SOLLC/75-133----------------------GCP...ARKQ......VER.SRL.-...........DP.TM....LLI.TYCSE---H
M0TXJ2_MUSAM/6-66----------------------RCD...AKKM......VQR.S.DD-...........DP.YT....FQV.TYCGS---H
M0S0M4_MUSAM/331-387----------------------KCP...VRKY......VER.SSE.-...........DS.AH....LVT.TYEGR---H
I1QTG0_ORYGL/63-124----------------------NCM...ATKV......VQQENDA.-...........DP.PL....YRV.TYIHP---H
W5FQQ6_WHEAT/802-862----------------------GCQ...ALKQ......LQA.T.DG-...........DP.LL....FNA.IYVGN---H
M4C895_BRARP/99-159----------------------KCP...AQKQ......VQR.S.DK-...........DP.SI....FEV.KYVGN---H
C5X5M4_SORBI/126-186----------------------RCM...ATRQ......VQA.S.DA-...........NP.SE....FII.SYYGQ---H
D7M935_ARALL/134-192----------------------GCL...ARKQ......VER.NPQ.-...........NP.EK....FTI.TYTNE---H
M4EPX7_BRARP/108-165----------------------GCD...VKKH......VER.RAD.-...........NV.KL....LVI.TYYGN---H
A9SRR4_PHYPA/11-68----------------------NCP...VRKR......VER.STE.-...........DP.DQ....VIT.TYEGR---H
E0CUJ8_VITVI/134-194----------------------GCL...ATKQ......VQR.S.DD-...........DP.TI....FEI.TYRGR---H
M0THF1_MUSAM/136-195----------------------GCL...ATKQ......VQR.S.DQ-...........DP.CV....FDI.TYRGE---H
K7M259_SOYBN/132-192----------------------GCP...ATKQ......VQR.T.QE-...........DP.PL....YRT.TYYGH---H
W1NEF1_AMBTC/8-65----------------------SCG...ARKR......VEW.CNS.-...........DP.QN....LRV.IYDGS---H
M4EPX6_BRARP/284-341----------------------GCN...VKKH......VER.GAD.-...........DV.KL....LVV.TYDGK---H
I1BSM4_RHIO9/209-264----------------------GCP...VNKT......VTWKGNGE-....................YLI.KYRGE---H
A8ITC4_CHLRE/117-174----------------------GCL...AKKI......VER.SDS.-...........DG.TV....LST.EYKGD---H
C5Y3H4_SORBI/132-194----------------------GCL...ATKH......VQQRDDNS-...........DL.PM....FHV.TYNND---H
J3N5J0_ORYBR/148-214----------------------KCK...ATKT......VQQ.R.ED-LNYA...NNGDHP.IM....YTM.VYYGQ---H
M0U1R5_MUSAM/220-275----------------------NCS...AKKK......VER.CP..-...........DG.TI....IEV.IYRGK---H
M1DVX5_SOLTU/167-225----------------------DCP...ARRH......IQKSSTDP-...........NK.......VIV.TYRGQ---H
K3ZIR4_SETIT/224-280----------------------GCS...VRKH......VER.SSR.-...........DP.ST....VIT.TYKGK---H
M8A8S6_TRIUA/118-178----------------------GCK...AKRH......VHV.S.EA-...........NP.SE....YTI.DYYGQ---H
K4AKU1_SETIT/30-91----------------------NCP...ATKQ......VQQKDHS.-...........DP.PL....YAV.TYYNE---H
D3BE88_POLPA/755-813----------------------GCT...VKKQ......MERRSSS.-...........DD.TL....NHV.VYKGE---H
K4C166_SOLLC/129-185----------------------CCG...ATKM......VQR.IET.-...........GP.LT....FEI.TYGGS---H
WRK45_ARATH/65-122----------------------GCR...VKKQ......VQR.QWG.-...........DE.GV....VVT.TYQGV---H
M4CDZ0_BRARP/106-165----------------------DCG...ARKH......EQQ.IKE.-...........NP.PV....YRT.TYFGH---H
C0PKA1_MAIZE/112-175----------------------GCQ...AKRT......VQR.NDDD-G........ATAP.PE....YTV.VYVAE---H
C5X581_SORBI/15-73----------------------GCP...AKKH......VQQ.C.DA-...........DP.SK....LEV.TYLEA---H
B9T4U8_RICCO/34-91----------------------GCP...ARKH......VER.ASD.-...........DP.SM....LVV.TYEGE---H
J3NA98_ORYBR/1018-1075----------------------GCR...AAKH......VQA.T.DD-...........NP.LI....VDV.MYHGE---H
I1J5V4_SOYBN/175-231----------------------NCS...VKKK......VER.SL..-...........EG.HV....TAI.IYKGE---H
I1PTK2_ORYGL/147-208----------------------NCK...ATKT......VQQ.L.DS-AG.......ET...IM....YTV.VYYGQ---H
I1HR78_BRADI/64-122----------------------GCP...ARKQ......VER.SQA.-...........DP.AM....VLV.TYSYE---H
W5D9K8_WHEAT/68-128----------------------QCL...ASKL......VQQENHE.-...........DP.PL....FKV.TYTYE---H
T1MEI9_TRIUA/119-182----------------------GCR...AKKT......VQQ.Q.DT-SG.......GR.R.PM....FQV.TYVNE---H
C5X9Q6_SORBI/1354-1412----------------------GCP...ARKH......MQR.R.DG-...........EP.IL....YDV.CYFGE---H
C1N120_MICPC/5-60----------------------NCP...ARKH......VEG.....-...........DP.SL....LSSLTYEGE---H

PF03615

Q5TQ16_ANOGA/3-143VLIC.TARCKLPNGGQINLRPAICDK--ARRKQQGRACPNRHCKVGRLEVLPCRGHCGYPVTHYWRHTEKAIFFQAKGNH
A7SSU8_NEMVE/11-147VLLC.SKDCTLPNGLKIVVRPAISDK--VRERQIGQNCPNASCSGI.LSHRKCTGNNGYPVTHFWVHQDDGIYFESKGTH
Q17NS1_AEDAE/37-177VLVC.SARCALPNGDKIHLRPAICDK--ARRKQQGKSCPNRLCVGGILEIQPCRGHCGYPVTHFWRHTPNAIFFQAKGVH
M9PFC8_DROME/47-186VLLC.SAKCKLPNGASVHLRPAICDK--ARRKQQGKQCPNRNCNGR.LEIQACRGHCGYPVTHFWRRDGNGIYFQAKGTH
GCM1_MOUSE/30-167VVVC.SRDCSTEEGRKIYLRPAICDK--ARQKQQRKSCPN..CNGP.LKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEH
K1PSK2_CRAGI/41-180VFVC.SYDCTLPNGEKVHLRPAICDK--ARRKQIGKQCPGPNCRGH.LELMTCKGHCGYPVTHFWRHINNAIFFQAKGVH
C3ZI50_BRAFL/63-202VLVC.ALHCTTPDGGKIHMRPAICDK--ARKKQLGKQCPNGSCQGR.LELMPCRGHCGYPVTHFWRQENNVIFFQAKGTH
A0A068YFP9_ECHMU/176-311VLVC.SLGCISPNGLPVAYRPAICDK--ARKKQCMRSCTTPGCKGR.LVQKNCKGHGGYPVTHFWRFCNGAVFFQAKGRH
G4VCV4_SCHMA/248-378VLLCTSKQCTLA......MRPAICDK--ARRRQEGRQCCMPNCTGR.IYIQSCHGHGGYPVTHFWREHGDTIYFQAKGTH
Q8MMJ4_STRPU/66-206VFLC.SKGCRTSSGEIVTVRPATSDR--ARKKQGDKKCPRTGCDGK.LFHMICAGKSGYPVTHFWRVTDTVILFQSKGVH
W5NJR0_LEPOC/36-173VVVC.SNNCTTADSREIHLRPAICDK--ARQKQQKKECPN..CNAP.LRLLCCKGNGGYPVTNFWRQEGPYIFFQSKGQH
B3MUW9_DROAN/83-223VLVC.SQHCTLPNGSKINLRPAICDK--ARRKQEGKACPNKSCRGGRLEIKPCRGHCGYPVTHFWRHSGNAIFFQAKGVH
D6WJ63_TRICA/26-165VLVC.SLRCTLANGERVHLRPAICDK--ARKKQQGKPCPNRQCTGR.LEILPCRGHCGYPVTHFWRHTDHAIFFQAKGVH
Q5TLZ9_DANRE/19-156VVVC.SRNCSLPDGSKLQLRPAICDK--ARQKQQKKLCPN..CNSA.LELIPCRGHSGYPVTNFWRVDGKAIFFQAKGVH
H3A2B3_LATCH/38-175VVVC.SQDCTTPDGKKIHLRPAICDK--ARQKQQKKRCPN..CGAS.LTLVFCQGHGGYPVTNFWRHEGPYIYFQSKGVH
H2KV09_CLOSI/280-413VLEC.SAGCLV.HGKPLSLRPAICDK--ARKKQINRMCITPGCSGR.LVLRNCRGHSGYPVTHFWRFANGAVYFEAKGEH

PF08731

Q6BK98_DEBHA/21-107----------------------SCP---FKIR------ANYSIR--------------NHVWT----LVVMNENHD---H
AFT2_CANAL/21-112----------------------SCP---FKIR------ANYSVR--------------NKVWT----LSIVSDEHD---H
AFT2_YEAST/51-137----------------------ACP---FRIR------AAYSVR--------------LQKWN----VVVMNNIHS---H
AFT1_YEAST/108-243----------------------NCP---FRVR------ATYSLK--------------RKRWS----IVVMDNNHS---H
Q6FS49_CANGA/15-125----------------------HCP---FRVR------ATYSLK--------------RKKWS----VVVLNNTHT---H
Q6CS78_KLULA/99-257----------------------SCP---FRVR------ATFSLK--------------RKKWN----IVVVNNVHT---H
Q6FSP0_CANGA/42-131----------------------ICP---FRVR------CTFSTQ--------------LKKWK----IVIINNSHS---H
Q755B2_ASHGO/89-206----------------------TCP---FRVR------AAYSLK--------------RKRWS----IVVVNNGHS---H

PF03108

Q2QMP0_ORYSJ/171-237----------------------GCP---WRIH------AAKLPG--------------VPTFS----I------------
Q9C702_ARATH/177-243----------------------HCK---WSIC------ASRREE--------------DGLFE----I------------
Q0D1G9_ASPTN/6-73----------------------GCP---YRVR------LYVRRD--------------TVQAQ----V------------
Q0DAT1_ORYSJ/144-210----------------------DCP---WRIH------ASKSPA--------------KKQFM----I------------
I1Q5U8_ORYGL/402-465----------------------RCK---WKVH------ATKRSS--------------.GTWR----I------------
I1QDU7_ORYGL/128-194----------------------GCP---WRVH------AYKGKW--------------KDYWT----V------------
M4FGM2_BRARP/194-256----------------------GCP---WRIH------ASRLST--------------TQLIC----I------------

PF03101

FRS4_ARATH/11-97NHDLLP----------
FRS8_ARATH/109-194NHSFDP----------
FRS10_ARATH/69-161NHELLE----------
FRS1_ARATH/35-137NHEIFT----------
FRS5_ARATH/87-179NHELVP----------
Q6NLE7_ARATH/25-111NHSLQF----------
Q8H344_ORYSJ/116-204NHQLAT----------
Q7XKT7_ORYSJ/54-140NHPCNP----------
Q93Z68_ARATH/84-172NHSLMP----------
Q6ESZ2_ORYSJ/64-154NHPLFI----------
FAR1_ARATH/65-154NHELLP----------
Q6AT58_ORYSJ/82-184NHPLVP----------
Q2QXD6_ORYSJ/96-184NHELVR----------
Q84JA7_ARATH/47-136NHPLLP----------
Q75LD4_ORYSJ/42-126NHALNP----------
J3LS84_ORYBR/67-154NHAV..----------

PF04500

Q70BY8_DROVI/421-485NH--------------
B4MBE8_DROVI/40-101NH--------------
FWCH1_MOUSE/402-460CH--------------
FWCH1_MOUSE/235-293CH--------------
A7UT18_ANOGA/463-522DH--------------
A7UT18_ANOGA/543-605LH--------------
FWCH1_HUMAN/600-658CH--------------
Q16SJ4_AEDAE/393-453NH--------------
Q17CC2_AEDAE/19-83NH--------------
Q6IDT6_DROPS/406-467QH--------------
Q16WE4_AEDAE/17-80NH--------------
Q6IDT7_DROPS/405-469DH--------------
Q6NP69_DROME/162-227AH--------------
Q16SI9_AEDAE/387-448DH--------------
Q17CD4_AEDAE/347-409NH--------------
Q6IDX8_ANOGA/378-443TH--------------
Q6IDX0_ANOGA/458-517TH--------------
Q6IDZ2_ANOGA/392-456TH--------------
Q17EL2_AEDAE/670-734NH--------------
Q17CD3_AEDAE/199-260NH--------------
Q9XWQ6_CAEEL/134-195NH--------------
Q16WH6_AEDAE/7-75DH--------------
Q17EL2_AEDAE/762-821VH--------------
Q17EL2_AEDAE/236-296TH--------------
Q16FH8_AEDAE/26-95NH--------------
Q16SK1_AEDAE/387-448CH--------------
Q17C92_AEDAE/22-90NH--------------
Q17CD5_AEDAE/89-153NH--------------
Q6NP69_DROME/596-663SH--------------
Q6IDU1_DROPS/408-468NH--------------
A0APY4_DROSI/32-92CH--------------
Q17MH0_AEDAE/8-77NH--------------
Q16SJ1_AEDAE/385-449NH--------------
Q17CC5_AEDAE/2-67NH--------------
Q17CC4_AEDAE/1-62NH--------------
Q16SK0_AEDAE/393-454SH--------------
Q16SK2_AEDAE/394-455TH--------------
Q6IDT9_DROPS/430-492NH--------------
Q17CA9_AEDAE/249-307QH--------------
Q17CB7_AEDAE/18-77SH--------------
Q17EK9_AEDAE/1691-1752TH--------------
Q17IM0_AEDAE/257-318NH--------------
Q7QDH8_ANOGA/445-505NH--------------
Q6IDZ7_ANOGA/373-431CH--------------
Q18225_CAEEL/143-204NH--------------
Q17CD3_AEDAE/4-68NH--------------
Q17CD3_AEDAE/86-145NH--------------
Q6IDY5_ANOGA/394-455NH--------------
Q17EK9_AEDAE/424-486QH--------------
Q6IDU0_DROPS/419-479CH--------------
Q16SI1_AEDAE/384-445NH--------------
Q6IDY6_ANOGA/439-499NH--------------
Q16SJ5_AEDAE/380-443IH--------------
Q17CB7_AEDAE/197-258TH--------------
A7DTF1_CAEEL/131-192NH--------------
Q17CD5_AEDAE/175-239NH--------------
Q6IDY2_ANOGA/385-450SH--------------
Q6IDU2_DROPS/436-495NH--------------
Q16SI4_AEDAE/385-447NH--------------
Q6IDX5_ANOGA/379-440TH--------------
Q6IDX7_ANOGA/374-437NH--------------
Q16SI2_AEDAE/384-446NH--------------
Q16SJ2_AEDAE/416-472NH--------------
Q17CC3_AEDAE/84-147NH--------------
Q6NP69_DROME/365-432TH--------------
Q17EL2_AEDAE/360-420NH--------------
Q17CC0_AEDAE/72-136NH--------------
Q6IDT4_DROPS/418-482MH--------------
Q17CB6_AEDAE/76-137NH--------------
Q16SJ8_AEDAE/412-474NH--------------
Q17CB9_AEDAE/37-98NH--------------
Q16FU8_AEDAE/997-1058NH--------------
Q17EK9_AEDAE/344-403RH--------------
Q6IDX2_ANOGA/381-447NH--------------
Q6IDV9_DROPS/402-461NH--------------
Q16SI5_AEDAE/381-443TH--------------
Q16SJ7_AEDAE/381-447TH--------------
Q17CD4_AEDAE/155-214NH--------------
Q17EK9_AEDAE/1138-1199NH--------------
MMD4_DROME/452-512VH--------------
Q17EK9_AEDAE/1463-1528NH--------------
Q16SI0_AEDAE/430-495NH--------------
Q16SB8_AEDAE/1076-1143NH--------------
Q17CD2_AEDAE/110-170NH--------------
Q6NP69_DROME/17-87IH--------------
Q17EL2_AEDAE/459-522NH--------------
Q17CB7_AEDAE/98-160NH--------------
Q16SI3_AEDAE/390-452NH--------------
Q16SJ6_AEDAE/386-449SH--------------
A8XLA6_CAEBR/145-206NH--------------
Q16SJ0_AEDAE/390-455NH--------------
Q17EK9_AEDAE/1257-1320NH--------------
Q17EK9_AEDAE/94-153SH--------------
B4GZB2_DROPE/96-158NH--------------
B4I3G6_DROSE/69-132TH--------------
B4I3H2_DROSE/2-65NH--------------
B4I3I4_DROSE/2-63NH--------------
B4JS54_DROGR/8-73NH--------------
B4R104_DROSI/89-155TH--------------
H2KZM4_CAEEL/53-119NH--------------
Q5TUB5_ANOGA/339-400NH--------------
Q6IDT0_DROPS/406-466NH--------------

PF03106

M7ZE84_TRIUA/87-143NHQ-------------
K3XPF8_SETIT/105-165TCH-------------
J3LNI8_ORYBR/48-108TCR-------------
M0SDB1_MUSAM/144-200NHP-------------
M1BIZ3_SOLTU/122-182SC.-------------
K4CF00_SOLLC/138-194EHP-------------
W1PMH6_AMBTC/119-178TC.-------------
U5GC56_POPTR/285-341DH.-------------
B9SRT4_RICCO/128-188TCK-------------
M0TU82_MUSAM/44-102NHP-------------
B9GXX9_POPTR/25-80NHA-------------
K7V4I1_MAIZE/134-195TCD-------------
B9RNV8_RICCO/68-125NHD-------------
I1QGE9_ORYGL/62-119NHP-------------
K7LCG4_SOYBN/201-259NHP-------------
K7LJY1_SOYBN/143-200NHE-------------
B4FCE6_MAIZE/44-105TCS-------------
K3ZE24_SETIT/124-183TC.-------------
D8RSA8_SELML/4-60NHP-------------
C5YRA1_SORBI/118-182TC.-------------
K7UWT7_MAIZE/125-185TC.-------------
T1M9Q3_TRIUA/111-176SC.-------------
M0VYD6_HORVD/124-188TCD-------------
C5X9Q6_SORBI/1487-1548TCD-------------
K7LGJ6_SOYBN/248-305NHD-------------
I1QAI9_ORYGL/25-82TC.-------------
M0YD52_HORVD/22-80TC.-------------
I1HSW0_BRADI/124-187TCQ-------------
E0CUS7_VITVI/11-69IHA-------------
T1NKL9_TRIUA/123-186KCQ-------------
I1NPU0_ORYGL/179-237CHP-------------
F6H336_VITVI/139-196NHD-------------
F4PLI3_DICFS/633-691NHD-------------
K4A5N4_SETIT/641-697NHP-------------
D7U1A8_VITVI/362-418DHD-------------
W5CBN1_WHEAT/2-57LH.-------------
F6HHL8_VITVI/281-338DHD-------------
W5I4X6_WHEAT/29-88TC.-------------
M0YE87_HORVD/134-198SCK-------------
W5B1V0_WHEAT/120-180TCR-------------
K3Y972_SETIT/138-202TCK-------------
M0THP3_MUSAM/86-142LH.-------------
A9SJ74_PHYPA/290-348TCS-------------
B9IIY4_POPTR/301-358NHE-------------
WRK59_ARATH/109-166NHP-------------
A0A096URZ3_WHEAT/1333-1392TC.-------------
K7M7W5_SOYBN/127-187TCN-------------
M4D9M7_BRARP/278-335DHD-------------
M1A3W0_SOLTU/224-280NHE-------------
M0SHM4_MUSAM/124-183TC.-------------
K3ZNU0_SETIT/123-184TCN-------------
I1MX45_SOYBN/109-166SH.-------------
B9H449_POPTR/209-265NHD-------------
M4E2W1_BRARP/156-211NHS-------------
B9IQ67_POPTR/183-243TCH-------------
K4CXA0_SOLLC/509-566NHD-------------
B9SM87_RICCO/108-165NHE-------------
WRK64_ARATH/103-163VCK-------------
D7LDZ6_ARALL/104-164TCD-------------
B9I8F0_POPTR/132-192TCR-------------
K4AJ90_SETIT/3-60QH.-------------
D7U1A8_VITVI/189-245NHD-------------
K4C162_SOLLC/27-81NCD-------------
K3ZQ30_SETIT/1145-1205TCK-------------
D7KMZ8_ARALL/325-382NHP-------------
K3YGF8_SETIT/55-112NHP-------------
I1KBC5_SOYBN/112-169NHQ-------------
K7M5Z1_SOYBN/77-134THP-------------
I1IJB3_BRADI/691-747NHP-------------
C5XNA2_SORBI/124-184TCD-------------
F6GX25_VITVI/254-311NHE-------------
K3ZNM2_SETIT/136-202TCN-------------
B3H4T8_ARATH/468-524NHE-------------
K4CB36_SOLLC/203-259NHD-------------
I1IV03_BRADI/121-188TC.-------------
K3ZVA0_SETIT/121-180TC.-------------
B9T726_RICCO/27-84AHS-------------
M0SWT7_MUSAM/131-193TCR-------------
M0TJN8_MUSAM/70-132TCK-------------
D7KEM5_ARALL/135-192NHP-------------
M1D7L1_SOLTU/128-184SC.-------------
J3M640_ORYBR/195-252NHP-------------
M0RX59_MUSAM/130-188NHP-------------
M1A9L5_SOLTU/207-265NHS-------------
B0LUS3_SOYBN/136-196TCK-------------
M7YD70_TRIUA/902-962TCT-------------
J3LCQ1_ORYBR/41-98RH.-------------
M0TLT1_MUSAM/216-272SHS-------------
M1BJ77_SOLTU/62-118DHP-------------
I1LDL1_SOYBN/180-238SHP-------------
K3ZLW2_SETIT/107-166TC.-------------
WRK25_ARATH/329-385NHD-------------
I1HL63_BRADI/95-152NHA-------------
K4CXX4_SOLLC/88-145NHP-------------
K3XT82_SETIT/66-125TC.-------------
K4ACF8_SETIT/124-184TCR-------------
I1KPJ1_SOYBN/130-190TCS-------------
B9RDW9_RICCO/125-184KC.-------------
A4S4Z2_OSTLU/45-105THA-------------
M4CUI9_BRARP/208-267DHP-------------
I1I889_BRADI/256-312NHP-------------
B9IL50_POPTR/163-221NHA-------------
K7KV11_SOYBN/172-232TCH-------------
I1HPN1_BRADI/101-161TCQ-------------
K7UAL6_MAIZE/166-235SC.-------------
C1MHM4_MICPC/67-120...-------------
K7MJ24_SOYBN/105-164TCN-------------
M0SJA2_MUSAM/36-92HHP-------------
W1NXJ2_AMBTC/234-290M..-------------
D3BE88_POLPA/1056-1111THD-------------
J3MP57_ORYBR/126-186TCR-------------
F6HHL8_VITVI/106-162DHP-------------
A8ITC4_CHLRE/316-373SHR-------------
Q013H7_OSTTA/23-83TCR-------------
I1JJR0_SOYBN/113-169NHP-------------
M0TK84_MUSAM/89-146NHR-------------
A9T511_PHYPA/27-83TH.-------------
WRKY1_DICDI/1111-1165NHD-------------
D8R168_SELML/1-61TCN-------------
F6H336_VITVI/353-410DHD-------------
I1GQR9_BRADI/375-432SHD-------------
W1P9B9_AMBTC/6-65ICQ-------------
M4DKE5_BRARP/141-201TCT-------------
K3Y1Z6_SETIT/159-216SHT-------------
K3Y9C1_SETIT/76-139TC.-------------
W5DIT2_WHEAT/219-278TC.-------------
M0YYV8_HORVD/86-146TCK-------------
M0YJN3_HORVD/140-204TC.-------------
K7KQN0_SOYBN/1276-1336TCA-------------
K7LJY0_SOYBN/131-188NHE-------------
Q6IES4_ORYSJ/135-192NHV-------------
K4CXA0_SOLLC/297-353KHP-------------
I1HG21_BRADI/167-225CHA-------------
M1CUN0_SOLTU/22-82TCK-------------
I1L6Z7_SOYBN/121-181TCK-------------
K4BBZ0_SOLLC/387-444NHD-------------
M1BRE7_SOLTU/99-159SCK-------------
I1R250_ORYGL/38-97SC.-------------
K3ZJB7_SETIT/126-188TCK-------------
U5D8Z1_AMBTC/112-170THP-------------
K3ZQ30_SETIT/1030-1090TCD-------------
K7KIE5_SOYBN/90-148NH.-------------
I1MKR8_SOYBN/158-216NHP-------------
W1NWG1_AMBTC/259-315DHP-------------
M4D1B7_BRARP/162-218SHE-------------
I1MBG9_SOYBN/221-276TH.-------------
I1IV04_BRADI/110-179TCK-------------
M0SWH8_MUSAM/162-222TCR-------------
U5GSI9_POPTR/36-91SHA-------------
WRK68_ARATH/118-175THP-------------
F4QAR0_DICFS/125-181NHP-------------
D7MUR9_ARALL/1173-1233NHP-------------
M4ECF8_BRARP/121-181SCS-------------
C5XPF8_SORBI/150-208NHP-------------
W5CDR1_WHEAT/9-69TCA-------------
F6H4B4_VITVI/93-150NHE-------------
K3ZN48_SETIT/373-432TC.-------------
K3XKH8_SETIT/112-171TCR-------------
WRK25_ARATH/166-222NHP-------------
M0TC40_MUSAM/153-210TCQ-------------
C5WVP7_SORBI/215-271NHQ-------------
M0TTG4_MUSAM/70-131TCK-------------
B9S4F2_RICCO/133-192TCS-------------
A9U1V6_PHYPA/32-88HH.-------------
WRK66_ARATH/86-145ACE-------------
M0YT11_HORVD/178-234NHP-------------
F6HC33_VITVI/111-171TCR-------------
I1R250_ORYGL/129-189TCD-------------
B9RNV8_RICCO/233-290DHD-------------
M0TPC7_MUSAM/150-207NHP-------------
U5FI33_POPTR/431-488DHK-------------
K3ZN48_SETIT/520-580TCT-------------
K7M257_SOYBN/138-198TCK-------------
M4CW62_BRARP/100-160ICE-------------
W1PB05_AMBTC/141-201TCR-------------
D8T390_SELML/1-56SHS-------------
W1P843_AMBTC/109-166NHT-------------
I1IVB4_BRADI/118-173NHP-------------
M4CSQ1_BRARP/127-187TCN-------------
J3MMM2_ORYBR/104-160THE-------------
A9RC52_PHYPA/317-380NHP-------------
T1LAC7_TRIUA/117-183TCS-------------
I1Q2J1_ORYGL/176-232S..-------------
D7M6E1_ARALL/110-170TCQ-------------
K3XS92_SETIT/45-106TCS-------------
D8RSA8_SELML/111-168NHD-------------
M1D2T0_SOLTU/151-208NHE-------------
B9GLD2_POPTR/244-301NHS-------------
J3L5A9_ORYBR/122-183TCQ-------------
A0A096SMI5_MAIZE/134-191SHP-------------
F4Q0C8_DICFS/619-677NHP-------------
M4CLX3_BRARP/328-385NHH-------------
K3YER8_SETIT/56-116TCN-------------
T1N7Y3_TRIUA/130-195TCK-------------
W5GE05_WHEAT/9-68SC.-------------
D8QTC4_SELML/4-64SCQ-------------
M1C548_SOLTU/54-110NHP-------------
M0SMA5_MUSAM/88-145NHH-------------
M4DKE6_BRARP/150-210TCQ-------------
D7M911_ARALL/158-218TCS-------------
I1IVB4_BRADI/275-329NH.-------------
F6GX25_VITVI/36-92NHP-------------
J3NAU6_ORYBR/110-173TCK-------------
M4F7P5_BRARP/264-321EHD-------------
K4CIW2_SOLLC/133-193NCH-------------
B9T8B8_RICCO/123-182TC.-------------
WRKY1_DICDI/814-869CH.-------------
F4PLI3_DICFS/941-996NHD-------------
K7VBJ3_MAIZE/118-180TCH-------------
Q0V871_ARATH/24-81NHP-------------
M4F9N3_BRARP/76-133NHE-------------
A9S0E7_PHYPA/16-72NH.-------------
M0X4S6_HORVD/138-199TCS-------------
U5FT31_POPTR/7-63EHP-------------
M1CMZ7_SOLTU/94-155VCK-------------
F6H3I5_VITVI/96-154NHE-------------
K4BIZ9_SOLLC/116-177TCN-------------
W5ET14_WHEAT/53-108QH.-------------
K7KVJ1_SOYBN/74-131THP-------------
U5GVF5_POPTR/157-215SHA-------------
I1LT43_SOYBN/160-216NHD-------------
WRK34_ARATH/178-234IHS-------------
M1D6V7_SOLTU/22-80NHE-------------
K4A5N4_SETIT/774-831NHD-------------
I1IR53_BRADI/286-342NHP-------------
M1DN19_SOLTU/86-144NHD-------------
W5FQQ6_WHEAT/917-977TCA-------------
B9RAC9_RICCO/80-137THS-------------
M7ZW64_TRIUA/111-170TC.-------------
U5GC56_POPTR/83-140NHD-------------
M0VMN8_HORVD/120-183TCH-------------
J3MMM2_ORYBR/273-330IHD-------------
A4S1F5_OSTLU/27-88TC.-------------
D7MKX1_ARALL/1146-1204NHP-------------
M0T0B0_MUSAM/207-264SHP-------------
I1PWM4_ORYGL/125-185TCS-------------
I1R3G5_ORYGL/139-200TCT-------------
F6GXW4_VITVI/171-231TCK-------------
M4CXB1_BRARP/69-126SHP-------------
D7MF96_ARALL/373-429TH.-------------
M1D7L8_SOLTU/129-186NCD-------------
J3MYJ7_ORYBR/269-325NHP-------------
C1EBM1_MICCC/10-63THA-------------
M1DBE7_SOLTU/170-228NHD-------------
K3Z832_SETIT/111-171TCR-------------
J3M860_ORYBR/133-194TCN-------------
M0VCG1_HORVD/220-278RHD-------------
K3ZIR4_SETIT/69-127NHD-------------
I1HSW1_BRADI/41-106TCR-------------
M7YP80_TRIUA/106-165TC.-------------
M0SP79_MUSAM/129-188TC.-------------
M0T4G9_MUSAM/121-181TCP-------------
M0U1R5_MUSAM/391-448NHE-------------
B9I7F0_POPTR/156-212NHP-------------
WRK50_ARATH/113-170NHS-------------
E1ZGV1_CHLVA/113-170THD-------------
B9RND6_RICCO/52-110NHP-------------
M4FA92_BRARP/266-323GHA-------------
K3ZT34_SETIT/82-138NHP-------------
M0U8S7_MUSAM/172-227NHD-------------
M0RX59_MUSAM/291-348NHP-------------
K3XLT9_SETIT/160-217NHP-------------
I1R3G9_ORYGL/27-91TCK-------------
A9TJH5_PHYPA/11-68SHQ-------------
E1ZGV1_CHLVA/4-61NHA-------------
D8R033_SELML/2-60NHP-------------
K4CG67_SOLLC/75-133NHQ-------------
M0TXJ2_MUSAM/6-66TCH-------------
M0S0M4_MUSAM/331-387NHE-------------
I1QTG0_ORYGL/63-124TCN-------------
W5FQQ6_WHEAT/802-862TCT-------------
M4C895_BRARP/99-159TCN-------------
C5X5M4_SORBI/126-186TCQ-------------
D7M935_ARALL/134-192NHE-------------
M4EPX7_BRARP/108-165EHD-------------
A9SRR4_PHYPA/11-68THQ-------------
E0CUJ8_VITVI/134-194TCT-------------
M0THF1_MUSAM/136-195TC.-------------
K7M259_SOYBN/132-192NCK-------------
W1NEF1_AMBTC/8-65SHP-------------
M4EPX6_BRARP/284-341NHP-------------
I1BSM4_RHIO9/209-264L..-------------
A8ITC4_CHLRE/117-174CHP-------------
C5Y3H4_SORBI/132-194TCN-------------
J3N5J0_ORYBR/148-214TC.-------------
M0U1R5_MUSAM/220-275NHD-------------
M1DVX5_SOLTU/167-225NHP-------------
K3ZIR4_SETIT/224-280NH.-------------
M8A8S6_TRIUA/118-178TCR-------------
K4AKU1_SETIT/30-91SCN-------------
D3BE88_POLPA/755-813NHE-------------
K4C166_SOLLC/129-185SC.-------------
WRK45_ARATH/65-122THA-------------
M4CDZ0_BRARP/106-165ICK-------------
C0PKA1_MAIZE/112-175TCT-------------
C5X581_SORBI/15-73TCD-------------
B9T4U8_RICCO/34-91NHT-------------
J3NA98_ORYBR/1018-1075TCT-------------
I1J5V4_SOYBN/175-231NHQ-------------
I1PTK2_ORYGL/147-208TCK-------------
I1HR78_BRADI/64-122NHS-------------
W5D9K8_WHEAT/68-128TCN-------------
T1MEI9_TRIUA/119-182KCQ-------------
C5X9Q6_SORBI/1354-1412SCD-------------
C1N120_MICPC/5-60NHE-------------

PF03615

Q5TQ16_ANOGA/3-143DHPKPE.SKTSGETRK
A7SSU8_NEMVE/11-147DHFRPQ.ARRATP...
Q17NS1_AEDAE/37-177DHPRPE.SKSSGETRK
M9PFC8_DROME/47-186DHPRPE.AKGSTEARR
GCM1_MOUSE/30-167DHPRPE.TKLEAEARR
K1PSK2_CRAGI/41-180DHPRPE.IKSSAEARR
C3ZI50_BRAFL/63-202DHPRPE.PKASAEARR
A0A068YFP9_ECHMU/176-311DHVKPT.TKALS....
G4VCV4_SCHMA/248-378DHIRPD.LKPV.....
Q8MMJ4_STRPU/66-206DHPRPDVVKTTSQAKL
W5NJR0_LEPOC/36-173DHPKPE.SKLEAEARK
B3MUW9_DROAN/83-223DHLRPD.PKNSSVSKR
D6WJ63_TRICA/26-165DHPRPE.AKSTSEARR
Q5TLZ9_DANRE/19-156DHPRPE.SKSETEARR
H3A2B3_LATCH/38-175DHPRPE.TKVEAEVRR
H2KV09_CLOSI/280-413DHNRPS.LKTF.....

PF08731

Q6BK98_DEBHA/21-107EL--------------
AFT2_CANAL/21-112VV--------------
AFT2_YEAST/51-137EL--------------
AFT1_YEAST/108-243QL--------------
Q6FS49_CANGA/15-125PL--------------
Q6CS78_KLULA/99-257PL--------------
Q6FSP0_CANGA/42-131PL--------------
Q755B2_ASHGO/89-206PL--------------

PF03108

Q2QMP0_ORYSJ/171-237----------------
Q9C702_ARATH/177-243----------------
Q0D1G9_ASPTN/6-73----------------
Q0DAT1_ORYSJ/144-210----------------
I1Q5U8_ORYGL/402-465----------------
I1QDU7_ORYGL/128-194----------------
M4FGM2_BRARP/194-256----------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window