Sequence alignment for CL0276

PF00990

Q55906_SYNY3/600-758---------SLRDPLTKLFN-RRYLEQRLSQELARA.KR...HHYSVGVLMIDVDHFKRFNDSLG-------HDAGDRIL
Y4LL_RHISN/399-555---------ARHDALTGLPN-RQFLREEFERLSDHIAP.....STRLAILCLDLDGFKAINDAYG-------RATGDLLL
YEGE_ECOLI/682-839---------ASHDALTHLAN-RASFEKQLRILLQTVNST....HQRHALVFIDLDRFKAVNDSAG-------HAAGDALL
YTRP_BACSU/423-571---------VKTDQLTELYS-RAYLDEKIQYSMKIH........QKGVFILVDIDNFKNVNDTYG-------HQTGDEIL
P74658_SYNY3/110-271---------LNLDSLTQVSN-RRHFDLHLAQQWERA.MD...SQEAIALILCDIDHFKQFNDFYG-------HLSGDDCL
P74197_SYNY3/340-500---------SHHDSLTCLPN-RRSLALFLENLHQNVHGRNNSDDQAFALLMLDLNKFKSINDRFG-------HLFGDKVL
P72790_SYNY3/288-449---------ANIDGLTHIAN-RRRFDEYLAQEWQRH.CR...EQKPLSLILVDIDYFKAYNDLYG-------HQKGDDCL
P72746_SYNY3/429-586---------ALYDPISKLPN-RVNLQKELSLAIDAAAHH....QHLMGVMFIHLEILNRINQAYG-------FGFGDEVF
YNEF_ECOLI/146-304---------ADFDFLTQVYS-RSGLYEALKSPSLKQ..T.....QHLTVMLLDIDYFKSINDNYG-------HECGDKVL
YEAP_ECOLI/174-331---------SYTDSLTGLPN-RRAIFENLTTLFSLARHL..N..HKIMIAFIDLDNFKLINDRFG-------HNSGDLFL
YEAI_ECOLI/328-485---------AVHDVLTNIYN-RRYFFNSVESLLSRP.VV...KDFCV..MLVDINQFKRINAQWG-------HRVGDKVL
PHY2_SYNY3/1100-1260---------SSLDALTQVGN-RYLFDSTLEREWQRL.QR...IREPLALLLCDVDFFKGFNDNYG-------HPAGDRCL
P73011_SYNY3/292-453---------AIYDELTQIPN-RRYFTSYLEQEWRQC.LR...QKSPISLILCDVDYFKNYNDLYG-------HQMGDKCL
P72956_SYNY3/314-475---------ANMDGLTGIAN-RRYLDHFLEQQWQKL.AK...HHQYLSLILCDIDFFKQYNDTYG-------HLEGDECL
Y1895_SYNY3/263-420---------AFYDPLTDLPN-RFLFKQELGKVLSNVQNQ....SSVLGLVLLGFRELQSLNDLLG-------HSVADEVL
YDEH_ECOLI/129-283---------SNMDVLTGLPG-RRVLDESFDHQLRNA......EPLNLYLMLLDIDRFKLVNDTYG-------HLIGDVVL
P73036_SYNY3/149-310---------AKVDQLTQLAN-RRQLELFLDTEWSEA.IR...EQYPFSILLCDIDYFKNYNDHYG-------HQGGDDCL
P74400_SYNY3/1150-1312---------AYYDPLTALPN-RRLLLDRAENALALA.QR...SKHFGAIVLIDLDGFKTLNDARG-------HDSGDRLL
YKOW_BACSU/372-530---------AHYDSLTDLPN-RRHAISHLTKVLNRE.HS...LHYNTVVFFLDLNRFKVINDALG-------HNVGDQLL
P72809_SYNY3/414-576---------AHIDGLTRIPN-RRYFEQQFAEEWQIF.LG...RGKSLTVMMVDVDHFKLYNDHYG-------HSQGDICL
P73272_SYNY3/180-338---------AMVDSLTRLWN-RLGIETLLKREWEYA.TR...KNSPISIVMIDFDNFKQINDQHG-------HLVGDEVL
GMR_ECOLI/237-391---------ANTDSITGLPN-RNAMQDLIDHAINHA......DNNKVGVVYLDLDNFKKVNDAYG-------HLFGDQLL
P72747_SYNY3/273-430---------TFYDPMTGLPN-HAFFEEQLAIALAKVQRD....QSRLAILFLNFYNYERMINAFG-------LGCGEILL
Q55955_SYNY3/706-867---------TQIDGLTGVYN-RRFFDQALEREWQIA.FR...ETESLTLVMLDIDYFKLYNDTLG-------HQAGDHCL
DOSC_ECOLI/295-452---------VGMDVLTKLLN-RRFLPTIFKREIAHA.NR...TGTPLSVLIIDVDKFKEINDTWG-------HNTGDEIL
Q55414_SYNY3/653-814---------IDIDGLTKIAN-RRCFNVRIKQEWRRL.SR...AQVPISLIMFDIDCFKNYNDRYG-------HPEGDLCL
YDAK_BACSU/132-281---------VAVDRVTGFDN-KQRMKLELSEEIKRAERY....GNSFVFLLLHMHYFKEFKSLYG-------EKETDRLF
YCDT_ECOLI/282-439---------AHRDPLTNIFN-RNYFFNELTVQSASA.QK...TPYCV..MIMDIDHFKKVNDTWG-------HPVGDQVI
YHCK_BACSU/192-351---------AHFDFLTGVYN-RRKFEETTKALYQQAADT...PHFQFALIYMDIDHFKTINDQYG-------HHEGDQVL
Q55576_SYNY3/795-953---------ANHDSLTNLPN-RSMFLDRLGHALQRNLRR...RDLRFAVLFLDLDGFKIINDSLG-------HSCGDLLL
P72748_SYNY3/162-319---------SYLDTATDLPN-QTLFLEYLNIALSNARRH....HAQVGVLLCQINNWSDLKRKRG-------DAVANAFL
CSRD_ECOLI/224-381---------AAQDVKTGLNN-RLFFDNQLATLLEDQ.EK...VGTHGIVMMIRLPDFNMLSDTWG-------HSQVEEQF
PLED_CAUCR/289-448---------AVTDQLTGLHN-RRYMTGQLDSLVKRATLG....GDPVSALLIDIDFFKKINDTFG-------HDIGDEVL
ADRA_ECOLI/210-366---------STRDGMTGVYN-RRHWETMLRNEFDNC.RR...HNRDATLLIIDIDHFKSINDTWG-------HDVGDEAI
PHY2_SYNY3/431-592---------TAYDPLTQLPN-WIIFNRQLTLALLDALYE..G..KMVGVLVIAMDRFKRINESFG-------HKTGDGLL
YEDQ_ECOLI/398-557---------AWHDTLTRLYN-RGALFEKARPLAKLCQT....HQHPFSVIQVDLDHFKAINDRFG-------HQAGDRVL
P72843_SYNY3/410-567---------AHYDHLTGLPN-RILAKDRLQQAIESA.LR...QKHIFGLMFLDLDNFKKVNDTLG-------HDAGDQLL
YEAJ_ECOLI/344-495---------NISDAMTGLYN-RKILTPELEQRLQKLVQS....GSSVMFIAIDMDKLKQINDTLG-------HQEGDLAI
P73380_SYNY3/304-462---------ALHDTLTGLAN-RALLLQRLEFAGHQIKNN...PKSRFALLFIDLDHFKLINDSWG-------HSVGDALL
YFIN_ECOLI/249-405---------ALHDPLTGLAN-RAAFRSGINTLMNNSDAR.....KTSALLFLDGDNFKYINDTWG-------HATGDRVL
P73713_SYNY3/801-959---------SIRDPLTGLFN-RRYLEQFFLQEIGRA.KR...YNHSIGVIMGDIDHFKQFNDQLG-------HDAGDHVL
YDAM_ECOLI/253-406---------AHHDAMTGLLN-RRQFYHITEPGQMQH.LA...IAQDYSLLLIDTDRFKHINDLYG-------HSKGDEVL
Y1354_MYCTU/184-338---------ADHDDLTGLHN-RRALLQHLDQRLAPG......QPGPVAALFLDLDRLKAINDYLG-------HAAGDQFI
Q7AQ57_MYCLE/393-549---------AAHDTLTGLPN-RTSILARIDEQRYCG.AP...DQLLTAVLFIDLDNFKGINDSLG-------HDVGDVVL
Q9CCU8_MYCLE/141-296---------ATHDCLTGLAN-RRFAEDQITKSLQHD.ER....SRLAAVLLLDLDDFKVINDSLG-------HDVGDAVL

PF00211

ADCY1_BOVIN/296-480------IYIQRHDNVSILFA-DIVGFTGLASQCT....A----QELVKLLNELFGKFDELATENH...CRRIKILGDCYY
CYAG_DICDI/387-572------VVAERSNNACVFFL-DIAGFTRFSSIHS....P----EQVIQVLIKIFNSMDLLCAKHG...IEKIKTIGDAYM
GCYB2_RAT/399-582------VAAGEFETCTILFS-DVVTFTNICAACE....P----IQIVNMLNSMYSKFDRLTSVHD...VYKVETIGDAYM
CYAA_DICDI/1180-1356------VYVQPHQDVSIMFI-QIAGFQEYDE.......P----KDLIKKLNDIFSFFDGLLNQKYGGTVEKIKTIGNTYM
GUC2C_HUMAN/815-1002------VEPELYEEVTIYFS-DIVGFTTICKYST....P----MEVVDMLNDIYKSFDHIVDHHD...VYKVETIGDAYM
ADCY9_MOUSE/385-573------FKMQQIEEVSILFA-DIVGFTKMSANKS....A----HALVGLLNDLFGRFDRLCEQTK...CEKISTLGDCYY
ADCY3_RAT/310-494------MYMYRHENVSILFA-DIVGFTQLSSACS....A----QELVKLLNELFARFDKLAAKYH...QLRIKILGDCYY
ADCY3_RAT/914-1121------LYSQSYDEIGVMFA-SLPNFADFYTEESINNGG----IECLRFLNEIISDFDSLLDNPKFRVITKIKTIGSTYM
GCYH_DROME/457-647------IDAKTYPDVTILFS-DIVGFTSICSRAT....P----FMVISMLEGLYKDFDEFCDFFD...VYKVETIGDAYC
ADCY1_BOVIN/862-1059------LYYQSYSQVGVMFA-SIPNFNDFYIELDGNNMG----VECLRLLNEIIADFDELMDKDFYKDLEKIKTIGSTYM
ANPRA_HUMAN/867-1053------VQAEAFDSVTIYFS-DIVGFTALSAEST....P----MQVVTLLNDLYTCFDAVIDNFD...VYKVETIGDAYM
ADCY2_HUMAN/878-1078------LYHQSYDCVCVMFA-SIPDFKEFYTESDVNKEG----LECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYM
GCY1_CAEEL/889-1077------VEPEGFDSVTVFFS-DVVKFTILASKCS....P----FQTVNLLNDLYSNFDTIIEQHG...VYKVESIGDGYL
CYAA_SCHPO/1323-1519------EVSPPKGCIAMVFT-DIKNSTLLWERH.....P----IAMRSAIKTHNTIMRRQLRATG...GYEVKTEGDAFM
GCYA1_BOVIN/473-660------VQAKRFGNVTMLFS-DIVGFTAICSQCS....P----LQVITMLNALYTRFDRQCGELD...VYKVETIGDAYC
ADCY8_HUMAN/973-1172------LYSQSYDAVGVMFA-SIPGFADFYSQTEMNNQG----VECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYM
GCYB1_BOVIN/412-605------VPAKRYDNVTILFS-GIVGFNAFCSKHASGEGA----MKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYM
E3FCG3_STIAD/222-407------..SPELREVTLLFA-DIRDFTSLSERLR....P----EQVVTLLNEYYGRMVEVVFRHG...GTLDKFIGDALM
K9ZFA5_ANACC/301-486------..AASTRRMTILFC-DIRGYTSMSEAME....P----IEIFRFLNDYLACMGKAIDEAG...GFIDKYIGDAIM
Q581E2_TRYB2/896-1107------.PKEPTDPVTLIFT-DIESSTALWAAH.....P----ELMPDAVATHHYLIRSLIGRYK...CYEVKTVGDSFM

PF05165

GCH3_AERPE/15-241V.........GYREWTEELGSDREWIIQTLQSDIYAAAQKEAAGYGGFVLPIRYDIMLLISSNMG-------VQEHARVL
GCH3_METJA/1-250MIQITVIQIDNYGPWTVTPNPRRESDLQALQSRLYADLNLMFGAHKGLVFYTRFDNLIAITNGID-------LITHKRIQ
GCH3_METTH/1-249MIQMTLIQIDNYGPWTVTPTPRNEADLQIMQAELYADLQRQFAARQGLVFFTRFDNMLAVTNGMD-------LEDHRRIQ
GCH32_HALSA/1-253M...AAVQIDDYGPWTTEPAPRRETDLQALQARLFADVADFLGGRDGYAFAGRFDNMVGAATGIA-------PAAFERLQ

PF00990

Q55906_SYNY3/600-758ASIGTL-----------------LKNNIRT....SDVACRYGGEEITIILPDATLE.-----------------------
Y4LL_RHISN/399-555RHVTER-----------------LRNFLKQ....SDILCRLSGDEFVVLRVGINSN.-----------------------
YEGE_ECOLI/682-839RELASL-----------------MLSMLRS....SDVLARLGGDEFGLLLPDCNVE.-----------------------
YTRP_BACSU/423-571IQVASV-----------------IKSNIRK....HDVGARWGGEELAIYLPNVPVA.-----------------------
P74658_SYNY3/110-271RRIAKT-----------------LSATLRN...PFDLFARYGGEEFGVILPQVTSE.-----------------------
P74197_SYNY3/340-500QRVAEI-----------------LLECVRD....GDQVARLSGDEFIIVLKSTK...-----------------------
P72790_SYNY3/288-449QKVANT-----------------LVDIAKR...ITDLVARYGGEEFVIVLPNTNRQ.-----------------------
P72746_SYNY3/429-586MAFHGA-----------------ISDCMRS....GDTVGQWDSNTLVIILAKIKSP.-----------------------
YNEF_ECOLI/146-304SVFARH-----------------IQKIVGD....KGLVARMGGEEFAVAVPSVN.P.-----------------------
YEAP_ECOLI/174-331IQVGER-----------------LNTLQQN....GEVIGRLGGDEFLVVSLNNEN..-----------------------
YEAI_ECOLI/328-485VSIVDI-----------------IQQSIRP....DDILARLEGEVFGLLFTELNSA.-----------------------
PHY2_SYNY3/1100-1260KKIADA-----------------MAKVAKR...PTDLVARYGGEEFAIILSETSLE.-----------------------
P73011_SYNY3/292-453QSVAKV-----------------IQNALKR...PSDVLARYGGEEFIVILPYTDQS.-----------------------
P72956_SYNY3/314-475KKVANL-----------------LKKVMRR...GTDLTARYGGEEFALVLPQTNKQ.-----------------------
Y1895_SYNY3/263-420KIITER-----------------LSAHVRL....EDLLCRWRGDTFILLIQSCRN..-----------------------
YDEH_ECOLI/129-283RTLATY-----------------LASWTRD....YETVYRYGGEEFIIIVKAANDE.-----------------------
P73036_SYNY3/149-310QQVAKA-----------------LTRVVHR...PKDLAARYGGEEFLIVLPNTDLQ.-----------------------
P74400_SYNY3/1150-1312QMVAKR-----------------LADSLRD....SDTVARLGGDEFIVLLPELAHDR-----------------------
YKOW_BACSU/372-530QFAAKR-----------------LSSVVPD....NGFIARLGGDEFIIILTDANT..-----------------------
P72809_SYNY3/414-576AEIAQI-----------------LQCCIRQP..GSDFVARYGGEEFVLVLPEVDQF.-----------------------
P73272_SYNY3/180-338QGSARL-----------------IISVLRS....YDILGRWGGDEFMLILPGSGRE.-----------------------
GMR_ECOLI/237-391RDVSLA-----------------ILSCLEH....DQVLARPGGDEFLVLASNTS...-----------------------
P72747_SYNY3/273-430KTVAKR-----------------LSQWTEK....RGLACRWQGKQFAILLKEPGDN.-----------------------
Q55955_SYNY3/706-867RIVAAI-----------------LQESVHR...TSDLVARYGGEEFALILPRTDLS.-----------------------
DOSC_ECOLI/295-452RKVSQA-----------------FYDNVRS....SDYVFRYGGDEFIIVLTEASEN.-----------------------
Q55414_SYNY3/653-814IRVAQA-----------------ARKAASR...PADLVARFGGEEFAVLLPETDTK.-----------------------
YDAK_BACSU/132-281QYVGQQ-----------------IRTSVRE....TDKKFRPSDERIGIVLTHTP...-----------------------
YCDT_ECOLI/282-439KTVVNI-----------------IGKSIRP....DDLLARVGGEEFGVLLTDIDTE.-----------------------
YHCK_BACSU/192-351KELGLR-----------------LKQTIRN....TDPAARIGGEEFAVLLPNCSLD.-----------------------
Q55576_SYNY3/795-953QGIAHR-----------------LRQCLRP....EDTLARLGGDEFTMLIENIT...-----------------------
P72748_SYNY3/162-319QEAGQK-----------------LKSNLRN....GDIVSRWDKDEFIFLVSKVQDT.-----------------------
CSRD_ECOLI/224-381FTLTNL-----------------LSTFMMRY..PGALLARYHRSDFAALLPHRTLK.-----------------------
PLED_CAUCR/289-448REFALR-----------------LASNVRA....IDLPCRYGGEEFVVIMPDTALA.-----------------------
ADRA_ECOLI/210-366VALTRQ-----------------LQITLRG....SDVIGRFGGDEFAVIMSGTPAE.-----------------------
PHY2_SYNY3/431-592QEVADR-----------------LNQKLSPLAAYSPLLSRWHGDGFTILLTQISDN.-----------------------
YEDQ_ECOLI/398-557SHAAGL-----------------ISSSLRA....QDVAGRVGGEEFCVILPGASLT.-----------------------
P72843_SYNY3/410-567VEVSER-----------------LQRALRQ....TDTVARLGGDEFLIILDQVS...-----------------------
YEAJ_ECOLI/344-495TLLAQA-----------------IKQSIRK....SDYAIRLGGDEFCIILVDSTPQ.-----------------------
P73380_SYNY3/304-462IKIAEK-----------------LQINLRE....TDLAVRLGGDEFVIFLESIT...-----------------------
YFIN_ECOLI/249-405IEIAKR-----------------LAEFGGL....RHKAYRLGGDEFAMVLYDVQSE.-----------------------
P73713_SYNY3/801-959KTIGRI-----------------LQSNIRG....SDIACRYGGEEMTIVLPQTSLE.-----------------------
YDAM_ECOLI/253-406CALART-----------------LESCARK....GDLVFRWGGEEFVLLLPRTPLD.-----------------------
Y1354_MYCTU/184-338HVFAQR-----------------IGDALVG....ESLIARLGGDEFVLI.PASPM..-----------------------
Q7AQ57_MYCLE/393-549QTAAQR-----------------LRAGLRS....RDVVGRFGGDEFVALILGKITH.-----------------------
Q9CCU8_MYCLE/141-296QTVAQR-----------------LRSAVRP....DDVVARLGGDEFIVLLRGPLSD.-----------------------

PF00211

ADCY1_BOVIN/296-480CVSGLT..................QPKTDH----AHCCVEMGLDMIDTI.TSVAEAT....E..................
CYAG_DICDI/387-572ATCGIFP...............KCDDIRHN----TYKMLGFAMDVLEFIPKEMSFH........................
GCYB2_RAT/399-582VVGGVP..................VPVESH----AQRVANFALGMRISA.KEVMNPVT..G...................
CYAA_DICDI/1180-1356AVSGLD...................GSPSF----LEKMSDFALDVKAYT.NSVAISR.......................
GUC2C_HUMAN/815-1002VASGLP.................KRNGNRH----AIDIAKMALEILSFM.GTFELEHL..PG..................
ADCY9_MOUSE/385-573CVAGCP..................EPRADH----AYCCIEMGLGMIKAI.EQFCQEK....K..................
ADCY3_RAT/310-494CICGLP..................DYREDH----AVCSILMGLAMVEAI.SYVREKT....K..................
ADCY3_RAT/914-1121AASGVTPDVNTNGFTSSSKEEKSDKERWQH----LADLADFALAMKDTL.TNINNQS....F..................
GCYH_DROME/457-647VASGLH..................RASIYD----AHKVAWMALKMIDACSKHITHDG.......................
ADCY1_BOVIN/862-1059AAVGLAPTAG..........TKAKKCISSH----LSTLADFAIEMFDVL.DEINYQS....Y..................
ANPRA_HUMAN/867-1053VVSGLP.................VRNGRLH----ACEVARMALALLDAV.RSFRIRHR..PQ..................
ADCY2_HUMAN/878-1078AATGLSAVPSQ.......EHSQEPERQYMH----IGTMVEFAFALVGKL.DAINKHS....F..................
GCY1_CAEEL/889-1077CVSGLP.................TRNGYAH----IKQIVDMSLKFMEYC.KSFNIPHL..PR..................
CYAA_SCHPO/1323-1519VCFQTV.....................PAA----LLWCFSVQLQLLSADWPNEIVESV..QGRLVLGS............
GCYA1_BOVIN/473-660VAGGLH..................KESDTH----AVQIALMALKMMELSHEVVSPHG.......................
ADCY8_HUMAN/973-1172AVSGLSPEK............QQCEDKWGH----LCALADFSLALTESI.QEINKHS....F..................
GCYB1_BOVIN/412-605TVSGLP..................EPCIHH----ARSICHLALDMMEIA.GQVQVDG.......................
E3FCG3_STIAD/222-407VYFGAP..................IADPAH----ARRGVQCALDMVQEL.ETVNALRSARGE..................
K9ZFA5_ANACC/301-486ALFDDG.................NTDCALH----AAILMQQALDKFNDE.RSMQTGKT..GL..................
Q581E2_TRYB2/896-1107IASKSP.....................FAA----VQLAQELQLCFLQHDWGTNAVDD....SYQQFEQQRAEEDEKYTPP

PF05165

GCH3_AERPE/15-241DAIAGL-----------------SKVKVRM----ASYCGVKPLDAVERAWNALRRREERLIYERCE............GE
GCH3_METJA/1-250ESIRNR-----------------YPFTVSM----VIASAETPYEAQKLATETLQEYGSAQDENRKEVLDVANEL...VVD
GCH3_METTH/1-249KSIGNR-----------------YPITVSM----GVGAAETPYDAQRNASRALQSHGGAQSEERKEVLAI.DGL...VDE
GCH32_HALSA/1-253ERIRNR-----------------YPVTVSV----GIGTARTPADALDAAGTALRDAGSAQDENRQEALSHRSPPGFAGTP

PF00990

Q55906_SYNY3/600-758-------------..EASQKAEFLRQAIAEMKIEY.SGKIV-------------------------------NS.VTASF
Y4LL_RHISN/399-555-------------....AEARLLAQQLIDVIEAPY.ELAGT-------------------------------HVDLQVVV
YEGE_ECOLI/682-839-------------..SARFIATRIISAVNDYHFIW.EGRVH-------------------------------R..VGASA
YTRP_BACSU/423-571-------------..VGKRITERLVYAVRKNTKP.......-------------------------------E..VTISC
P74658_SYNY3/110-271-------------..AAQQIAKRMQASLTMLEIPH.HHSPT-------------------------------SEFVTMSF
P74197_SYNY3/340-500-------------..SGDDAKKCADRIHRLFSRPL.TMEGI-------------------------------QLLISTSI
P72790_SYNY3/288-449-------------..DALAMAENMLQAIAALAIPH.EGSSV-------------------------------SKYVTISI
P72746_SYNY3/429-586-------------....QDSIRLAERILDRLKNPI.TVRER-------------------------------EFIFNINI
YNEF_ECOLI/146-304-------------.VDGLLMAEKIRKGVELQPFTW.QQKTL-------------------------------YLTVSIGV
YEAP_ECOLI/174-331-------------...ADISSLRERIQQQIRGEYH.LGDVD-------------------------------LYYPGASL
YEAI_ECOLI/328-485-------------..QAKIIAERMRKNVELLTGFS.NRYDV-------------------------------PEQMTISI
PHY2_SYNY3/1100-1260-------------..GAINVTEALQVEVANLAIPH.TVSGT-------------------------------G.HVTLSI
P73011_SYNY3/292-453-------------..GAYTVGQRIHHCLAEAQISH.ADSPT-------------------------------SRYLTISL
P72956_SYNY3/314-475-------------..GCQNVVIHLQSVFKQAQIPH.RSSII-------------------------------QPYLTLSI
Y1895_SYNY3/263-420-------------...LDEIEVFVRRLLAVLKRPF.FIANN-------------------------------PLYLQGYA
YDEH_ECOLI/129-283-------------..EACRAGVRICQLVDNHAITH.SEGHI-------------------------------N..ITVTA
P73036_SYNY3/149-310-------------..GAIHIGEDIQAEITRLAIPH.VQSAI-------------------------------ADHVTLSI
P74400_SYNY3/1150-1312-------------ELAARLGLGVGEKIRQALATPF.TLEAE-------------------------------QVQISGSI
YKOW_BACSU/372-530-------------..GTGEADVLARKIIQKFKKPF.KIQDH-------------------------------TLVTSVSI
P72809_SYNY3/414-576-------------..GAIAIAQRIKTALQTRNISH.HAVDL-------------------------------AGNVTCSI
P73272_SYNY3/180-338-------------..QTAVLLERIQATIAQNPVPT.SAGPM-------------------------------A..ISLSM
GMR_ECOLI/237-391-------------...QSALEAMASRILTRLRLPF.RIGLI-------------------------------EVYTSCSV
P72747_SYNY3/273-430-------------....QALTEMVKEMLAMLEESI.DVAKQ-------------------------------KIHLKGKV
Q55955_SYNY3/706-867-------------..GAVIVAQRIKTLMDAKAISH.PTSEI-------------------------------ANYVTVSI
DOSC_ECOLI/295-452-------------..ETLRTAERIRSRVEKTKL.K.AANGE-------------------------------DIALSLSI
Q55414_SYNY3/653-814-------------..GAIMVAEKIIQAISQLAIAH.EASPI-------------------------------SGQITISL
YDAK_BACSU/132-281-------------....AEHMPAVLTKLKKQLDTY.QLE.N-------------------------------GKYVSLTF
YCDT_ECOLI/282-439-------------..RAKALAERIRENVERLTGDN.PEYAI-------------------------------PQKVTISI
YHCK_BACSU/192-351-------------..KAARIAERIRSTVSDAPIVL.T.NGD-------------------------------ELSVTISL
Q55576_SYNY3/795-953-------------..CPEDVIAVAQRIHQELQKPF.NLNGQ-------------------------------EIFTNTSI
P72748_SYNY3/162-319-------------....SSLLGIAQRLMKPVLAPV.TAGGR-------------------------------PFQPEITY
CSRD_ECOLI/224-381-------------.....EAESIAGQLIKAVDTLP.NNKML-------------------------------DRDDMIHI
PLED_CAUCR/289-448-------------..DALRIAERIRMHVSGSPFTV.AHGRE-------------------------------MLNVTISI
ADRA_ECOLI/210-366-------------..SAITAMLRVHEGLNTLRLP....NTP-------------------------------QVTLRISV
PHY2_SYNY3/431-592-------------....QEMIPLCERLLSTFQEPF.FLQGQ-------------------------------PIYLTASM
YEDQ_ECOLI/398-557-------------..EAAEVAERIRLKLNEKEMLI.AKSTT-------------------------------IR.ISASL
P72843_SYNY3/410-567-------------..HSRKLMAIAQRLLRVMRQPV.NLQGL-------------------------------EFFVHGSI
YEAJ_ECOLI/344-495-------------..IAAQLPERIEKRLQHIAPQK.E....-------------------------------IG...FSS
P73380_SYNY3/304-462-------------..EIKQAIDVAERILIHLRLPV.QIQAK-------------------------------ELFVKASI
YFIN_ECOLI/249-405-------------....SEVQQICSALTQIFNLPFDLHNGH-------------------------------QTTMTLSI
P73713_SYNY3/801-959-------------..DTLVKAESLRQAIASMEVEY.KGKEL-------------------------------GT.LTVSL
YDAM_ECOLI/253-406-------------..TALSLAETIRVSVAKVSI.....SGL-------------------------------PR.FTVSI
Y1354_MYCTU/184-338-------------..SADAAQPLAERLRDQLKDHV.AIGGE-------------------------------VLTRTVSI
Q7AQ57_MYCLE/393-549-------------....TELSKVVDRMHAALSEPT.YVADA-------------------------------VLHLRASI
Q9CCU8_MYCLE/141-296-------------....MNANDVAKRLHTTLSESL.VVDQL-------------------------------TVPIGASV

PF00211

ADCY1_BOVIN/296-480.............VDLNMRVGLHTGRVLCGVLG..-LRKWQ-------------------------------YDVWSNDV
CYAG_DICDI/387-572.............LGLQVRVGIHCGPVISGVIS.G-YAKPH-------------------------------FDVWGDTV
GCYB2_RAT/399-582.............EPIQIRVGIHTGPVLAGVVG..-DKMPR-------------------------------YCLFGDTV
CYAA_DICDI/1180-1356................VVRIGISHGPLVAGCIG..-ISRAK-------------------------------FDVWGDTA
GUC2C_HUMAN/815-1002.............LPIWIRIGVHSGPCAAGVVG..-IKMPR-------------------------------YCLFGDTV
ADCY9_MOUSE/385-573.............EMVNMRVGVHTGTVLCGILG..-MRRFK-------------------------------FDVWSNDV
ADCY3_RAT/310-494.............TGVDMRVGVHTGTVLGGVLG..-QKRWQ-------------------------------YDVWSTDV
ADCY3_RAT/914-1121.............NNFMLRIGMNKGGVLAGVIG..-ARKPH-------------------------------YDIWGNTV
GCYH_DROME/457-647.............EQIKMRIGLHTGTVLAGVVG..-RKMPR-------------------------------YCLFGHSV
ADCY1_BOVIN/862-1059.............NDFVLRVGINVGPVVAGVIG..-ARRPQ-------------------------------YDIWGNTV
ANPRA_HUMAN/867-1053.............EQLRLRIGIHTGPVCAGVVG..-LKMPR-------------------------------YCLFGDTV
ADCY2_HUMAN/878-1078.............NDFKLRVGINHGPVIAGVIG..-AQKPQ-------------------------------YDIWGNTV
GCY1_CAEEL/889-1077.............ENVELRIGVNSGPCVAGVVG..-LSMPR-------------------------------YCLFGDTV
CYAA_SCHPO/1323-1519.......KNEVLYRGLSVRIGVNYGVTVSELD...-PITRR-------------------------------MDYYGPVV
GCYA1_BOVIN/473-660.............EPIKMRIGLHSGSVFAGVVG..-VKMPR-------------------------------YCLFGNNV
ADCY8_HUMAN/973-1172.............NNFELRIGISHGSVVAGVIG..-AKKPQ-------------------------------YDIWGKTV
GCYB1_BOVIN/412-605.............ESVQITIGIHTGEVVTGVIG..-QRMPR-------------------------------YCLFGNTV
E3FCG3_STIAD/222-407.............PCLRIGVGVHTGPAVLGNIGSA-TRRLE-------------------------------YTAIGDTV
K9ZFA5_ANACC/301-486.............PRISVGIGIHRGTVVMGTVG.F-TSRID-------------------------------STVIGDAV
Q581E2_TRYB2/896-1107TARLDLKVYSRLWNGLRVRVGIHTGLCDIRHD...-EVTKG-------------------------------YDYYGRTP

PF05165

GCH3_AERPE/15-241EYTAIAHIDLNNVT.AITRAEGPVRTYYEVMDLMAKISKVA.EKIGAITQYLGGDNILA.........VLPLNGSVKETV
GCH3_METJA/1-250GYVQIAHIDINNITGTLTDIVSAYDTYLNVNKVKLALMEEL.LKYNALLFFIGGDNFMAPSNGMSEEDFLDIFNRINKKY
GCH3_METTH/1-249GYVQIAHIDINGITETMTDIVPAYDTSFIVNRVQHFLMKKL.IKEGALLFFIGGDNFMSPCNGLEPQGLLRIINEIDDEI
GCH32_HALSA/1-253GAVTIAHFDVVDATGTYTDTVSPVRAGTEIQGAVTTLAEYLYDTHDAVTQFVGGDNAIAVCPEIDAGIVDDATAHVREAA

PF00990

Q55906_SYNY3/600-758GV-----ACY..PDHGETGQEIIQIADKALYDAK---------------QAGRNR-------------------------
Y4LL_RHISN/399-555GL-----AAA..SKSDQSLDELIKTADIALERAK---------------TGGGGT-------------------------
YEGE_ECOLI/682-839GI-----TLID..DNNHQAAEVMSQADIACYASK---------------NGGRGR-------------------------
YTRP_BACSU/423-571GI-----SCWT.TETKKSLKELVHEADEALYSAK---------------RSGKNR-------------------------
P74658_SYNY3/110-271GI-----GRLY.PQPGQLPLDLIAQADENLYKAK---------------RQGRNC-------------------------
P74197_SYNY3/340-500GI-----VIS..NYEQFDYDRLIDYADTAMYEAK---------------RNG.EL-------------------------
P72790_SYNY3/288-449GV-----SSII.PMPEDTIERIISEADQALYSAK---------------SQGRNR-------------------------
P72746_SYNY3/429-586GI-----SAYP..NDGNRAEDLLSRANAALQKLR---------------QTGFNH-------------------------
YNEF_ECOLI/146-304GS-----GRASYLTLTDDFNKLMVEADTCLYRSK---------------KDGRNR-------------------------
YEAP_ECOLI/174-331GI-----VEVD..PETTDADSALHAADIAMYQEK---------------KHKQKT-------------------------
YEAI_ECOLI/328-485GT-----VFS..TGDTRNISLVMTEADKALREAK---------------SEGGNK-------------------------
PHY2_SYNY3/1100-1260GI-----AVYT.PERHINPNALVKAADLALYEAK---------------AKGRNQ-------------------------
P73011_SYNY3/292-453GI-----GTTV.PLLHYHPSDLIKIADQALYAAK---------------AAGRNQ-------------------------
P72956_SYNY3/314-475GS-----ATMV.PLPNVPPKQLIDWADQALFKAK---------------KAGRNC-------------------------
Y1895_SYNY3/263-420GI-----ACYP..NHGDNVEILLNRVGIALNEVK---------------DIGSRQ-------------------------
YDEH_ECOLI/129-283GV-----SRA...FPEEPLDVVIGRADRAMYEGK---------------QTGRNR-------------------------
P73036_SYNY3/149-310GC-----ASTI.PRLGSDWGKLVGAADQYLYEAK---------------AQGRNR-------------------------
P74400_SYNY3/1150-1312GI-----TLF..PKLNEKVSDLFKEADTAMYQAK---------------KAGRDK-------------------------
YKOW_BACSU/372-530GI-----AIS..PKDGTDGLELMKKADMAMYAAK---------------ERNKSK-------------------------
P72809_SYNY3/414-576GI-----AVAH.SRFASSKETLLKQADQALYCAK---------------QAGRNQ-------------------------
P73272_SYNY3/180-338GG-----VSVF.TNQGEALQYWVEQADNQLMKVK---------------RLGKGN-------------------------
GMR_ECOLI/237-391GI-----ALS..PEHGSDSTAIIRHADTAMYTAK---------------EGGRGQ-------------------------
P72747_SYNY3/273-430GI-----AVYP..DGGTDGATLLKNSHTALEQIK---------------EKHFDS-------------------------
Q55955_SYNY3/706-867GI-----HCAV.PRPGLSLASWVKCADDALYQAK---------------KRGRNG-------------------------
DOSC_ECOLI/295-452GA-----AMF...NGHPDYERLIQIADEALYIAK---------------RRGRNR-------------------------
Q55414_SYNY3/653-814GI-----GTQF.PSKELISRTLIKQADMALYEAK---------------RRGRNQ-------------------------
YDAK_BACSU/132-281HV-----CYLP....YRN...DIQTADQFLEELE---------------NEMMMN-------------------------
YCDT_ECOLI/282-439GA-----VVT..QENALNPNEIYRLADNALYEAK---------------ETGRNK-------------------------
YHCK_BACSU/192-351GA-----AHY..PNNTEQPGSLPILADQMLYKAK---------------ETGRNR-------------------------
Q55576_SYNY3/795-953GI-----ALN..HPHYGHPQDVLRDADTAMYRAK---------------AAGKGR-------------------------
P72748_SYNY3/162-319GV-----ALYP..VDGEQVNDLIGHIRENLQQLL---------------PQPTNP-------------------------
CSRD_ECOLI/224-381GI-----CAWR...SGQDTEQVMEHAESATRNAG---------------LQGGNS-------------------------
PLED_CAUCR/289-448GV-----SAT..AGEGDTPEALLKRADEGVYQAK---------------ASGRNA-------------------------
ADRA_ECOLI/210-366GV-----APLN..PQMSHYREWLKSADLALYKAK---------------KAGRNR-------------------------
PHY2_SYNY3/431-592GI-----STAP..YDGETAESLLKFAEIALTRAK---------------CQGKNT-------------------------
YEDQ_ECOLI/398-557GV-----SSSE.ETGDYDFEQLQSLADRRLYLAK---------------QAGRNR-------------------------
P72843_SYNY3/410-567GI-----TVF..PDDGFHADVLLRNADTAMYAAK---------------LAGRNM-------------------------
YEAJ_ECOLI/344-495GI-----YAMK...ENDTLHDAYKASDERLYVNK---------------QNKNSR-------------------------
P73380_SYNY3/304-462GI-----VIG..SIHYYEPERLIRDADIAMYQAK---------------NNGRNQ-------------------------
YFIN_ECOLI/249-405GY-----AMTI...EHASAEKLQELADHNMYQAK---------------HQRAEK-------------------------
P73713_SYNY3/801-959GV-----ACY..PNHGETMVNIIQAADRALYQAK---------------AAGRNR-------------------------
YDAM_ECOLI/253-406GV-----AHH...EGNESIDELFKRVDDALYRAK---------------NDGRNR-------------------------
Y1354_MYCTU/184-338GV-----ASG..TPGQHTPSDLLRRADQAALAAK---------------HAGGD.-------------------------
Q7AQ57_MYCLE/393-549GV-----VAIK.GDDPRNIGQILRDADTAMYRAK---------------LSGE..-------------------------
Q9CCU8_MYCLE/141-296GI-----LEVR.PDDRRRAADILRDADSAMYAAK---------------NKKQ..-------------------------

PF00211

ADCY1_BOVIN/296-480TL-----ANVM-EAAGLPGKVHI..TKTTLACLN...............GDYEVE.......PGHGHERNSF....LKTH
CYAG_DICDI/387-572NV-----ASRM-ESTGIAGQIHV..SDRVYQLGK......EDFNFSERCDIIHVK........G....K..........G
GCYB2_RAT/399-582NT-----ASRM-ESHGLPSKVHL..SPTAHRALK.....NKGFEIVRR.GEIEVK........G....K..........G
CYAA_DICDI/1180-1356NT-----ASRM-QSNAQDNEIMV..THSVYERLN......KLFYFDDE.KEILVK........G....K..........G
GUC2C_HUMAN/815-1002NT-----ASRM-ESTGLPLRIHV..SGSTIAILK...RTECQFLYEVR.GETYLK........G....R..........G
ADCY9_MOUSE/385-573NL-----ANLM-EQLGVAGKVHI..SEATAKYLD...............DRYEME.......DGRVIERLGQSVVADQLK
ADCY3_RAT/310-494TV-----ANKM-EAGGIPGRVHI..SQSTMDCLK...............GEFDVE.......PGDGGSRCDY....LDEK
ADCY3_RAT/914-1121NV-----ASRM-ESTGVMGNIQV..VEETQVILR.....EYGFRFVRR.GPIFVK........G....K..........G
GCYH_DROME/457-647TI-----ANKF-ESGSEALKINV..SPTTKDWLTK..HEGFEFELQPR.DPSFLPKEF..PNPG...............G
ADCY1_BOVIN/862-1059NV-----ASRM-DSTGVQGRIQV..TEEVHRLLR.....RGSYRFVCR.GKVSVK........G....K..........G
ANPRA_HUMAN/867-1053NT-----ASRM-ESNGEALKIHL..SSETKAVLE....EFGGFELELR.GDVEMK........G....K..........G
ADCY2_HUMAN/878-1078NV-----ASRM-DSTGVLDKIQV..TEETSLVLQ.....TLGYTCTCR.GIINVK........G....K..........G
GCY1_CAEEL/889-1077NT-----ASRM-ESNGKPSLIHL..TNDAHSLLTT..HYPNQYETSSR.GEVIIK........G....K..........G
CYAA_SCHPO/1323-1519NR-----TSRV-VSVADGGQIAV..SAEVVSVLNQLDSETMSSEKTNV.NEMEVR........A...............L
GCYA1_BOVIN/473-660TL-----ANKF-ESCSVPRKINV..SPTTYRLLK....DCPGFVFTPR.SREELPPNFPSDIPG................
ADCY8_HUMAN/973-1172NL-----ASRM-DSTGVSGRIQV..PEETYLILK.....DQGFAFDYR.GEIYVK........GISEQE..........G
GCYB1_BOVIN/412-605NL-----TSRT-ETTGEKGKINV..SEYTYRCLMTPENSDPQFHLEHR.GPVSMK........G....K..........K
E3FCG3_STIAD/222-407NL-----ASRI-ESLTKTRDVPILASRATREQAG......DTFLWNEM.APASVP........G....K..........S
K9ZFA5_ANACC/301-486NV-----ASRI-EGLTKQYGCNILITESVVRNLS....CPESFSLRLIDKSVKVK........G....K..........D
Q581E2_TRYB2/896-1107NM-----AART-ESVANGGQVLM..TGSTYLSLSA..EEREQIDVTAL.GDVPLR........G...VP..........D

PF05165

GCH3_AERPE/15-241DMLLVRSDLKAGIGIAPTARASLALAAEALHEIR---------------..SKIN-------------------------
GCH3_METJA/1-250KI.....ELKAGIGIGRTAEDASNLADIGLEKIR---------------..GKLV-------------------------
GCH3_METTH/1-249NV.....ALKAGIGKAPTAEKAANLADLALEEIR---------------..GGFT-------------------------
GCH32_HALSA/1-253GV.....DFQVGVGHGDTPHDAGADAKHALETCR---------------ATGARV-------------------------

PF00990

Q55906_SYNY3/600-758---------
Y4LL_RHISN/399-555---------
YEGE_ECOLI/682-839---------
YTRP_BACSU/423-571---------
P74658_SYNY3/110-271---------
P74197_SYNY3/340-500---------
P72790_SYNY3/288-449---------
P72746_SYNY3/429-586---------
YNEF_ECOLI/146-304---------
YEAP_ECOLI/174-331---------
YEAI_ECOLI/328-485---------
PHY2_SYNY3/1100-1260---------
P73011_SYNY3/292-453---------
P72956_SYNY3/314-475---------
Y1895_SYNY3/263-420---------
YDEH_ECOLI/129-283---------
P73036_SYNY3/149-310---------
P74400_SYNY3/1150-1312---------
YKOW_BACSU/372-530---------
P72809_SYNY3/414-576---------
P73272_SYNY3/180-338---------
GMR_ECOLI/237-391---------
P72747_SYNY3/273-430---------
Q55955_SYNY3/706-867---------
DOSC_ECOLI/295-452---------
Q55414_SYNY3/653-814---------
YDAK_BACSU/132-281---------
YCDT_ECOLI/282-439---------
YHCK_BACSU/192-351---------
Q55576_SYNY3/795-953---------
P72748_SYNY3/162-319---------
CSRD_ECOLI/224-381---------
PLED_CAUCR/289-448---------
ADRA_ECOLI/210-366---------
PHY2_SYNY3/431-592---------
YEDQ_ECOLI/398-557---------
P72843_SYNY3/410-567---------
YEAJ_ECOLI/344-495---------
P73380_SYNY3/304-462---------
YFIN_ECOLI/249-405---------
P73713_SYNY3/801-959---------
YDAM_ECOLI/253-406---------
Y1354_MYCTU/184-338---------
Q7AQ57_MYCLE/393-549---------
Q9CCU8_MYCLE/141-296---------

PF00211

ADCY1_BOVIN/296-480NIETFFIVP
CYAG_DICDI/387-572RMKTWYLMG
GCYB2_RAT/399-582KMTTYFLIQ
CYAA_DICDI/1180-1356KMVTHVLKG
GUC2C_HUMAN/815-1002NETTYWLTG
ADCY9_MOUSE/385-573GLKTYLISG
ADCY3_RAT/310-494GIETYLIIA
ADCY3_RAT/914-1121ELLTFFLKG
GCYH_DROME/457-647TETCYFLES
ADCY1_BOVIN/862-1059EMLTYFLEG
ANPRA_HUMAN/867-1053KVRTYWLLG
ADCY2_HUMAN/878-1078DLKTYFVNT
GCY1_CAEEL/889-1077VMETFWVHG
CYAA_SCHPO/1323-1519KQIGYIIHN
GCYA1_BOVIN/473-660..ICHFLEA
ADCY8_HUMAN/973-1172KIKTYFLLG
GCYB1_BOVIN/412-605EPMQVWFLS
E3FCG3_STIAD/222-407QPVAIFT..
K9ZFA5_ANACC/301-486EAISIY...
Q581E2_TRYB2/896-1107PVEMYQLN.

PF05165

GCH3_AERPE/15-241PGPLVVKAQ
GCH3_METJA/1-250DKNVCTLKQ
GCH3_METTH/1-249YDLVHVMKE
GCH32_HALSA/1-253HGPWTTADD

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window