Sequence alignment for CL0277

PF09129

V9XKK4_9NOCA/261-581--RMRCQSFTDITWQELF-------SPA..GSPGR----TFESFV--DSAGRAEAIWYPFTE------------------
E9T1B4_COREQ/275-613--RQRCQSYTDIPWRELF-------APK..GADGR----TFEKFV--AESGGAEAIWYPFTE------------------
C0ZNA9_RHOE4/268-586--RLRCRSFTDIPWQELF-------AAP..GSPGR----TYESFV--EKSGRVEAIWFPFTQ------------------
E3J1G5_FRASU/288-608--RLRCQSWFNINWTELF-------AAP..GSSGR----TFASYV--ESAGRVEAIWFPFTD------------------
E5ASP8_BURRH/293-606--K........ISARELF-------TKT..GTSKR----TIESFL--DKSGRIEIIWFPFTS------------------
Q13UN0_BURXL/264-584--RLRCQSYVDIPASELF-------ASA..KSGGR----TIESFL--DRSGRMEAIWFPFTS------------------
C0ZPW5_RHOE4/267-587--RMRCVSHTDIGWQELF-------GAR..GASGR----TFEKFV--RENGRAEAIWYPFTE------------------
V9XKE0_9NOCA/262-582--RVRCQSFTDIPWRELF-------APP..GSPGR----TFERYV--EEHGRVEAIWFPFTE------------------
W5W8X8_9PSEU/258-566--RLLCRSVLDVPVGEVF-------AAPE.HATER----SFANQL--AATGAAEVIWFPYTE------------------
D3VCK8_XENNA/241-561--RLRCQSFTDIPATELF-------ASPEQTKGKQ----TFSHFL--DQSGRAEVILFPFTD------------------
Q63X30_BURPS/264-586--RLQCESFVDIPAAELF-------AAA..GTRGR----TVESFV--QRSGRIEAIWFPFTD------------------
E9SX65_COREQ/264-584--RLRCQSIMDIPWQEMF-------APK..GSPGR----TYERFA--EESGRVEAIWFPFTD------------------
Q9HWP1_PSEAE/277-597--RMRCQSYVNIPASEMF-------AAA..GSGGR----TFDSFL--QKSGRAEAIWFPFTD------------------
B5I5E6_9ACTO/259-569--.LRCVSRVDIPAAELF-------AAP..GGDGR----TFASFL--DQAGRVEAIWFAYTE------------------

PF04030

ALO_DEBHA/202-551-VTLRTIPKYTIKSKQEI.......IKF--DTLLK----NWDTVW..LDSEFIRVWWFPYSG------------------
GGLO_RAT/180-438-VTLQCVPQFHLQETSFP.......STL--KEVLD----NLDSHL..KRSEYFRFLWFPHTE------------------
A5WEE3_PSYWF/185-441-LTLKVVDLYGLKESNEP.......IDF--EQGLA----GFYDTA..RAHRHMEWFLFPGTN------------------
Q8EQI8_OCEIH/179-431-AKIRVVPSPVYRYISNH.......VYY--PTLLN----NLETYI..QDNQHFEFFMFPYAD------------------
Q47NJ0_THEFY/176-430-ITMAVEPAFLLHARETP.......MPL--GEVLE----RLEELR..TTNDHFEFFWFPHTE------------------
Q82KJ4_STRAW/182-436-ITFSVEPVFLLTAREEP.......MSF--DKVTA----DFDELF..AENEHFEFYWFPHTG------------------
Q2JG59_FRASC/206-462-VTLQAVPLFALQVQEGP.......MRL--DEVLD----TYDDLV..DQTDHLRFSWFPHTT------------------
Q4JW76_CORJK/189-446-VEMDVVDTFVLHAVERA.......EPN--DEVVE----NFAERV..RGKDHLEFYWFPGTD------------------
Q5YR83_NOCFA/174-426-VTLQLVPSFVLEGIERP.......VPV--DEVLA----ELDSYV..DGNEHFEFYMFGHSP------------------
Q9HTM8_PSEAE/186-438-VRLQNRAAYRLRERQWI.......ART--EELLE----DVEKNT..RENQHWEMLVVTHSD------------------
Q983S0_RHILO/175-424-VTLNNIATYRLRRRKWV.......LPI--GDMLR----DFEKMM..TAHRSAEFYYIPFSG------------------
Q57ZU1_TRYB2/262-506-ATLPMTAGNTITKLTSSKLRNFSSEKC--NSTGE----DYQMWL..RNQRTLR........------------------
Q5K700_CRYNJ/204-464-VEIEVEDAFRLRETKEG.......KRV--EEVLE----SLDEIR..KSAEHVRVWWYPYGK------------------
Q2H4W5_CHAGB/168-472-VTLRAVPAFSLAWSQTI.......DAD--ARLFE----GWDDVL.WKQAEFVRVWWFPYMR------------------
ALO_NEUCR/210-513-VTFKAVPAFSLAWSQAI.......DSD--KRIFE----KWEKDL.WSQAEFVRIWWFPYMR------------------
Q2UQI3_ASPOR/199-482-VTFKAEASFKVAWRQTR.......RAL--SSVLA----EWSTGL.WTSHEFVRVWWMPYEK------------------
ALO_CANAL/202-552-VTLRTCPKYTIKSKQEI.......INF--ETLLN----NWDNLW..LESEFIRIWWFPYTN------------------
ALO_CANGA/188-518-ATVRVVPAFNIKSTQEV.......IKF--ETLLE----KWDSLW..TSSEFIRIWWYPYTR------------------
ALO_YEAST/186-516-ATIRVVPGFNIKSTQEV.......ITF--ENLLK----QWDTLW..TSSEFIRVWWYPYTR------------------
ALO_ASHGO/192-522-ATIRVVPAFNIHSTQEV.......INF--ETLLD----NWETIW..TSSEFIRCWWYPYVR------------------
ALO_KLULA/190-520-ATIRVIPEFNIKSTQEV.......IHF--ETLLN----NWETIW..TSSEFIRCWWYPYTR------------------
ALO_YARLI/189-523-ATLRTVPAYTIHSTQHV.......ITF--ETLIR----EWDNLW..TASEYIRVWWFPYAE------------------
ALO_SCHPO/187-459-ITISVVPAFDLVATEDV.......TTV--TDLFQ----DWKNNLIWESAEFVRVHVFPYAN------------------
Q22YW5_TETTS/180-449-VTFRTIPMEILTCKKIT.......TNF--DTLCS----VYSQMN..EKSDYAKAWWFPESD------------------
GULDH_MYCTU/172-425-VTLQTVPLFTLHRHDQR.......RSL--AQTLE----RLDEFV..DGNDHFEFFVFPYAD------------------
Q81HV8_BACCR/179-429-IKLKVIPAYSLVYESEK.......QSL--STVMN----KLEEY...KKHRHFEFFVFPYSD------------------

PF02913

D2HDH_ARATH/309-551KLSSVNLAFIACKDYLSC-------Q.KLLVEAKR----NLGEIL--SAFEFLDNNSMDLVLNHLDGV....--------
DLD_ARATH/319-560IPQHSVVAVCNFPTVKDA-------A.DVAIATMM----S.GIQV--SRVELLDEVQIRAINMANGK.....--------
Q9RJ97_STRCO/274-525APEVRRYEGWRFASFDEG-------T.AALRRLAQ----D.GPRP--TVLRLSDETETLIGLAQPDAVG...--------
Q9RTM9_DEIRA/229-469PPKFTRTLMSHFAEVGQA-------A.EAVSSAIA----A.GAVP--SKLEFMDRACVGAVEDYLHL.....--------
DLD1_KLULA/320-566RSTFETVAVVPFPTVSDA-------A.SCSSHLIQ----A.GIQL--NAMELLDDNMMKIINQSGAT.....--------
ADAS_RAT/370-643TPEYQKYGSVAFPNFEQG-------V.ACLREIAK----Q.RCAP--ASIRLMDNQQFQFGHALKPQVSSIF--------
Q9A317_CAUCR/209-458LLASRAVAIVGLASPANA-------I.QLLARAKD----ETGGAV--EAFELMGRLGFELTVRNVPGL....--------
Q987U0_RHILO/206-447KPETARALLIGFPTSEQG-------G.QCVADIIG----A.GIIP--GGMEMMDRPAIHAAEDFVHA.....--------
Q9S2F6_STRCO/248-487KPPEQLVLAAEFASASAA-------C.DAICRIME----G.GHVP--SLLELMDRTTVKAVNDLAHM.....--------
Q9HTK3_PSEAE/230-471RPPVAKVLLASFDDVESA-------G.RAVADLIG----A.GIVP--AGLEMMDNLSIRAAEDFIHA.....--------
O29450_ARCFU/211-460LPENIVYAGAFFDSPEKA-------M.QAVVEIKH----M...WP--AIMEFLDSDLVKAGREISGI.....--------
Q9KSQ8_VIBCH/286-544IPKARTLVNVKYDSFDSA-------L.RNAPLMVE----A...KA--LSVETVDSKVLNLAKEDIIWHSVK.--------
Q97G30_CLOAB/221-465LPKKAISLLVPFPNLTKA-------I.ETVPKIVK----S.KTIP--TSIEFMERDVILAAEEFLGK.....--------
Q9I6H4_PSEAE/216-461TPKNLTAMVLGTPDFDSI-------M.PVLHAFQS----K..LDL--TAFEFFSDKALAKVLARGDVP....--------
Q9K9B9_BACHD/216-457KPESKQTMLALYQDIEAA-------A.QTVSSIIA----N.KVIP--TTLEFLDQPTLKVVEAHAQI.....--------
YN53_SCHPO/272-525RPSSTNVAFFGVPSYENV-------L.KAFSETRS----HLTEIL--SAFELMDNTSQTLVDKYSGTQ....--------
Q986B0_RHILO/224-475NPKGREVAFAGLSSPEAA-------L.SLFSLAMD----RAGASL--TAFELIGKRPYDFTLKHGQGV....--------
O29853_ARCFU/209-439QMRDMTVLAIPFPTMEDA-------M.NCVVEVAR----K..MLP--MALEFMEKRAVEIGEKVSGE.....--------
Q9F3A3_STRCO/294-548LDRRVSSGLLFFPSLTAA-------A.AAVPLFNE----A...GA--LAVELMDGNTLRASVSVRGVPA...--------
Q9PGF5_XYLFA/218-457QPQAIAGLRAFYQDTTAA-------A.AAVSRLMS----Q.PAIP--ATLEFMDHKAIELLYRNDSN.....--------
Q9HZI0_PSEAE/264-527LAEDERFYSVFLPNWQQA-------L.QATRELAQ----A.RVPL--SMLRLSNAVETMTQLALAGHPGQIA--------
ADAS_CAEEL/313-584IPEVKRFGSFVFPNFESG-------V.NFFREVAI----Q.RCQP--ASLRLMDNDQFVMGQALKVASDSWW--------
Q11061_MYCTU/215-454AQNASSIVVASFGSVQAA-------V.DAVLGVTG----R..LRP--AMLEFMDSVAINAVEDTLRM.....--------
ADAS_DROME/337-605LPSLRRYGSLAFPNFEQG-------V.LFMREVAR----R.RCQP--ASVRLMDNEQFMFGQALKPEKSWWA--------
O07406_MYCTU/211-446TPSHRVTAVCGFAELAAL-------V.DAGRMFRD----V..EGI--AALELIDGRAAALTREHLGV.....--------
O05784_MYCTU/269-523RPRWQVTVSVVFDDWAAA-------V.AATRTIAQ----A.GLYP--ANCRLLDPAEALLNAGTSVG.....--------
Q9YEU4_AERPE/215-469MPENVVVVLAFFPTLRQL-------V.DAVIEVKS----R.AIDT--LLMEFMDVDSARLAAETLGA.....--------
Q55124_SYNY3/222-464TPESICVVLADFLSLEAT-------A.QSVADIIA----A.GIVP--AGMEIMDNFSINAVEDVVAT.....--------
Q9F2Y0_STRCO/247-482SPRARALAVLGYTDEAGA-------A.EAAA....----..GLLP--LGPLTVEGMAVDLVPSTEGL.....--------
Q9HMR2_HALSA/293-559VPAETAVAMLTYDDVRDA-------M.QDVAPVLD----H...DP--SAVEVMDDVFLDLARDTDEFAD...--------
Q9RVK1_DEIRA/212-453LPAEVVVLRCNFGTVAEA-------A.ACAVTVMG----A.ALQP--ERLELIDEHEIHAVNVQLER.....--------
Q986W2_RHILO/218-457KPASEVNAFCALASLDAA-------I.ALLGLLRQ----RLGPLL--SAYEVNFAPLYDVMAASMAMP....--------
Q9KKW5_VIBCH/271-520EHAHKASALLVFADIEQA-------S.QAVTTLSK----T...PV--AAVEMMDGRALRSVADKKGMPE...--------
ADAS_DICDI/317-586VPQAVEYYGFLFPTFAHA-------V.SALQQIRS----S.EVIP--TMIRVYDPEETQLSFAWKPSKGAVS--------
Q98KG4_RHILO/325-565IPQAISGGVCPFPSVEAA-------C.NAVIATIQ----M.GIPV--ARIELVNALQMRAMKNYSKL.....--------
O67645_AQUAE/239-479KPKARMTALALFDDLETV-------G.KAVTKILT----S.GVFP--SALEFMDRDAIRAVEDFKPV.....--------
Q9I3S8_PSEAE/214-458LQRPGATALLGLPDVDAA-------I.TIAARLRR----EHAERL--FACEILWHDYLQCTAAPMGDS....--------
Q88EH0_PSEPK/279-533IPKYAVLVNVRYTSFMDA-------L.RDANALMA----H...KP--LSIETVDSKVLMLAMKDIVWHSVA.--------
Q97U60_SULSO/203-443KPEVSKTILASFNSIDDA-------G.KAVVSVYK----A.GVTP--AAMEFLDKNSIIAIENTQYK.....--------
Q9HKQ4_THEAC/212-457KPERIARILAFFRTIDDA-------G.NAISEVKE----R..IIP--EMAEFMDKISLDSVPDAIKY.....--------
Q9HV36_PSEAE/265-514EHPHKASALLVFPTVETC-------C.TAVAVLKR----Q...PV--SAVELLDRRSLRSVENMQGMPE...--------
GLCD_BACSU/216-457KPETKKTLLALYENIDAA-------A.QTVSDIIA----A.KIIP--ATLEFLDQPTLLVIEDYAKI.....--------
Q9CMN0_PASMU/284-542IPQYRTLINVKYSSFDAA-------L.RNAPFMVK----A...NA--LSVETVDSKVLNLAKQDIIWHSVS.--------
DLD2_YEAST/277-529KPKAFNVSYLSVESFEDV-------Q.KVFVRARQ----ELSEIL--SAFEFMDAKSQVLAKSQLKDA....--------
YDIJ_ECOLI/281-539LPKVRRLVNVKYDSFDSA-------L.RNAPFMVE----A...RA--LSVETVDSKVLNLAREDIVWHSVS.--------
A4XDV9_NOVAD/262-503.NQVIPNAAVAVDLLWEV-------SAKTTRRHYF----D.GKGP--IPDSIRKKIASDHGLGMWNF.....--------
B4R3E5_DROSI/291-531..RAVNVAFIGLNSFDDV-------L.KTFVSAKR----NLGEIL--SSCELIDERALNTALEQFKFL....--------
Y2280_MYCTU/217-453...HNASVLAPFADFDQV-------M.AAVPKILA----S.GLAP--DILEYIDNTSMAALISTQNLELG..--------
Q585R0_TRYB2/307-576IPEVKRYEGWLFPSFEVA-------F.TAFHTCTR----K.GIHP--CTMRLYDEDDTRLSFAASTDSGLVS--------
Q7APS7_MYCLE/212-444.PAHRVTAVCGFSDLGAL-------V.DASRAFRD----V..YGI--AALELIDGRASSLIREHLGV.....--------
LDHD_MOUSE/245-483...ATVAATCAFPSVQAA-------V.DSTVQILQ----A.AVPV--ARIEFLDDVMMDACNRHSKL.....--------

PF08031

YGAK_BACSU/399-443-------DYVNWPDIEIR-------..........----.----------------------------------------
Q7RV07_NEUCR/421-465-------TYAGYVDPELK-------..........----.----------------------------------------
Q6LJC7_PHOPR/280-323-------VYVNFISEDE.-------..........----.----------------------------------------
Q84PV7_ORYSJ/461-526-------AYVNYLDLDLG-------ANNWTHPIG.----.----------------------------------------
Q6EUS8_ORYSJ/495-552-------AYINYRDLDLG-------QNVEG.....----.----------------------------------------
Q8EGB1_SHEON/850-894-------AFINFKDNTIP-------..........----.----------------------------------------
Q8XND2_CLOPE/404-448-------SFINFPFKDLK-------..........----.----------------------------------------
Q92U94_RHIME/427-471-------AYVNFMPEDEM-------..........----.----------------------------------------
Q7SB35_NEUCR/597-641-------GYLNEGDVMEP-------..........----.----------------------------------------
Q7NIA5_GLOVI/31-76-------AYYNFLRGDEQ-------..........----.----------------------------------------
Q82GZ2_STRAW/449-493-------AYVNVPNIGMQ-------..........----.----------------------------------------
YVDP_BACSU/400-444-------SYVNVPDQNIE-------..........----.----------------------------------------
Q7SHH8_NEUCR/453-496-------VYVNYAHGDET-------..........----.----------------------------------------
Q84PV6_ORYSJ/334-398-------AYVNYLDLDLG-------TNTWRNATD.----.----------------------------------------
O64745_ARATH/479-537-------AFFNYRDVDIG-------ITTPG.....----.----------------------------------------
Q869M2_DICDI/431-473-------DYSNINDTFLS-------..........----.----------------------------------------
Q9SA85_ARATH/465-524-------SFFNYRDVDLG-------INSHNG....----.----------------------------------------
Q7V3Z6_PROMM/524-568-------SYVNEGNFFEP-------..........----.----------------------------------------
Q9FKU8_ARATH/476-534-------AYVNYRDLDLG-------RNTKDV....----.----------------------------------------
Q7S915_NEUCR/469-516-------AFINFPDEVLS-------..........----.----------------------------------------
Q9FKV2_ARATH/471-528-------AYLNYRDLDLG-------MNRGV.....----.----------------------------------------
Q81C29_BACCR/8-52-------VYVNTPDLSIK-------..........----.----------------------------------------
Q81IH6_BACCR/396-440-------DYVNWPDIDIK-------..........----.----------------------------------------
Q6ZB64_ORYSJ/480-545-------AYVNYVDLDLG-------TNALAGNV..----.----------------------------------------
Q9EX55_STRCO/495-548-------CYINYADADLA-------DPA.......----.----------------------------------------
P71984_MYCTU/413-458-------AYVNFTADDAP-------..........----.----------------------------------------
Q93S08_STRCO/490-543-------AFINYADADLA-------DPA.......----.----------------------------------------
Q93ZA3_ARATH/477-530-------AYVNYRDLDLG-------MNG.......----.----------------------------------------
Q9SA89_ARATH/469-526-------SYLNYRDIDIG-------VNDHG.....----.----------------------------------------
Q87IH1_VIBPA/415-459-------AYINFLTQDEA-------..........----.----------------------------------------
Q8Y3D0_RALSO/458-507-------CYINYPDVDML-------..........----.----------------------------------------
Q9FKV0_ARATH/479-537-------AYVNYRDLDFG-------QNKNNA....----.----------------------------------------
O64743_ARATH/475-528-------AYVNYRDLDLG-------TNE.......----.----------------------------------------
Q84PV5_ORYSJ/467-535-------AYINYMDLDLG-------MNNWSNLRMY----G----------------------------------------
B8NRL4_ASPFN/503-546-------AYLNEADFRQP-------..........----.----------------------------------------
F4HV09_ARATH/467-522-------AFLNYRDIDIG-------KNLN......----.----------------------------------------
M1D3J3_SOLTU/322-380-------AYINYRDLDIG-------VNNIKG....----.----------------------------------------
M1W0X9_CLAP2/412-456-------SYRNLGDPQEK-------..........----.----------------------------------------
Q1K7N8_NEUCR/507-549-------AYMNEGNFQQP-------..........----.----------------------------------------
Q7S1P7_NEUCR/454-499-------.YINYADPTMK-------..........----.----------------------------------------
Q9FI21_ARATH/469-527-------AYVNFKDMDLG-------MYLGKK....----.----------------------------------------
Q9FZC7_ARATH/490-547-------AFFNFRDIDIG-------SNPSG.....----.----------------------------------------
Q9SA88_ARATH/468-523-------AFLNYRDIDIG-------SSGN......----.----------------------------------------
Q9SA99_ARATH/470-527-------TYINYRDLDIG-------VNTPG.....----.----------------------------------------
Q9SUC6_ARATH/470-527-------AYLNYRDLDLG-------STKGI.....----.----------------------------------------
V4K8Y9_9ACTO/416-460-------.YVNFMNPGEA-------..........----.----------------------------------------

PF09265

K4CKY2_SOLLC/235-510-PDMVRWVRVVYSEFHEF-------SSDAELLITN.........P--ESFDYVEGFVFV.NS..DDPVNGWL........
I1L1H8_SOYBN/249-526-PTRVKWLRLLYNNFTAF-------SRDQEHLISF.S...ERNDI--ATADYVEGMLLL.NQ...PPLD...........
CKX3_ORYSJ/232-512-PQKVKWVRAFYDDFATF-------TKDQELLVSM.........P--VLVDYVEGFIVL.NE...QSLHS..........
CKX1_ORYSJ/245-531-PARARWVRLVYADFAAF-------SADQERLVAA....RPDGSH--GPWSYVEGAVYLAGR...GLAVALKSS......
CKX2_ORYSJ/256-560-PARARWVRFVYTTAAAM-------TADQERLIAVDRAGGAGAVG--GLMDYVEGSVHL.N...QGLVETWRTQPQPPSP
A9TE88_PHYPA/237-513-.EKVRWIRAMYTDFATF-------TRDQEMLVTQ.....APES.--.AFDYIEGFVVL.KN..KDSSHGWN........
A9U580_PHYPA/199-480-PQRVRWMRAIYTDFATF-------RRDQELLIRS......SSGS--PPFDYVEGFVVV.ND..ANPINGWG........
C5YCF7_SORBI/234-520-PPKVRWVRAFYDSFETF-------TKDQELLVSM.........P--ELVDYVEGFMVL.NE...QSLHS..........
M0TFY8_MUSAM/196-467-PQRVRWLHLVYTNFDMF-------TRDQEMLISK........LE--KGFDYVEGRLLKGK.......DVSS........
K3YYC8_SETIT/244-525-PKRVRWVRLAYTDVVTF-------TKDQEFLISD......RARE--VGFNYVEGQVQL.NR...SFAEGPKS.......
D8SXN5_SELML/247-526-PQKVKWIRALYSDFKAF-------TRDQELLIAR.....PKDSP--NSFDYVEGSVIV.NN..NHPSNEYK........
J3MTM1_ORYBR/125-404-PQTVRWTRVVYASFADY-------AADAEWLVTR.......PAH--EAFDYVEGFAFV.RS..DDPVNGWP........
CKX10_ORYSJ/246-530-PKRVKWVRIAYSDVHPF-------TTDQELLISK......WASG--SGFDYVEGQVQL.NR...TLTQGRRS.......
B9H4G1_POPTR/239-521-PQRVRWIRVLYSNFSTF-------TGDQEYLISM.H...GKPST--LKFDYVEGFVIV.DE...GLINNWR........
M0S8L8_MUSAM/196-467-PQRVRWVRFIYTDFGSF-------INDQELLISI........SE--EGFDYVEGQLLMKN.......GAAN........
C5YM55_SORBI/218-506-PKAVRWTRVVYASFADY-------TADAEWLVTR.......DPD--AAFDYVEGFAFV.NS..DDPVNGWP........
K3XHX8_SETIT/127-423-PARARWVRLLYTDVAVL-------TGDQERLIAE.....RGAVA--GIMDYVEGSVLT.DY..QGLIGSWRSQPPS...
W5B8J6_WHEAT/275-552-PPKVRWVRAFYDSFETF-------TKDQELLISM.........P--EQVDYVEGFMVL.DE...HSIHS..........
K7V1U5_MAIZE/241-516-PKMVRWIRVLYSDFESF-------TEDQEMLIMA.........E--NSFDYVEGFVII.NR..TGVLNNWR........
M0RM32_MUSAM/220-488-PQRVRWLRLFYTDFSSF-------TGDQELLVSM........TE--KVFDYVEGQLLTEK.......DVGN........
M1A8V5_SOLTU/250-526-PKMVKWIRVLYSDFSTF-------ARDQERLISA.........S--KTFDYIEGLVIK.NK..TGLLNNWR........
M0RWA6_MUSAM/235-509-PQKVRWARAFYDDFDTF-------TRDQELLLSM.........P--DLVDYLEGFIVP.NQ...LSLLG..........
D7KSP4_ARALL/242-520-PQRVRWIRVLYSSFKVF-------TEDQEYLISM.H...GQ...--LKFDYVEGFVIV.DE...GLVNNWR........
D8S2E8_SELML/208-483-PARARYKRLVYTDFGAF-------QKDIERLISL........NE--DVVNYVEGIVIPSCD...DPYQGYN........
M0WQT5_HORVD/289-587-PARARWVRLFYTSAAAL-------TADQEGLIGINL...GTAVS--GLMDYVEGSVVL.AD..QGRAGSWR........
I1GXU3_BRADI/247-523-PKRVKWVRLAYSDVRLF-------TADQELLISK.........A--AGFDYVEGQVQL.NR...TLTEGRRS.......
I3VIX5_HORVD/238-510-PQMVRWIRVLYLDFMSF-------TEDQEMLISA.........E--KTFDYIEGFVII.NR..TGILNNWR........
I1N8X2_SOYBN/261-537-PMMVKWIRVLYSEFSTF-------TMDQEYLISL.........N--NTFDYIEGFVII.NR..TGILNNWR........
I1M956_SOYBN/223-503-PDMVRWIRVLYSEFAHF-------TRDAEWLVTL.......PEG--DGFDYVEGFVLV.NS..DDPCNGWP........
W1PP63_AMBTC/225-535-PHKVKWVRAFYDDFGAF-------TEDQEMLVSM.........A--DKVDYVEGFMVL.NE...QSLEG..........
K7LYV0_SOYBN/248-523-PTRVKWLRLLYNNFSAF-------SGDQEYLISV.N...GRNET--NAADYVEGFLLL.NQ...PPQD...........
I1NS44_ORYGL/244-525-PHRVRWIRALYSNFTEF-------TADQERLISL......QHGG--RRFDYVEGFVVA.AE...GLINNWR........
CKX1_MAIZE/246-533-PARARWVRFVYTDFAAF-------SADQERLTAP.RPGGGGASF--GPMSYVEGSVFV.NQ...SLATDLAN.......
M0ZWN0_SOLTU/233-515-PQRVRWIRVLYSNFSTF-------TQDQEYLISL.H...GKPAS--QKFDYVEGFVIV.DE...GLINNWR........
B9RGG6_RICCO/247-523-PDMVKWIRVLYSDFNTF-------ARDQESLISA.........E--NTFDYIEGFVII.NR..TGLLNNWR........
I1HYS9_BRADI/244-525-PKRARWVRLAYTDVTVF-------TGDQELLISK......KASE--AGFDYVEGQVQL.NR...TLIDGPES.......
B9RI30_RICCO/238-508-.KRAVWAQILYSNFSAF-------TRDQERFIAG.H...AKKEG--NAISYLEGALLL.DN...GTPNTWR........
F6H3S4_VITVI/229-509-PDMVRWMRLVYAEFDAF-------SRDAEFLVTR.......PEG--DSFDYVEGFVFV.NS..SDPVNGWP........
W1PC48_AMBTC/235-507-PEMVKWIRVLYSDFSLF-------TKDQELLISL.........E--KGFDYVEGFVII.NR..NGILNNWR........
B9RQW4_RICCO/233-514-PDMVRWIRVVYTEFEDY-------ARDAEWLVTR.......PDD--MSFDYVEGFVFV.NS..DDHVNGWP........
M0T0P2_MUSAM/213-487-PERVRWARLIYTDFVSF-------TRDQELLISM........SE--EGFDYVEGSLLMMDH...SLIGNWR........
CKX7_ARATH/239-520-PDMVRWIRVVYTEFDEF-------TQDAEWLVSQ.......KNE--SSFDYVEGFVFV.NG..ADPVNGWP........
I1LL79_SOYBN/269-545-PAMVKWIRVLYADFTAF-------IRDQEKLIFA.........E--KAFDYVEGFVII.NR..TGLLNNWS........
CKX4_ARATH/250-523-PTRVKWSRILYSDFSAF-------KRDQERLISM.......TND--LGVDFLEGQLMM.SN...GFVD...........
B9T889_RICCO/261-537-PKRVRWIRVLYAEFSKF-------SNDQEHLIAS.........E--NSFDYIEGFVII.NR..TGLLNNWR........
B9HH07_POPTR/240-507-PTKVRWSRAFYSNFSDF-------IRDQERIVRG.......GQR--DVANYLEGSLML.DN...GTPTEWI........
I1HCZ6_BRADI/259-559-PARARWVRLLYTTAASL-------TGDQERLIAD.....GGGVS--GLLDYVEGSVLL.AD...QLAGSWRSPG.....
K4DBX8_SOLLC/251-526-PTRVKWVRMLYDDFSKF-------TKDQEHLISI........HN--NGLDYVEGSLMM.EQ...SSLNNWR........
I1L1J0_SOYBN/266-544-PKRVKWVRLLYNDFSAF-------TKDQEQLISI.T...RRKQN--IALDYLEGLLLM.HQ...GPINNWR........
M0TSS1_MUSAM/191-475-PKMVRWIRVVYKGFEEY-------AGDAEWLVTR.......ADS--EAFDYVEGFAFV.ND.VSDPVNGWG........
W1PTT2_AMBTC/244-524-PDMVRWIRVVYADFDDF-------SRDQELLVTR.......ASS--ESFDYIEGFVFT.NS..DHPVNGCH........
M7YGJ3_TRIUA/205-501-PTWARWVRLLYTGAAAL-------TGDQERLIDVER...GDALS--GLMDYVEGTVVA.DE...GLIGSWRSQSPSSSS
C5XLU9_SORBI/270-568-PARARWVRLLYTAAADL-------TADQERLIDD.....GGALA--GLMDYVEGSVLT.DFQGQGLIGSWRSQPP....
CKX7_ORYSJ/234-513-PKRVRWVRLAYSDVATF-------TKDQELLISK......RASE--AGFDYVEGQVQL.NR...TLTEGPKS.......
A9TFW7_PHYPA/211-490-PQRVRWMRTLYTDFVTF-------KKDQELLISS.......ATS--KTFDYVEGFVVV.NN..ENAINGWG........
D7MM89_ARALL/244-517-PKRAKWLRFLYIDFSEF-------TRDQERLISK.........T--DGVDFLEGSVMV.DH...GPPDNWR........
K7VI02_MAIZE/264-548-PRRVLWVRLAYSDVRSF-------TSDQELLISK...RPAGGCG--SGFDYVEGQVQL.NR...TLTEGRRS.......
M0SHZ5_MUSAM/198-471-PTMVRWVRLIYKDFAAF-------TSDQERLISL.......EKK--KGFNYVEGSVIMAD....SLTDNWR........
C5XY40_SORBI/244-525-PKRVRWVRLAYSDVATF-------TKDQELLISN......RTGL--IGFDYVEGQVQL.NR...SFIEGPKS.......
M1D3U0_SOLTU/258-536-PDMVRWIRVVYSEFEDF-------THDAELLITS.........Q--ETFNYVEGFVFV.NS..DDPVTGWP........
W1PW76_AMBTC/30-311-PHRVRYIRVVYAKVEDF-------VRDQVRLVSL.......PKG--HTFDYIEGFILA.NE...NTIDGWK........
D7LTR1_ARALL/245-521-PTMVKWIRVLYLDFSAF-------AKDQEQLISA.........D--NKFDYIEGFVII.NR..TGLLNNWR........
M0TFY7_MUSAM/200-473-PQRVRWVRLIYTHFVSF-------SRDQELLISM........MD--QGFDYVEGSLLM.DH...TLITNWR........
A9TFW3_PHYPA/268-544-.EKVRWIRAMYTDFATF-------TRDQEMLISQ.....PPQH.--.TFDYIEGFVVL.KN..EDPNNGWN........
M0T1W4_MUSAM/207-492-PPMVAWIRVKHHDFDQF-------TRHGELVVNS..........--GEVDYLEGFIKFGDA..................
M0SCZ3_MUSAM/209-484-PKMVKWIRVLYSDFASF-------TEDQEMLISL.........K--ETFDYIEGFVII.NR..TGLLNNWR........
CKX1_ARATH/263-539-PHMVKWIRVLYSDFSAF-------SRDQEYLISK.........E--KTFDYVEGFVII.NR..TDLLNNWR........
K7KSR3_SOYBN/132-409-PHRVRWIRVLYSNFARF-------CKDQEYLISL.H...GKAAR--ERFDYVEGFVIV.DE...GLINNWR........
W1NUG7_AMBTC/245-525-PQRVRWIRVLYSDFNTF-------TRDQEHLISL.H...GR...--TKFDYVEGFVIV.DE...GLINNWR........
B9H8X5_POPTR/248-526-PKRVKWVRILYSDFSAF-------TRDQERLISI.N...GRKQK--NALDYLEGSLLM.AQ...GPPNNWR........
I3VIX4_HORVD/239-520-PKQVRWVRLAYSDVVAF-------TRDQELLISK......QASE--AGFDYVEGQVQL.NR...TLTEGPKS.......
A9U0K6_PHYPA/202-478-.EKVRWIRVMYTDFAAF-------TRDQEMLVSQ.....PPES.--.AFDYIEGFVVL.KT..EDSINGWN........
M0SR52_MUSAM/231-511-..MVRWIRVLYSDFGAF-------TRDQEHLISL.H...GALPS--QRFDYVEGFVIV.DE...GLINNWR........
M0RWJ8_MUSAM/214-498-PEKVKWVRAFYDDFDTF-------TSDQELLISM.........P--ELVDYVEGFVVL.NE...QFLHG..........
CKX8_ORYSJ/239-523-PPKVRWVRAFYDSFETF-------TGDQELLVSM.........P--EQVDYVEGFMVL.NE...QSLHS..........
W5D410_WHEAT/239-515-PTRARWARLVYTDFATF-------SADQERLXGA.........F--GPMSYLEGAVYV.NH...SLAAGLKNS......
K7KI99_SOYBN/133-410-PDMVRWIRVVYSEFEEY-------ARDAESLVE..........E--YCFDYVEGFVLV.NS..DNRANGWP........
I1HCT8_BRADI/241-520-PARARWVRLVYTDFATF-------SADQERVIAG....AADSAF--GAVSYLEGAAYV.NQ...SLASGLKNA......
I0IUQ8_SOLLC/258-534-PKKVKWIRVLYSDFSTF-------SNDQEQLISS.........K--DSFDYVEGFVII.NK..TGLLNNWR........
M0TME6_MUSAM/211-494-PPKVKWVRAFYDDFETF-------TEDQELLVAM.........P--DAVDYVEGFILL.NE...QSLHS..........
F6HGV7_VITVI/246-518-PKRVKWVRMLYDDFSTF-------SEDQEHLISI..........--NGLDYLEGSLIT.KQ...SPPNNWR........
CKX2_ARATH/227-501-PKRAKWFRMLYSDFTTF-------TKDQERLISM.......AND--IGVDYLEGQIFL.SN...GVVD...........
B9HD10_POPTR/233-515-PDMVRWIRVVYSEFEDF-------TRDAEWLVTR.......PEG--ESFDYVEGFVFV.NS.VDDPANGWP........
B9RK75_RICCO/250-528-PKKVKWVRMLYSDFSEF-------TKDQERLISI.N...GRKQS--NALDYVEGSLLM.NQ...GPPNNWR........

PF09330

Q16DY3_ROSDO/271-558------VYYVGTNDPAQL-------TELRRRA.LT----ELPELP--VSGEYLHRECFDIARKYG---------------
D8ISV9_HERSS/281-569------VFYIGANDPAVL-------EDLRRHI.LS----NFRALP--IAGEYMHRSGYDLARKYG---------------
X2HJ85_9NEIS/275-564------VFYIGSNDTHEL-------DDIRRQI.LS----KFKNLP--VSGEYMHREAFDIAAAYG---------------
B8IIE3_METNO/300-589------VFYIGTNDVDNL-------TKIRRHI.LG----SFIHLP--VAGEYIHRDAFDIAEQYG---------------
A8GBH8_SERP5/274-563------VFYIGTNDTAVL-------TELRRHM.LS----QFDNLP--VAGEYMHRDIFDIAEVYG---------------
Q7VS08_BORPE/283-572------VFYIGTNDPGEL-------TAIRRHM.LT----RLPALP--IAGEYLHRDAFDIADVYG---------------
C7MHH4_BRAFD/277-568------TFYIGTDRPADL-------ESLRRAF.LA----ADGPLP--ISGEYMSSHAFDLAVEYG---------------
Q32EL2_SHIDS/278-567------VFYIGTNQPEVL-------TEIRRHI.LA----NFENLP--VAGEYMHRDIYDIAEKYG---------------
A1B668_PARDP/280-568------VFYVGSNDPDEL-------TEIRRHI.LA----HFQSLP--IAGEYIHREAYDIAAKYG---------------
I2B7H2_SHIBC/278-567------VFYIGTNQPAVL-------SQIRRHI.LA----NFSNLP--VAGEYMHRDIYDIAAVYG---------------
B8BXH2_THAPS/394-691------VFWVSFPDMETT-------LAFRREVCLN----NPKDLP--ISCEYMNRDSVNIIDRSG---------------
A6VYY6_MARMS/276-565------VFYIGTNDPAVM-------EQMRRDM.LS----TFKNLP--VSGEYMHNSSYDISKKYG---------------
M9X3I1_PASHA/272-562------VFYIGTNHTDTL-------NDIRRYM.LA----NFEVLP--ISGEYIHRDAFDIAADYG---------------
Q0C1N1_HYPNA/263-552------VFHVATDDAGVL-------SDVRRRM.LG----QAALVP--ISAEYMHRDTFRMAEREG---------------
D3V833_XENBS/278-567------VFYIGTNQPEVL-------TELRRHI.LA----NFQHLP--IAGEYMHRDIFDIAEVYG---------------
Q5NQX4_ZYMMO/284-573------VFYIGTNDPDEL-------TELRRQV.LK----SFKYLP--ISGEYMHRHAYDIAAKYG---------------
Q7N371_PHOLL/278-567------VFYIGTNQTGVL-------TELRRHI.LA----NFHNLP--MAGEYMHRDIFDIAEIYG---------------
U5T2S7_9GAMM/273-552------.YYIGSNDTHEM-------AEFRARF.LR----EASRLP--ITAEYLHRELFDVARRYG---------------
F6AE61_PSEF1/273-561------VFYIGTNAAGDL-------TEVRRHL.LN----RLPSLP--IAGEYIHRTAFDIGEKYG---------------
A5WED9_PSYWF/295-584------TFYIGSNSIGEL-------AQLRRQI.LL----GFTNIP--EVGEYMHRDIFDVSTKYG---------------
I1YIL1_METFJ/275-564------VFYIGTNDSTVL-------AKMRRDI.LS----EFDNLP--VSGEYLSREYYDVCKKYG---------------
C7M6Y2_CAPOD/272-562------VFYIGTNNTAVL-------TKLRRDM.LG----TFEEIP--ISGEYIHRTAFDIAAKYG---------------
C5ZZE0_DINSH/276-563------VFYIGTNDPDEL-------TELRRHM.LA----EFKSLP--VSAEYMAREIFDISEKYG---------------
C5BHL3_EDWI9/279-568------VFYIGTDRPQVL-------TGLRRHI.LS----HFTHLP--VAAEYLHRDTFDIAERYG---------------
I0DPH6_PROSM/278-567------VFYIGTNNPDVL-------EDIRRHI.LS----EFKNLP--VAGEYMHRGCFDIAEVYG---------------
F6IEM7_9SPHN/289-577------.FYIGSNDPVEL-------SAIRRTI.LT----DFSSLP--IQAEYIHRSAFRLTERYG---------------
G8MIK8_9BURK/283-568------VFYIGTNDTAVL-------TEIRRHA.LA----GFTHLP--IAGEYLHRDAFDIARDYG---------------
E6WEH0_PANSA/273-563------TFYIGTNDETVL-------VELRRYL.LT----RMSELP--VQAEYIHRNAFDLTVRYA---------------
I0HV55_RUBGI/273-561------VFYLGTNEPDEL-------TAVRRHL.LT----ALPRLP--IAGEYIHRTAFDIGERYG---------------
E3F2U2_KETVY/276-564------VFYIGSNDSNEL-------SDLRRAV.LT----AFQTQP--VAGEYIRRDAYELAVKYG---------------
S5XTB9_PARAH/284-572------VFYVGTNDPAEL-------TRIRRDM.LA----DFTHLP--IAGEYIHREAYDVAAKYG---------------
B2IER8_BEII9/289-578------VFYIGTNDPAEL-------TEIRRHI.LA----QFKTLP--VSGEYMHRDAFDIAETYG---------------
K7SGY9_GLUOY/277-566------VFYIGTSSTHDL-------EDLRRHF.LT----SFDELP--IAGEYIHRDAFNIAEVYG---------------
N0APL0_9BACI/270-559------VFYIGTNTPRVL-------ELIRRKA.LS----EFENLP--VAGEYMHREIYDIAKKYG---------------
J7U450_MORMO/278-567------VFYIGTNTPSVL-------EDIRRHI.LA----EFEHLP--VAGEYMHRECYDIAKVYG---------------
Q8NRY8_CORGL/279-570------VFYIGTNNTHEL-------EEIRRLF.LE----ADMPLP--ISGEYMGRSAFDLAEKYG---------------
W0HXS9_9ENTR/288-576------VFYIGTNQTSVL-------TAIRRQI.LG----QFTHLP--ISGEYLHRDAYDIAARYG---------------
U3TWX4_9ENTR/276-565------VFYIGTNDPATL-------GELRRHI.LA----EFTHLP--VAGEYMHRDIFDIAEVYG---------------
Q7CH75_YERPE/279-568------VFYIGTNQTQVL-------TELRRII.LR----DFKHLP--IAGEYLHRDIFDIAETYG---------------
F4HE38_GALAU/273-562------VFYIGTNDIHEL-------NDIRRTI.LA----EFKQLP--ISGEYIHREAFDVAAIYG---------------
W0AF31_9SPHN/283-572------VFYIGTNDPVEL-------GDIRRAM.LE----RFAELP--IAAEYMHRDCFDIANEYG---------------
G8PGV4_PSEUV/272-560------TFYIGTNDPAEL-------TELRRHI.LT----HFENLP--VSAEYMHREAYDISEKYG---------------
D8MM49_ERWBE/273-563------TFYIGTNDETEL-------VALRRYL.LE----GLSELP--LQAEYIHRDAFDLTVRYA---------------
Q13Q13_BURXL/285-573------VFYIGTNRPDEL-------TAIRRHA.LH----DFKHLP--ISGEYLHRDAFDIAEEYG---------------
B0UTX6_HISS2/274-564------VFYIGTNQTDVL-------NDIRRHM.LA----NFQQLP--ISGEYIHRDAFDIAAKYG---------------
D4Z0R4_SPHJU/277-567------TFYIATNDAAVF-------TSLRRAA.LG----TFSHLP--VSAEYLSRETILMSERYG---------------
G4R7Z9_PELHB/272-560------VFYIGSNDPLEL-------NTIRRHM.LS----RFTHLP--IAGEYLHRDGYTLTQKFG---------------
Q7V9S2_PROMA/275-565------VFFVGTNNAEHL-------THLREKI.LT----NMNSLP--DMGEYMHFSYFDGSAKYC---------------
H2IVR9_RAHAC/272-561------VFYIGTNDTAVL-------TELRRQI.LR----DFANLP--VAGEYMHRDIFDITEVYG---------------
F2G3K5_ALTMD/276-565------VFYVGSNDAAVF-------TKVRRDI.LS----TFKNLP--DSGEYLHRDCYDVSKKYG---------------
C7JDF4_ACEP3/277-566------VFYIGTNNTDEL-------ENLRRHV.LT----AFNELP--IAGEYIHRDAFNIAEKYG---------------
F2JZ95_MARM1/276-565------VFYIGTNDPAVM-------EQIRRDM.LS----KFDNLP--VSGEYMHKTCYDISKKYG---------------
T2DLG8_ALTMD/271-561------TFYIGTNDAAVL-------TRIRREI.LS----QFDNVP--EVGEYLHREMFDIADIYG---------------
Q6D2B5_PECAS/284-573------VFYIGTNQPQVL-------TELRRHM.LA----DFKNLP--VAGEYMHRDIFDIAETYG---------------
B2FII9_STRMK/273-560------VFYIGSNRTDSL-------TAIRRQL.LT----GFERLP--IAGEYIHRDAYDIGERYG---------------
G4QGM0_GLANF/289-578------TFYIGTNDTKEL-------TKLRKDI.LS----RLTNMP--EVGEYMHRDIFDISQKYG---------------
B4E754_BURCJ/288-575------VFYIGTNDIDEL-------TDIRRHA.LT----QFKRLP--IAGEYLHRDAFDIAQKYG---------------
D8MPZ9_ERWBE/278-567------VFYLGTNDPDVL-------DELRRHM.LQ----HFSHLP--VAAEYMHRDIFDIAEVYG---------------
B4ETB6_PROMH/278-567------VFYIGTNDPDEL-------EDIRRHI.LS----QFKVLP--VAGEYMHRSYYKMAEVYG---------------
G2KVV8_LACSM/270-559------VFYIGTNDPDVL-------EKLRRHI.LT----KFKYLP--VSGEYMHREAYDLAKKYG---------------
X2H2U0_9GAMM/275-570------VFYIGTNNTNEL-------DDIRRHI.LG----QFKNLP--VSGEYIHRDAFDIAAVYG---------------
G7URI2_PSEUP/281-570------VFYIGSNDPDEL-------TRIRRDI.LS----GFQSLP--VAGEYLHRDAFDIGDRYG---------------
D5QJ51_KOMHA/278-567------VFYIGTNQTDVL-------EDVRRHV.LG----AFSELP--IAGEYLHRDAFNIAEKYG---------------
C5BSR5_TERTT/274-576------VFYLGTNDDAVF-------TEIRRHI.LS----SFEHMP--VLGEYIHKTAFDVARDYG---------------
Q6FFS0_ACIAD/279-567------VFYVGSNDADDL-------TAIRRYL.LT----SLPSLP--IAGEYIHRDAYQIGEKYG---------------
Q5FRI2_GLUOX/282-571------VFYIGTNNTSDL-------EDLRRHV.LT----HFDELP--IAGEYLHRDAFNIAEKYG---------------
Q87HG0_VIBPA/273-562------VFYLGTNDANKL-------TKLRKDF.LT----QFDNLP--EMGEYLHRDIFNMAEKYG---------------
Q6LQ09_PHOPR/273-562------VFYIGTDDAEKL-------TQLRRDI.LS----KFDNLP--EMGEYMHRDIFNLSEKYG---------------
H8L1S9_FRAAD/288-574------VFYIGTNSADEL-------TDIRREV.LA----NFRHLP--ISGEYLHRDAFEIAEQYG---------------
F6IHY7_9SPHN/276-565------TFYIGTNNTAEL-------ARIRRDI.LK----DFECLP--VAGEYMHREAFDLAARYG---------------
A6VK90_ACTSZ/272-562------VFYIGTNRTSVL-------SDLRRHM.LS----NFEELP--VSGEYIHRDAFDIAARYG---------------
Q9JZL7_NEIMB/272-561------VFYIGTNDINEL-------TDIRRAA.LG----EFESLP--VSGEYIHRHAFDIADVYG---------------
K0HVQ3_9BURK/282-571------VFYIGTNQPRDL-------ADLRRHM.LA----CFASLP--VAAEYMHRSAYDLSRTYG---------------

PF09129

V9XKK4_9NOCA/261-581-------------------------------RPWMKVWSLAP----E...................KPATSR------EV
E9T1B4_COREQ/275-613-------------------------------KPWMKVWTVSP----TKPDSSNEVGSLGSAGSLVGKPPQAR------EV
C0ZNA9_RHOE4/268-586-------------------------------TPWLKVWTPTP----V...................KPPESR------EV
E3J1G5_FRASU/288-608-------------------------------NPWLKVWTRSP----N...................KPLLSR------QV
E5ASP8_BURRH/293-606-------------------------------NPWLKVWSIKP----N...................KPLFSR------TV
Q13UN0_BURXL/264-584-------------------------------CPWLKVWSVQP----S...................RPFFSR------EV
C0ZPW5_RHOE4/267-587-------------------------------RPWMKVWSLAP----T...................KPPFSR------EV
V9XKE0_9NOCA/262-582-------------------------------TPWLKIWSVSP----E...................KPAASR------EV
W5W8X8_9PSEU/258-566-------------------------------FPWTKYWSVRP----E...................APRCAR------RV
D3VCK8_XENNA/241-561-------------------------------KPWLKVWSVSP----T...................KPASST------KT
Q63X30_BURPS/264-586-------------------------------YPWLKVWTVRP----N...................RPSGAR------VV
E9SX65_COREQ/264-584-------------------------------KPWLKIWSPTP----V...................KPPESR------EV
Q9HWP1_PSEAE/277-597-------------------------------KPWLKVWTPTP----R...................CPFGAR------AV
B5I5E6_9ACTO/259-569-------------------------------FPWLKVWSVAP----T...................RPLTSR------RV

PF04030

ALO_DEBHA/202-551-------------------------------N--CVCWRASK----S-------------------SEPL..........
GGLO_RAT/180-438-------------------------------N--VSIIYQDH----T-------------------NKAP..........
A5WEE3_PSYWF/185-441-------------------------------K--IQQKTLSV----V-------------------APQPMR......RA
Q8EQI8_OCEIH/179-431-------------------------------Q--VQTKTMNP----T-------------------NTSP.........K
Q47NJ0_THEFY/176-430-------------------------------R--TITKRNNR----V-------------------PGPAR.......PL
Q82KJ4_STRAW/182-436-------------------------------N--CNTKRNNR----S-------------------AGPER.......PV
Q2JG59_FRASC/206-462-------------------------------T--ALVRRGQR----R-------------------PLDDGL.....APL
Q4JW76_CORJK/189-446-------------------------------V--AHVKTNTR----L-------------------PGNTPT.....NPI
Q5YR83_NOCFA/174-426-------------------------------L--AMTKRNSR----V-------------------DLPEQ.......PR
Q9HTM8_PSEAE/186-438-------------------------------Y--ALSIALNE----T-------------------DEPKT.......PP
Q983S0_RHILO/175-424-------------------------------Y--AQFIASDF----S-------------------TEATTT.....RPT
Q57ZU1_TRYB2/262-506-------------------------------.--........----.-------------------..............
Q5K700_CRYNJ/204-464-------------------------------G--AVVGRASR----T-------------------YEP...........
Q2H4W5_CHAGB/168-472-------------------------------R--AVVWKADR----V-------------------EKEEIEAG..RVRH
ALO_NEUCR/210-513-------------------------------R--AAVWTANV----V-------------------DPVDLKTG..AVKH
Q2UQI3_ASPOR/199-482-------------------------------S--AIVWQADK----T-------------------DLPL..........
ALO_CANAL/202-552-------------------------------K--CVLWRANK----S-------------------TDPL..........
ALO_CANGA/188-518-------------------------------K--CILWRGVK----T-------------------NEPQ..........
ALO_YEAST/186-516-------------------------------K--CVLWRGNK----T-------------------TDAQ..........
ALO_ASHGO/192-522-------------------------------K--CVLWRGVK----T-------------------SEPA..........
ALO_KLULA/190-520-------------------------------K--VVLWRGSK----T-------------------EEPL..........
ALO_YARLI/189-523-------------------------------R--CILWRASK----S-------------------ELPL..........
ALO_SCHPO/187-459-------------------------------R--AVVWRANK----V-------------------EPNTV........P
Q22YW5_TETTS/180-449-------------------------------D--VHIWDVNK----A-------------------SEEEQELYFQNNRE
GULDH_MYCTU/172-425-------------------------------K--ALTRTMHR----S-------------------DEQPK........P
Q81HV8_BACCR/179-429-------------------------------E--VQVKLTNE----T-------------------TNTG.........S

PF02913

D2HDH_ARATH/309-551-----..............RNPVSSS-----ENFYILIETTG----S--------------------DE..-----TNDR
DLD_ARATH/319-560-----..................NLT-----EAPTLMFEFIG----T--------------------E...-----AYTR
Q9RJ97_STRCO/274-525-----..............ASLERQD-----AGCLAVVGFEG----T--------------------GE..-----DTAH
Q9RTM9_DEIRA/229-469-----................GLPRD-----ADAVLLVDTDG----D--------------------DA..-----EIVA
DLD1_KLULA/320-566-----...............SKDNWV-----ESPTLFFKIGG----R--------------------SE..-----QIIQ
ADAS_RAT/370-643-----TSFLDGFKKFYITKFKGFDPN-----QISVATLLFEG----D--------------------RE..-----KVLQ
Q9A317_CAUCR/209-458-----..............RDPLPEA-----HPWYVLIEIAS----G--------------------EP..-----GAAE
Q987U0_RHILO/206-447-----................GYPLD-----VEALLIVELDG----P--------------------G...-----VEVD
Q9S2F6_STRCO/248-487-----................GLPES-----TEALLLAAFDT----T--------------------DP..-----...A
Q9HTK3_PSEAE/230-471-----................GYPVD-----AAAILLCELDG----V--------------------E...-----ADVH
O29450_ARCFU/211-460-----...................DE-----EGNMLVVGIEC----N--------------------H...-----EASE
Q9KSQ8_VIBCH/286-544-----...........DLLTDVPGKE-----MQGINMVEYAG----Q--------------------DS..-----AQIN
Q97G30_CLOAB/221-465-----...............KFPDSA-----ADAYLLLTFDG----N--------------------ST..-----EEIE
Q9I6H4_PSEAE/216-461-----...............RAFETD-----CPFYALLEFEA----T--------------------TE..-----EVAN
Q9K9B9_BACHD/216-457-----................GLPTD-----VQAVLLIEQDG----P--------------------S...-----EVVK
YN53_SCHPO/272-525-----...............RPLEDE-----HPFYVLVETQG----S--------------------NK..-----EHDE
Q986B0_RHILO/224-475-----..............VRPLADD-----WPWYVLMQISS----G--------------------RS..-----EADG
O29853_ARCFU/209-439-----...............RWVSRE-----GEAHLLMVFES----F--------------------D...-----....
Q9F3A3_STRCO/294-548-----..............DWAGLPR-----ETAALLVEFRA----P--------------------DEAG-----QAAF
Q9PGF5_XYLFA/218-457-----..................IPM-----AGAMLLIEGDG----N--------------------H...-----DTLP
Q9HZI0_PSEAE/264-527-----W........LEKYLALRGAGE-----GKCMLTFGVTG----N--------------------RR..-----QNGL
ADAS_CAEEL/313-584-----ADLKSSVSKMYITSWKGFKVD-----EICAATCVYEG----N--------------------RE..-----EVDQ
Q11061_MYCTU/215-454-----................DLDRD-----AAAMLVAGSDE----R--------------------G...-----RAAT
ADAS_DROME/337-605-----SVVDA.MKQRYVTSWKGIDLN-----QICAATLLFEG----D--------------------LK..-----DVQR
O07406_MYCTU/211-446-----................RPPVE-----ADWLLLVELAA----D--------------------HD..-----....
O05784_MYCTU/269-523-----.....................-----.GGLLVLAFES----A--------------------DH..-----PIDP
Q9YEU4_AERPE/215-469-----.................AIRP-----DGHMLLVGVPV----N--------------------R...-----EAST
Q55124_SYNY3/222-464-----...............NCYPRD-----AAAILLVELDG----L--------------------P...-----IEVE
Q9F2Y0_STRCO/247-482-----...................PR-----GGAWLFVETGG----D--------------------TE..-----AEAR
Q9HMR2_HALSA/293-559-----.............VVGLLPDG-----TDSTLLVEFYA----D--------------------SP..-----AEAR
Q9RVK1_DEIRA/212-453-----..................DYP-----ERPTLWIELAS----P--------------------SR..-----AALE
Q986W2_RHILO/218-457-----...............APLPVG-----SPVYVLAEIQG----N--------------------EP..-----ERDG
Q9KKW5_VIBCH/271-520-----..............FIAKLDL-----EAAALLIESHA----S--------------------DA..-----QTLH
ADAS_DICDI/317-586-----EFTSA.MVKKYLHYIRSFDFK-----NVCLSIIGFEG----P--------------------KK..-----VVDF
Q98KG4_RHILO/325-565-----..................DYP-----ESPCLFVEFHG----S--------------------D...-----AGVA
O67645_AQUAE/239-479-----................GLPRD-----VEALLLIEVDG----H--------------------P...-----LTVK
Q9I3S8_PSEAE/214-458-----...............APSLAP-----CPLYLLVELAE----D--------------------RH..-----LDAG
Q88EH0_PSEPK/279-533-----...........EYFPADPERP-----TLGINLVEFCG----D--------------------EP..-----AEVN
Q97U60_SULSO/203-443-----................ANYPM-----AEAILLIELDG----Y--------------------SV..-----NVEE
Q9HKQ4_THEAC/212-457-----..................PEG-----TNYALIVDASG----P--------------------P...-----ETLQ
Q9HV36_PSEAE/265-514-----..............WVKSLSA-----GACALLIESRA----A--------------------SR..-----TLLH
GLCD_BACSU/216-457-----................GLPTS-----AKAVLLIEQDG----P--------------------F...-----ETVE
Q9CMN0_PASMU/284-542-----...........ELLTEQEENP-----ILGLNIVEYAS----N--------------------DK..-----GQIH
DLD2_YEAST/277-529-----..............AFPLEDE-----HPFYILIETSG----S--------------------NK..-----DHDD
YDIJ_ECOLI/281-539-----...........ELITDVPDQE-----MLGLNIVEFAG----D--------------------DE..-----ALID
A4XDV9_NOVAD/262-503-----.....................-----..YAALYGPPP----I--------------------I...-----....
B4R3E5_DROSI/291-531-----...............NSPISG-----FPFYMLIETSG----S--------------------NG..-----DHDE
Y2280_MYCTU/217-453-----.............IPDQIRDS-----CEAYLLVALEN----R--------------------IA..-----DRLF
Q585R0_TRYB2/307-576-----TFFSK.CFKKYIATVKGWNLS-----KISLVVVGFEG----T--------------------KA..-----QTNC
Q7APS7_MYCLE/212-444-----................SSPVD-----GDWLLLVELAA----D--------------------H...-----DQTN
LDHD_MOUSE/245-483-----..................NCP-----VAPTLFLEFHG----S--------------------Q...-----QTLA

PF08031

YGAK_BACSU/399-443--------------------------------------------------------------------------------
Q7RV07_NEUCR/421-465--------------------------------------------------------------------------------
Q6LJC7_PHOPR/280-323--------------------------------------------------------------------------------
Q84PV7_ORYSJ/461-526--------------------------------------------------------------------------------
Q6EUS8_ORYSJ/495-552--------------------------------------------------------------------------------
Q8EGB1_SHEON/850-894--------------------------------------------------------------------------------
Q8XND2_CLOPE/404-448--------------------------------------------------------------------------------
Q92U94_RHIME/427-471--------------------------------------------------------------------------------
Q7SB35_NEUCR/597-641--------------------------------------------------------------------------------
Q7NIA5_GLOVI/31-76--------------------------------------------------------------------------------
Q82GZ2_STRAW/449-493--------------------------------------------------------------------------------
YVDP_BACSU/400-444--------------------------------------------------------------------------------
Q7SHH8_NEUCR/453-496--------------------------------------------------------------------------------
Q84PV6_ORYSJ/334-398--------------------------------------------------------------------------------
O64745_ARATH/479-537--------------------------------------------------------------------------------
Q869M2_DICDI/431-473--------------------------------------------------------------------------------
Q9SA85_ARATH/465-524--------------------------------------------------------------------------------
Q7V3Z6_PROMM/524-568--------------------------------------------------------------------------------
Q9FKU8_ARATH/476-534--------------------------------------------------------------------------------
Q7S915_NEUCR/469-516--------------------------------------------------------------------------------
Q9FKV2_ARATH/471-528--------------------------------------------------------------------------------
Q81C29_BACCR/8-52--------------------------------------------------------------------------------
Q81IH6_BACCR/396-440--------------------------------------------------------------------------------
Q6ZB64_ORYSJ/480-545--------------------------------------------------------------------------------
Q9EX55_STRCO/495-548--------------------------------------------------------------------------------
P71984_MYCTU/413-458--------------------------------------------------------------------------------
Q93S08_STRCO/490-543--------------------------------------------------------------------------------
Q93ZA3_ARATH/477-530--------------------------------------------------------------------------------
Q9SA89_ARATH/469-526--------------------------------------------------------------------------------
Q87IH1_VIBPA/415-459--------------------------------------------------------------------------------
Q8Y3D0_RALSO/458-507--------------------------------------------------------------------------------
Q9FKV0_ARATH/479-537--------------------------------------------------------------------------------
O64743_ARATH/475-528--------------------------------------------------------------------------------
Q84PV5_ORYSJ/467-535--------------------------------------------------------------------------------
B8NRL4_ASPFN/503-546--------------------------------------------------------------------------------
F4HV09_ARATH/467-522--------------------------------------------------------------------------------
M1D3J3_SOLTU/322-380--------------------------------------------------------------------------------
M1W0X9_CLAP2/412-456--------------------------------------------------------------------------------
Q1K7N8_NEUCR/507-549--------------------------------------------------------------------------------
Q7S1P7_NEUCR/454-499--------------------------------------------------------------------------------
Q9FI21_ARATH/469-527--------------------------------------------------------------------------------
Q9FZC7_ARATH/490-547--------------------------------------------------------------------------------
Q9SA88_ARATH/468-523--------------------------------------------------------------------------------
Q9SA99_ARATH/470-527--------------------------------------------------------------------------------
Q9SUC6_ARATH/470-527--------------------------------------------------------------------------------
V4K8Y9_9ACTO/416-460--------------------------------------------------------------------------------

PF09265

K4CKY2_SOLLC/235-510.....SVPLDSNQ..TFDPTHLPKKI.....GPLLYCLEVAL....H--------------------YNKH.....ED..
I1L1H8_SOYBN/249-526.....LLFYPASDH.QRVTSL..VTQ.....YGIIYILELAK....Y--------------------Y.YN.....NS..
CKX3_ORYSJ/232-512.....SSIAFPTNV.DFNPDFGTKNN.....PKIYYCIEFAV....H--------------------DYQN.....KNI.
CKX1_ORYSJ/245-531.....GGFFSDADA.ARVVALAAARN.....ATAVYSIEATL....N--------------------YAAN.....AT..
CKX2_ORYSJ/256-560SSSSSSSFFSDADE.ARVAALA.KEA.....GGVLYFLEGAI....Y--------------------F.GGAAG..PS..
A9TE88_PHYPA/237-513.....SVPFDAKKI.D..PSIIPEEG.....GSVLYCIELVK....K--------------------F.SP.....NH..
A9U580_PHYPA/199-480.....SVPFAPGDI...SEAMIPPQA.....GNIMYCLEVTK....A--------------------Y.SA.....AD..
C5YCF7_SORBI/234-520.....SSVAFPAPV.NFTPDFGSDAGSSSSNKVVYYCIEYAV....H--------------------DFQQ.....QDSA
M0TFY8_MUSAM/196-467.....SSFISEEDS.EKVKLL..ADE.....FGAIYLLEGAV....Y--------------------Y.EQ.....AT..
K3YYC8_SETIT/244-525.....TPFFSATDL.NRLAKLALRKG.....SAAIYYIEGAM....Y--------------------Y.NE.....DN..
D8SXN5_SELML/247-526.....PIPFHGQTL.N..ASLIPPSA.....GPVLYCLELTK....N--------------------Y.DE.....DE..
J3MTM1_ORYBR/125-404.....SVPIPDGA..RFDPSLLPAGA.....GPVLYCLEVALYQQHH--------------------HH...........
CKX10_ORYSJ/246-530.....SSFFSATDL.ARLTGLAIDTG.....SVAIYYIEGAM....Y--------------------Y.DD.....NT..
B9H4G1_POPTR/239-521.....SSFFSPRNP.VKISSV..GAN.....GGVLYCLEITK....N--------------------Y.DE.....ST..
M0S8L8_MUSAM/196-467.....SSFFSERDS.EKIKVL..AAE.....FGVIYFLEGAI....Y--------------------Y.EL.....AT..
C5YM55_SORBI/218-506.....SVPIPGGA..RFDASLLPAGA.....GPVLYCLEVALYQYDA--------------------HHRP.....DD..
K3XHX8_SETIT/127-423.....SSFFSEGDA.ARVAALA.KGA.....GGVLYCLEGAV....Y--------------------Y.GGAGD..TS..
W5B8J6_WHEAT/275-552.....SSIAFPARI.DFSPDFGSNGK.....RKVYYCIEFAV....H--------------------DFGS.........
K7V1U5_MAIZE/241-516.....AS.FKPQDP.VEASHF..QSD.....GRVLYCLELTK....N--------------------F.NS.....DD..
M0RM32_MUSAM/220-488.....SSFFSDTDT.EKVKML..AAE.....YGRIYFVEGGV....Y--------------------Y.EP.....AT..
M1A8V5_SOLTU/250-526.....TS.FDPQDP.VQASHF..VSD.....GRTLYCLELTK....N--------------------L.YP.....EK..
M0RWA6_MUSAM/235-509.....TSIAFPAHL.GFVPEF..........HKVYYCIEFAV....H--------------------DFQA.....KGT.
D7KSP4_ARALL/242-520.....SSFFSPRNP.VKISSV..SSN.....GSVLYCLEITK....N--------------------Y.HD.....SD..
D8S2E8_SELML/208-483.....SVPFDGE...AIDPSLIPDSS.....GPVLYCIEIAK....Y--------------------Y.NH.....GQ..
M0WQT5_HORVD/289-587.....SSFFSDADA.ARIAALA.EEA.....GGILYCLEGAL....Y--------------------Y.GGAAAARGG..
I1GXU3_BRADI/247-523.....SSFFSASEL.ARLAGLTLDTG.....SAAIYYIEGAM....Y--------------------Y.DG.....YS..
I3VIX5_HORVD/238-510.....SS.FNPQDP.ERASRF..ETD.....RKVLFCLEMTK....N--------------------F.NP.....EE..
I1N8X2_SOYBN/261-537.....SS.FDPKNP.LQASQF..SSD.....GKTLYCLEMAK....Y--------------------F.NP.....DE..
I1M956_SOYBN/223-503.....TVPMGPNQ..YFDPLRIPSAA.....GPLLYCLELAL....H--------------------YRNQ.....DH..
W1PP63_AMBTC/225-535.....ASVAFPSHF.HFIASNTNNT......SQVYYCVEIAF....Y--------------------YYSQ.....KAS.
K7LYV0_SOYBN/248-523.....LSFYPEPDH.PRITSL..VTQ.....YGIIYVIELVK....Y--------------------Y.DN.....ST..
I1NS44_ORYGL/244-525.....SSFFSPQNP.VKLSSL..KHH.....SGVLYCLEVTK....N--------------------Y.DD.....ST..
CKX1_MAIZE/246-533.....TGFFTDADV.ARIVALAGERN.....ATTVYSIEATL....N--------------------Y.DN.....ATAA
M0ZWN0_SOLTU/233-515.....SSFFSPSNP.VKISSL..KAE.....GGVLYCLEITK....N--------------------Y.HL.....SN..
B9RGG6_RICCO/247-523.....SS.FNPQDP.LQASQF..ESD.....GRTLFCLELAK....Y--------------------F.KK.....DK..
I1HYS9_BRADI/244-525.....TPFFSGADI.NRLAGLVSRSG.....SGAIYFIEAAM....Y--------------------Y.DE.....AT..
B9RI30_RICCO/238-508.....TSFFPKSDI.PRITSL..IKQ.....HGILYSLEIAN....S--------------------F.DE.....LT..
F6H3S4_VITVI/229-509.....SVPLTPEQ..RFNSGRVPRTA.....GSVLYCIEVAL....H--------------------YKSS.....DH..
W1PC48_AMBTC/235-507.....SSFFTPENP.IQASRF..NSN.....GRTLYCLEIAK....N--------------------F.DF.....NN..
B9RQW4_RICCO/233-514.....SVSLDPDR..GYDHTAIPATA.....GSVLYCLEVAL....H--------------------YQNS.....DH..
M0T0P2_MUSAM/213-487.....SSFFSDRDW.EKVKLL..ASQ.....FGAIYCLEGAV....Y--------------------Y.EL.....AT..
CKX7_ARATH/239-520.....TVPLHPDH..EFDPTRLPQSC.....GSVLYCLELGL....H--------------------YRDS.....DS..
I1LL79_SOYBN/269-545.....SS.FNPQDP.VQASEF..KSD.....GRTLFCLELAK....Y--------------------Y.NL.....EE..
CKX4_ARATH/250-523.....TSFFPLSDQ.TRVASL..VND.....HRIIYVLEVAK....Y--------------------Y.DR.....TT..
B9T889_RICCO/261-537.....SS.FNPKDP.LQASQF..ISD.....GRTLYCLEIAK....Y--------------------F.NP.....ED..
B9HH07_POPTR/240-507.....TSFFHPTQL.PQIMSL..VKT.....YGIIYCLELTK....Y--------------------YFIE.....DI..
I1HCZ6_BRADI/259-559.....SSFSSDADSGARVQALA.REA.....GGVLYCLEGAL....Y--------------------Y.GGASA..DG..
K4DBX8_SOLLC/251-526.....SSFYSPSNQ.TKIASL..LSK.....NKIMYCLEIVK....Y--------------------Y.DD.....QN..
I1L1J0_SOYBN/266-544.....SSFFPLADH.ARIISL..VTK.....HSVLYCLEVAK....Y--------------------Y.DG.....QN..
M0TSS1_MUSAM/191-475.....SVPILPGS..VFDPAKIPAES.....EPILYCLELAL.....--------------------HHNH.....SG..
W1PTT2_AMBTC/244-524.....SVPLLPHQ..TFDLNLIPANA.....GPVLYCLEIAL....H--------------------FANR.....DD..
M7YGJ3_TRIUA/205-501.....SSFFSGPDAAARFAKLA.EEA.....GGVLYCLEGAL....Y--------------------Y.GGAA...GG..
C5XLU9_SORBI/270-568.....SSFYSTADA.ARIAALA.KEA.....AGVLYCLEGAL....Y--------------------Y.GGASD..TT..
CKX7_ORYSJ/234-513.....TPFFSSSDI.GRLAGLASKSV.....SGVIYVIEGTM....Y--------------------Y.NE.....ST..
A9TFW7_PHYPA/211-490.....SVPFVHSEI...SEAMIPPSA.....SAIMYCLEVIK....A--------------------Y.SA.....AD..
D7MM89_ARALL/244-517.....STYYPPSDH.LRIASM..VKR.....HRVIYCLEVVK....Y--------------------Y.DE.....TS..
K7VI02_MAIZE/264-548.....SSFFSAPEL.DQLARLAVATG.....SAAIYYIEGAM....Y--------------------Y.DD.....DTTT
M0SHZ5_MUSAM/198-471.....SSFYVEEDI.TRISRL..AAQ.....YGAVYCLEGAK....Y--------------------Y.DH.....AT..
C5XY40_SORBI/244-525.....TPFFSGTDL.ARLARLASRTG.....SVAIYYIEAAM....Y--------------------Y.TE.....DN..
M1D3U0_SOLTU/258-536.....SVPLNSNQ..SFDPTLLPKKT.....GPVLYYLELVL....H--------------------YNNH.....DD..
W1PW76_AMBTC/30-311.....SVPFSSNQ..TFNSTLIPQES.....GPILYCLELGF....N--------------------YFNY.....TS..
D7LTR1_ARALL/245-521.....LS.FTPEEP.LEASQF..KSD.....GRTLYCLELAK....Y--------------------L.KQ.....DN..
M0TFY7_MUSAM/200-473.....SSFFSKTNS.EKIRGL..AAE.....FGAIYCLEGAV....Y--------------------Y.H..........
A9TFW3_PHYPA/268-544.....SVPFDAKKI.D..PSMIPEEG.....GSVLYYIELAK....K--------------------F.SG.....DN..
M0T1W4_MUSAM/207-492.....PQSHQPKNA...FSRFGAERCVKPRQPTAYYLLEMAI....Y--------------------Y........DDDD
M0SCZ3_MUSAM/209-484.....SS.FNPQNP.VQASEF..DSD.....GRILFCLEMTK....N--------------------F.DQ.....DN..
CKX1_ARATH/263-539.....SS.FSPNDS.TQASRF..KSD.....GKTLYCLEVVK....Y--------------------F.NP.....EE..
K7KSR3_SOYBN/132-409.....SSFFAASNP.VKITSL..NAD.....GGVLYCLEITK....N--------------------Y.DQ.....GN..
W1NUG7_AMBTC/245-525.....SSFFSPRNP.IKLQSIVSGSK.....GTVLYCLEVTK....N--------------------Y.DE.....AT..
B9H8X5_POPTR/248-526.....SSFFPSSDI.PKIMSL..VTQ.....HAIIYCLEVAK....Y--------------------Y.DD.....GT..
I3VIX4_HORVD/239-520.....TPFFSEADI.NRLASLASETG.....SRAIYFIEAAM....Y--------------------Y.DE.....TT..
A9U0K6_PHYPA/202-478.....SVPFDSKKI.D..PSVIPEEG.....GSVLYYIELVK....N--------------------F.SS.....ND..
M0SR52_MUSAM/231-511.....SSFFSPKNP.VKISSV..GSN.....GGVLYCLEMTK....N--------------------Y.DD.....ST..
M0RWJ8_MUSAM/214-498.....SSTAFPTHL.DFTPEFHSNGS.....SNVYYCIEFAV....H--------------------DDGS.....KNA.
CKX8_ORYSJ/239-523.....SSVAFPAQL.NFSPDFGSKGR.....KKVYYCIEFAV....H--------------------DFQQ.....DSS.
W5D410_WHEAT/239-515.....GGFFTDADV.ARIVAVAAARN.....ATTVYVIEATL....N--------------------Y.DN.....AT..
K7KI99_SOYBN/133-410.....TVPLGPEQ..VFDPTHIPFTA.....GPVLYCLELAL....H--------------------YRNA.....DH..
I1HCT8_BRADI/241-520.....GGFYSDADV.SRIVALAALRN.....ASSLYAIELTL....N--------------------Y........VN..
I0IUQ8_SOLLC/258-534.....ST.FNPKDP.LLATKF..SSE.....GKVLYCLEVAK....Y--------------------F.NP.....EE..
M0TME6_MUSAM/211-494.....SSVAFPSHL.EFTPEFDSNGSN....YRVYHCIEFAI....H--------------------DYQV.....EST.
F6HGV7_VITVI/246-518.....SSFFSKSQY.PIISSL..LTK.....NGIIYSIEVVK....Y--------------------Y.DD.....LT..
CKX2_ARATH/227-501.....TSFFPPSDQ.SKVADL..VKQ.....HGIIYVLEVAK....Y--------------------Y.DD.....PN..
B9HD10_POPTR/233-515.....TVPLDPDQ..GFDPSRVPRTA.....GSVLYCLEAAL....H--------------------YQKT.....DH..
B9RK75_RICCO/250-528.....SSFFPSSDI.PRIMSL..VTQ.....HGIIYCLEVAK....Y--------------------Y.DD.....AT..

PF09330

Q16DY3_ROSDO/271-558-------------------------------KDTLLMINWLG----T-------------------.DFLPRIFAMKGAM
D8ISV9_HERSS/281-569-------------------------------KDLFLYIRKAG----T-------------------.DKVPLAFALKSRF
X2HJ85_9NEIS/275-564-------------------------------KDIFVAIQKFG----T-------------------.DAMPRLFAFKNFV
B8IIE3_METNO/300-589-------------------------------KDTFLLIRALG----T-------------------.SRLPTFFKLKSSF
A8GBH8_SERP5/274-563-------------------------------KDTFMMIDKLG----T-------------------.DQMPSFFTLKGRM
Q7VS08_BORPE/283-572-------------------------------KDTFLAIRQLG----T-------------------.ARLPRLFAIKARI
C7MHH4_BRAFD/277-568-------------------------------KDTYVSLKHAG----S-------------------.RTLVRMFALKSWA
Q32EL2_SHIDS/278-567-------------------------------KDTFLMIDKLG----T-------------------.DKMPFFFNLKGRT
A1B668_PARDP/280-568-------------------------------KDTFLFIRHAG----T-------------------.DRMPAFFAAKARM
I2B7H2_SHIBC/278-567-------------------------------KDTFLMIDKLG----T-------------------.DKMPFFFTLKGRT
B8BXH2_THAPS/394-691-------------------------------RILTYMIRVLG----M-------------------GDVMGMMWGVKIAI
A6VYY6_MARMS/276-565-------------------------------KDSYLVIDKLG----T-------------------.KYIPKMFALKRTV
M9X3I1_PASHA/272-562-------------------------------KDTFWVIKKLG----T-------------------.HRLPQLFSLKAKV
Q0C1N1_HYPNA/263-552-------------------------------KDLLLAVRTAG----A-------------------.DRLPFLFGFKAGV
D3V833_XENBS/278-567-------------------------------KDTFVMIDKLG----T-------------------.DKMPMFFSLKGRM
Q5NQX4_ZYMMO/284-573-------------------------------KDTFLAIEYLG----T-------------------.DRLPQLFAMKGWF
Q7N371_PHOLL/278-567-------------------------------KDAFIMIDKLG----T-------------------.DKMPTYFTLKGRM
U5T2S7_9GAMM/273-552-------------------------------KDSFLLIKKLG----T-------------------.ARLPKAFALKTRI
F6AE61_PSEF1/273-561-------------------------------KDTFLLIDRFG----T-------------------.ARVPAAFAMKSRV
A5WED9_PSYWF/295-584-------------------------------KDTFLSIKHLG----T-------------------.DTLPRLFSIKGAI
I1YIL1_METFJ/275-564-------------------------------KDTFLVIDKLG----S-------------------.KYIPKLFSLKRTV
C7M6Y2_CAPOD/272-562-------------------------------KDTFWYIKNVG----T-------------------.EYLPKLFSLKAWG
C5ZZE0_DINSH/276-563-------------------------------KDTVMMINWLG----T-------------------.DKLPMFFAMKGAV
C5BHL3_EDWI9/279-568-------------------------------KDTFLMIEKLG----T-------------------.DRMPFFFNLKGRI
I0DPH6_PROSM/278-567-------------------------------KDTFLMIDKFG----T-------------------.DKMPLFFTIKGRI
F6IEM7_9SPHN/289-577-------------------------------KDTFLAIRHLG----A-------------------.KQLPVVFSLKSRF
G8MIK8_9BURK/283-568-------------------------------KDLFVIIDRFG----T-------------------.DRLPAFFNLKTRC
E6WEH0_PANSA/273-563-------------------------------KHMYLAIRKLG----P-------------------.QAIPRLMAGKAKW
I0HV55_RUBGI/273-561-------------------------------KDTFLLIDRFG----T-------------------.ARVPKAFALKSRI
E3F2U2_KETVY/276-564-------------------------------KDIFLALKYAG----T-------------------.ERMSTLYRLKSGF
S5XTB9_PARAH/284-572-------------------------------KDTFLFIQKAG----T-------------------.DRMPGLFALKSRV
B2IER8_BEII9/289-578-------------------------------KDTFLAIRALG----T-------------------.DRLPKLFAWKAKF
K7SGY9_GLUOY/277-566-------------------------------KDTTAIIRYMG----T-------------------.RFLPTFFGLKSRF
N0APL0_9BACI/270-559-------------------------------KDSFLVINKLG----T-------------------.DRLPFLFGLKANA
J7U450_MORMO/278-567-------------------------------KDSFLMIDKLG----T-------------------.EKMPKLFTIKGRM
Q8NRY8_CORGL/279-570-------------------------------KDTFVFLKFMS----P-------------------.ALQTRMFSFKTWA
W0HXS9_9ENTR/288-576-------------------------------KDTFLLIHWLG----T-------------------.ARLPALFALKNRF
U3TWX4_9ENTR/276-565-------------------------------KDTFVMIDKLG----T-------------------.DKMPLFFTLKGRV
Q7CH75_YERPE/279-568-------------------------------KDTFVMINSMG----T-------------------.NNMPRFFTLKGKI
F4HE38_GALAU/273-562-------------------------------KDTFWAIKILG----T-------------------.NNLPKLFKLKNNV
W0AF31_9SPHN/283-572-------------------------------KSTFFAINLLG----T-------------------.ERLPMLYTIGAKL
G8PGV4_PSEUV/272-560-------------------------------KDTVVMINHLG----T-------------------.DRLPMFFALKGAM
D8MM49_ERWBE/273-563-------------------------------KHMYWAINRFG----P-------------------.EALPQLMANKAKW
Q13Q13_BURXL/285-573-------------------------------KDTFLAINYLG----T-------------------.SRLPALFGLKSRF
B0UTX6_HISS2/274-564-------------------------------KDTFWIIKKFG----T-------------------.HRLPKLFALKAKV
D4Z0R4_SPHJU/277-567-------------------------------RDSFFAIKYLG----T-------------------.RRLPRLFALKRAL
G4R7Z9_PELHB/272-560-------------------------------KDTFLIIKRFG----T-------------------.DRIPTAFAAKSWV
Q7V9S2_PROMA/275-565-------------------------------KDTFLFLKYFG----T-------------------.KYLPKLLEAKRYI
H2IVR9_RAHAC/272-561-------------------------------KDTFLMIDKLG----T-------------------.DKMPDMFTAKGKF
F2G3K5_ALTMD/276-565-------------------------------KDMFIVISKLG----A-------------------.KFIPKLFAFKRKF
C7JDF4_ACEP3/277-566-------------------------------KDTFAVIRYFG----T-------------------.KFLPKMFAMKSRF
F2JZ95_MARM1/276-565-------------------------------KDSYLVIDKMG----T-------------------.KYMPKMFAMKRTV
T2DLG8_ALTMD/271-561-------------------------------KDTILSVQRLG----T-------------------.DSLPKMFALKGRV
Q6D2B5_PECAS/284-573-------------------------------KDTFMMIDKLG----T-------------------.DKLPLFFNLKGQV
B2FII9_STRMK/273-560-------------------------------KDSFLLIDRLG----T-------------------.ARVPAAFALKSRV
G4QGM0_GLANF/289-578-------------------------------KDTFLSVLHLG----T-------------------.ERLPRLFSIKGSI
B4E754_BURCJ/288-575-------------------------------KDTFLMIRHFG----T-------------------.KRMPMLFGFKSKC
D8MPZ9_ERWBE/278-567-------------------------------KDTFVMIDKLG----T-------------------.DKMPLFFTLKGRT
B4ETB6_PROMH/278-567-------------------------------KDTFLIIDKLG----T-------------------.DKMPALFAIKGRV
G2KVV8_LACSM/270-559-------------------------------KDNLMVIDDIG----T-------------------.KPLPFLFNARAAS
X2H2U0_9GAMM/275-570-------------------------------KHLFLAIQKLG----T-------------------.DTIPKMYALKNFV
G7URI2_PSEUP/281-570-------------------------------KDTFLAIRTLG----T-------------------.QRLPSFFAAKSRL
D5QJ51_KOMHA/278-567-------------------------------KDTFLVIRMLG----T-------------------.RRLPALFAMKARF
C5BSR5_TERTT/274-576-------------------------------KDTFIAIKRLG----T-------------------.DAMPRLFSVKGYF
Q6FFS0_ACIAD/279-567-------------------------------KDTFLFIEKFG----T-------------------.ANVPKAFAMKDKI
Q5FRI2_GLUOX/282-571-------------------------------KDTFAVIRYFG----T-------------------.KYLPMFFSMKSRF
Q87HG0_VIBPA/273-562-------------------------------KDVFLSIDLLG----T-------------------.DKLPKMFALKAKV
Q6LQ09_PHOPR/273-562-------------------------------KDVFLSINYLG----T-------------------.ESLPKFFALKAKV
H8L1S9_FRAAD/288-574-------------------------------KDTFLMIHHLG----T-------------------.SRLPAMFALKAKC
F6IHY7_9SPHN/276-565-------------------------------KDTVIAIERLG----T-------------------.ARLPRLFGAKARL
A6VK90_ACTSZ/272-562-------------------------------KDTFWVIKKFG----T-------------------.DWLPKLFALKANV
Q9JZL7_NEIMB/272-561-------------------------------KDTFYVIKKFG----T-------------------.HQLPKLFDLKARV
K0HVQ3_9BURK/282-571-------------------------------KDLFVYIRKLG----T-------------------.ARVPLAFALKSRF

PF09129

V9XKK4_9NOCA/261-581TGPYNYP-------FS----DNVPEPITDL-------------LGHIT.AGNTSIAPAFGQTYYGVTVA-------GLAA
E9T1B4_COREQ/275-613SGPYNYI-------FS----DNLPEPITDM-------------IGAIN.AGNPGIAPLFGPAMYEITKL-------GLAA
C0ZNA9_RHOE4/268-586SGPYNYF-------FS----DAIPEEVTTP-------------LGMVA.QGLQAATPLFGASQFGAVAA-------GLAL
E3J1G5_FRASU/288-608SSPYNYS-------FS----DNLPSSITDL-------------VAQIS.TGAPQLAPTLGQTQIAVVGA-------GLIS
E5ASP8_BURRH/293-606TKANNYP-------FS----DWIPTELSDL-------------IKRIVIDNEVTITPHFGQKQLAITTA-------GLIT
Q13UN0_BURXL/264-584KQPYNYP-------FS----DSISQPLADL-------------VKRIMIGGECYLTPLFGQLQMGIVVA-------GLGV
C0ZPW5_RHOE4/267-587TGPYNYI-------FS----DNLPEPVTDM-------------IGQIN.AGNPGIAPAFGQIMYATTVA-------GLAA
V9XKE0_9NOCA/262-582QDPYNYY-------FS----DSLPEELTDL-------------LGQVV.RGAQGVTPTFGASQFGAVAA-------GLAA
W5W8X8_9PSEU/258-566ASPYNYG-------FS----DSLPDSVTAV-------------VGQVT.AGACALTPALMHALITVAST-------GLLA
D3VCK8_XENNA/241-561DTPYNYP-------FS----DNISLNISDF-------------MENVL.VNAPAITPFIGETQYQLTKA-------ALQG
Q63X30_BURPS/264-586EEPYNYP-------FS----DSISRELSDL-------------VSRIVLNGEIQLAPLFGKTQYTIAYL-------GLTN
E9SX65_COREQ/264-584FGPYNYF-------FT----DNLPEPLTDL-------------LGQVA.GGIQAATPAFGVGQLAAVQA-------GLAL
Q9HWP1_PSEAE/277-597NGPFNYP-------FS----DNIPKALSDL-------------LAAIN.TGHPELTPLLGKLQYDLVVG-------GMAL
B5I5E6_9ACTO/259-569TSPYNYP-------FS----DNVPTVVADL-------------AGRMVSDAAWYLAPVLGNAQLDVATV-------GLTA

PF04030

ALO_DEBHA/202-551SKPRDSW-------YG----TWFGRKFYES-------------LLWISVHICPHLTPLIEKFVFKNQYGDVE..TLGHGD
GGLO_RAT/180-438SSASNWF-------WD----YAIGFYLLEF-------------LLWTS.TYLPCLVGWINRFFFWMLFN........CKK
A5WEE3_PSYWF/185-441QKLKDHF-------ES----IVILNGAFYL-------------LSELA.RMNPKLTKKVSEISANSIPN..........T
Q8EQI8_OCEIH/179-431SIKRHQW-------NN----LIVENYMYQA-------------VSHLC.LLYPSLTRSVSRLSAKLVSK..........S
Q47NJ0_THEFY/176-430SAFRAWL-------DD----EFLSNSVFEV-------------VNRMA.RRLPRLIPAINQISARALTA..........R
Q82KJ4_STRAW/182-436GQLSGWI-------ED----EFLSNGVFQV-------------ANLLG.RAVPATIPTLARVSSRALSA..........R
Q2JG59_FRASC/206-462PRLRCWV-------DD----ELVSNTLFGA-------------LMTTG.RRMPAAVRPIAHVSARASGS..........R
Q4JW76_CORJK/189-446PRWKEVL-------DD----ELLNNGAYRA-------------MCDLA.HHFPSLSRPFAKLSAKTLAQ..........R
Q5YR83_NOCFA/174-426AKAVDWL-------AD----IVLSNYTFDA-------------LCRLG.RAQPRTIPWIHRAAAYAGSY..........R
Q9HTM8_PSEAE/186-438LDPAKEG-------GN----EFVG..LIEG-------------LDKYL.SDFPETRRTLLNSLRHFARF..........D
Q983S0_RHILO/175-424.......-------DD----DEGSLRTLRR-------------LRTGL.AWLPSLRRRLILGAVAKVPS..........E
Q57ZU1_TRYB2/262-506TRICKIL-------KG----SWLRHGVVEA-------------ALAAA.VIQPGIQPYINRTYRRLFYN........APE
Q5K700_CRYNJ/204-464AQPTSDL-------VG----HILGFHVTQF-------------FLYVA.RIFPSLTSLVGRWAWWLSKE.........DS
Q2H4W5_CHAGB/168-472SQPPTSF-------QD----SRLGYIVYQN-------------LLALA.RWFPRVTPWIEWFVFGLNYGFRN..GESTRV
ALO_NEUCR/210-513REPPTSY-------YD----SWLGYYVYHN-------------LLALS.RWIPRITPWIEWFVFGMQYGFKN..GEVTRI
Q2UQI3_ASPOR/199-482RAPPATF-------YG----ETIGYHIYHN-------------LLALA.NYFPRILPWVEWFVFGLQYGFR...SEAKVT
ALO_CANAL/202-552SDPRPSW-------YG----TKLGRFFYES-------------LLWVSVHLFPRLTPFVEKFVFGQQYGEVE..TLGKGD
ALO_CANGA/188-518TKSRYSW-------WG----STLGRFFYQT-------------LLFISTKIYPPLTPYVERFVFRRQYGEVE..TLGKGD
ALO_YEAST/186-516NGPAKSW-------WG----TKLGRFFYET-------------LLWISTKIYAPLTPFVEKFVFNRQYGKLE..KSSTGD
ALO_ASHGO/192-522EKSRSSW-------WG----TTLGRLVYES-------------LLWLTVNVYPSLTPFVERFIFRQQYGKVE..TFGNGD
ALO_KLULA/190-520TAPRKSW-------WG----STFGRFIYES-------------LIWISVKIYPALTPYVESFVFHQQYGRVE..TYGSGD
ALO_YARLI/189-523SAPRPSW-------YG----TWLGRLFYET-------------LLWVSVRLWPSLTPSVERFIFSRQYGMEDTLGSGTGS
ALO_SCHPO/187-459HTPKPSL-------FR----LKLDSFVYQC-------------LLFVG.KCVNRVTPYLERFWFKCHYGSK....LGTAL
Q22YW5_TETTS/180-449LTQISQQ-------TD----NQLNEAIDQI-------------ILKMSYETCDDKFEGRQFETVQRFKS.........VT
GULDH_MYCTU/172-425TPGWQRM-------VG----ENFENGGLSL-------------ICQTG.RRFPSVAPRLNRLMTNMMSS..........S
Q81HV8_BACCR/179-429DLKWHKL-------KV----ELLENRMFSL-------------LSKGC.KWFPSISKGVSRLSAKAVPN..........T

PF02913

D2HDH_ARATH/309-551EKLEA.F-------LL----KSLEKGLVSD.............G..VIAQDINQAS..SFWRIREGITE...........
DLD_ARATH/319-560EQTQ..I-------VQ----QIASKHNGSD.............F..MFAEEPEAKK..ELWKIRKEALW...........
Q9RJ97_STRCO/274-525RREGAAE-------IL----RESGGTFAGE.........................EPGERWAHGRYSAP.........YL
Q9RTM9_DEIRA/229-469AELE..L-------VA----QACAAAGGTV................RRAANDAEAD..ALWRARRSISP...........
DLD1_KLULA/320-566EVIK..E-------VE----KIASQHNNTK.............F..EFATDEDSKL..ELWEARKVALWS.......TID
ADAS_RAT/370-643HEKQVYD-------IA----AKFGGLAAGE.........................DNGQRGYLLTYVIA.........YM
Q9A317_CAUCR/209-458AALER.L-------LA----GALERGLIAD.............A..AVAQTETQMK..AFWHIREGHSA...........
Q987U0_RHILO/206-447HLIT..A-------VE----AIAISNGSTT.............C..RISQSEAERL..SFWAGRKAAFP...........
Q9S2F6_STRCO/248-487ADLA..A-------VG----ALCEAAGATQ.............V..VPAEDAAESE..LLLQARRLALT...........
Q9HTK3_PSEAE/230-471EDCE..R-------VR----ELFEAAGATS.............V..RQAQDEAERQ..RFWAGRKNAFP...........
O29450_ARCFU/211-460RIAS..A-------LE----SILSQTARRV................IIARNQRELEEKNLLALRRAFYPLA.....IKLA
Q9KSQ8_VIBCH/286-544QQVA..Q-------LT----ARLDEMMANQQA.........GIIGYQVCSDLASIN..RIYNMRKKAVG.........LL
Q97G30_CLOAB/221-465KDYE..S-------AA----NIVLNEGALD.............I..FIADTDERKE..AIWSARGAFLE...........
Q9I6H4_PSEAE/216-461EALA..T-------FE----HCVEQGWVLD.............G..VMSQSEQQLQ..NLWKLREYISE...........
Q9K9B9_BACHD/216-457REME..K-------MH----ALCEQGQAIS.............V..QIAESEDEAE..ALRTARRSALS...........
YN53_SCHPO/272-525QKITA.L-------VE----DLLEKEIISD.............G..VLAQDESQLR..VLWERREGITE...........
Q986B0_RHILO/224-475RALIEEV-------LA----DGLQQGIVGD.............A..VVAASLAQGD..AFWNFRETLPE...........
O29853_ARCFU/209-439.EAE..E-------AA----KIAQSLGAID.............V..YAATTKKDQD..RLLKVRGMIYE...........
Q9F3A3_STRCO/294-548ERAAARV-------VE----RLELVAPVAS.............VTNAFTRDAKVIS..GYWKARKAFVT..........A
Q9PGF5_XYLFA/218-457YILQ..A-------LA----QAASGEGLID.............L..DVAMDGAARD..QLWVARKSLSP...........
Q9HZI0_PSEAE/264-527SLSQAKA-------LL----KRFGGVFTGT.........................LLGRKWAQNRFRFP.........YL
ADAS_CAEEL/313-584HEERLNK-------LA----EQFHGVVGGA.........................ENGQYGYRLTFAIA.........YL
Q11061_MYCTU/215-454EDAA..V-------MA----AVFAENGAID.............V..FSTDDPDEGE..AFIAARRFAIP...........
ADAS_DROME/337-605QEALIYE-------IA----EKFQGFPAGG.........................QNGERGYILTFVIA.........YI
O07406_MYCTU/211-446......Q-------TD----RLADLLGGARM...........CGEPAVGVDAAAQQ..RLWRTRESLAE...........
O05784_MYCTU/269-523WLHRAVA-------IT----AEHGGTVTAQ.............RSRGTTSDATEHNAAANWRSAFLRMP.........YQ
Q9YEU4_AERPE/215-469RVLE..E-------MV----SIAKAAGAAS.............V..YTAKSMEEAEEKKLLEIRRSLFATQ.....ALLT
Q55124_SYNY3/222-464LNQA..K-------VE----EICRNNGARN.............T..AIAYDQETRL..KMWKGRKAAFA...........
Q9F2Y0_STRCO/247-482ARAE...-------..----AVVRAADVVD.............A..LVVTDPAGQR..TLWRIREDASG.........TA
Q9HMR2_HALSA/293-559RRVADLL-------AD----RLPSATPAADPPGATTTDAPVHAVDALEAYDDDRQA..HFWKMRKAGLP.........IL
Q9RVK1_DEIRA/212-453ESLS..V-------CS----DLCRDAGGQD.............L..AVATSAEERA..AVWEARHKAYS...........
Q986W2_RHILO/218-457ERFAE.V-------LM----QAVEDGVVDD.............V..VVSQSPREFR..ALWDVREDANR...........
Q9KKW5_VIBCH/271-520AQCEQ.V-------MS----ALQRYHIIES.............V..PFTSESKTVA..TLWGIRKGMFP..........A
ADAS_DICDI/317-586HRTSVFD-------IL----SKNAAFGLGS.........................APGKTWAEKRYDLP.........YI
Q98KG4_RHILO/325-565EQAE..T-------FG----MIAEENGGGP.............F..LWTSVAEERT..KLWKARHDAYW...........
O67645_AQUAE/239-479EEIK..E-------VG----KILEELGAKV................QVAQSEEEAQ..KLWSARKNLGP...........
Q9I3S8_PSEAE/214-458EALTA.L-------LE----DCFEDGLVED.............A..LLAANETQRL..AIWRLREDSDA...........
Q88EH0_PSEPK/279-533AKVQ..A-------FI----QHLQSDTSVE............RLGHTLAEGAEAVT..RVYTMRKRSVG.........LL
Q97U60_SULSO/203-443EEVR..V-------VS----AIRNNNGEV.................FIPKDEEEKN..RWWWGRKGAFP...........
Q9HKQ4_THEAC/212-457RRRE..Q-------IE----GILKKYAIET................RSTTDKAEMN..RIYLARKGLYA.........SI
Q9HV36_PSEAE/265-514EQLGR.I-------MA----SIAEYPLEKQ.............V..DFSEDPAVYN..QLWRIRKDTFP..........A
GLCD_BACSU/216-457RDME..K-------IE----AICKKGDAVS.............V..QTAQTEEEAF..ALTEARRSALS...........
Q9CMN0_PASMU/284-542RQVQ..A-------LC----AELDKKITHQQD.........AIIGYQVCSDLASIE..RIYAMRKKAVG.........LL
DLD2_YEAST/277-529SKLET.F-------LE----NVMEEGIVTD.............G..VVAQDETELQ..NLWKWREMIPE...........
YDIJ_ECOLI/281-539ERVN..A-------LC----ARLDELIASHQA.........GVIGWQVCRELAGVE..RIYAMRKKAVG.........LL
A4XDV9_NOVAD/262-503.ENNWKL-------VE----EAMMSISGAK................LHLNREND....PAWDYRVRLMRGEPNMTEFSIM
B4R3E5_DROSI/291-531EKINQ.F-------IG----DGMERGEIQD.............G..TVTGDPGKVQ..EIWKIREMVPL...........
Y2280_MYCTU/217-453EDIQ..T-------VG----EMLMELGAVD................AYVLEGGSAR..KLIEAREKAFW...........
Q585R0_TRYB2/307-576QRSELVG-------VF----QAFGATCLGT........................KP.GNTWQEKKYDLP.........YL
Q7APS7_MYCLE/212-444RLAELSM-------AV----QMCGVPAVG....................VDAGAQQ..RLWRVRESLAE...........
LDHD_MOUSE/245-483EQLQ..R-------TE----AITQDNGGSH.............F..SWAKEAEKRN..ELWAARHNAWY...........

PF08031

YGAK_BACSU/399-443--------------------------------------------------------------------------------
Q7RV07_NEUCR/421-465--------------------------------------------------------------------------------
Q6LJC7_PHOPR/280-323--------------------------------------------------------------------------------
Q84PV7_ORYSJ/461-526--------------------------------------------------------------------------------
Q6EUS8_ORYSJ/495-552--------------------------------------------------------------------------------
Q8EGB1_SHEON/850-894--------------------------------------------------------------------------------
Q8XND2_CLOPE/404-448--------------------------------------------------------------------------------
Q92U94_RHIME/427-471--------------------------------------------------------------------------------
Q7SB35_NEUCR/597-641--------------------------------------------------------------------------------
Q7NIA5_GLOVI/31-76--------------------------------------------------------------------------------
Q82GZ2_STRAW/449-493--------------------------------------------------------------------------------
YVDP_BACSU/400-444--------------------------------------------------------------------------------
Q7SHH8_NEUCR/453-496--------------------------------------------------------------------------------
Q84PV6_ORYSJ/334-398--------------------------------------------------------------------------------
O64745_ARATH/479-537--------------------------------------------------------------------------------
Q869M2_DICDI/431-473--------------------------------------------------------------------------------
Q9SA85_ARATH/465-524--------------------------------------------------------------------------------
Q7V3Z6_PROMM/524-568--------------------------------------------------------------------------------
Q9FKU8_ARATH/476-534--------------------------------------------------------------------------------
Q7S915_NEUCR/469-516--------------------------------------------------------------------------------
Q9FKV2_ARATH/471-528--------------------------------------------------------------------------------
Q81C29_BACCR/8-52--------------------------------------------------------------------------------
Q81IH6_BACCR/396-440--------------------------------------------------------------------------------
Q6ZB64_ORYSJ/480-545--------------------------------------------------------------------------------
Q9EX55_STRCO/495-548--------------------------------------------------------------------------------
P71984_MYCTU/413-458--------------------------------------------------------------------------------
Q93S08_STRCO/490-543--------------------------------------------------------------------------------
Q93ZA3_ARATH/477-530--------------------------------------------------------------------------------
Q9SA89_ARATH/469-526--------------------------------------------------------------------------------
Q87IH1_VIBPA/415-459--------------------------------------------------------------------------------
Q8Y3D0_RALSO/458-507--------------------------------------------------------------------------------
Q9FKV0_ARATH/479-537--------------------------------------------------------------------------------
O64743_ARATH/475-528--------------------------------------------------------------------------------
Q84PV5_ORYSJ/467-535--------------------------------------------------------------------------------
B8NRL4_ASPFN/503-546--------------------------------------------------------------------------------
F4HV09_ARATH/467-522--------------------------------------------------------------------------------
M1D3J3_SOLTU/322-380--------------------------------------------------------------------------------
M1W0X9_CLAP2/412-456--------------------------------------------------------------------------------
Q1K7N8_NEUCR/507-549--------------------------------------------------------------------------------
Q7S1P7_NEUCR/454-499--------------------------------------------------------------------------------
Q9FI21_ARATH/469-527--------------------------------------------------------------------------------
Q9FZC7_ARATH/490-547--------------------------------------------------------------------------------
Q9SA88_ARATH/468-523--------------------------------------------------------------------------------
Q9SA99_ARATH/470-527--------------------------------------------------------------------------------
Q9SUC6_ARATH/470-527--------------------------------------------------------------------------------
V4K8Y9_9ACTO/416-460--------------------------------------------------------------------------------

PF09265

K4CKY2_SOLLC/235-510PFIM..........IE....KLLGKLRYLK----------------HFRYEIDLTYMNFLSRVDHVEEA----------A
I1L1H8_SOYBN/249-526QAHVNEE.......VA....YLLKGLNFVH----------------TFVFERDVSYEEFVNRVYPLEQM----------L
CKX3_ORYSJ/232-512..NVEQV.......VE....VISRQMSHIA----------------SHLYSVEVSYFDFLNRVRMEEMS----------L
CKX1_ORYSJ/245-531PSSVDAA.......VA....AALGDLHFEE----------------GFSFSRDVTYEEFLDRVYGEEEA----------L
CKX2_ORYSJ/256-560AADVDKR.......MD....VLRRELRHER----------------GFVFAQDVAYAGFLDRVHDGELK----------L
A9TE88_PHYPA/237-513MDTLNKT.......VE....RMVAPLSFIP----------------TLIFTIDVPYEKFLNRLHEVEIS----------L
A9U580_PHYPA/199-480LHNLDQV.......VE....NMLSRLGFHR----------------GLLFKTDTSYLKFLNRLHDVEMQ----------L
C5YCF7_SORBI/234-520AATADHV.......VD....LVSGKLSYLR----------------PHAYSVEVAYWDFLNRVRVEEES----------L
M0TFY8_MUSAM/196-467ASMVYQE.......VE....SLLKQLSFVP----------------GFAFTKDVSYIGFLDRVHEEDTK----------Q
K3YYC8_SETIT/244-525PESVDQK.......ME....ALMDNLSFEP----------------GFVFTKDVTFVQFLDRVLEEERV----------L
D8SXN5_SELML/247-526SATIDET.......VS....SLLAPLGHVP----------------SLVFSKDASYFEFLNRVHDGEIR----------L
J3MTM1_ORYBR/125-404..DMDKR.......VG....EMMQQLKYVR----------------GLEFAAGVGYVEFLSRVNRVEDE----------A
CKX10_ORYSJ/246-530AASVDQK.......LD....ALLEELSFVR----------------GFVFVRDASYVEFLDRVGREEQN----------L
B9H4G1_POPTR/239-521GDTIDQE.......VE....ALMKNLNFIP----------------STVFTTDLPYTDFLDRVHRAELK----------L
M0S8L8_MUSAM/196-467ASLVDQK.......LK....LLLKKLSFVP----------------GFAFTKDVSYLRFLDRVHHDEIK----------L
C5YM55_SORBI/218-506DDDEDQG.......VASVSRRMMARLKYVR----------------GLEFAADVGYVDFLSRVNRVEEE----------A
K3XHX8_SETIT/127-423AADVDKG.......LE....MMLRELQYAR----------------GFAFVQDVSYVEFLDRVRAGELK----------L
W5B8J6_WHEAT/275-552..SVDNV.......VE....LVAGKMSHMR----------------PHMYSVEVSYFDFLNRVRMEEES----------L
K7V1U5_MAIZE/241-516TDTMEQE.......VT....VLLSRLRFIQ----------------STLFHTDVTYLEFLDRVHTSELK----------L
M0RM32_MUSAM/220-488ASMVDQK.......LE....TLLKRLSFVP----------------GFAFTKDVAYISFLNRVQEEET.----------.
M1A8V5_SOLTU/250-526FDTVNQE.......IE....DLLSQLSYIP----------------STLFMSEVPYIDFLDRVHASELI----------L
M0RWA6_MUSAM/235-509..NAEQV.......VE....KITKQMSHIP----------------SLMYSVEVSYFDFLNRVRIEEMS----------L
D7KSP4_ARALL/242-520SETVDQE.......VE....ILMKKLNFIP----------------TSVFTTDLQYVDFLDRVHKAELK----------L
D8S2E8_SELML/208-483EAFMEDR.......LE....RLLGSLSFVP----------------GLTFTTDLTYFDFLNRVHGVEEV----------L
M0WQT5_HORVD/289-587ESDVDQR.......LD....VLLRELRYAR----------------GFAFVQDVSYAGFLDRVRDGELK----------L
I1GXU3_BRADI/247-523AATVDQK.......LE....ALLEELSFLP----------------GLVFIRDVAYVQFLDRVGQEEQK----------L
I3VIX5_HORVD/238-510ADIMEQE.......VH....ALLSQLRYTP----------------ASLFHTDVTYIEFLDRVHSSEMK----------L
I1N8X2_SOYBN/261-537AEAMNQS.......VD....QLLSKLSYIP----------------STLFLSEVSYVEFLDRVHVSENK----------L
I1M956_SOYBN/223-503PSAVDME.......VD....RLLGRLRFVE----------------GLKFCVDVTYMEFLLRVKRVEED----------A
W1PP63_AMBTC/225-535..HVEKV.......AK....ETLRKLDCIP----------------SLVYETEVSYFDFLNRVSAEEAN----------L
K7LYV0_SOYBN/248-523QEHVDED.......VN....FWVEELKFVP----------------TFMFEKDVSYEEFLNRVHADELF----------L
I1NS44_ORYGL/244-525AVTVDQD.......VE....ALLGELNFIP----------------GTVFTTDLPYVDFLDRVHKAELK----------L
CKX1_MAIZE/246-533AAAVDQE.......LA....SVLGTLSYVE----------------GFAFQRDVAYAAFLDRVHGEEVA----------L
M0ZWN0_SOLTU/233-515ADTIDQE.......IE....ILLKKLNYIP----------------ASEFRTDLPYVDFLDRVHKAELK----------L
B9RGG6_RICCO/247-523TDKLNEE.......IM....NLLSQLRYIP----------------STLFLSEVPYIEFLDRVHVSEVK----------L
I1HYS9_BRADI/244-525ASSVDQK.......LE....AVLEQLSFTP----------------GFVFTKDVTYVQFLDRVRVEEEV----------L
B9RI30_RICCO/238-508NKAVQEE.......MK....DFIKALSSKP----------------DYIYHTNVSYLEFLNRVQIPDEQ----------S
F6H3S4_VITVI/229-509ASTVDMA.......VS....RMLGRLGFIE----------------GLEFHVDVGYMEFLLRVKRVEED----------A
W1PC48_AMBTC/235-507ANATDQE.......VE....SLLAQLSFIP----------------STLFSSELPYLDFLDRVHASEVK----------L
B9RQW4_RICCO/233-514PSTVDTA.......VN....SLLGRLGFLE----------------DLRFQVDISFVDFLLRVKRVEEN----------A
M0T0P2_MUSAM/213-487ASSVDQK.......LD....SFLKQLSFVP----------------GFAFAKDVSYMAFLDRVHDGEMK----------L
CKX7_ARATH/239-520NSTIDKR.......VE....RLIGRLRFNE----------------GLRFEVDLPYVDFLLRVKRSEEI----------A
I1LL79_SOYBN/269-545TLLVNQE.......VE....KHLSRLNYIP----------------STLFLTEVTYVDFLDRVHTSEVK----------L
CKX4_ARATH/250-523LPIIDQV.......ID....TLSRTLGFAP----------------GFMFVQDVPYFDFLNRVRNEEDK----------L
B9T889_RICCO/261-537FDIMNQK.......TE....DLLSGLSYIP----------------STLFLSEVSYVEFLDRVHVSEMK----------L
B9HH07_POPTR/240-507ESEIDQD.......LQ....QVFKDFSHVP----------------GLINAKFVSYQEFLTRVPNAENE----------S
I1HCZ6_BRADI/259-559ESDVAKR.......LE....VLLRELRYER----------------GFAFVHDVPYSGFLDRVHSGELS----------L
K4DBX8_SOLLC/251-526ANTIDKE.......LK....KLVKGLKYVG----------------GFMFKKDVSFVEFLNRVRSGELE----------L
I1L1J0_SOYBN/266-544ENNVDKE.......LK....VLLQGLSYIP----------------GFYYEKDVSYVEFLNRVRSGELK----------L
M0TSS1_MUSAM/191-475AAGVDEG.......VAARAKEMMWPLRYMR----------------GLVFAADVSYVDFLSRVGRSEEE----------A
W1PTT2_AMBTC/244-524AKTIEKR.......VS....QMLEPLKFRR----------------GLKFSCDLTYYDFLQRVKSNEEA----------A
M7YGJ3_TRIUA/205-501ERDVDKR.......LE....TLLRELRYAR----------------GFASVQDVSYVEFLDRVHGGELK----------L
C5XLU9_SORBI/270-568AADVDKG.......VE....VLVQELRYAR----------------GFAFVQDVSYVQFLDRVSAGERK----------L
CKX7_ORYSJ/234-513STTMDQK.......LE....SILGQLSFEE----------------GFVFTKDVRYVQFLDRVREEERV----------L
A9TFW7_PHYPA/211-490VQTLDEE.......IE....SMLAPLNFHR----------------ELLFKTDTTYFKFLDRVHELELQ----------L
D7MM89_ARALL/244-517QYTVNEE.......ME....ELSESLNYVR----------------GFMYEKDVTYMDFLNRVRTGELN----------L
K7VI02_MAIZE/264-548ASSVNQK.......LE....TLLEELSFVP----------------GLAFVRDVSYVDFLDRVGRDEQK----------L
M0SHZ5_MUSAM/198-471ASSIDQE.......LR....SVVDDLRYLP----------------GFEFRNDVSYMHFLNRVREGETK----------L
C5XY40_SORBI/244-525AISMDKK.......MK....ALLDQLSFEK----------------GFVFTKDVTFMQFLDRVREEESV----------L
M1D3U0_SOLTU/258-536PSTLNMM.......VE....KLLGKLKYLE----------------HFRFETNLTYMDFLLRVDHVEEA----------A
W1PW76_AMBTC/30-311NPTLEQS.......IE....ELMRGLGYIR----------------GLEFVIDLSYFDFLYRVHAAEVA----------Q
D7LTR1_ARALL/245-521KDVINQE.......VK....ETLSELSYVS----------------STLFSTEVTYEAFLDRVHVSEVK----------L
M0TFY7_MUSAM/200-473....DTKDYDPFRALH....LLLQRLSFVP----------------GFAFTNDVSYVGFLDRVHDGEVK----------L
A9TFW3_PHYPA/268-544ILGLDQI.......VE....RMMAPLSFIP----------------TLVFTTDVPYAKFLNRLHDVELN----------L
M0T1W4_MUSAM/207-492VSDAAKK.......RA....KVLARVSSMT----------------SVEI.LEVSYLDFLNRVREEELS----------L
M0SCZ3_MUSAM/209-484AETVNQQ.......VE....ALLSKLRYIP----------------STLFQSEVSYLEFLDRVHVSEVK----------L
CKX1_ARATH/263-539ASSMDQE.......TG....KLLSELNYIP----------------STLFSSEVPYIEFLDRVHIAERK----------L
K7KSR3_SOYBN/132-409ADSVDEE.......IQ....ALLKKLNFIP----------------TSVFTTDLPYVDFLDRVHKAELK----------L
W1NUG7_AMBTC/245-525ADTVDQE.......VD....SLLKTLSFIQ----------------GSVFTTDLPYIDFLDRVHKAELK----------L
B9H8X5_POPTR/248-526RHIVDKD.......LQ....QLLKGLSFVA----------------GFMFEKDVSFVDFLNRVRSGEQK----------L
I3VIX4_HORVD/239-520APYVDQK.......LE....TVLAQLSFVP----------------GFVFTKDVTYLQFLDRVRVEEVV----------L
A9U0K6_PHYPA/202-478TDTVNET.......VE....RMLAPLSFIP----------------ALVFTIDVSYEKFLNRLHDVEVN----------L
M0SR52_MUSAM/231-511ADTIDEV.......VE....ALLRQLSFIP----------------ATVFTTDLPYVDFLDRVHKAELR----------L
M0RWJ8_MUSAM/214-498..STEEV.......VE....EIARRMSHLP----------------SHLYGAEVSYYDFLNRVRMEEMS----------L
CKX8_ORYSJ/239-523..RADHV.......VK....LVSAKLSYLR----------------PHVYSVEVSYFDFLNRVRMEEES----------L
W5D410_WHEAT/239-515AASVDQE.......LS....SVVATLRHEE----------------GLAFVRDASYLEFLDRVHGEEVA----------L
K7KI99_SOYBN/133-410PSRVDTD.......VD....GLLGRLRFIQ----------------GLKFQVDVTYMEFLLRVKRVEEH----------A
I1HCT8_BRADI/241-520ATAVDQE.......FE....AVVGELRHET----------------GFAFARDVAYEAFLDRVYEEEVA----------L
I0IUQ8_SOLLC/258-534TPNTDQN.......ID....VLLSKLSYIK----------------STLFQSEVSYVEFLDRVHVSEMK----------L
M0TME6_MUSAM/211-494..DVEQV.......VT....EISRKMSHIP----------------SHFYSVEVSYFDFLNRVRMEEVS----------L
F6HGV7_VITVI/246-518SHTVDEE.......LQ....ELFKGLRFLP----------------GLVFTKDVTLVDFLDRVHNGELQ----------L
CKX2_ARATH/227-501LPIISKV.......ID....TLTKTLSYLP----------------GFISMHDVAYFDFLNRVHVEENK----------L
B9HD10_POPTR/233-515PSTVDKA.......VN....SLLGRLGFIE----------------DMKFQVDVSYVEFLLRVKHAEES----------A
B9RK75_RICCO/250-528QHSMSME.......LQ....LMFKGLSFAD----------------GFMFEKDVPYVDFLDRVRSGEIK----------L

PF09330

Q16DY3_ROSDO/271-558DARFAKV-------------PFLPANLVDR-------------VMQVVSNILPEALPKRMMDFRARFEHHLILKVSADSI
D8ISV9_HERSS/281-569DALTEKL-------------G.LGRSLSDR-------------LLQALADRLPAHLPPRLEDMRDRYAHHLLLKMGDEGI
X2HJ85_9NEIS/275-564DRIMAKI-------------PFFPKNFSDH-------------FAVFMCKFLPQHLPQSIRDYRDRYEHHLILKMADDGI
B8IIE3_METNO/300-589DALAKRV-------------AFLPADFSDR-------------VLQAVSRWLPSHLPARIRRFRDAYEHHLLLKMSGEGA
A8GBH8_SERP5/274-563DASLNKL-------------PLLPHNLTDR-------------LMQGLSHLAPSHLPKRMKDYRERFEHHLLLKMAGPGV
Q7VS08_BORPE/283-572DSFCERV-------------PLLPKYLSDR-------------VLQFASRLFPDHLPRRLREYRDAYAHHLMIKVPGKIG
C7MHH4_BRAFD/277-568NGVFAKL-------------SGMGPSVADA-------------ISQKLFSLVPEKIPARLAGFRDRYDHHLLVVVSGSER
Q32EL2_SHIDS/278-567DAMLEKV-------------KFFRPHFTDR-------------AMQKFGHLFPSHLPPRMKNWRDKYEHHLLLKMAGDGV
A1B668_PARDP/280-568DALTERL-------------G.LGATLSDR-------------LAQGVAALMPQHLPRRMNDFRDRYEHHLLLRMGGAGI
I2B7H2_SHIBC/278-567DAALAKV-------------PFVKPYFTDR-------------FMQKLGKLFPRHLPERMQTWRDKYEHHLLLKMSGDGI
B8BXH2_THAPS/394-691EGLPFSW-------------SPL...ICDK-------------LLHTFNNWVPSAIPNKFIQVGREYDHNCVVAVGEFGD
A6VYY6_MARMS/276-565DRWAGKL-------------KFMPSKFSDI-------------MMQYASQLFPNHLPKRMEDFREKYEHHWIVETSNDGV
M9X3I1_PASHA/272-562DRMAKKL-------------TFLPANLSDK-------------ILQAISKMLPQHLPESLRDYRNQYEHHLIIKMGGKGV
Q0C1N1_HYPNA/263-552DGVARWL-------------GFGRACLTDR-------------LLQAVGRLAPPQLSETLRQMGEQYAHHLFLKVEADQA
D3V833_XENBS/278-567DAMFGKI-------------PFLPSHLTDR-------------VIQGLNRLLPSHLPTRLKEYRNRFEHHLMLKMSGEGI
Q5NQX4_ZYMMO/284-573DGLNNRV-------------SFLPRYLSDR-------------VMQFASTLFPHHLPKRMDDFRDRYEHHLILKVSEEGT
Q7N371_PHOLL/278-567DAIFNRV-------------PFLPVNLIDR-------------IMQGLSRLLPSHLPKRLKEYRNRFEHHLILKMSGDGV
U5T2S7_9GAMM/273-552DAFFRRL-------------PLLPAPITDH-------------VLQRLSWLAPDPLPERVVEWRDRFEHHLILRANGDMA
F6AE61_PSEF1/273-561DGFFERF-------------GL..RGVSDR-------------IIQLVMNLLPSHLPPRMRDYRERFEHHLMIRVANDSL
A5WED9_PSYWF/295-584DAKLNKW-------------SWMPKHFTDK-------------VMQFIANIFPNHLPKRMTQYRNKYEHHLILKMSDAGI
I1YIL1_METFJ/275-564DRIAGNF-------------KFLPAKLSDH-------------LMQYLSYLWPNHLPKKMDAFRERFAHHWILEMNDDGV
C7M6Y2_CAPOD/272-562DRVAKKL-------------PFMPNHFSEK-------------FLQFTSKLMPQHLPKILWDYRNQYEHHLILKMGGKGV
C5ZZE0_DINSH/276-563DARLNKF-------------A.LTRGFTDK-------------FMQLASAVVPRLIPKRMMAYRDRFEHHLILKMRDEGI
C5BHL3_EDWI9/279-568DAWAARV-------------PLLPFHPVDR-------------AMQALSRLWPGHLPPRIRQYRDRYSHHLLLKMAGEGI
I0DPH6_PROSM/278-567DAVLNKV-------------PLLPSNLVDR-------------TMQLLSKLWPAHLPPRMKQFRDKYEHHLMLKMAGEGI
F6IEM7_9SPHN/289-577DAFCARL-------------RFAPHDLSDR-------------VIQAAVSLLPRHLPKRMRDYDRRYEHHLILKMGGSGV
G8MIK8_9BURK/283-568DAWFERL-------------GFMPKHLSDR-------------VLQWVSTLLPDHLPARLVAYREQYEHHLMLKVPAAGI
E6WEH0_PANSA/273-563DVRVSHL-------------KFLPRNFVDR-------------VLQFFNQITPRFVAPRIMDYRSEYEHHLMIKVESAQT
I0HV55_RUBGI/273-561DGFFERF-------------GC..RGVTDR-------------VVQAITDRLPSHLPARMRAWRDRYEHHLLIRVSNDQA
E3F2U2_KETVY/276-564DAFTKRI-------------G.LGDNLSDV-------------MLNGLMGILPNHLPKRMNDFAAKYEHHILLRMDGTGI
S5XTB9_PARAH/284-572DALTERL-------------G.LGNTISDR-------------IAQGISRFFPQHLPARMNTWRDRYEHHLLIRMGGAGI
B2IER8_BEII9/289-578DVFVQRY-------------RFLPQDLSDK-------------IMQAVSRLFPSHLPPRMKDYRDRFEHHLMLKMAGPGI
K7SGY9_GLUOY/277-566DIAVQRI-------------PGISSHLSDL-------------LLQAFSKIIPKQLPARMCDFRDRFEHHLMLKVSAELA
N0APL0_9BACI/270-559ERILDKM-------------KIFKPYLPDR-------------ILQKLSYLFPNHLPKRMEEFREKYEHHLMLKMSGAGS
J7U450_MORMO/278-567DAVFNKI-------------PLLPKNLIDR-------------TMQLFSHLWPNHLPRRMEEYRDKYEHHLMLKMAGEGI
Q8NRY8_CORGL/279-570NGLFSKI-------------PGIGPTFADT-------------VSQAMFSVLPNQLPKRMMEYRNRFEHHLLLTVSESQK
W0HXS9_9ENTR/288-576DLLAERL-------------RFLPAHCGDR-------------LLQFLSHLLPNPLPARMNNYRDRYEHHLLLKVSAEGV
U3TWX4_9ENTR/276-565DAWLSKL-------------SFVKPHLTDR-------------LLQRISRWFPAHLPKRLKQYRDKYEHHLMLKMSGDGV
Q7CH75_YERPE/279-568DARLNKI-------------PHLVDHLTDR-------------VMQGFSQILPNHLPKRLKTYRNQYEHHLLLKMSGDGI
F4HE38_GALAU/273-562DRFCRKI-------------PFLPDNISDK-------------LMQFASHLLPQHLPQNLRDYRDQYEHHLILKMANDGI
W0AF31_9SPHN/283-572SAIASRI-------------GIGADRLGPR-------------LIHGLARLLPRHLPRRLTDYRDRYEHHLILRMGGAGI
G8PGV4_PSEUV/272-560DAYLNKI-------------SFLPKNLTDR-------------FMQVLAKIWPSVLPERMSQYRQDYEHHLILKMSDEGI
D8MM49_ERWBE/273-563DIRVKNL-------------KVLPANFVDK-------------VLQFANNVTPKGVAPRILDYRERFEHHLMIKAEARHA
Q13Q13_BURXL/285-573DALFDRL-------------GVFPSHFTDR-------------VMQAASRLFPSHLPPRMKQYRDKYEHHLMLKVAAGSV
B0UTX6_HISS2/274-564DRIAKKV-------------SFLPNDFSDK-------------FMQILSKAMPEHLPKSLWQYRDQYEHHLIVKIGGTGV
D4Z0R4_SPHJU/277-567DRAARWI-------------GIGSDAPSDR-------------LLQRLGNLLPSPLSPPLRRYRDRYEHHLVIRVADDGI
G4R7Z9_PELHB/272-560DGITEKL-------------G.LGGAISDR-------------VVQAITGLLPEHLPRRMNEYRDRFEHHLMIRMGGEGI
Q7V9S2_PROMA/275-565DQLTGQV-------------TFLPENISDR-------------LMQFIADILPNHLPIRLLSFRKKFNYYMLLLASNNSI
H2IVR9_RAHAC/272-561DAHASKV-------------PFLPKNFSDR-------------VMQCLSKALPNHLPPRMKQYRDRFEHHLLLKMSGPGI
F2G3K5_ALTMD/276-565DAFTDKL-------------GFLPNKMSDR-------------VMQYMSYLFPSHLPKRMEEYRDKYQHHWILEMSNVGV
C7JDF4_ACEP3/277-566DIFAKKL-------------GFLPDHLSDR-------------IMQAISYLLPRQLPTRMLDYRDKFEHHLMLKVSHDLA
F2JZ95_MARM1/276-565DRIASKF-------------SFLPNKFSDR-------------AMQFIADFFPNHLPQRMEEFRERFEHHWIVETANAGV
T2DLG8_ALTMD/271-561DGVLNKL-------------PLLPPYFSDR-------------VMQFGSKFFPDQIPQSLRTFRNKYEHHLILKMSDGGI
Q6D2B5_PECAS/284-573DTIFSKV-------------PFLPSHLVDR-------------TMQFLGRLLPSHLPARMKTYRDRFEHHLMVKMAGDGI
B2FII9_STRMK/273-560DGWFERL-------------GL..RGVTDR-------------VMQVLTGLLPSHLPKRMGEFRQRYEHHLLLKVSAQDA
G4QGM0_GLANF/289-578DEALSKV-------------SWLPKSLTDK-------------CMQFCSRLFPQHIPPRLLQYRKDYEHHLILKMSDEGI
B4E754_BURCJ/288-575DAWFDRL-------------GFLPRHLSDR-------------VMQAVSNLFPNHLPPRIRDYGKRYEHHLMLKVSADTA
D8MPZ9_ERWBE/278-567DALLKPV-------------SFLKPNFSDR-------------LLQKISKALPSHLPKRMKAYRDRFEHHLMIKMSGDGI
B4ETB6_PROMH/278-567DAVLNKV-------------PFLPKNLTDR-------------TMQLMSKLWPAHLPARMTEYRDKYEHHLMLRMADSGI
G2KVV8_LACSM/270-559ERILRHI-------------PTFKPYFVDR-------------MLQNMSKIFPDQLPKRMEEFRDKYQHYLQLKVDDQGI
X2H2U0_9GAMM/275-570DRIMSKI-------------PCFSGSFSDK-------------FAVTVCKFWPNHLPKSLRDYRDRYAHHLILKMSDEGI
G7URI2_PSEUP/281-570DALLERL-------------RVFPEHFSDR-------------ALQWLSGRFPDHLPRRMRDFRQRYEHHLLLRMSGTGI
D5QJ51_KOMHA/278-567DRLFDRM-------------GFMPSHFTDR-------------FMQFMSHFFPNHLPRRMRDYRDRFAHHLMLKVSASGA
C5BSR5_TERTT/274-576TSVLNSV-------------PLLPRDLPDR-------------MLQWASKLFPQHLPNRLLRFHARYEHHLIIKMSGDGI
Q6FFS0_ACIAD/279-567DGVLEKL-------------KI..KGLTDH-------------LLQALTFCLPSHLPKRMTEFRDLYQHHLILRIEKNSK
Q5FRI2_GLUOX/282-571DVFAQRL-------------PFLSDHFSDL-------------AMQFLSRFLPKQLPQRMCDYRDRFEHHLMLKVSAHMT
Q87HG0_VIBPA/273-562ENFLERV-------------PFVSKYLPDT-------------ILYYASKLFPQHLPERMLEFRDKYEHHLVLKMSDGGI
Q6LQ09_PHOPR/273-562ENFLGRI-------------PYVSKYLPDT-------------ILYYVSKLFPQHLPKRMLDFRNKYQHHLILKMSDVGI
H8L1S9_FRAAD/288-574DAIFERI-------------PFLPKHLTDR-------------LLQAASHLFPKHLPRRMREFNKKYDHHLLLKVSAEGT
F6IHY7_9SPHN/276-565DAWMRKA-------------PGGLRHASDS-------------FMQAAGRCFGDHLPTRLRAFRDKFEHHLILKMGGNGV
A6VK90_ACTSZ/272-562DRLSKKL-------------PFVPSHFSDK-------------FMQWCSKLIPEHLPKSLWQYRERYEHHLILKMGGKGV
Q9JZL7_NEIMB/272-561DRFGKKV-------------SFLPKHFSDK-------------AMQFVSKFLPDHLPKSMRDYRDKYEHHLILKMGGKGV
K0HVQ3_9BURK/282-571DALAERC-------------G.LGRNLADR-------------LLQRLANRMPEHLPARMNAFRDRYAHHLLLKVSDAGI

PF09129

V9XKK4_9NOCA/261-581TGS..SDIWGWSKDLQFYIKATTLRLTEGGGA-------------VLTNRANIANVIHDFAHWFSERI---------EHY
E9T1B4_COREQ/275-613TNA..NDIWGWSKDVQFYIKATTLRLTEGGGA-------------VVTSRANIATVINDFTEWFHERI---------EFY
C0ZNA9_RHOE4/268-586TDT..DDLWGWSKDVLFYLRHTTLRVVAGGGA-------------VITKRSNIGRVVHEMTSWLNERM---------THY
E3J1G5_FRASU/288-608TLT..YDIWGWSKDLTLYVRPSTLRVTANGYA-------------ILTSRANIQRVVNEFCAYYRTKL---------TTY
E5ASP8_BURRH/293-606THS..LDIWGWSRNVLQYIRPSTLRVTANGYA-------------VVTSRANVQRVISEFVENYQERI---------NAY
Q13UN0_BURXL/264-584TFS..SDIWGWSRNVLQYIRPSTLRVTANGYA-------------VLARRADVQRVIYEFVQFYQNRV---------DVY
C0ZPW5_RHOE4/267-587TFS..NDLWGWSKDVQFYIRATTLRLTEGGGA-------------VITSRANIGQVIHDFTQWFNGRM---------EYY
V9XKE0_9NOCA/262-582TGT..KDLWGWSKDLLFYLRAATLRVVAGGGV-------------VVTRRDNIARVINEFTTWLHERM---------THY
W5W8X8_9PSEU/258-566TGT..LDVWGWAKDVLLYVRPTTLRVTANGYA-------------VLTRRAEVQRVVSDFHQALEQLL---------GDY
D3VCK8_XENNA/241-561NAK...DIWGWSKNVLLYVRPTTLRVTANGYA-------------VLTRRADIQRVLNVFYTQWQNLM---------AEF
Q63X30_BURPS/264-586IFRPLTNLWGWSRSVLHYVRPTTLRVTANGYA-------------VLTRRENVQRAINEFVGAYRQRV---------AAY
E9SX65_COREQ/264-584TDT..DDLWGWSKDVLFYLRHTTMRVTAGGGV-------------VVTERANIQRVVNEFTTWHNSRM---------SEL
Q9HWP1_PSEAE/277-597TLG..YDLWGWSKDLLLYIKPSTLRVTANGYA-------------VLTRRRDVQRVINEFYLQYQTMV---------AAY
B5I5E6_9ACTO/259-569TLS..ADIWGPSKNTLLYIKPTTLRVTANGYA-------------VLTGRDQVQRVVSEFADFYRERL---------AAY

PF04030

ALO_DEBHA/202-551VAV--------QNSVEGLNMDCLFSQFVNEWS-------------T--PLSSGQDVLIKLNDVIQTARE...........
GGLO_RAT/180-438ESS--------NLSHKIFTYECRFKQHVQDWA-------------I--PREKTKEALLELKAMLEAHP............
A5WEE3_PSYWF/185-441HRQ--------GYSYEVFPTPRGVRFNESEYF-------------I--KLSDFDQCITEINDILLQDD............
Q8EQI8_OCEIH/179-431TID--------AKSYQLFATPRKVRFLEMEYG-------------I--PIEYFHDAIQEIRETIVKNQ............
Q47NJ0_THEFY/176-430EYV--------DVSYRVFTSPRRVKFVEMEYA-------------I--PVEHLPDVLHDMRAVFASSR............
Q82KJ4_STRAW/182-436TYT--------DIPYKVFTSPRRVRFVEMEYA-------------V--PREALVETLRELKSMVDRSP............
Q2JG59_FRASC/206-462TFR--------DLSYRVFTSHRRVRFKEMEYA-------------L--PRADLAATLRELVYAMGSAD............
Q4JW76_CORJK/189-446EYS--------NVAHDVFVSARRVRFNEMEYS-------------V--PLADAREILRDVQHTMNTCG............
Q5YR83_NOCFA/174-426RQV--------DRSYRVFASPRLIRFTEMEYA-------------I--PREHSAEAIRAIKEIAAR..............
Q9HTM8_PSEAE/186-438ERV--------DDSYAVYANVRNVRFNEMEYS-------------V--PAEHGPACLREILALIRDKD............
Q983S0_RHILO/175-424DYV--------QDWLNVYASDRQTKFNEMEYH-------------L--PFEEGPKALAEIIELTEKRF............
Q57ZU1_TRYB2/262-506VQY--------GTSLECFTFDCLFKQWACEWA-------------I--DISNVMPAFHYLRGLISSEN............
Q5K700_CRYNJ/204-464VMV--------DDGYKVLNFDCLFPQYALEWA-------------I--DAKEAKACLQEMKKWLDREAAD..........
Q2H4W5_CHAGB/168-472SGC--------QESYKAFLLNCLYSQFVNEWA-------------I--PLHKGPEALQRLGAWLNRLQPGDPGYVDHRIP
ALO_NEUCR/210-513GAV--------QPSQKAFLLNCLYSQSVNEWA-------------I--PLHKGPEALQRLGAWLQNLKPGDPGYVEHGIP
Q2UQI3_ASPOR/199-482EAV--------EPARAGLLLNCLYSQFVNEWA-------------L--PLEKGPEAIIRLSAWLNGDTETARI......P
ALO_CANAL/202-552IAV--------QNSVEGLNMDCLFSQFVNEWS-------------S--PLNSGPEILTELKKIITDASQ...........
ALO_CANGA/188-518VAI--------EDSVTGFNMDCLFSQFVDEWG-------------C--PMDNGLEVLRSLDHSIAQAAA...........
ALO_YEAST/186-516VNV--------TDSISGFNMDCLFSQFVDEWG-------------C--PMDNGLEVLRSLDHSIAQAAI...........
ALO_ASHGO/192-522EAV--------QTSIDGLNMDCLFSQFVDEWA-------------C--PLNNGPEVLRSLDHSIAQAAQ...........
ALO_KLULA/190-520VSV--------QTSIAGLNMDCLFSQFVDEWG-------------C--PLNNGPEVLRSLDYSITQAAQ...........
ALO_YARLI/189-523EAV--------QGSVEGLNMDCLFSQFVNEWG-------------M--PLDNGPDVLRALRAKIEAAAK...........
ALO_SCHPO/187-459QVA--------GPGFDVLQMFCYFSQHVSEWG-------------I--PLESAPDALEKLINYTVDDAG...........
Q22YW5_TETTS/180-449NVV--------GDIYQVFCKGIPVPQINCEIA-------------V--PFEQITEVLHALRDWYRKSE............
GULDH_MYCTU/172-425TVQ--------DRAYKVFATQRKVRFTEMEYA-------------I--PRENGREALQRVIDLVRRRS............
Q81HV8_BACCR/179-429KII--------GPSYEVFATSRTVPFYEMEYS-------------I--PSKYMRTVVEEISNLIEKKK............

PF02913

D2HDH_ARATH/309-551...--------ALQKAGAV------YKYD----------------LSLPVEEIYNIVNDLRGRLGDLA...........N
DLD_ARATH/319-560ACY--------AMAPGHEA------MITD----------------VCVPLSHLAELISRSKKELDASS..........LL
Q9RJ97_STRCO/274-525RDA--------LLDAGALA------ETLE----------------TAALWSRLPALYAAVREALTATLTAA...GTPPLV
Q9RTM9_DEIRA/229-469..S--------LGRIRPQR------MNED----------------IVVPRSALPDVVREIRALGDASP..........FH
DLD1_KLULA/320-566TGR--------KTNPDANI------WTTD----------------VAVPISKFADVINATKEEMNASG..........LL
ADAS_RAT/370-643RDL--------GLEYYVVG------ESFE----------------TSAPWDRVIDLCRNVKERIRRECKERG.VQFAPLS
Q9A317_CAUCR/209-458...--------GQKPEGAV------WKHD----------------VSVPVSKIPDFIGQANAAIEKSFP........GTR
Q987U0_RHILO/206-447..A--------VGRISPDY------YCMD----------------GTIPRKELPRVLAGMRELSEKYG..........LG
Q9S2F6_STRCO/248-487..A--------LEAVKGTT------MIDD----------------VCVPRSRLGDMLEGIDRVAAKYG..........LT
Q9HTK3_PSEAE/230-471..A--------VGRISPDY------YCMD----------------GSIPRRELPRVLHGIAELSREYG..........LR
O29450_ARCFU/211-460SKE--------FGTKKSLV------LIED----------------ISVPVSKLPEAIRGIKEIARKYD..........FT
Q9KSQ8_VIBCH/286-544GAA--------KGRAKPVA------FTED----------------TCVPPENLADFIVEFRALLDSKN..........LA
Q97G30_CLOAB/221-465..A--------IKASTTEM------DECD----------------VCVPRNKIAEFINYTYKLQDKFD..........IR
Q9I6H4_PSEAE/216-461...--------.TISHWTP------YKND----------------ISVTVSRVPAFLKDIDAIVEANYP........DFE
Q9K9B9_BACHD/216-457..A--------LARLKPTT------ILED----------------ATVPRSEIANMVKVINEIAEKYE..........LT
YN53_SCHPO/272-525..C--------LAKAGSGV------YKYD----------------VSLPLPVLYDLVNDTKKRLIEFNLLDDTPEHPVID
Q986B0_RHILO/224-475...--------CQKPEGAS------IKHD----------------ISVPIASIPRFIAEAAGAVASVSA........GAR
O29853_ARCFU/209-439...--------.GLRKEVI------EVLD----------------ACVPPAKIAEYWRRSNELAEEYG..........IE
Q9F3A3_STRCO/294-548VGG--------SRPAGTTL------ITED----------------FAVPPSRLADACEDLLGLQAEHG..........FD
Q9PGF5_XYLFA/218-457..M--------LRTIKPGK------LNED----------------VVVPVSRIPDLVAGIEVLAAESG..........LP
Q9HZI0_PSEAE/264-527REA--------LWQAGYAV------DTLE----------------TATDWSNVDGLLQKIEASLRDGLAAE...GEKVHV
ADAS_CAEEL/313-584RDL--------GMNHGVLG------ESFE----------------TSVPWDKVLSLCRNVKELMKREAKAQG.VTHPVLA
Q11061_MYCTU/215-454...--------AVESKGAL------LLED----------------VGVPLPALGELVTGIARIAEERN..........LM
ADAS_DROME/337-605RDF--------GLHQGIVA------ESFE----------------TSVPWDRCSLLCRSVKQRVVSECSKRS..INYYTI
O07406_MYCTU/211-446...--------VLGVYGPP------LKFD----------------VSLPLSAISGFARDAVALVHRHVPD.....SPEAL
O05784_MYCTU/269-523RDA--------LVRRGVIA------ETFE----------------TACTWDGFDTLHAAVTDAARTAIWKV...CGTGVV
Q9YEU4_AERPE/215-469QKQ--------FKGRKVMM------LMED----------------IAVPPSKLLDAVERLKELEAKYG..........FK
Q55124_SYNY3/222-464..A--------AGKLSPSY------FVQD----------------GVVPRTQLVQILSDINDLSKKYG..........FA
Q9F2Y0_STRCO/247-482TRM--------PDGSEAWP------GWED----------------CAVPPARLGGYLRDFRRLLTAHE..........LR
Q9HMR2_HALSA/293-559LSR--------TSDEKHYP------YIED----------------TAIPADHLPAFVADFQAILDDLD..........TV
Q9RVK1_DEIRA/212-453SMV--------AMYPGHVN------LSTD----------------VCVPLHRLPAVVAATRAKCDERG..........LN
Q986W2_RHILO/218-457...--------VLFSIKGL------IGVD----------------ISIPLARMGAFLQEADAAIHAVDP........SAD
Q9KKW5_VIBCH/271-520VGA--------VREVGTTV------IIED----------------VAFPVEKLAAGVRDLQALFDKYH.........YNE
ADAS_DICDI/317-586RDF--------LLDHNMWV------DVAE----------------TTVSYANLQTLWKDAKQTFVKHFKDQ...GIPAWI
Q98KG4_RHILO/325-565ASL--------TLRPGAKG------LSTD----------------VCVPISRFAECVTETEADIAEMG..........LI
O67645_AQUAE/239-479..A--------LGNLKTGK------INED----------------IVFPRTYLHEALPKLREIAKKYN..........LT
Q9I3S8_PSEAE/214-458...--------AIHAGVDS------LSFD----------------VSLPVPALAGYVERIRRRLDDLVK........GMQ
Q88EH0_PSEPK/279-533GNV--------EGEVRPQP------FVED----------------TAVPPEQLADYIADFRALLDGYG..........LA
Q97U60_SULSO/203-443..S--------FAYYSPAY------LTLD----------------ANVPRSTLPTMLRFTYEISKKYG..........LP
Q9HKQ4_THEAC/212-457LRL--------RKSEKEYI------VIGD----------------IVVPVSELPSALKEIEKARDVDG..........VR
Q9HV36_PSEAE/265-514VGA--------VRETGTTV------IIED----------------VTFPVERLAEGVNRLIELFDKHR.........YDE
GLCD_BACSU/216-457..A--------LARLKPTT------ILED----------------ATVPRSEIANMVKAINDIAAKYD..........IS
Q9CMN0_PASMU/284-542GNA--------KGMAKPIP------FVED----------------SCVPPEHLADYIAEFRALLDAHK..........LD
DLD2_YEAST/277-529...--------ASQANGGV------YKYD----------------VSLPLKDLYSLVEATNARLSEAELVGD.SPKPVVG
YDIJ_ECOLI/281-539GNA--------KGAAKPIP------FAED----------------TCVPPEHLADYIAEFRALLDSHG..........LS
A4XDV9_NOVAD/262-503NWI--------.GGGGHIN------FSPI----------------SAPDGKEALSQYNLIKQRCHDFG............
B4R3E5_DROSI/291-531...--------GLIEKSFC------FKYD----------------ISLPLRDFYNIVDVMRERCGPLA..........TV
Y2280_MYCTU/217-453...--------AAKALGAD------DIID----------------TVVPRASMPKFLSTARGLAAAAD..........GA
Q585R0_TRYB2/307-576RDF--------ALAHNFWA------DVFE----------------TSVLYTDAIHCWRAVKKSFAEVMAEN...GKNAWI
Q7APS7_MYCLE/212-444...--------VLGVYGPP------LKFD----------------VSLPLSAISGFAKEAATLIDAQVSD.....VQEAL
LDHD_MOUSE/245-483AAL--------ALSPGSKA------YSTD----------------VCVPISRLPEILVETKEEIKASK..........LT

PF08031

YGAK_BACSU/399-443--------------------------------------------------------------------------------
Q7RV07_NEUCR/421-465--------------------------------------------------------------------------------
Q6LJC7_PHOPR/280-323--------------------------------------------------------------------------------
Q84PV7_ORYSJ/461-526--------------------------------------------------------------------------------
Q6EUS8_ORYSJ/495-552--------------------------------------------------------------------------------
Q8EGB1_SHEON/850-894--------------------------------------------------------------------------------
Q8XND2_CLOPE/404-448--------------------------------------------------------------------------------
Q92U94_RHIME/427-471--------------------------------------------------------------------------------
Q7SB35_NEUCR/597-641--------------------------------------------------------------------------------
Q7NIA5_GLOVI/31-76--------------------------------------------------------------------------------
Q82GZ2_STRAW/449-493--------------------------------------------------------------------------------
YVDP_BACSU/400-444--------------------------------------------------------------------------------
Q7SHH8_NEUCR/453-496--------------------------------------------------------------------------------
Q84PV6_ORYSJ/334-398--------------------------------------------------------------------------------
O64745_ARATH/479-537--------------------------------------------------------------------------------
Q869M2_DICDI/431-473--------------------------------------------------------------------------------
Q9SA85_ARATH/465-524--------------------------------------------------------------------------------
Q7V3Z6_PROMM/524-568--------------------------------------------------------------------------------
Q9FKU8_ARATH/476-534--------------------------------------------------------------------------------
Q7S915_NEUCR/469-516--------------------------------------------------------------------------------
Q9FKV2_ARATH/471-528--------------------------------------------------------------------------------
Q81C29_BACCR/8-52--------------------------------------------------------------------------------
Q81IH6_BACCR/396-440--------------------------------------------------------------------------------
Q6ZB64_ORYSJ/480-545--------------------------------------------------------------------------------
Q9EX55_STRCO/495-548--------------------------------------------------------------------------------
P71984_MYCTU/413-458--------------------------------------------------------------------------------
Q93S08_STRCO/490-543--------------------------------------------------------------------------------
Q93ZA3_ARATH/477-530--------------------------------------------------------------------------------
Q9SA89_ARATH/469-526--------------------------------------------------------------------------------
Q87IH1_VIBPA/415-459--------------------------------------------------------------------------------
Q8Y3D0_RALSO/458-507--------------------------------------------------------------------------------
Q9FKV0_ARATH/479-537--------------------------------------------------------------------------------
O64743_ARATH/475-528--------------------------------------------------------------------------------
Q84PV5_ORYSJ/467-535--------------------------------------------------------------------------------
B8NRL4_ASPFN/503-546--------------------------------------------------------------------------------
F4HV09_ARATH/467-522--------------------------------------------------------------------------------
M1D3J3_SOLTU/322-380--------------------------------------------------------------------------------
M1W0X9_CLAP2/412-456--------------------------------------------------------------------------------
Q1K7N8_NEUCR/507-549--------------------------------------------------------------------------------
Q7S1P7_NEUCR/454-499--------------------------------------------------------------------------------
Q9FI21_ARATH/469-527--------------------------------------------------------------------------------
Q9FZC7_ARATH/490-547--------------------------------------------------------------------------------
Q9SA88_ARATH/468-523--------------------------------------------------------------------------------
Q9SA99_ARATH/470-527--------------------------------------------------------------------------------
Q9SUC6_ARATH/470-527--------------------------------------------------------------------------------
V4K8Y9_9ACTO/416-460--------------------------------------------------------------------------------

PF09265

K4CKY2_SOLLC/235-510RGS--------GIWS.TPH------PWLN----------------MFVSKKDIDAFNRIVFQNI.LRN.......GINGP
I1L1H8_SOYBN/249-526RSE--------GLWE.VPH------PWLN----------------LWVPRSRISDFDEGVFKDIVLKQ.....NIT.GGS
CKX3_ORYSJ/232-512RNS--------GLWE.VHH------PWLN----------------MFVPSAGISDFRDLLMDSI........SPDNFEGL
CKX1_ORYSJ/245-531EKA--------GLWR.VPH------PWLN----------------LFVPGSRIADFDRGVFKGI.LQT.....ATDIAGP
CKX2_ORYSJ/256-560RAA--------GLWD.VPH------PWLN----------------LFLPRSGVLAFADGVFHGI.LSR......TPAMGP
A9TE88_PHYPA/237-513DSQ--------GLWN.VPH------PWLN----------------LFVPRSSIGLFDALIFKQM.IKD.......DFSGP
A9U580_PHYPA/199-480SAK--------GLWDQIPH------PWLN----------------LFVPAASINCFDRLVLKQL.KTW.......DFSGP
C5YCF7_SORBI/234-520RSR--------GLWD.VPH------PWLN----------------LFVPSHGAARFKDMLMDTV........TQGDFEGP
M0TFY8_MUSAM/196-467SST--------EHED.VLH------PWFN----------------LFLPKSRIRDFESAVFKGI.LKN.....NNP.VGL
K3YYC8_SETIT/244-525RSA--------GVWE.VPH------PWLN----------------LFVPRSRILDFDNGVFKGL.LRD.....ANP.AGI
D8SXN5_SELML/247-526RKK--------GLWD.VPH------PWMN----------------LLVPKSKIEEFDALVFREI.LRK.......GINGP
J3MTM1_ORYBR/125-404RRN--------GSWA.APH------PWLN----------------LFISSRDIAAFDRAVLNGM.LAD.......GVDGP
CKX10_ORYSJ/246-530RSA--------GAWD.VPH------PWLN----------------LFVPRSRILHFDAAVFKGI.LRN.....ANP.VGL
B9H4G1_POPTR/239-521RAK--------GLWE.VPH------PWLN----------------LFVPRSRIADLDRGVFKGI.LGN.....NKT.SGP
M0S8L8_MUSAM/196-467RPM--------GLWD.VPH------PWLN----------------LFVPKSRMRDFETGIFRGI.LIE.....NNTPMAT
C5YM55_SORBI/218-506RRN--------GSWD.APH------PWLN----------------LFVSARDVADFDRAVIKGM.LAD.......GIDGP
K3XHX8_SETIT/127-423RAA--------GLWD.VPH------PWLN----------------LFLPRSRILDFAAGVFHGV.LLRDGA..GGGATGP
W5B8J6_WHEAT/275-552RSQ--------GLWD.VPH------PWLN----------------MFVPKHGVAQLKDLLMDTV........LAGYFQGA
K7V1U5_MAIZE/241-516RAQ--------GLWE.VPH------PWLN----------------LLIPRSSIRRFAKEVFGKI.LK......DSN.NGP
M0RM32_MUSAM/220-488HST--------APEN.VLH------PWLN----------------MFVPKSRIRDFEMGVFKGI.LKN.....NNP.IGL
M1A8V5_SOLTU/250-526RSK--------GLWD.LPH------PWLN----------------LLVPKSKIQHFANEVFGNI.LS......DTN.NGP
M0RWA6_MUSAM/235-509RSR--------GLWE.VPH------PWLN----------------MFVPRSGIKDFKDLLLENI........SPEEFEGP
D7KSP4_ARALL/242-520RSK--------NLWE.VPH------PWLN----------------LFVPKSRISDFDKGVFKGI.LG......NKT.SGP
D8S2E8_SELML/208-483RKV--------KQWD.VPH------PWLA----------------LFVPKSKISKFNDIVFRDMVCK........GVNGP
M0WQT5_HORVD/289-587RAA--------GLWD.VPH------PWLN----------------LFLPRSRVLDFAVGVFHGI.LRRDS...TTGAMGP
I1GXU3_BRADI/247-523RSA--------GAWD.VPH------PWLN----------------LFVPKSRIHEFDAGVFKGI.LKD.....AKP.VGL
I3VIX5_HORVD/238-510RAK--------GLWE.VPH------PWLN----------------LIIPRSTIHTFAEQVFGKI.LE......DNN.NGP
I1N8X2_SOYBN/261-537RAQ--------GLWE.VPH------PWLN----------------LLIPRSEIHDFAEEVFGNI.LK......DTS.NGP
I1M956_SOYBN/223-503KAN--------GIWD.APH------PWLN----------------MFVSKSNIAEFDREVFKKI.LKH.......GVGGP
W1PP63_AMBTC/225-535RAR--------GLWE.VAH------PWLN----------------MFVPRSQIKAFKDLLLQTI........SPDHFEGP
K7LYV0_SOYBN/248-523RSQ--------GLWD.IPH------PWLN----------------LFVPASRISDFDEGVFKGIILQQ.....NIT.AGL
I1NS44_ORYGL/244-525RGK--------GMWE.VPH------PWLN----------------LFVPASRIADFDRGVFRGV.LGS.....RTA.GGP
CKX1_MAIZE/246-533NKL--------GLWR.VPH------PWLN----------------MFVPRSRIADFDRGVFKGI.LQ......GTDIVGP
M0ZWN0_SOLTU/233-515RSK--------GLWE.VPH------PWLN----------------LFVPKSRIAEFDKGVFKGI.LG......NKT.SGP
B9RGG6_RICCO/247-523RSK--------GLWE.VPH------PWLN----------------LLVPKSKIHNFAEEVFGNI.LT......DTS.NGP
I1HYS9_BRADI/244-525RSV--------GVWD.VPH------PWLN----------------LFIPRSRIIGFDTGVLKGI.LGG.....TNP.VGV
B9RI30_RICCO/238-508QA.--------.......H------PWLN----------------LFIPKSNISDFNSGVFRDIVLQR.....NIT.TGP
F6H3S4_VITVI/229-509RAN--------GIWD.APH------PWLN----------------LLVSKRDIADFDRTVFKKI.LRD.......GVGGP
W1PC48_AMBTC/235-507RAQ--------GLWE.VPH------PWLN----------------LLIPQSTIHDFAEEIFGKL.LT......DSS.NGP
B9RQW4_RICCO/233-514RAN--------GIWD.APH------PWLN----------------MFVSKKDIADFDQMVFKRI.LKE.......GVGGP
M0T0P2_MUSAM/213-487RSM--------GLWD.VPH------PWLN----------------IFVPKSRIRDFEIGVFKGI.LKP.....NNS.MGP
CKX7_ARATH/239-520KEN--------GTWE.TPH------PWLN----------------LFVSKRDIGDFNRTVFKEL.VKN.......GVNGP
I1LL79_SOYBN/269-545RSK--------GLWD.VPH------PWLN----------------LFIPKTKIHHFAEVVFGNI.VK......ETS.NGP
CKX4_ARATH/250-523RSL--------GLWE.VPH------PWLN----------------IFVPGSRIQDFHDGVINGLLLNQ.....TST.SGV
B9T889_RICCO/261-537RAE--------GLWE.VPH------PWMN----------------LLIPKSNISAFAKEVFGNI.LT......DSS.NGP
B9HH07_POPTR/240-507QT.--------.......H------PWQN----------------LFIPQSRISDFNVGVLRDIVLKR.....NIT.TGP
I1HCZ6_BRADI/259-559RAK--------GLWD.VPH------PWLN----------------LFLPRSHILDFAAGVFHGI.LRRDNDNHITGAGGP
K4DBX8_SOLLC/251-526QSK--------GMWD.VPH------PWLN----------------LFVPKSSIMHFNAAVFVDIILRQ.....NKT.NGP
I1L1J0_SOYBN/266-544QSQ--------GLWD.VPH------PWLN----------------LFIPKSQIMEFDSGVFKNIILKR.....NIT.TGP
M0TSS1_MUSAM/191-475RAN--------GTWA.TPH------PWLN----------------ILVSSSDIADFDRTVFKRI.LRR.......GVGGP
W1PTT2_AMBTC/244-524KAN--------GTWD.APH------PWLN----------------LFISSKNIQEFDSKVFNKI.LKN.......GIGGS
M7YGJ3_TRIUA/205-501RAA--------GQWD.VPH------PWLN----------------LFLPRSRVLDFAAGVFHGI.LRRG....TTGAMGP
C5XLU9_SORBI/270-568RGE--------GLWD.VPH------PWLN----------------LFLPRSSILDFAAGVFHGV.LLR.....GGGGGGP
CKX7_ORYSJ/234-513RSI--------GMWD.VPH------PWLN----------------LFVPRSRILDFDAGVFKGV.FAG.....ANP.VGV
A9TFW7_PHYPA/211-490RSR--------GLWE.IPH------PWLN----------------IFVPASVIDRFDMLVFKHL.VTH.......EFNGP
D7MM89_ARALL/244-517KSK--------GQWD.VPH------PWLN----------------LFVPKSQISKFDDGVFKGIILRN.....NIT.TGP
K7VI02_MAIZE/264-548RSA--------GVWD.VPH------PWLN----------------IFVPRSRILDFDAGVFKGI.LKG.....TRP.VGL
M0SHZ5_MUSAM/198-471QSR--------GLWN.VPH------PWLN----------------MLIPRSRILEFDRGVFKSI.LKH.....NNS.VGP
C5XY40_SORBI/244-525RSA--------GVWE.VPH------PWLN----------------LFVPRSRILDFDNGVFKAL.LKD.....ANP.AGI
M1D3U0_SOLTU/258-536RGS--------GIWA.TPH------PWLN----------------MFISKKDIDAFNRIVLQNI.LKS.......GVNGP
W1PW76_AMBTC/30-311RSS--------GSWL.RPH------AWLN----------------LFLPQKSIMQFDTHVFRTM.LNN.......GVGGP
D7LTR1_ARALL/245-521RSK--------GQWE.VPH------PWLN----------------LLVPRSTIKEFAKGVFGNI.LT......DTS.NGP
M0TFY7_MUSAM/200-473RSM--------GLWE.VPH------PWLN----------------IFVPKSRIQDFEVGVFKGI.LMP.....NNS.TGP
A9TFW3_PHYPA/268-544ASQ--------GLWD.VPH------PWLN----------------LFVPRSSIASFDDLIFKHM.IKS.......DFSGP
M0T1W4_MUSAM/207-492RRM--------GLWD.VPH------PWMN----------------LFVPRSQIRRFHDLFLRTM........SDSCVNGP
M0SCZ3_MUSAM/209-484RSK--------GLWE.VPH------PWLN----------------LLIPRTRIRDFAAQVFGKI.LP......DSN.NGP
CKX1_ARATH/263-539RAK--------GLWE.VPH------PWLN----------------LLIPKSSIYQFATEVFNNI.LT......SNN.NGP
K7KSR3_SOYBN/132-409KSK--------GLWD.VPH------PWLN----------------LFVPKSRIEDFDKGVFKGI.LG......NKT.SGP
W1NUG7_AMBTC/245-525RAK--------GLWD.VPH------PWLN----------------LFIPKSKIADFDAGVFKGI.LG......KKT.SGP
B9H8X5_POPTR/248-526HSQ--------GLWD.VPH------PWLN----------------LFLPKSRILEFNKGVFHDLVLKR.....NIT.TGV
I3VIX4_HORVD/239-520RSA--------GVWD.VPH------PWLN----------------LFIPRSRILDFDAGVLKGI.LGG.....DNP.VGL
A9U0K6_PHYPA/202-478DSH--------GLWD.IPH------PWLN----------------LFVPRSSIASFDALIFKHL.IKS.......DFNGP
M0SR52_MUSAM/231-511RAK--------GLWE.VPH------PWLN----------------LFVPASRIADFDRGVFRGI.LG......NRT.SGP
M0RWJ8_MUSAM/214-498RSV--------GLWE.VPH------PWLN----------------MFVPKSGIKAFRDLLLETI........SPDEFAGP
CKX8_ORYSJ/239-523RSR--------GLWD.VPH------PWLN----------------VFVPKHGITQFKGLLMDTV........SADDFEGP
W5D410_WHEAT/239-515DKI--------GLWR.VPH------PWLN----------------VLVPRSRIADFDSGVFKGI.LQ......GTDIAGP
K7KI99_SOYBN/133-410KGN--------GTWD.APH------PWLN----------------LFVSKSHIVDFDREVFKKI.LKD.......GVDGP
I1HCT8_BRADI/241-520EKL--------GLWR.VPH------PWLN----------------VLVPSSRIADFDRAVFKGI.LQ......GTDIAGP
I0IUQ8_SOLLC/258-534QEK--------GLWD.VPH------PWLN----------------LLIPKSRIHDFAQEVFGKI.LT......DTS.HGP
M0TME6_MUSAM/211-494RSR--------GLWE.VAH------PWLN----------------LFVPKSGIREFKDLLLDNI........SPTDFEGL
F6HGV7_VITVI/246-518QAK--------GLWD.VPH------PWLN----------------LFVPKSRISDFNSGVFRDIILKT.....NQT.VGP
CKX2_ARATH/227-501RSL--------GLWE.LPH------PWLN----------------LYVPKSRILDFHNGVVKDILLKQ.....KSA.SGL
B9HD10_POPTR/233-515REN--------GTWD.APH------PWLN----------------MFVSKRDVADFDRVVFKRM.LKE.......GVGGP
B9RK75_RICCO/250-528QSQ--------GLWD.VPH------PWLN----------------LFLPKSSISDFNSGVFRDIVLKR.....NVT.TGP

PF09330

Q16DY3_ROSDO/271-558VGT--------ESILNDTV........GA.......DGWF.....ACDPKETKKAMLHRFAAAGAAIRY.HAVHPGTTED
D8ISV9_HERSS/281-569EEA--------RAYLHAIL......PTAQ.......AGFI.....ECDAEEAGAAFLNRFAIGNAANRY.RAVHQDTVED
X2HJ85_9NEIS/275-564EEA--------EAFLNTFF......QQKT.......GSYF.....RCNEKEAEAAMLHRFAAAGAATTY.RNVHSNTVEN
B8IIE3_METNO/300-589GEA--------GQFLRQFF......ETAE.......GGFF.....ECTTEEGNKAFLHRFAVAGAAVRY.RAVHAREVED
A8GBH8_SERP5/274-563EEA--------QQYLKQYF......AQAN.......GEFF.....TCTPDEGKKAFLHRFAAAGAAVRY.HAVHADKVED
Q7VS08_BORPE/283-572DQT--------RRFLQAYF......DDAT.......GASF.....ECTPEEGKAAFLLRFAAAGAAVRY.RAVHAGQVED
C7MHH4_BRAFD/277-568EGT--------ARLLEEFF....AAPEHE.......GAFF.....ECDAEEAQSATLIRFGVASAASRF.FVMHRAEASA
Q32EL2_SHIDS/278-567GEA--------KSWLVDYF......KQAE.......GDFF.....VCTPEEGSKAFLHRFAAAGAAIRY.QAVHSDEVED
A1B668_PARDP/280-568AEA--------RDYLGAIF......PSAS.......GAMF.....ECTPDEGKAAFLHRFAVAGAAVRY.RAIHAREVQD
I2B7H2_SHIBC/278-567NEA--------QTWLTEFF......KDAE.......GDFF.....ACTATEGAKAFLHRFAAAGAAIRY.HAVHTDEVED
B8BXH2_THAPS/394-691GTL--------ARFMERMDAFVKKYNGKAVLDANDIGKKIISVVEANSSSEVTALNAFRFVAAPAFKTY......CVGED
A6VYY6_MARMS/276-565AEA--------QAYLDNFF......KDNE.......GDYF.....ACTKREADQAILHRFVTGGALTRL.HIMNKKELGS
M9X3I1_PASHA/272-562QEA--------RDYLARYF.....ADTQK.......GGYL.....ECNPTESQAAMLHRFAVASAAIRY.RAIHDKEVED
Q0C1N1_HYPNA/263-552AGV--------RALLADVV......PALK.......GACH.....ECSPAEGRQVFLHRFAATGAAARH.AAMSRGKAGA
D3V833_XENBS/278-567KEA--------SEWLESYF......KQAE.......GEFF.....ACTPEEGTKAFLHRFAAAGAAIRY.QAIHSNEVED
Q5NQX4_ZYMMO/284-573EEA--------RSFLKDFF......EKAS.......GGYF.....ECSDEEGKKAFLHRFAAAGAAIRY.RDVHQDEVED
Q7N371_PHOLL/278-567EEA--------RSWLEDYF......SRVE.......GDFF.....ACTPEEGAKAFLHRFSAGGSAIRY.QAVHSNEVGN
U5T2S7_9GAMM/273-552EET--------EGFLQECFP................DAWF.....RCTADEAERAMLHRFAAAGAGVRY.QTIHHKEVED
F6AE61_PSEF1/273-561DET--------RRFLAEHF.....GTAST.......GAFF.....ECDADEGRKAFLHRFAIAGAAIRY.REAHPASVED
A5WED9_PSYWF/295-584IEA--------QVFLEKFF.....ADSTT.......GDYF.....ECSDEESESAFLHRFAAAGAALRY.EVIHQEEVGD
I1YIL1_METFJ/275-564EEA--------RQYLSTFF......ASHE.......GDYF.....ECTPAEGEKAILHRFVAGGAVGRY.HTIKRKQFGP
C7M6Y2_CAPOD/272-562DEA--------RAYLQKEF.....ADSTK.......GAYI.....ECDAKLAQAAMLLRFAVASAAIRY.RSVHEDEVED
C5ZZE0_DINSH/276-563DEA--------RDFLGAFF......AGRG.......GDYF.....ECTAKEGKIAGLHRFAAAGAAIRY.QNIHADQVED
C5BHL3_EDWI9/279-568EEA--------QRWLSDYF......AQAD.......GDFF.....TCTPEEGNKAFLHRFAAAGAAIRY.QAVHDRQVED
I0DPH6_PROSM/278-567DEA--------KVWLKSFF......ATAD.......GGYF.....ECTPEEGAKAFLHRFAAAGSAVRY.HAVHNKDVED
F6IEM7_9SPHN/289-577REA--------RDFLSKIF......PTAT.......GDFF.....ECTRDEGDKAFLHRFAVAGASIRY.RALHRDQISD
G8MIK8_9BURK/283-568DEA--------RAFLSARF......ADGG.......GAYF.....ECSDEEGRKAFLHRFAAASAAVRY.RAVHHRDVED
E6WEH0_PANSA/273-563AEL--------QGLLADFF......ARHR.......GNFF.....HCDAREAADAFLVRFGVGGCTISYCDALGYNPNER
I0HV55_RUBGI/273-561EAT--------REYLQRQF.....EASTT.......GAWF.....ECDAEEGRKAFLHRFAIAGAAIRY.REAHRGQVGD
E3F2U2_KETVY/276-564DEA--------RAWLAARF......PNAT.......GDFF.....ECTDDEADAAFRHRYAVAGSSVRY.RAVHHKRLDN
S5XTB9_PARAH/284-572AET--------RAYFAGLF......PSAS.......GDVF.....ECSADEGKAAFLHRFAVAGAAGRY.RAIHKSRVED
B2IER8_BEII9/289-578EEA--------RTYLRSIF......PSAK.......GHFF.....ECTPEEGVKAFLHRFATAGAAIRY.RAIHRQEVED
K7SGY9_GLUOY/277-566GPV--------KAYLEDWR......SKTA.......GDFF.....ACTPEEGKLAFLHRFAAAGAAIRY.RAVHSKTAED
N0APL0_9BACI/270-559AEA--------EAYLMALF......KEAE.......GDFF.....VCTPKEGADAFLHRFVAAGAAIRF.QEVHQNEVDD
J7U450_MORMO/278-567DEA--------RNWLSTFF......DNAE.......GAFF.....ECDAKEGADAFLHRFVAAGAAIRY.HAVNSSKVED
Q8NRY8_CORGL/279-570AAS--------EKMLKEFF....AEPEHT.......GEFF.....ICTSDEEKSASLNRFGAASAATRY.AALKRRHIAG
W0HXS9_9ENTR/288-576SEA--------QDFLSGFF......AEHE.......GAFF.....PCTEEEGKKAFLHRFAAAGAAVRY.RAVHARQVED
U3TWX4_9ENTR/276-565AEA--------QAYLQEYF......REGG.......GEFF.....ACDAKEGTHAFLHRFAAVGAAVRY.HTVHADEVED
Q7CH75_YERPE/279-568TEA--------QQHLRAFF......ATAE.......GNFI.....ACTADEGKKAFLHRFAAAGAAVRY.HAVHADQVED
F4HE38_GALAU/273-562NEA--------RNFLQTYF......ANKN.......GAFF.....ECNPQEAQAAMLHRFAVAGAAVRY.RIIHHQQVED
W0AF31_9SPHN/283-572AEA--------EAYLGTIF......PSAR.......GDFF.....TCSPAEGEKAFLHRFAAAGAAIQY.RKVHADAVAG
G8PGV4_PSEUV/272-560DEA--------GAFLKDFF......ASRS.......GDYF.....ECDATEGKMAALHRFAAAGAAVRY.KAVHGDAAED
D8MM49_ERWBE/273-563DEL--------QRLLDTFF......SDRS.......GQYF.....ACDAREERDAFLVRFGVGGCTISYCDYKGINTDQR
Q13Q13_BURXL/285-573EET--------RAFLSSYF......ESAT.......GGYF.....ECTDEEGRKAFLHRFAAAGAAVRY.RAVHPREVEN
B0UTX6_HISS2/274-564QEA--------QEYLKEYF.....SDNSK.......GNYF.....QCNAEETQAAMLHRFAVASAAIRY.RAIHDKDVED
D4Z0R4_SPHJU/277-567GEM--------RAYLEGVE.....RDGDT.......TGWR.....ECTDAEAERAFLLRFVAAGAAIRH.ASLEDGGVGR
G4R7Z9_PELHB/272-560AEA--------RAYLESIF......PSAN.......GDYF.....ECTPQEGTDAFLHRFAFGGAAVRY.RATHSHEVED
Q7V9S2_PROMA/275-565EEM--------KLLLDIET.....EKSED.......FEYI.....ECTESEGKDALLHRYVAGAAPARY.KILNPDLAGD
H2IVR9_RAHAC/272-561DEA--------RTFLTRFF......SEGQ.......GDFF.....ICSADEGKKAFLHRFAAAGAAVRY.HAVHEKEVED
F2G3K5_ALTMD/276-565EEA--------KAYLDEFF......KTNE.......GSYF.....ECTQEEADKAILHRFVAGGAIGRY.HVMHSKEVGA
C7JDF4_ACEP3/277-566GPM--------RQYLQTYF......GSAT.......GDYF.....ECTAEEGKLAFLHRFAAAGAAVRY.RAVHHKEAED
F2JZ95_MARM1/276-565DEA--------QAYLDEFF......KDNE.......GDYF.....ACTEREADQAILHRFVAGGAIGRY.HLMDGKDLGS
T2DLG8_ALTMD/271-561EEA--------KALLSKLF....TQEQLD.......GGYI.....ECSDEEAAKAFLLRFAAAGAAVRY.QTLHHKQVGD
Q6D2B5_PECAS/284-573DEA--------HRWLEEYF......HDAD.......GEFF.....VCTPEEGAKAFLHRFAAAGAAIRY.HAVHSNDVEN
B2FII9_STRMK/273-560AET--------EAWLRAFF......AGHE.......GGFF.....HCTAEEGRKAFLHRFAVAGAAVRY.REVHRGQVQD
G4QGM0_GLANF/289-578AEA--------DAFLTDFF.....SKSTS.......GSFI.....VCDANEAKRAYLHRFAAAGAALRY.HTMFEKEVGD
B4E754_BURCJ/288-575DEA--------RSFLTSFF......AKRT.......GAFF.....ECTPAEGDKAFLHRFAAAGAAIRY.RNVHTRDVED
D8MPZ9_ERWBE/278-567GEA--------RDYLTTYF......AQAD.......GEFF.....ECTPDEGSKAFLHRFAAAGAAVRY.HAVHHDEVED
B4ETB6_PROMH/278-567EEA--------STYLKEYF......KHAT.......GDYF.....ECTEEEGNKAFLHRFAAAGAAVRY.HAVHINDVED
G2KVV8_LACSM/270-559KEA--------QDYLQEFF......KDNE.......GGYF.....ECTPKEAKVAATHRYVTAAVPIRY.AETHQKDDIQ
X2H2U0_9GAMM/275-570AEA--------EAFLKSYFDNSSTAEKRD.......GSYF.....RCNNKEAEAAMLHRFAVAGAATVY.RNVHTKTVED
G7URI2_PSEUP/281-570DEA--------AAYLKRFF......SGAS.......GDWF.....ACTPGEGARAFLLRFAVAGAAVRY.RAVHPAQVQD
D5QJ51_KOMHA/278-567QEA--------RDFLNSHF......AQHE.......GEFF.....ECTPDEGAKAFLHRFAAAGAAVRY.RAVHPRTTED
C5BSR5_TERTT/274-576AEL--------NRYLASLFGNESEHERADKSNATSNGAYI.....ACTPDEATDAMLHRFAVAGAGVRY.LQVNTEEVED
Q6FFS0_ACIAD/279-567ALT--------EQFLTEYF.....ALHST.......GAYF.....LCDQDEGRKAFLHRFAIAGAAIRY.RDTHRNEVED
Q5FRI2_GLUOX/282-571APV--------RAYLEQWA......SSTG.......GAFF.....ECTPDEGTRAFLHRFAAAGAAVRY.RAVHTKTAED
Q87HG0_VIBPA/273-562EEA--------QKYLKEVW.....AVEDD.......CDFF.....ECTPDEGKKAYLHRFAAAGAAIRY.ETIHRNEVED
Q6LQ09_PHOPR/273-562EEA--------KAYLEKNW.....GEDSG.......GSYF.....ACTADEGKKALLHRFAAAGAAIRY.ETIHRNEVEE
H8L1S9_FRAAD/288-574EEA--------RVFLRRYF......SQAT.......GGFF.....ECTPDEGAKAFLHRFAAAGAANRY.RAVHSSTVED
F6IHY7_9SPHN/276-565AEA--------QAYLERAF......PSAD.......GDFF.....ACSQKEAAKAFLHRFAVAGAAIRY.RAIHHRTVED
A6VK90_ACTSZ/272-562EEA--------RAYLADYF.....KDSGK.......GAYF.....ECNKAETQAAMLHRFAVASAAIRY.RAIHSKEVEE
Q9JZL7_NEIMB/272-561DEA--------RAFLKEYF......AHHG.......GAFF.....ECNAEETQAAMLHRFAVASAAIRY.RAVHDDEVED
K0HVQ3_9BURK/282-571EET--------RAYLQTFM.....AERPE.......AGFF.....ECNEEEAGAAFLNRFAVGNATNRY.RAVHADTVED

PF09129

V9XKK4_9NOCA/261-581RSLGQFPLNGPVEIRCCGLD--------------------------------------RPEDVLVPSAGPPTIASTRPRP
E9T1B4_COREQ/275-613RAKGEFPLNGPVEIRCCGLD--------------------------------------QAADVKVPSVGPPTISATRPRP
C0ZNA9_RHOE4/268-586ASLGQYPVNMPFEVRLCGVD--------------------------------------DSGEVLVDSAGVPDLSAVRPRA
E3J1G5_FRASU/288-608QNNNQFPMNGPVEIRVTGLD--------------------------------------AGGDVQVPSAGSPQLSALRPRP
E5ASP8_BURRH/293-606QEQSQYPINGPLEIRVSGLD--------------------------------------NPNDVS.PNSVTAALSMLKPRL
Q13UN0_BURXL/264-584RQRGEFPMNGPVEIRVTGLD--------------------------------------QAADVG.PGAVTPSLAALKPRP
C0ZPW5_RHOE4/267-587RSIGQFPLNGPVEIRCCGLD--------------------------------------QPSDVEVDSAGAPTISAMRPRP
V9XKE0_9NOCA/262-582ASLGQYPVNMPFEVRLCKVD--------------------------------------DADEVLVDAAGVPDLSPVRPRP
W5W8X8_9PSEU/258-566RERGEYPMNGPLEVRVTELD--------------------------------------.......EHAAPPLLSAIKPCP
D3VCK8_XENNA/241-561TMAGKYPINGPLEVRVTELD--------------------------------------NPIEVMDAKAVVPSLSAIRPRL
Q63X30_BURPS/264-586RAAGRYPMNGPIEIRVTGVD--------------------------------------TPDDVG.RGAVPPSLSAIRPRP
E9SX65_COREQ/264-584AAQGKYPINGPFEVRMCKVD--------------------------------------DDAEVLVESAGPPNLSAVRPRP
Q9HWP1_PSEAE/277-597RANGHYPMNGPVEIRVSGLD--------------------------------------QPGESIVPGAQVPSLSAIRPRP
B5I5E6_9ACTO/259-569TAQGKFPVNGTVEIRVTGLD--------------------------------------DPAEAELAGARAPLLSALRAEG

PF04030

ALO_DEBHA/202-551..QNRFYVHAPIEVRCSNLTYSEKPFVDENDEPSLYPNKKWLAKRDRLSPGPIPGNNLRPYLDNSSNL.RYDGDGANVTN
GGLO_RAT/180-438....KVVAHYPVEVRFTRGD......................................DILL..............SPCF
A5WEE3_PSYWF/185-441.....KRSHFPIEVRTHKAE......................................IGML..............SPTQ
Q8EQI8_OCEIH/179-431.....YKVHFPIECRTVKQD......................................DIWL..............SPSY
Q47NJ0_THEFY/176-430.....HRISFPVEVRFAPAD......................................DVWL..............SPGY
Q82KJ4_STRAW/182-436.....LRVSFPVEVRTAPAD......................................DITL..............STAS
Q2JG59_FRASC/206-462.....VRAVFPVEVRCAAAD......................................EIPI..............STAY
Q4JW76_CORJK/189-446.....EQVLFPIEVRATAAD......................................DVPL..............STAK
Q5YR83_NOCFA/174-426.....FDTPMPIEVRWVAPD......................................DALL..............SPAG
Q9HTM8_PSEAE/186-438.....LRTWFPIEYRYVKAD......................................DIPL..............SMFE
Q983S0_RHILO/175-424.....PEVYFPMEVRSVAPD......................................KFWL..............SPFY
Q57ZU1_TRYB2/262-506.....LSVHFPVEFRFTGAD......................................TAAL..............SPAH
Q5K700_CRYNJ/204-464..PAGLRVHFPIEIRWSCAD......................................DIWL..............SPSY
Q2H4W5_CHAGB/168-472FSADGLWVHSPVEVRVSDTTVHTDS............................TTRNNRPFL.............DITPD
ALO_NEUCR/210-513YSAEGLWVHSPVEVRASDSTVYTS.............................REANTRPFL.............DPTQS
Q2UQI3_ASPOR/199-482FPVEGLWVHCPIEVRVTDSTHN.................................KNPRPFL.............DPSHH
ALO_CANAL/202-552..TGDFFVHAPIEVRCSNVTYSDEPFTDDKNQKSLYPSQEWLSNRSKTSAGPIPGNNLRPYLDNSPKL..PYSKDGKITN
ALO_CANGA/188-518..NKDFYVHVPVEVRCANTTLPKEQPETSFRS..............NTSRGPVYGNLLRPYLDNTPSQ.CSYAPIHSVTN
ALO_YEAST/186-516..NKEFYVHVPMEVRCSNTTLPSEPLDTSKRT..............NTSPGPVYGNVCRPFLDNTPSH.CRFAPLENVTN
ALO_ASHGO/192-522..NKEFFVHVPIEVRCSNTTLPHEYKCPEDRT..............VTAPGPVYGNLLRPYLDNTPSH.LRYAPLSDVTN
ALO_KLULA/190-520..NKEFFVHVPVEVRCSNTTLPAEIPDYSNRT..............KTSAGPVFGNTLRPYLDATPRH.LRYAPLSDVTN
ALO_YARLI/189-523..DNIYYVHSPVEVRCSNMSVPDSGDRNVEPNTQ.........EFSASRRGAITGNTLRPLLDINPRDRPYASPHGHVTN
ALO_SCHPO/187-459..KIGAYTHWPIEVRVCAPTP...................................EDECWL..............STDC
Q22YW5_TETTS/180-449.....HKPHYPFILRCTGAS......................................EAYL..............SGSY
GULDH_MYCTU/172-425.....LPIMFPIEVRFSAPD......................................DSFL..............STAY
Q81HV8_BACCR/179-429.....YKVHFPIECRYVKGD......................................DIWL..............SPAY

PF02913

D2HDH_ARATH/309-551V--MGYGHL-G.......DG--------------------------------------NLH---------------LNIS
DLD_ARATH/319-560C--TVIAHA-G.......DG--------------------------------------NFH---------------TCIM
Q9RJ97_STRCO/274-525M--CHISHV-Y.......EN--------------------------------------GAS---------------LYFT
Q9RTM9_DEIRA/229-469L--VQFGHI-G.......DG--------------------------------------NLH---------------PNIM
DLD1_KLULA/320-566T--SLVGHA-G.......DG--------------------------------------NFH---------------AFII
ADAS_RAT/370-643T--CRVTQT-Y.......DA--------------------------------------GAC---------------IYFY
Q9A317_CAUCR/209-458I--VAFGHV-G.......DG--------------------------------------NVH---------------YDVL
Q987U0_RHILO/206-447V--ANVFHA-G.......DG--------------------------------------NLH---------------PLIL
Q9S2F6_STRCO/248-487I--GVCAHA-G.......DG--------------------------------------NTH---------------PTVC
Q9HTK3_PSEAE/230-471V--ANVFHA-G.......DG--------------------------------------NMH---------------PLIL
O29450_ARCFU/211-460V--FIAGHV-G.......DG--------------------------------------NLH---------------PTIW
Q9KSQ8_VIBCH/286-544Y--GMFGHV-D.......AG--------------------------------------VLH---------------VRPA
Q97G30_CLOAB/221-465I--KNFGHA-G.......DG--------------------------------------NLH---------------VYIL
Q9I6H4_PSEAE/216-461V--VWFGHI-G.......DG--------------------------------------NLH---------------LNIL
Q9K9B9_BACHD/216-457I--CTFGHA-G.......DG--------------------------------------NLH---------------PTCL
YN53_SCHPO/272-525V--VGFGHM-G.......DG--------------------------------------NLH---------------LNIA
Q986B0_RHILO/224-475V--VCFGHM-G.......DG--------------------------------------NLH---------------YNIS
O29853_ARCFU/209-439L--ITYGHA-G.......DG--------------------------------------NVH---------------QHP.
Q9F3A3_STRCO/294-548A--AVAGHA-A.......HG--------------------------------------NLH---------------FLLA
Q9PGF5_XYLFA/218-457I--VTFGHA-G.......NG--------------------------------------NLH---------------VNIM
Q9HZI0_PSEAE/264-527F--THLSHV-Y.......GE--------------------------------------GSS---------------IYTT
ADAS_CAEEL/313-584N--CRVTQV-Y.......DA--------------------------------------GAC---------------VYFY
Q11061_MYCTU/215-454I--SVIAHA-G.......DG--------------------------------------NTH---------------PLLV
ADAS_DROME/337-605S--CRVTQT-Y.......DA--------------------------------------GAC---------------IYFY
O07406_MYCTU/211-446P--LLFGHI-G.......EG--------------------------------------NLH---------------LNVL
O05784_MYCTU/269-523T--CRFTHV-Y.......PD--------------------------------------GPA---------------PYYG
Q9YEU4_AERPE/215-469T--VLGGHI-G.......DG--------------------------------------NLH---------------PTIS
Q55124_SYNY3/222-464I--ANVFHA-G.......DG--------------------------------------NLH---------------PLIL
Q9F2Y0_STRCO/247-482G--TPYGHF-G.......DG--------------------------------------CIH---------------VRID
Q9HMR2_HALSA/293-559A--SYYAHA-G.......PG--------------------------------------VLH---------------VRPL
Q9RVK1_DEIRA/212-453A--SFVGHV-G.......DG--------------------------------------NFH---------------VLFH
Q986W2_RHILO/218-457I--YVFGHL-G.......DG--------------------------------------NLH---------------YQVL
Q9KKW5_VIBCH/271-520A--IIFGHA-L.......EG--------------------------------------NLH---------------FVFT
ADAS_DICDI/317-586C--AHISHT-Y.......TN--------------------------------------GVC---------------LYFI
Q98KG4_RHILO/325-565A--PIVGHA-G.......DG--------------------------------------NFH---------------VLVL
O67645_AQUAE/239-479M--VVFGHI-G.......DG--------------------------------------NLH---------------VNLL
Q9I3S8_PSEAE/214-458V--FLFGHF-L.......DG--------------------------------------NLH---------------VMLA
Q88EH0_PSEPK/279-533Y--GMFGHV-D.......AG--------------------------------------VLH---------------VRPA
Q97U60_SULSO/203-443V--ANSFHA-G.......DG--------------------------------------TLH---------------PLIG
Q9HKQ4_THEAC/212-457C--ALFGHI-G.......DG--------------------------------------NIH---------------ANIF
Q9HV36_PSEAE/265-514A--ILFGHA-L.......EG--------------------------------------NLH---------------FVFT
GLCD_BACSU/216-457I--CTFGHA-G.......DG--------------------------------------NLH---------------PTCT
Q9CMN0_PASMU/284-542Y--GMFGHV-D.......AG--------------------------------------VLH---------------VRPA
DLD2_YEAST/277-529A--IGYGHV-G.......DG--------------------------------------NLH---------------LNVA
YDIJ_ECOLI/281-539Y--GMFGHV-D.......AG--------------------------------------VLH---------------VRPA
A4XDV9_NOVAD/262-503.--..FDYI-GEFLVGWRDM--------------------------------------HHI---------------LMIM
B4R3E5_DROSI/291-531V--CGYGHL-G.......DS--------------------------------------NLH---------------LNVS
Y2280_MYCTU/217-453A--VGCGHA-G.......DG--------------------------------------NVH---------------MAIA
Q585R0_TRYB2/307-576G--CHTAHQ-Y.......RF--------------------------------------GCC---------------LYFT
Q7APS7_MYCLE/212-444P--VLFGHV-G.......EG--------------------------------------NLH---------------LNVL
LDHD_MOUSE/245-483G--AIVGHV-G.......DG--------------------------------------NFH---------------CILL

PF08031

YGAK_BACSU/399-443------------------..--------------------------------------...---------------....
Q7RV07_NEUCR/421-465------------------..--------------------------------------...---------------....
Q6LJC7_PHOPR/280-323------------------..--------------------------------------...---------------....
Q84PV7_ORYSJ/461-526------------------..--------------------------------------GSS---------------MEAV
Q6EUS8_ORYSJ/495-552------------------..--------------------------------------...---------------NTSY
Q8EGB1_SHEON/850-894------------------..--------------------------------------...---------------....
Q8XND2_CLOPE/404-448------------------..--------------------------------------...---------------....
Q92U94_RHIME/427-471------------------..--------------------------------------...---------------....
Q7SB35_NEUCR/597-641------------------..--------------------------------------...---------------....
Q7NIA5_GLOVI/31-76------------------..--------------------------------------...---------------....
Q82GZ2_STRAW/449-493------------------..--------------------------------------...---------------....
YVDP_BACSU/400-444------------------..--------------------------------------...---------------....
Q7SHH8_NEUCR/453-496------------------..--------------------------------------...---------------....
Q84PV6_ORYSJ/334-398------------------..--------------------------------------GTS---------------NNSV
O64745_ARATH/479-537------------------..--------------------------------------...---------------YNAT
Q869M2_DICDI/431-473------------------..--------------------------------------...---------------....
Q9SA85_ARATH/465-524------------------..--------------------------------------..K---------------ISSY
Q7V3Z6_PROMM/524-568------------------..--------------------------------------...---------------....
Q9FKU8_ARATH/476-534------------------..--------------------------------------...---------------KTCI
Q7S915_NEUCR/469-516------------------..--------------------------------------...---------------....
Q9FKV2_ARATH/471-528------------------..--------------------------------------...---------------NTSF
Q81C29_BACCR/8-52------------------..--------------------------------------...---------------....
Q81IH6_BACCR/396-440------------------..--------------------------------------...---------------....
Q6ZB64_ORYSJ/480-545------------------..--------------------------------------SSP---------------SSSV
Q9EX55_STRCO/495-548------------------..--------------------------------------...---------------...L
P71984_MYCTU/413-458------------------..--------------------------------------...---------------....
Q93S08_STRCO/490-543------------------..--------------------------------------...---------------...L
Q93ZA3_ARATH/477-530------------------..--------------------------------------...---------------..KG
Q9SA89_ARATH/469-526------------------..--------------------------------------...---------------ADGY
Q87IH1_VIBPA/415-459------------------..--------------------------------------...---------------....
Q8Y3D0_RALSO/458-507------------------..--------------------------------------...---------------....
Q9FKV0_ARATH/479-537------------------..--------------------------------------...---------------KVNF
O64743_ARATH/475-528------------------..--------------------------------------...---------------..GE
Q84PV5_ORYSJ/467-535------------------GD--------------------------------------GIP---------------NPEV
B8NRL4_ASPFN/503-546------------------..--------------------------------------...---------------....
F4HV09_ARATH/467-522------------------..--------------------------------------...---------------.STY
M1D3J3_SOLTU/322-380------------------..--------------------------------------...---------------YTSY
M1W0X9_CLAP2/412-456------------------..--------------------------------------...---------------....
Q1K7N8_NEUCR/507-549------------------..--------------------------------------...---------------....
Q7S1P7_NEUCR/454-499------------------..--------------------------------------...---------------....
Q9FI21_ARATH/469-527------------------..--------------------------------------...---------------KTKY
Q9FZC7_ARATH/490-547------------------..--------------------------------------...---------------ETNV
Q9SA88_ARATH/468-523------------------..--------------------------------------...---------------.STY
Q9SA99_ARATH/470-527------------------..--------------------------------------...---------------PNSY
Q9SUC6_ARATH/470-527------------------..--------------------------------------...---------------NTSF
V4K8Y9_9ACTO/416-460------------------..--------------------------------------...---------------....

PF09265

K4CKY2_SOLLC/235-510I--LTYPLL.RSKWDNRWSV--------------------------------------ALP......K........NEIF
I1L1H8_SOYBN/249-526F--LVYPTNRRNKWDDRMTP--------------------------------------ITP......D........EDVF
CKX3_ORYSJ/232-512I--LIYPLL.RHKWDTNTSV--------------------------------------VLP......DSGST....DQVM
CKX1_ORYSJ/245-531L--IIYPVN.KSKWDAAMSA--------------------------------------VTP......EGE......EEVF
CKX2_ORYSJ/256-560V--LIYPMN.RNKWDSNMSA--------------------------------------VIT......DDDG.....DEVF
A9TE88_PHYPA/237-513I--LIYPLN.RNWWDSRSSA--------------------------------------VIP......D........ESIF
A9U580_PHYPA/199-480I--LVYPLN.KSKWDRRLSA--------------------------------------AVP......EGP......EEVF
C5YCF7_SORBI/234-520V--LVYPLL.TDRWDGNMSA--------------------------------------VVP......ASP......DGVV
M0TFY8_MUSAM/196-467V--LIYPFN.KNKWDDKISA--------------------------------------AIP......DE.......EEVF
K3YYC8_SETIT/244-525I--LMYPMN.KDKWDDRMTA--------------------------------------MTP....TDD........EDVF
D8SXN5_SELML/247-526L--LVYPLD.KMKWDSRTSV--------------------------------------VMP......D........ENIF
J3MTM1_ORYBR/125-404M--LIYPML.KNKWDPATSV--------------------------------------ALP......E........GEIF
CKX10_ORYSJ/246-530I--LMYPMN.KDMWDDRMTA--------------------------------------MTP......D........EDVF
B9H4G1_POPTR/239-521I--LIYPMN.KNKWDQRSSV--------------------------------------VTP......D........EDVF
M0S8L8_MUSAM/196-467V--LISPMN.RSKWDEKMSV--------------------------------------TIP......D........EDIF
C5YM55_SORBI/218-506M--LVYPML.KSKWDPNTSV--------------------------------------ALP......E........GEIF
K3XHX8_SETIT/127-423V--LVYPMN.RRMWDGAMSA--------------------------------------VFP......DDDG.....DEVF
W5B8J6_WHEAT/275-552I--LVYPLL.TDKWDRNTSA--------------------------------------VIP......SAP......DGVM
K7V1U5_MAIZE/241-516I--LLYPVN.KSKWDNRTSV--------------------------------------VIP......D........EEIF
M0RM32_MUSAM/220-488V--LIYPFN.KNKWDDKMSA--------------------------------------AIP......D........EEVF
M1A8V5_SOLTU/250-526V--LVYPIH.KSKVDNRTSF--------------------------------------VCP......D........EDII
M0RWA6_MUSAM/235-509I--LVYPLL.RDKWDANTSA--------------------------------------VLP......DAPA.....EQVV
D7KSP4_ARALL/242-520I--LIYPMN.KDKWDERSSA--------------------------------------VTP......D........EEVF
D8S2E8_SELML/208-483M--LIYPLN.RSKWETRSSV--------------------------------------VVP......D........ESIF
M0WQT5_HORVD/289-587V--LVYPMN.RNRWDPDTSA--------------------------------------VFP......DE.......EEVF
I1GXU3_BRADI/247-523L--LMYPMN.KNKWDNQMTA--------------------------------------MTP......D........EDVF
I3VIX5_HORVD/238-510I--LLYPVK.KSRWDNRTSV--------------------------------------VIP......D........EEVF
I1N8X2_SOYBN/261-537I--LIYPVN.QTRWNSRPSL--------------------------------------VTP......E........EDVF
I1M956_SOYBN/223-503I--LVYPLL.RSKWDSRHSV--------------------------------------VVP......D........SNIF
W1PP63_AMBTC/225-535I--LIYPIR.RDKWNGNTSA--------------------------------------VLP......EDK......ENIL
K7LYV0_SOYBN/248-523V--IIYPMN.RTKWDDNMSA--------------------------------------VTP......H........DDVF
I1NS44_ORYGL/244-525I--LIYPMN.RHKWDPRSSV--------------------------------------VTP......E........EDVF
CKX1_MAIZE/246-533L--IVYPLN.KSMWDDGMSA--------------------------------------ATP......S........EDVF
M0ZWN0_SOLTU/233-515I--LIYPMN.KNKWDDRSSV--------------------------------------VTP......E........EDVF
B9RGG6_RICCO/247-523I--LIYPVN.KSKWDNRTSV--------------------------------------VIP......E........EDIF
I1HYS9_BRADI/244-525I--LMYPMN.TNKWDDRMTA--------------------------------------VTP....QTE........EDVF
B9RI30_RICCO/238-508V--LFYPMM.RNKWDNRMSV--------------------------------------AIP......D........EDIF
F6H3S4_VITVI/229-509M--LVYPLL.RSKWDDRTSV--------------------------------------VIP......E........GEIF
W1PC48_AMBTC/235-507I--LIYPLN.KEKWDNRTSA--------------------------------------VTP......N........EDIF
B9RQW4_RICCO/233-514M--LVYPLV.RSRWDHRTSV--------------------------------------MIP.....AE........GEIF
M0T0P2_MUSAM/213-487V--LIYPLK.KNKWDEKMSA--------------------------------------VIP......D........EEIF
CKX7_ARATH/239-520M--LVYPLL.RSRWDDRTSV--------------------------------------VIP.....EE........GEIF
I1LL79_SOYBN/269-545V--LIYPVN.KSKWDNRTSV--------------------------------------VIP......E........EDIF
CKX4_ARATH/250-523T--LFYPTN.RNKWNNRMST--------------------------------------MTP......D........EDVF
B9T889_RICCO/261-537I--LIYPVN.QSKWNNKTSL--------------------------------------ITP......E........EDIF
B9HH07_POPTR/240-507V--LFYPLN.RHKWDAELSA--------------------------------------VIP......D........EDIF
I1HCZ6_BRADI/259-559V--LIYPMN.RDKWDEKMSA--------------------------------------VFP......EE.......EEVF
K4DBX8_SOLLC/251-526I--LVYPTS.RKRWDDRMSA--------------------------------------IIP......E........EETF
I1L1J0_SOYBN/266-544V--LVYPMN.RNKWDNRMSA--------------------------------------SIP......D........EDIF
M0TSS1_MUSAM/191-475M--LVYPLL.RSKWDPRMSV--------------------------------------AVP......E........SEVF
W1PTT2_AMBTC/244-524I--LVYPLI.KSKWDPRMSV--------------------------------------VVP......D........NEIF
M7YGJ3_TRIUA/205-501V--LVYPMN.RNRWDGGMSA--------------------------------------VFP......EE.......EEVF
C5XLU9_SORBI/270-568V--LVYPMN.RGKWDSATSA--------------------------------------VLPLPEDDEDD.......DEVF
CKX7_ORYSJ/234-513I--LMYPMN.TNMWDDCMMA--------------------------------------VAS......D........DDVF
A9TFW7_PHYPA/211-490I--LVYPVN.KSKWDKRLSV--------------------------------------AVP......EGQ......EEIF
D7MM89_ARALL/244-517V--LVYPMN.RNKWNDRMSA--------------------------------------AIP......E........EDVF
K7VI02_MAIZE/264-548I--LMYPMN.KDRWDDRMTT--------------------------------------ATP......D........EDVF
M0SHZ5_MUSAM/198-471I--LICAMN.RNKWDQRTSA--------------------------------------VVP......D........EEVF
C5XY40_SORBI/244-525I--LMYPMN.KDMWDDRMTA--------------------------------------VTP....TMN........DDVF
M1D3U0_SOLTU/258-536I--LTYPLL.RSKWDNRSSV--------------------------------------VLP......Q........DEIF
W1PW76_AMBTC/30-311V--LVYPVN.STMWDPEMSA--------------------------------------VFP......EE.......EEIF
D7LTR1_ARALL/245-521V--IVYPVN.KSKWDNQTSA--------------------------------------VTP......E........EEVF
M0TFY7_MUSAM/200-473V--LIYPMI.KNKWHDEMSA--------------------------------------VTP......D........EEVF
A9TFW3_PHYPA/268-544I--LIYPIK.GERWDSRSSA--------------------------------------VIP......D........ESIF
M0T1W4_MUSAM/207-492I--IMYPTL.RHQWNLNTSI--------------------------------------VVP......QDEAG....EDVF
M0SCZ3_MUSAM/209-484I--LLYPLN.KSKWDNRTSA--------------------------------------VIP......D........EEIF
CKX1_ARATH/263-539I--LIYPVN.QSKWKKHTSL--------------------------------------ITP......N........EDIF
K7KSR3_SOYBN/132-409I--LIYPMN.KNKWDHRSSV--------------------------------------VTP......E........EDVF
W1NUG7_AMBTC/245-525I--LIYPMN.KNRWDEKTSA--------------------------------------VTP......D........EDVF
B9H8X5_POPTR/248-526V--LFYPMN.RKKWDDKMSA--------------------------------------VIP......E........EDIF
I3VIX4_HORVD/239-520I--LMYPMN.TAKWNSQMTA--------------------------------------VTP....PTR........EDVF
A9U0K6_PHYPA/202-478I--LIYPLK.RDKWDSQSSA--------------------------------------VIP......D........ESVF
M0SR52_MUSAM/231-511I--LIYPMN.KHKWDDRSSV--------------------------------------VTP......D........EEVF
M0RWJ8_MUSAM/214-498I--LLYPLL.RDKWDTNTSV--------------------------------------VLP......DAAGGAAEDERVL
CKX8_ORYSJ/239-523I--LVYPLL.TDKWDGNTSA--------------------------------------VVP......AAP......DGVM
W5D410_WHEAT/239-515L--VVYPLN.KSKWDDGMSA--------------------------------------VTP......A........EEVF
K7KI99_SOYBN/133-410I--LVYPLL.RNKWDSRHSV--------------------------------------VVP......D........SDMF
I1HCT8_BRADI/241-520L--VIYPLN.KSKWDEGMSA--------------------------------------VTP......A........EEVF
I0IUQ8_SOLLC/258-534I--LIYPVN.KSKWIKGTSM--------------------------------------VTP......E........EDVM
M0TME6_MUSAM/211-494V--LIYPLL.RDKWDANSSA--------------------------------------VLP......DGGGRAE..EQVM
F6HGV7_VITVI/246-518L--LVYPMI.RNKWDNGMSA--------------------------------------AIP......D........EDIF
CKX2_ARATH/227-501A--LLYPTN.RNKWDNRMSA--------------------------------------MIP....EID........EDVI
B9HD10_POPTR/233-515I--LVYPLL.RSKWDDRTSV--------------------------------------VLP.....AE........GEIF
B9RK75_RICCO/250-528V--LVYPMN.RNKWDDRTSA--------------------------------------VIP......D........EDVF

PF09330

Q16DY3_ROSDO/271-558I..LALDIALKRNDRNWVET--------------------------------------LPP------EIED..QLVAKMY
D8ISV9_HERSS/281-569I..VALDVALPRNTYDWFEV--------------------------------------LPK------ELAE..QIEFTMY
X2HJ85_9NEIS/275-564I..VALDVALRRNDSEWFET--------------------------------------LPD------SINQ..HFIHKMY
B8IIE3_METNO/300-589I..VALDIALRRNETNWFET--------------------------------------LPF------NIDE..AIIHKIY
A8GBH8_SERP5/274-563I..LALDIALRRNDTDWFET--------------------------------------LPP------EIDS..QLVHKLY
Q7VS08_BORPE/283-572I..VALDIALKRNDRDWLEQ--------------------------------------LPP------DVEA..PILMKLY
C7MHH4_BRAFD/277-568M..VTFDVALRRDDEDWLER--------------------------------------LPP------HIAE..QLLESVY
Q32EL2_SHIDS/278-567I..LALDIALRRNDTEWYEH--------------------------------------LPP------EIDS..QLVHKLY
A1B668_PARDP/280-568I..VALDIALRRNDRDWVER--------------------------------------LPP------DLDA..KLEKKLY
I2B7H2_SHIBC/278-567I..LALDIALRRNDEDWFEH--------------------------------------LPA------EIDS..KLTYKLY
B8BXH2_THAPS/394-691IQGVSVDYALPKNGG....T--------------------------------------IPP------LTKDAAKPLKRMR
A6VYY6_MARMS/276-565I..MTIDVAFPRNERDWFEE--------------------------------------LPQ------DIED..KVAVKMY
M9X3I1_PASHA/272-562I..VALDIALRRNDKAWFEV--------------------------------------LPP------EIES..QITHKLY
Q0C1N1_HYPNA/263-552V..VELDVALRRNDKAWWYV--------------------------------------LPD------HLKG..MVEHTLV
D3V833_XENBS/278-567I..LALDIALRRNDHEWFEH--------------------------------------LPP------EIDG..ALVHRLY
Q5NQX4_ZYMMO/284-573I..VALDIALPRNNRAWEEH--------------------------------------LPS------EITD..KISHILY
Q7N371_PHOLL/278-567I..LSLDIALRRNDREWFEQ--------------------------------------LPP------EFDD..VLVHKLY
U5T2S7_9GAMM/273-552I..LALDIALARNDRDWFEE--------------------------------------LPE------SITR..DLMHRLY
F6AE61_PSEF1/273-561I..LALDIALRRNDRDWVET--------------------------------------LPA------QMEA..QIIHKLY
A5WED9_PSYWF/295-584I..LALDIAIPRNELAWFEA--------------------------------------LPE------EINQ..HLEKKLY
I1YIL1_METFJ/275-564M..MTVDVALKRNEQQWLEV--------------------------------------LPQ------EIED..KLEAKLY
C7M6Y2_CAPOD/272-562I..VALDIALRRNDEDWFEK--------------------------------------LPP------ELDA..KILYKLY
C5ZZE0_DINSH/276-563I..LALDIALKRNERAWLEE--------------------------------------LPP------HIAD..KLVHKLY
C5BHL3_EDWI9/279-568I..LALDIALRRNDTQWFEQ--------------------------------------LPP------ELMQ..DLSHCLY
I0DPH6_PROSM/278-567V..LPLDIALRRNDRDWFEK--------------------------------------LPP------EIEK..LLVHKLY
F6IEM7_9SPHN/289-577I..VALDVALRRNDDDWDEK--------------------------------------LPD------ELSE..QIVGVSY
G8MIK8_9BURK/283-568I..VALDIALRRNDRDWFER--------------------------------------LPD------KIER..PILKKLY
E6WEH0_PANSA/273-563L..VAFDVALRRNDDAWRLT--------------------------------------LPD------HLAA..QVQVDSC
I0HV55_RUBGI/273-561I..VALDVALRRNDRAWVEQ--------------------------------------LPD------EIER..DVVHKLY
E3F2U2_KETVY/276-564L..VSLDMALPRNIDDWRED--------------------------------------LPV------EVRP..AIEMTMA
S5XTB9_PARAH/284-572I..VALDIALRRNDRDWVEV--------------------------------------LPA------EMEA..RIEKKLY
B2IER8_BEII9/289-578I..VALDIALRRNDRDWIET--------------------------------------LPP------AIDA..PILHKLY
K7SGY9_GLUOY/277-566I..VALDVALRRNDREWFET--------------------------------------LPK------DIED..KLIVKLY
N0APL0_9BACI/270-559I..LALDIALRRNDMDWFEE--------------------------------------LPE------EISS..QIEHKLY
J7U450_MORMO/278-567I..LALDIALRRNDQAWLEV--------------------------------------LPP------EIES..KLVHKLY
Q8NRY8_CORGL/279-570L..IPIDVALRRDDWNWLEV--------------------------------------LPE------EIDD..QLEVKAY
W0HXS9_9ENTR/288-576I..VALDIALRRNDDEWFEQ--------------------------------------LPP------ALDQ..QMIHKLY
U3TWX4_9ENTR/276-565I..LALDIALRRNDQEWFER--------------------------------------LPP------EFDN..DLIHRLY
Q7CH75_YERPE/279-568I..LALDIALRRNEKQWFET--------------------------------------LPP------EIEK..CLIAKLY
F4HE38_GALAU/273-562I..VALDVALRRNDREWFET--------------------------------------LPD------SINQ..KCIHKLY
W0AF31_9SPHN/283-572I..IALDIALPRNSVNWVET--------------------------------------LPP------AIAA..QIVHSLY
G8PGV4_PSEUV/272-560I..LALDIALRRDDRTWFEQ--------------------------------------LPE------HIEE..KLIHRLY
D8MM49_ERWBE/273-563L..IAFDVALRRNDTEWRIK--------------------------------------LPQ------ALQD..QVLEDSC
Q13Q13_BURXL/285-573I..VALDVALRRNDRDWIET--------------------------------------LPP------EIEE..TISIKLY
B0UTX6_HISS2/274-564I..VALDVALRRNDKEWFEK--------------------------------------LPA------EIEN..KIIHKLY
D4Z0R4_SPHJU/277-567L..VALDVALPRNCADWVEQ--------------------------------------LPD------DISS..QLVARAT
G4R7Z9_PELHB/272-560I..LALDVALPRNEIDWLPE--------------------------------------LPA------ELEA..QIEYKVL
Q7V9S2_PROMA/275-565L..LPLDIAFPRNFKDWDQL--------------------------------------LPQ------DILN..EMSDSFE
H2IVR9_RAHAC/272-561I..LALDIALRRNDRDWFET--------------------------------------LPE------DIDN..QLVAKLY
F2G3K5_ALTMD/276-565M..MTIDVALRRNDPDWFEV--------------------------------------LPK------EIDD..QIDTKLY
C7JDF4_ACEP3/277-566I..VALDVALRRNDREWFEK--------------------------------------LPQ------DIEN..KLIVKLY
F2JZ95_MARM1/276-565I..MTIDVAFPRNEREWFET--------------------------------------LPK------ELED..QIAVKMY
T2DLG8_ALTMD/271-561I..LALDIALRRNDEFWVEK--------------------------------------LPA------HIAM..HVEKPLY
Q6D2B5_PECAS/284-573I..LALDIALRRNDREWFEH--------------------------------------LPA------DISD..MLVHRLY
B2FII9_STRMK/273-560I..VALDIALRRDDADWFEQ--------------------------------------LPA------DVDG..RLLHKLY
G4QGM0_GLANF/289-578I..LALDIALPRNAVDWLEA--------------------------------------LPE------ELDK..QIDKKLY
B4E754_BURCJ/288-575I..VALDIALRRNDRDWFET--------------------------------------LPP------DIDA..PIAIKLY
D8MPZ9_ERWBE/278-567I..LALDIALRRNDRDWFER--------------------------------------LPA------EFDD..ALVHRLY
B4ETB6_PROMH/278-567V..LPLDIALRRNDRDWFEK--------------------------------------LPP------EIEN..QLLYKLY
G2KVV8_LACSM/270-559I..LPLDIALPRNEEDWFEI--------------------------------------LPK------EIDD..KIKYKLY
X2H2U0_9GAMM/275-570L..VALDIALRRNDKDWFET--------------------------------------LPE------SISQ..HFIYKLY
G7URI2_PSEUP/281-570I..VALDIALRRNERDWFER--------------------------------------LPP------ELDA..PVLHKLY
D5QJ51_KOMHA/278-567I..VALDVALRSNDREWFEV--------------------------------------LPE------EIDR..EIIVKLY
C5BSR5_TERTT/274-576I..VALDIALKRNESNWFEA--------------------------------------LPS------EISE..KILPPLY
Q6FFS0_ACIAD/279-567I..VALDIALRRNDRQWVEQ--------------------------------------LPE------EMEK..KILHKLY
Q5FRI2_GLUOX/282-571I..VALDVALRRNDREWFEV--------------------------------------LPK------EIED..RIIVKLY
Q87HG0_VIBPA/273-562I..VALDIALRRNDEEWLET--------------------------------------LPE------EVSK..NLVQSLY
Q6LQ09_PHOPR/273-562I..VALDIALRRNDREWVEE--------------------------------------LPE------EITK..NMVTSLY
H8L1S9_FRAAD/288-574I..LALDIALPRNARQWQET--------------------------------------LPP------DIEQ..PIMRKLY
F6IHY7_9SPHN/276-565I..IALDIALRRNDRDWFEM--------------------------------------LPD------SITD..KLVHKLY
A6VK90_ACTSZ/272-562I..VALDIALRRNDSDWFEM--------------------------------------LPP------EIDS..KIIHKLY
Q9JZL7_NEIMB/272-561L..VALDIALRRDDRDWFEK--------------------------------------LPP------EIDN..KIIHKLY
K0HVQ3_9BURK/282-571V..VALDIALPRNALEWFEI--------------------------------------LPP------ELAA..QVEQPMY

PF09129

V9XKK4_9NOCA/261-581DHPEWDTAIWLNVLGVPGTPG------MFAFYREME----------------------------------QWMRQRYNGS
E9T1B4_COREQ/275-613DHPDWDVAIWLNVLGVPGTPG------MFEFYREME----------------------------------QWMRSHYNND
C0ZNA9_RHOE4/268-586DRQDWDTAIWMNVVSIPGTAG------LPAFLREME----------------------------------RWMVANYSGD
E3J1G5_FRASU/288-608DHPEWDVAVWLDILTVPGTPY------ANQFYREVE----------------------------------AWVFSNYSGS
E5ASP8_BURRH/293-606DRPDWNIAVWFDILTLPGTPH------ANKFYRETE----------------------------------QWMLSNYAGS
Q13UN0_BURXL/264-584DHPEWNIAVYFDLLTLPGTPL------ANSFYREIE----------------------------------QWMMSNYAGS
C0ZPW5_RHOE4/267-587DHPEWDTAIWLNVLGVPGTPG------MFAFYREME----------------------------------QWMRNHYNNN
V9XKE0_9NOCA/262-582DRPDWDTAIWMNVVSIPGTAG------MPAFFREME----------------------------------QWMAAHYSGD
W5W8X8_9PSEU/258-566GRPEFDVAVWFDVLTVPGTRA------SGNFFRDLE----------------------------------EWAVDHYCGD
D3VCK8_XENNA/241-561DHPEWDVAIWLDILTMPKTPH------TLEFLRKFE----------------------------------QWLFQEFNGD
Q63X30_BURPS/264-586DHPEWNAAIWFDILTIPGTPD------ANRFYREIE----------------------------------QWMLSNYSGD
E9SX65_COREQ/264-584DHPEWDTCIWMNVVTLPGTPG------AAEYFREME----------------------------------RWMAQHYSGD
Q9HWP1_PSEAE/277-597DQPEWDTAIWLDILSLPGTPQ------ANAFYHEFE----------------------------------AWLFDHFSGD
B5I5E6_9ACTO/259-569TRPEWDTAVWLDILTLPGTPY------AEAFLREIE----------------------------------QFLFDGYEGT

PF04030

ALO_DEBHA/202-551DQL----TLFINATMYRPFHTNVN...SQEWYQLFE----------------------------------DIMTNA.SG-
GGLO_RAT/180-438QRD----SCYMNIIMYRPYGKDVP...RLDYWLAYE----------------------------------TIMKKF.GG-
A5WEE3_PSYWF/185-441GED----CAVLSFHVYKGMD.......SEPLFNWLY----------------------------------DYMKKW.QG-
Q8EQI8_OCEIH/179-431KRD----SAFIAFHVYKGME.......YQTYFRDME----------------------------------AIMKKY.NG-
Q47NJ0_THEFY/176-430GRE----SAYVAVHVYQGCP.......WQEYFADLE----------------------------------AIFTAA.AG-
Q82KJ4_STRAW/182-436GRD----SAYIAVHMFRGTP.......YQAYFTAAE----------------------------------RIFTAH.EG-
Q2JG59_FRASC/206-462GRD----TAYIAVHVDHRGA.......HGDYFGLAE----------------------------------KIMLSV.GG-
Q4JW76_CORJK/189-446GRE----SCYIAIHRYNKDS.......HQALFRHIE----------------------------------PIFKAASGG-
Q5YR83_NOCFA/174-426DRA----TCYIAVHQYRGMA.......WEPFFRACE----------------------------------AVFDRY.QG-
Q9HTM8_PSEAE/186-438GRD----SCSISVHQHYSMD.......HHNFFAAVE----------------------------------PIFWKY.AG-
Q983S0_RHILO/175-424NRP----TCSIAIHHDAASD.......PLPFMQAAE----------------------------------PIFRRY.GG-
Q57ZU1_TRYB2/262-506GRQ----TCWIGIVMYRPYLRHAR..DTLRYYDAFS----------------------------------KAMTVM.GG-
Q5K700_CRYNJ/204-464GRD----TCWIGVVTYRPYGLSVP...YRQFHEKFS----------------------------------SLLKSY.GG-
Q2H4W5_CHAGB/168-472DGP----ALYLNATMYRPYYRDPPHEATERYYRAFE----------------------------------WLMRDL.GG-
ALO_NEUCR/210-513DGP----TLYLNAIMYRPYHREPTYNATERYYLGFE----------------------------------WLMREL.GG-
Q2UQI3_ASPOR/199-482DGP----TLYLNATLYRPYLRDPP..CKDRYYEAFE----------------------------------WLMREM.GA-
ALO_CANAL/202-552DQL----TLFINATMYRPFGTNVE...THKWFQLFE----------------------------------DVMSKA.GG-
ALO_CANGA/188-518SQL----TLYINATIYRPFHTNAP...IHKWFTLFE----------------------------------DTMSAA.GG-
ALO_YEAST/186-516SQL----TLYINATIYRPFGCNTP...IHKWFTLFE----------------------------------NTMMVA.GG-
ALO_ASHGO/192-522SQL----TLYINATIYRPFGTNTP...IHKWFTLFE----------------------------------DTLGAA.GG-
ALO_KLULA/190-520SQL----SLYINATIYRPFGSNSP...IHKWFTLFE----------------------------------DTMGAA.GG-
ALO_YARLI/189-523SNL----TLYINATMYRPFGVNSP...VGKWYRDFE----------------------------------GIVAEA.GG-
ALO_SCHPO/187-459KVP----TCYIEAIMYRPFSTSIN...YKPYFKALE----------------------------------DIANQY.NG-
Q22YW5_TETTS/180-449NRR----VCWVGFLVYLAKDGSFIK.GSLEMMKELQ----------------------------------IILAKF.QG-
GULDH_MYCTU/172-425GRD----TCYIAVHQYAGME.......FESYFRAVE----------------------------------EIMDDY.AG-
Q81HV8_BACCR/179-429GRD----SAYIAVHMYKGMK.......YAAYFGEVE----------------------------------KIFLKY.EG-

PF02913

D2HDH_ARATH/309-551AAEYND.....KLLGLIEPYVYEW.......TSKHR----------------------------------GSISAEHGLG
DLD_ARATH/319-560FDPSSE.....EQRREAERLNHFM....VHSALSMD----------------------------------GTCTGEHGVG
Q9RJ97_STRCO/274-525VVS........AQGEDAVAHWTRAKHAANDAILAAG----------------------------------GTITHHHAVG
Q9RTM9_DEIRA/229-469FDPRT......EDTHAVHDLAHKI....ALVAIRHG----------------------------------GVLSGEHGIG
DLD1_KLULA/320-566YNT........EQRKTAETIVENM....VKRAIDAE----------------------------------GTCTGEHGVG
ADAS_RAT/370-643FAFNYR.....GISDPL.TVFEQTEAAARDEILANG----------------------------------GSLSHHHGVG
Q9A317_CAUCR/209-458QPVGGDGDAHGAQREAGAKIVHDI.......TAGFG----------------------------------GSISAEHGLG
Q987U0_RHILO/206-447YDANVP.....GELDKAESFGADI....LRLCVKVG----------------------------------GVLTGEHGVG
Q9S2F6_STRCO/248-487FDVQDP.....DESRRARESFDEI....MALGLELG----------------------------------GTITGEHGVG
Q9HTK3_PSEAE/230-471FDANLA.....GELERAEALGGRI....LELCVAVG----------------------------------GSITGEHGVG
O29450_ARCFU/211-460TSPEDE.....ELMSRSHKFYTEV....MELALRLG----------------------------------GTISAEHGIG
Q9KSQ8_VIBCH/286-544LDLCDP.....KQELLMREISDQV....VKLVAKYG----------------------------------GLMWGEHGKG
Q97G30_CLOAB/221-465KDE........MTEDSWNKKLPEVFKCMYKKARELK----------------------------------GQVSGEHGIG
Q9I6H4_PSEAE/216-461KPENLGKDEFFAKCATVNKWVFET.......VEKYN----------------------------------GSISAEHGVG
Q9K9B9_BACHD/216-457TDIRNH.....EEIERVEKAFAEI....FEKAIALG----------------------------------GTITGEHGVG
YN53_SCHPO/272-525VRQFDK.....RVEKCLEPWVYEW.......VSRHR----------------------------------GSISAEHGLG
Q986B0_RHILO/224-475RPIDGDDEAFLALYHPMNKAVHDV.......VRSFH----------------------------------GSISAEHGIG
O29853_ARCFU/209-439...........LVYEGWEKSYFEFRKSLLSLAVSLG----------------------------------GVISGEHGIG
Q9F3A3_STRCO/294-548FDASKP.....SDVDRYAAFMDDF...CRMTVERFD----------------------------------GSLKAEHATG
Q9PGF5_XYLFA/218-457YDDQDA.....EDITRAQATLPKL....FKLVLTLG----------------------------------GTLSGEHGIG
Q9HZI0_PSEAE/264-527YVFRPA.....ASYAATLERWKRLKHAASQAIVDNR----------------------------------GTISHQHGVG
ADAS_CAEEL/313-584FGFNAR.....GLKNGL.EVYDRIETAARDEIIACG----------------------------------GSISHHHGVG
Q11061_MYCTU/215-454YDPADA.....AMLERAHLAYGEI....MDLAVGLG----------------------------------GTITGEHGVG
ADAS_DROME/337-605FGFRST.....DVADPV.ELFEAIEHSARDEILSCG----------------------------------GSLSHHHGVG
O07406_MYCTU/211-446R..........CPPDREPALYAKM....MGLIAECG----------------------------------GNVSSEHGVG
O05784_MYCTU/269-523IYAG.......GRWGSLDAQWDEIKAAVSEAISASG----------------------------------GTITHHHAVG
Q9YEU4_AERPE/215-469YPVDDE.....KAKEAALKWYYDV....MRMAIELG----------------------------------GTVSAEHGIG
Q55124_SYNY3/222-464YDQKVP.....GAWEKVEELGGEI....LKRCVELG----------------------------------GSLSGEHGIG
Q9F2Y0_STRCO/247-482FDLLSE.....AGVARFRRFSEEL....ADVVVAHG----------------------------------GSLSGEHGDG
Q9HMR2_HALSA/293-559VTLADE.....AGVAKMAEIADRV....TDLVVEYG----------------------------------GAVSGEHGDG
Q9RVK1_DEIRA/212-453AAPDDR.....ATWDAIHATYDEM....MTLTLAAG----------------------------------GTCSGEHGIG
Q986W2_RHILO/218-457T..........ADPAAAYGIVYRG.......VAAAG----------------------------------GGVSAEHGIG
Q9KKW5_VIBCH/271-520QGFDKQ.....SEIERYGAFMDDV...AELVAVKYQ----------------------------------GSLKAEHGTG
ADAS_DICDI/317-586FASK.......QNENKDMAQYIEAKKLMTDIIFKYG----------------------------------GSLSHHHGVG
Q98KG4_RHILO/325-565MDVNDP.....KEIALSEKFVARL....NLRAIAMD----------------------------------GTCTGEHGIG
O67645_AQUAE/239-479YDKSNK.....EEEERAERAVDEV....FELALNYN----------------------------------GSITGEHGVG
Q9I3S8_PSEAE/214-458ADVPLL.....PLHQAVEEILYGE.......LGECA----------------------------------GVISAEHGIG
Q88EH0_PSEPK/279-533LDMKDP.....VQAALVKPISDAV....AALTKRYG----------------------------------GLLWGEHGKG
Q97U60_SULSO/203-443FDPKNA.....DETIKAIKAAEEI....TKLAIKVG----------------------------------GVPSGEHGIG
Q9HKQ4_THEAC/212-457ADLSNE.....EAMAKVNKFMMDM....AMISVRHG----------------------------------GSVSAEHGIG
Q9HV36_PSEAE/265-514QGFDSP.....EQIARYSAFMDDV...AHLVAVEYG----------------------------------GSLKAEHGTG
GLCD_BACSU/216-457TDIRNK.....DEMERVEQAFAEI....FEKAIELG----------------------------------GTITGEHGVG
Q9CMN0_PASMU/284-542LNLCDK.....AQVKLFKEISDQV....VALTHKYG----------------------------------GLIWGEHGKG
DLD2_YEAST/277-529VREYNK.....NIEKTLEPFVYEF.......VSSKH----------------------------------GSVSAEHGLG
YDIJ_ECOLI/281-539LDMCDP.....QQEILMKQISDDV....VALTAKYG----------------------------------GLLWGEHGKG
A4XDV9_NOVAD/262-503YDRADD.....GMRKSAYDLFGKL....VDEAAGAG----------------------------------FGEYRTHLAF
B4R3E5_DROSI/291-531CEQFND.....EIYKRVEPFVYEY.......TSKLK----------------------------------GSISAEHGIG
Y2280_MYCTU/217-453C..........KDPEKKKKLMTDI....FALAMELG----------------------------------GAISGEHGVG
Q585R0_TRYB2/307-576FIGG.......QADENDLKIFLQVKKRAMEVMLQHR----------------------------------GNLTHHHGIG
Q7APS7_MYCLE/212-444R..........CPPDREKTLTAAM....MELIAQAG----------------------------------GNVSSEHGVG
LDHD_MOUSE/245-483VDPDDA.....EEQRRVKAFAENL....GRRALALG----------------------------------GTCTGEHGIG

PF08031

YGAK_BACSU/399-443.....N--------------------------------------------------------------------------
Q7RV07_NEUCR/421-465.....D--------------------------------------------------------------------------
Q6LJC7_PHOPR/280-323.....D--------------------------------------------------------------------------
Q84PV7_ORYSJ/461-526ARARSS--------------------------------------------------------------------------
Q6EUS8_ORYSJ/495-552EEAR.V--------------------------------------------------------------------------
Q8EGB1_SHEON/850-894......--------------------------------------------------------------------------
Q8XND2_CLOPE/404-448.....D--------------------------------------------------------------------------
Q92U94_RHIME/427-471.....D--------------------------------------------------------------------------
Q7SB35_NEUCR/597-641.....E--------------------------------------------------------------------------
Q7NIA5_GLOVI/31-76.....Q--------------------------------------------------------------------------
Q82GZ2_STRAW/449-493.....D--------------------------------------------------------------------------
YVDP_BACSU/400-444.....N--------------------------------------------------------------------------
Q7SHH8_NEUCR/453-496......--------------------------------------------------------------------------
Q84PV6_ORYSJ/334-398IHAK.S--------------------------------------------------------------------------
O64745_ARATH/479-537YEGAKV--------------------------------------------------------------------------
Q869M2_DICDI/431-473......--------------------------------------------------------------------------
Q9SA85_ARATH/465-524VEGK.R--------------------------------------------------------------------------
Q7V3Z6_PROMM/524-568.....N--------------------------------------------------------------------------
Q9FKU8_ARATH/476-534KQAQ.V--------------------------------------------------------------------------
Q7S915_NEUCR/469-516..SATG--------------------------------------------------------------------------
Q9FKV2_ARATH/471-528EDAK.L--------------------------------------------------------------------------
Q81C29_BACCR/8-52.....N--------------------------------------------------------------------------
Q81IH6_BACCR/396-440.....N--------------------------------------------------------------------------
Q6ZB64_ORYSJ/480-545SRARST--------------------------------------------------------------------------
Q9EX55_STRCO/495-548NRSGIP--------------------------------------------------------------------------
P71984_MYCTU/413-458.....M--------------------------------------------------------------------------
Q93S08_STRCO/490-543NTSGIG--------------------------------------------------------------------------
Q93ZA3_ARATH/477-530SDAR.E--------------------------------------------------------------------------
Q9SA89_ARATH/469-526RKGE.I--------------------------------------------------------------------------
Q87IH1_VIBPA/415-459.....E--------------------------------------------------------------------------
Q8Y3D0_RALSO/458-507..AYPF--------------------------------------------------------------------------
Q9FKV0_ARATH/479-537IEAK.I--------------------------------------------------------------------------
O64743_ARATH/475-528TDAR.E--------------------------------------------------------------------------
Q84PV5_ORYSJ/467-535EAAR.V--------------------------------------------------------------------------
B8NRL4_ASPFN/503-546.....N--------------------------------------------------------------------------
F4HV09_ARATH/467-522EEGK.V--------------------------------------------------------------------------
M1D3J3_SOLTU/322-380VQAK.V--------------------------------------------------------------------------
M1W0X9_CLAP2/412-456.....E--------------------------------------------------------------------------
Q1K7N8_NEUCR/507-549.....D--------------------------------------------------------------------------
Q7S1P7_NEUCR/454-499...RAE--------------------------------------------------------------------------
Q9FI21_ARATH/469-527EEGK.S--------------------------------------------------------------------------
Q9FZC7_ARATH/490-547DEAK.I--------------------------------------------------------------------------
Q9SA88_ARATH/468-523EEGK.I--------------------------------------------------------------------------
Q9SA99_ARATH/470-527RVAE.V--------------------------------------------------------------------------
Q9SUC6_ARATH/470-527EDAR.K--------------------------------------------------------------------------
V4K8Y9_9ACTO/416-460.....D--------------------------------------------------------------------------

PF09265

K4CKY2_SOLLC/235-510YLVALLRFSHAHPT...ESEINQMVAQNEEIVQTCI.........................KN.......GFDFKMYLPH
I1L1H8_SOYBN/249-526YVVDFLRVAKT......FDVVDKLQVQNKQILRFCN.........................DA.......GIKITEYLIG
CKX3_ORYSJ/232-512YAVGILRSANPDDGCS.HHCLQELLLRHRRLAGAAA.........................S........GLGAKQYLAH
CKX1_ORYSJ/245-531YVVSLLFSAV.......ANDVAALEAQNRRILRFCD.........................LA.......GIGYKAYLAH
CKX2_ORYSJ/256-560YTVGILRSAAA......AGDVGRLEEQNDEILGFCE.........................VA.......GIAYKQYLPY
A9TE88_PHYPA/237-513YLVGFLRISLPSS....GALLGNLIADNDKIMQVCH.........................SA.......KLGCKKYLPE
A9U580_PHYPA/199-480YIVAFLRNKLPDTLG..GPPLSVMLEENENILRICE..................................PLHCKQYMPH
C5YCF7_SORBI/234-520YVFSVLRSTDP.ARCG.GACVEGILEQHRRVADEAC.........................R........RLGAKQYLAR
M0TFY8_MUSAM/196-467YTIGLLPSAT.......RENWEYLDKQHHEILSFCH.........................QE.......GIEFKQYLPR
K3YYC8_SETIT/244-525YAVSLLWSALS......VDEVVKLERENESVMNLCD.........................KA.......GIKWKQYLPH
D8SXN5_SELML/247-526YLVGMLRYATPSG....VPSVNSLVDQNKEILRVCK.........................SA.......GIHLKQYIPQ
J3MTM1_ORYBR/125-404YLVALLRFCRPYPGG..GPPVAELVAQNKAIIDACR.........................SN.......GYDYKIYFPS
CKX10_ORYSJ/246-530YAVGLLRSAVAGGS...GGDVEQLERENAAVLELCD.........................LAGG.....GIGCRQYLPH
B9H4G1_POPTR/239-521YLVALLRSALDNGEE..TQSLEYLTDQNRKILRFCD.........................DA.......GIKVKQYLPH
M0S8L8_MUSAM/196-467YAIGILRSAT.......MDDWKHLDDQNDEILRFCN.........................QA.......GIEFKQYLPH
C5YM55_SORBI/218-506YLVALLRFCRPG.....GPAVDELVAQNGAILSACR.........................AN.......GYDYKAYFPS
K3XHX8_SETIT/127-423YTVAILRSAVA......AGDLGRMEAQNAEVARFCE.........................GA.......GIPCTQYLAS
W5B8J6_WHEAT/275-552YIFSVLRSADP.SRCG.RGCVEEILEQHRRVADEAC.........................RVGG.....GIGAKQYLAR
K7V1U5_MAIZE/241-516YLVGFLSSA.PSLSG..YGSIAHSMNLNKQIVEFCE.........................EA.......GIGMKQYLAP
M0RM32_MUSAM/220-488YTIGLLPSAT.......VDDWKYLDSQNDEILRFCQ.........................QE.......GIDFKQYLPH
M1A8V5_SOLTU/250-526YLVAFLSHANPSSNG..TDSLQHVLTQNKRILDFCE.........................VS.......HLGVKQYLPH
M0RWA6_MUSAM/235-509YIVGVLRSATP.ASCP.ARCLDDILRRNRRIVEAAS.........................AP.......RIGAKQYLPR
D7KSP4_ARALL/242-520YLVALLRSALTDGEE..TQKLEYLKDQNRRILEFCE.........................QA.......KINVKQYLPH
D8S2E8_SELML/208-483YIVCLLRYVVEG.....GQPLEAHLQQNEEIMRRCE.........................IN.......GLNVKQYFPH
M0WQT5_HORVD/289-587YTVGILRSSVPAWTDDGRQLLRRLEEQNEEILRFCE.........................EM.......GIPCVQYLPY
I1GXU3_BRADI/247-523YAVGLLRSAMG......PGDLERLEKENEAVLGFCD.........................RA.......GIGCKQYLPH
I3VIX5_HORVD/238-510YLVGFLSSAIG......PHSIEHTLNLNNQIIEFSN.........................KA.......SIGVKQYLPN
I1N8X2_SOYBN/261-537YLVALLSSALPNSTG..ADSLEHILAQNNKIIDFYT.........................GA.......QLRVKQYLPH
I1M956_SOYBN/223-503YIIALLRFIPPPPK...GPPTELLVEQNHEIIQLCY.........................NR.......GFDFKLYLPH
W1PP63_AMBTC/225-535YIVGMLRSASPQCVSE.SPCLQSYLQQNNKITEGATSISLHSNSKIQIADPNGQDHELETISGSDSLKRSDLGGKLYLSY
K7LYV0_SOYBN/248-523YVVSFLHSTG.......FDKLEEFQAQNQQILQFCA.........................NA.......GIGIKQYLPQ
I1NS44_ORYGL/244-525YLVAFLRSAVPGSTDP.AQSLEALERQNREILEFCD.........................EA.......GIGAKQYLPN
CKX1_MAIZE/246-533YAVSLLFSSVA......PNDLARLQEQNRRILRFCD.........................LA.......GIQYKTYLAR
M0ZWN0_SOLTU/233-515YLVAFLRSALENGDE..TQTLDYLSNQNYEILKFCE.........................DE.......KINVKQYLPH
B9RGG6_RICCO/247-523YLVAFLSSAVPSSTG..TDGLKHILTQNRRILEFCD.........................TA.......RLGFKQYLPH
I1HYS9_BRADI/244-525YAVSLLRSAVA......VGDVERLERENEAVLAFCT.........................RE.......AIRCKQYLPH
B9RI30_RICCO/238-508YTAALLYSSG.......LNEWQVYDDQNKEILEFCD.........................KA.......GIQGKQYLPN
F6H3S4_VITVI/229-509YLVALLRFDPAYSK...DSVVEKMVAQNQEIIQCCM.........................KN.......GFDFKLYLPH
W1PC48_AMBTC/235-507YLVAFLSSST.......VDSLEHSLSQNRRILEFCE.........................KQ.......GIGMKQYLPH
B9RQW4_RICCO/233-514YIVALLRFTSPYPK...GPAVEKLVSQNQEIIQLCV.........................ND.......EFDFKLYLPH
M0T0P2_MUSAM/213-487YSIGLLRSAI.......MGDWEHLDDQNDEILRFCH.........................RE.......GIEYKQYLPH
CKX7_ARATH/239-520YIVALLRFVPPCAK...VSSVEKMVAQNQEIVHWCV.........................KN.......GIDYKLYLPH
I1LL79_SOYBN/269-545YLVAFLASAVPSSNG..PDGLEHILSRNKKILEYCE.........................RA.......NLGVKQYLPH
CKX4_ARATH/250-523YVIGLLQSAGG......SQNWQELENLNDKVIQFCE.........................NS.......GIKIKEYLMH
B9T889_RICCO/261-537YLVGFLSSAVPSSTG..KDSLPHILARNKRILDFCS.........................KA.......NLGVKQYLPH
B9HH07_POPTR/240-507YTTSFLHTSG.......IDNWQVYEDQNQAVIKFCE.........................EA.......GIKMVKYLAD
I1HCZ6_BRADI/259-559YTVGILPSAPPATSTDGGDELRRMEEQNEEIMRFCE.........................AA.......GIPCVQYLSY
K4DBX8_SOLLC/251-526YCVGLLHSSSG......YNECKILDNQNEEILNYCD.........................KV.......GLNIKQYLPH
I1L1J0_SOYBN/266-544YTVGFLHSSG.......FDNWKAYDAQNKEILQFCN.........................DS.......GIKVKQYLPH
M0TSS1_MUSAM/191-475YLVALLRFIAPREG...DAALEEAVAQNREIIGCCR.........................SK.......GYDFKVYIPR
W1PTT2_AMBTC/244-524YLVALLRFNKPYPE...GPSLQSLLAQNQEIIDCCT.........................SN.......NFDFKVYIPH
M7YGJ3_TRIUA/205-501YTVGILRSAVS......EGDLGRLEEQNDEILRFCE.........................EA.......GIACVQYLSY
C5XLU9_SORBI/270-568YTVGILRSAVA......DGDMRRMEEQNAEVARFCE.........................AA.......GIPCTQYLAY
CKX7_ORYSJ/234-513YAVGLLRSAAV......IGDVERLEKENEAVLAFCH.........................NE.......DIGCKQYLPY
A9TFW7_PHYPA/211-490YIVAFLRNKLPDAAG..GPSLSTMLEDNEKILRICE..................................PLQCKQYLPH
D7MM89_ARALL/244-517YAVGFLRSAG.......FDNWEAYDQENMEILKFCE.........................DG.......NMGVIQYLPY
K7VI02_MAIZE/264-548YAVGLLRSAVA......AADLEQLERENAAVLEFCH.........................RE.......GIGYRQYLPS
M0SHZ5_MUSAM/198-471YAIGLLRSG........MDGWKNLEEQNEEILRFCD.........................DA.......GISYRQYLPH
C5XY40_SORBI/244-525YAVSMLWSALS......MDDVPQLERGNKAVLDFCD.........................QA.......GIECKQYLPH
M1D3U0_SOLTU/258-536YLVALLRFTHTHPK...ESEIKQMVAQNQEVVQTCI.........................KN.......GFDFKLYFPH
W1PW76_AMBTC/30-311YAISVLRSLDADQP...ITVLESQMKENSEIINICR.........................RL.......DLKCKKYLGR
D7LTR1_ARALL/245-521YLVAILTSAVPGKED..GGGVEQILKRNRRILEFSE.........................EA.......GIGLKQYLPH
M0TFY7_MUSAM/200-473YSIGLLRSAI.......TDDWQDLDNQNDDILGFCH.........................RE.......GIQFKQYLPH
A9TFW3_PHYPA/268-544YLVAFLRISLPSS....GPLLSTLMAENDKIMEICH.........................DA.......GMGCKMYLPE
M0T1W4_MUSAM/207-492YVVSVLRAAPPICTVG.SSCLDGLMQQNEQMIRMAT.........................ARGSSHGGGGMGAKQYMPY
M0SCZ3_MUSAM/209-484YLVAFLSSA.PSSSD..HDSLDRALKQNDRILDFCK.........................QA.......GIRMKQYLPY
CKX1_ARATH/263-539YLVAFLPSAVPNSSG..KNDLEYLLKQNQRVMNFCA.........................AA.......NLNVKQYLPH
K7KSR3_SOYBN/132-409YLVAFLRSALD......TETLEYLTNQNRQILRFCH.........................DS.......EIKVKQYLPH
W1NUG7_AMBTC/245-525YLVAFLRSALDNGEE..TQSLRYLQDQNERILRFCE.........................EA.......NIEMKQYLPH
B9H8X5_POPTR/248-526YTVGFLHSSG.......FNDWQAYDHQNKDILKFCD.........................KA.......GIEIKQYLPL
I3VIX4_HORVD/239-520YTVGLLRSALS......TNELERLQRENQSVLAFCD.........................KE.......GIECKQYLPH
A9U0K6_PHYPA/202-478YLVGFLRISLPSS....GPPLSSLIAENDKIMEVCH.........................NA.......SLGCKMYLPE
M0SR52_MUSAM/231-511YLVAFLRSALSDSDDP.TQSLEYLSQQNQKILEFCD.........................EV.......GIEIKQYLPH
M0RWJ8_MUSAM/214-498YIVGVLRSANP.ASCT.AECLRDLLRLNRGIADAAS.........................AP.......GIGAKQYIPH
CKX8_ORYSJ/239-523YIFGVLRSTDP.ARCG.RACVDSIMARHRRVADEAC.........................RDGGGGGR.GIGAKQYLAR
W5D410_WHEAT/239-515YAVSLLFSSV.......ANDLKRLEAQNQKILRFCD.........................LA.......GIGYKEYLAH
K7KI99_SOYBN/133-410YIVALLRFTPPPPK...GPAAELLVAQNNEIIEFCT.........................SR.......SLDFKLYFPH
I1HCT8_BRADI/241-520YAVSLLFSSV.......ANDLKKLQAQNQKILQFCD.........................MA.......GIGYKEYLAH
I0IUQ8_SOLLC/258-534YLIAFLSSAMPSSTG..KDGLEHILNKNKKILNFCN.........................KA.......HIGMKQYLPH
M0TME6_MUSAM/211-494YIVGVLRSANP.ATCA.AQCLRDLLRRRRRVAKVAT.........................DP.......RIGAKQYLAR
F6HGV7_VITVI/246-518YSIGLLHSSG.......ADDWEPLENQNKEILKFCD.........................KA.......GIKIKQYLPR
CKX2_ARATH/227-501YIIGLLQSAT.......PKDLPEVESVNEKIIRFCK.........................DS.......GIKIKQYLMH
B9HD10_POPTR/233-515YLVALLRFTMPCPK...APSAEKLVSQNREIVQFCV.........................KE.......GLDFKLYLPH
B9RK75_RICCO/250-528YTVGFLHSSG.......FDDWQTYDDQNKDLLNYCD.........................KA.......GIKVKQYFPH

PF09330

Q16DY3_ROSDO/271-558YGHFFCHVFHQDYLVKKGCDPKALKEQMLALLDTRG----------------------------------AEYPAEHNVG
D8ISV9_HERSS/281-569CGHFFCHVMHQEYLVKKGRDCDAVKQRLLAMLEARG----------------------------------ARYPAEHNFG
X2HJ85_9NEIS/275-564YGHFFCHVFHQDYIARKGTDCNKVEDEMLVLLDQRG----------------------------------AQYPAEHNVG
B8IIE3_METNO/300-589YGHFFCHVFHQDYVVKRGVDCLELEHKIWRLLDDRK----------------------------------AEYPAEHNVG
A8GBH8_SERP5/274-563YGHFMCHVFHQDYVVKKGVDSHALKEKMLAILDQRG----------------------------------AEYPAEHNVG
Q7VS08_BORPE/283-572YGHFFCHVFHQDYIVKKGEDCLALEHRMWKLLDERG----------------------------------AEYPAEHNVG
C7MHH4_BRAFD/277-568FGHFFCHVLHQDHVAKKGVDPVALKQEMTALLESRG----------------------------------AAVPAEHNYG
Q32EL2_SHIDS/278-567YGHFMCYVFHQDYIVKKGVDVHALKEQMLELLQQRG----------------------------------AQYPAEHNVG
A1B668_PARDP/280-568YGHFFCHVFHQDYVVKKGQDCLAVEHEMWRLLDRRG----------------------------------AEYPAEHNVG
I2B7H2_SHIBC/278-567YGHFLCHVFHQDYIVKKGHDPHEVKEQMLALLRERG----------------------------------AQYPAEHNVG
B8BXH2_THAPS/394-691YSHFGCNVVHEDIAYPLGVDTHKEKMAFKNTVEDEG----------------------------------GKLPAEHGHG
A6VYY6_MARMS/276-565YGHFFCHVMHQNYIMKKGVDAKAVKKQILSSYDARG----------------------------------AEYPAEHNVG
M9X3I1_PASHA/272-562YGHFMCHVFHQDYIVKKGVDCLALEHQMLELLDKRG----------------------------------AQYPAEHNVG
Q0C1N1_HYPNA/263-552HGHFFCHVFQQDYILKKGADAAAFRRGMAAHYEARG----------------------------------AECPAEHNVG
D3V833_XENBS/278-567YGHFMCHVFHQDYIVKKGIDVHALKVKMLKILNQRG----------------------------------AEYPAEHNVG
Q5NQX4_ZYMMO/284-573YGHFFCQVFHQDYIVKKGGNCADIEHAMWKILDSRH----------------------------------AEYPAEHNVG
Q7N371_PHOLL/278-567CGHFMCYVFHQDYIVKKGVDVQALKARMIELLDKRG----------------------------------AEYPAEHNVG
U5T2S7_9GAMM/273-552YGHFFCNVFHQDYVFREGADVAAHKAKMLEILDERG----------------------------------AEYPAEHNVG
F6AE61_PSEF1/273-561YGHFFCHVFHQDYIVKKGVDPIAMEHAMWKLLDERR----------------------------------AEYPAEHNVG
A5WED9_PSYWF/295-584YGHFFCYVFHQDYILKKGSDAQQVKHFMLELLNTRG----------------------------------AKYPAEHNVG
I1YIL1_METFJ/275-564LGHLFCHVMHQNYILKKGVDAKALKQQLLAFFDARG----------------------------------AEYPAEHNVG
C7M6Y2_CAPOD/272-562YGHFMCHVFHQDYVIKKGYNCEEIEEEMLKILDTRG----------------------------------AQYPAEHNVG
C5ZZE0_DINSH/276-563YGHFMCHVLHQDYIVKKGVDVKALKAEMLELLDKRG----------------------------------AEYPAEHNVG
C5BHL3_EDWI9/279-568YGHFLCHVFHQDYIVRKGADVAAIKAKMLALLDARG----------------------------------AEYPAEHNVG
I0DPH6_PROSM/278-567CGHFMCHVMHQDYVLKKGVDPKELKEKMLALLDERG----------------------------------AQYPAEHNVG
F6IEM7_9SPHN/289-577CGHFFCHVFHRDYLVKASHDPVAFEYAMFALLDARG----------------------------------AEYPAEHNVG
G8MIK8_9BURK/283-568YGHFLCHVFHQDYIVAKGNDCMALEHEMLDLLDARG----------------------------------AEYPAEHNVG
E6WEH0_PANSA/273-563CGHFFCYVNHQDYVLKAGVDAKAFKEAVKEVLEQRG----------------------------------AKYPAEHNVG
I0HV55_RUBGI/273-561YGHFFCHVFHQDYIVKPGVDPVAMEHRMWELLDARR----------------------------------AEYPAEHNVG
E3F2U2_KETVY/276-564AGHFLCMVFHYDYAIKKGWDWHKVEADIIAHLAARG----------------------------------VEFPSEHNVG
S5XTB9_PARAH/284-572YGHFFCHVFHQDYVAKKGTDCLALEHEMWALLDQRG----------------------------------AEYPAEHNVG
B2IER8_BEII9/289-578YGHFFCYVFHQDYIVKKGHDTLALEHEMWTLLDERG----------------------------------AQYPAEHNVG
K7SGY9_GLUOY/277-566YGHFFCHVMHQDYVVKKGYNAMAVEHSMLPGLEARG----------------------------------ARYPAEHNVG
N0APL0_9BACI/270-559YGHFLCHVLHQDYIVKKGVDAHTLKEKMLELLDARG----------------------------------AIYPAEHNVG
J7U450_MORMO/278-567YGHFLCHVFHQDYIVKKGVDPHALKEEMLEILNTRG----------------------------------AEYPAEHNVG
Q8NRY8_CORGL/279-570YGHFFCHVMHQDYVAKQGVDLEALHDRIQHLLEERG----------------------------------AKLPAEHNYG
W0HXS9_9ENTR/288-576YGHFLCHVFHQDYIIKKGRDCLTLEHSLWQGLDARG----------------------------------AQYPAEHNVG
U3TWX4_9ENTR/276-565YGHFFCHVFHQDYIVKKGVDAHALKEKMLAILTARG----------------------------------AEYPAEHNVG
Q7CH75_YERPE/279-568YGHFLCHVFHQDYIVKKGVDVKALKEKMLSLLNDKG----------------------------------AEYPAEHNVG
F4HE38_GALAU/273-562YGHFMCHVFHQDYIIKKGVDTQQLEEEMLVLLDQRG----------------------------------AQYPAEHNVG
W0AF31_9SPHN/283-572YGHFFCHVFHQDYVLKKGADVHALEQAMLDLLDARG----------------------------------AEYPAEHGVG
G8PGV4_PSEUV/272-560YGHFMCHVLHQDYIVKKGVDVAALKQEMLEILDTRG----------------------------------AEYPAEHNVG
D8MM49_ERWBE/273-563CGHFFCFVNHQDYILKPGVDALAFKHDVLEYLDRRG----------------------------------AKYPAEHNVG
Q13Q13_BURXL/285-573YGHFLCHVFHQDYIVKKGNDCLEVEHKMWTLLDRRG----------------------------------AEYPAEHNVG
B0UTX6_HISS2/274-564YGHFMCHVFHQDYIIKKGHNCIELEHQMLDLLDQRG----------------------------------AEYPAEHNVG
D4Z0R4_SPHJU/277-567YAHFFCHVFHRDYLVRPGCDVEILKQRLLDRLAEQG----------------------------------AEYPAEHNVG
G4R7Z9_PELHB/272-560CGHFFCHVMHQDYMIKKGADVPAIKEKLLALLDTRG----------------------------------AEYPAEHNVG
Q7V9S2_PROMA/275-565MAHFLCMVFHLDFVVKKGVDSKLLKEKILKFLDSIN----------------------------------AKYPAEHNVG
H2IVR9_RAHAC/272-561YGHFMCHVFHQDYIVKKGANSKALKHRMLELLDAKG----------------------------------AEYPAEHNVG
F2G3K5_ALTMD/276-565YGHLFCHVMHQNYVLKKGADAKLLKGKILETFDARN----------------------------------AEYPAEHNVG
C7JDF4_ACEP3/277-566YGHFLCHVMHQDYVVKKGYNAIAVEHEMLPGLDARG----------------------------------ARYPAEHNVG
F2JZ95_MARM1/276-565YGHFFCHVMHQNYIMKKGVDAKAVKNKILESFDARG----------------------------------AEYPAEHNVG
T2DLG8_ALTMD/271-561YGHFFCHVFHQDYILKKGSDAKKVKADMLALLDSRG----------------------------------AKYPAEHNVG
Q6D2B5_PECAS/284-573YGHFMCHVFHQDYIVKKGVDVHELKERMLALLDQRG----------------------------------AEYPAEHNVG
B2FII9_STRMK/273-560YGHFLCHVFHQDYIARKGEDPMAIEHAMWALLDQRG----------------------------------AEYPAEHNVG
G4QGM0_GLANF/289-578YGHFFCYVFHQDYILKKGTDAKQVKKQMLALLNDRG----------------------------------AKYPAEHNVG
B4E754_BURCJ/288-575YGHFLCHVFHQDYIVKKGNDCLALEHAMWKLLDARR----------------------------------AEYPAEHNVG
D8MPZ9_ERWBE/278-567YGHFFCHVFHQDYIVKKGVDVHALKEKMLAMLADRG----------------------------------AEYPAEHNVG
B4ETB6_PROMH/278-567CGHFMCHVMHQDYIIKKGVDAKALKAQMLALLDKRG----------------------------------AEYPAEHNVG
G2KVV8_LACSM/270-559YGHFLDHVMHQDYILKKGVDPHELKQEMLKILDKRG----------------------------------ARYPAEHNVG
X2H2U0_9GAMM/275-570YGHFFCSVFHQDYIAKKGTDCSKVEEEMLAILDQRG----------------------------------AQYPAEHNVG
G7URI2_PSEUP/281-570YGHFFCHVLHQDYIVKAGTDCHALEQQMLAVLDARG----------------------------------ARYPAEHNVG
D5QJ51_KOMHA/278-567YGHFLCHVMHQDYVVRKGNDCMDLEHRMLPLLDRRG----------------------------------ARYPAEHNFG
C5BSR5_TERTT/274-576YGHFFCHVFHQDYLVKKGHCAKDVKKALLAYQDTRQ----------------------------------AAYPAEHNFG
Q6FFS0_ACIAD/279-567YGHFFCHVFHQDYIIQKGVNPLEMEHEMWKLLDARR----------------------------------AEYPAEHNVG
Q5FRI2_GLUOX/282-571YGHFFCHVMHQDYVIKKGYNAMKVEHDMLPGLDARG----------------------------------ARYPAEHNVG
Q87HG0_VIBPA/273-562YGHFMCYVFHQDYIFKKGTDTKLMKKLMLEHLNSRG----------------------------------AKYPAEHNVG
Q6LQ09_PHOPR/273-562YGHFMCHVFHQDYIFKKGTDTKKMKKLMLELLEQKG----------------------------------AKYPAEHNVG
H8L1S9_FRAAD/288-574YGHFLCHVFHQDYIVEKGHDCMAIEHKMWKLLDERG----------------------------------AEYPAEHNVG
F6IHY7_9SPHN/276-565YGHFFCHVFHQDYIVRKGADPLALEREMLEILDRRG----------------------------------AEYPAEHNVG
A6VK90_ACTSZ/272-562YGHFMCHVFHQDYIIKKGCDYEEVEHDMLKLLDRRG----------------------------------AQYPAEHNVG
Q9JZL7_NEIMB/272-561YGHFMCHVFHQDYIIKKGNDCMALEHEMLHLLDQRG----------------------------------AQYPAEHNVG
K0HVQ3_9BURK/282-571CGHFFCHVMHQEYLVKKGVDCAQFKERVLALLDARG----------------------------------AKYPAEHNVG

PF09129

V9XKK4_9NOCA/261-581DSTFRPE---WSKGWAFGPDLPYTDEQILTQG------------------LPDTYREGV.PSDENWDSARAVYNRL--DP
E9T1B4_COREQ/275-613DATFRPE---WSKGWAFGPD.PYTDNDIVTNK------------------MRATYIEGV.PTTENWDTARARYNQI--DP
C0ZNA9_RHOE4/268-586YATFRPE---WSKGWAFTDQAAYQDDEFLTST------------------VPATFRAG...GDGNWDFALATLDEH--DP
E3J1G5_FRASU/288-608YAAARPE---WSKGWGYTNSAAWADPTMIGTT------------------IPNALRAGQ.PAGDTWDTALATLDTY--DP
E5ASP8_BURRH/293-606YATMRPE---WSKGWAYTDSSAWEDYTTISTT------------------IPNIYREGQIDQEKDWDKAIRTLNKY--DP
Q13UN0_BURXL/264-584YATVRPE---WSKGWAYTNAEPWQDSMMIGTT------------------IPNLHSEGQ.PPGSSWSTARNTLNRY--DP
C0ZPW5_RHOE4/267-587DATFRPE---WSKGWAFGPDKPYTDAPIITQG------------------LPQTYRDGV.PSSDNWDTANAAYNAL--DP
V9XKE0_9NOCA/262-582YATFRSE---WSKGWAFDDEGGYRDPGFLGET------------------VPAMYRTGL.PSGQGWDAALAAFEQY--DP
W5W8X8_9PSEU/258-566YALVRPE---WSKGWAYGAGGAWSDEHFLATT------------------IPAAH......GRADWDRAAALFERM--DP
D3VCK8_XENNA/241-561YACARVE---WSKGWAYGKTAAWEDEEVLTKI------------------IPTSLTDGL.PTNNNWNFAVATLQKY--DP
Q63X30_BURPS/264-586YATVRPE---WSKGWGYADTAAWSDDAMLRTT------------------IPDLFRQGL.SSADDWDAALRTLERY--DP
E9SX65_COREQ/264-584YATFRSE---WAKGWGFTDQGGYRDDEWLGQT------------------LPAAYTTGI.PASGNFAAARASLNAH--DP
Q9HWP1_PSEAE/277-597YASLRVE---WSKGWGYSPAAAWDEPTVVDQL------------------VAQSLRQGL.VADNDWDSAVRQLNEA--DP
B5I5E6_9ACTO/259-569....RVE---WSKGWAYTDDAVWADEEVLGTT------------------IPGSFGEAV......WGKAAGVLDRL--DP

PF04030

ALO_DEBHA/202-551----RPH---WAKNFIGVNGAHRTDQDLRKQLEF..GGKTSYSMKGFNPILKKWF-------GENLVEYNKVRESM--DP
GGLO_RAT/180-438----RPH---WAKAHNCTQKD.............................FEEMY-------.PTFHKFCDIREKL--DP
A5WEE3_PSYWF/185-441----RPH---WGKINKLSSDE.............................LQVLY-------.PQMKRFLQIRQIY--DP
Q8EQI8_OCEIH/179-431----RPH---WGKLHQQKAKD.............................LCEMY-------.PKWDQFIQLRQQL--DP
Q47NJ0_THEFY/176-430----RPH---WGKMHTRTLSY.............................LDKVY-------.PRLRDALEVRERV--DP
Q82KJ4_STRAW/182-436----RPH---WGKVHTRDAEY.............................FSGVY-------.PRFGEFTALRDRL--DP
Q2JG59_FRASC/206-462----RPH---WGKLHSLDAAT.............................LRGLY-------.PRFDDFLAVRDAA--DP
Q4JW76_CORJK/189-446----RPH---WGKLHTLTHED.............................LLERH-------.EDLARACEIRAKV--DP
Q5YR83_NOCFA/174-426----RPH---WGKRHFQTADT.............................LRERY-------.PHWDRFAQVRKRF--DP
Q9HTM8_PSEAE/186-438----RPH---WGKLHGLNAHQ.............................LQGLY-------.PRWKAFAEVRQAL--DP
Q983S0_RHILO/175-424----RPH---WGKMHSLKAAD.............................FKKLY-------.PRWDDAMAVRRDI--DP
Q57ZU1_TRYB2/262-506----RPH---WAKYYTWGPEQ.............................MLKAY-------GKNWEDFLLFRKKM--DP
Q5K700_CRYNJ/204-464----RPH---WAKQHILGPKT.............................LEVIY-------.PKFKDFQQVLRRV--DP
Q2H4W5_CHAGB/168-472----RPH---WAKTFSVSPGE.............................FATWY-------GADWRRFCAVRDKA--DP
ALO_NEUCR/210-513----KPH---WAKTFTATQAD.............................LARWY-------GDDFQRWGAVRESV--DP
Q2UQI3_ASPOR/199-482----KPH---WAKNFKVTGRH............................ELQGLY-------GKNMDEWLKVRQEV--DP
ALO_CANAL/202-552----KPH---WAKNFIGLTQDEKYDKQQDLKTQLEFGGKPFYTMLGFKPVMQDWF-------GKDLVAFNKVRKET--DP
ALO_CANGA/188-518----KPH---WAKNFLGSTSFAQGQVKAEGQY.......QDYEMRGMATRVKEWY-------GSDLETFKKVRREQ--DP
ALO_YEAST/186-516----KPH---WAKNFLGSTTLAAGPVKKDTDY.......DDFEMRGMALKVEEWY-------GEDLKKFRKIRKEQ--DP
ALO_ASHGO/192-522----KPH---WAKNFLGSTATAAGPVKSSDEY.......QDYEMRGMATKIKEWY-------GDNLKQFQKVRREQ--DP
ALO_KLULA/190-520----KPH---WAKNFLGATSMAAGKVKDEKDY.......DDYEMRGMATKIKEWY-------GEDLLKFREIRSQQ--DP
ALO_YARLI/189-523----KPH---WAKNFLGPETAELKDNESED...........GKMLGLKPIIDEWY-------GDDLKQWKSLREKY--DP
ALO_SCHPO/187-459----KPH---WAKEYSLTKEQ.............................LLERY-------.PNLSKWLSLRKLL--DP
Q22YW5_TETTS/180-449----VPH---LGKHFIKEIFD.............................FEANL-------.PKWNTFKQLRKQY--DP
GULDH_MYCTU/172-425----RPH---WGKRHYQTAAT.............................LRERY-------.PQWDRFAAVRDRL--DP
Q81HV8_BACCR/179-429----RPH---WGKMHTLSYEQ.............................LQDIY-------.PEFHSFLQARKSL--DE

PF02913

D2HDH_ARATH/309-551VM-KAN....EIFYSKSPET---------------------------------------------VALMASIKKLL--DP
DLD_ARATH/319-560TG-KMK....YLEKELGIEA---------------------------------------------LQTMKRIKKTL--DP
Q9RJ97_STRCO/274-525TD-HRD....WYVREAGPLG---------------------------------------------VEALRAVKRSL--DP
Q9RTM9_DEIRA/229-469TM-KRD....FMRDAVDPVT---------------------------------------------LNVLRDVKRAL--DP
DLD1_KLULA/320-566IG-KRD....YLLEEVGEDT---------------------------------------------VAVMRKLKLAL--DP
ADAS_RAT/370-643KL-RKQ....WLKESISDVG---------------------------------------------FGMLKSVKDYV--DP
Q9A317_CAUCR/209-458AM-KTA....EALTYKDPIE---------------------------------------------VAALRAIRGAL--DP
Q987U0_RHILO/206-447VE-KRD....LMPEMFNQVD---------------------------------------------LDQQMRIKCAF--DP
Q9S2F6_STRCO/248-487VL-KKE....WLAREIGPVG---------------------------------------------LEMQRAVKEVF--DP
Q9HTK3_PSEAE/230-471RE-KIN....QMCAQFNADE---------------------------------------------LTLFHAVKAAF--DP
O29450_ARCFU/211-460VV-KKEGLEMEMKYKKSEKA---------------------------------------------LEIMREIKKLF--DP
Q9KSQ8_VIBCH/286-544YR-SE.....YGPEFFGEEL---------------------------------------------FTELRRVKAAF--DP
Q97G30_CLOAB/221-465YA-KKK....YLNEQIGEAN---------------------------------------------LTLMRNIKLAF--DS
Q9I6H4_PSEAE/216-461MT-KRD....YLTYTRSETE---------------------------------------------IAYMKALKAVF--DP
Q9K9B9_BACHD/216-457VM-KAP....YLERKLGEAG---------------------------------------------MAAMKAIKEAL--DP
YN53_SCHPO/272-525LL-KKP....FVGYSKSKEM---------------------------------------------IHLMKTLKNVF--DP
Q986B0_RHILO/224-475QL-KRD....ELIATAPPMA---------------------------------------------IDLMRRVKAAF--DP
O29853_ARCFU/209-439AV-KLS....ELEELF.PEQ---------------------------------------------FELMRQIKLLF--DP
Q9F3A3_STRCO/294-548RN-IAP....FLELEWGPRA---------------------------------------------TELMWRLKRLI--DP
Q9PGF5_XYLFA/218-457VA-KRD....FMTQAFDTPT---------------------------------------------LAAMRAVKAAF--DP
Q9HZI0_PSEAE/264-527KD-HAP....YLPREKGELG---------------------------------------------VAALRAMAGHF--DP
ADAS_CAEEL/313-584KI-RKQ....WMLTTNGAVG---------------------------------------------IALLKAIKSEL--DP
Q11061_MYCTU/215-454RL-KRP....WLAGYLGPDV---------------------------------------------LALNQRIKQAL--DP
ADAS_DROME/337-605KI-RSH....WYRNAVTETG---------------------------------------------SSLYSAAKRHL--DP
O07406_MYCTU/211-446SR-KRA....YLGMSRQAND---------------------------------------------VAAMRRVKAAL--DP
O05784_MYCTU/269-523RD-HRA....WYDRQRPDPF---------------------------------------------AAALRAAKSAL--DP
Q9YEU4_AERPE/215-469VL-KKEALRLELERMGSVKA---------------------------------------------LEIMAGIKRVF--DP
Q55124_SYNY3/222-464ID-KNC....FMPNMFNEVD---------------------------------------------LETMQWVRQCF--NP
Q9F2Y0_STRCO/247-482QA-RAE....LLPRMYGPET---------------------------------------------VALFERAKAVW--DP
Q9HMR2_HALSA/293-559RA-RSQ....WNRKFYGEDL---------------------------------------------WASFRRTKAAF--DP
Q9RVK1_DEIRA/212-453LH-KQK....YLAQERAD.T---------------------------------------------LELMREVKALF--DP
Q986W2_RHILO/218-457LD-KKQ....WLHLVRSDAE---------------------------------------------IATMRRLKTAL--DP
Q9KKW5_VIBCH/271-520RN-MAP....YVELEWGKEG---------------------------------------------YALMQKIKALF--DP
ADAS_DICDI/317-586YE-HVP....WMTRYATRGW---------------------------------------------INVYRSLKETI--DP
Q98KG4_RHILO/325-565QG-KIG....FLRPELGH.G---------------------------------------------VDIMRSIKQAL--DP
O67645_AQUAE/239-479LT-KRK....FLKWQFGETG---------------------------------------------YELLKGIKKLF--DP
Q9I3S8_PSEAE/214-458LE-KKE....ALGRYADPLK---------------------------------------------LALMAQIKELL--DP
Q88EH0_PSEPK/279-533LR-SE.....YVPEYFGE.L---------------------------------------------YPALQRLKGAF--DP
Q97U60_SULSO/203-443IE-KIK....FMKLYYSEDD---------------------------------------------LTLMRRLKATF--DP
Q9HKQ4_THEAC/212-457LE-KKKLFVEEMRFHDNMRT---------------------------------------------LDLMRSIKRIF--DP
Q9HV36_PSEAE/265-514RN-MAP....FVELEWGEDA---------------------------------------------YRLMWQLKRLL--DP
GLCD_BACSU/216-457EM-KAP....YLEMKLKKEG---------------------------------------------IDAMKALKAAF--DP
Q9CMN0_PASMU/284-542MR-SQ.....YGETFFTPEL---------------------------------------------WQELRYIKFLF--DP
DLD2_YEAST/277-529FQ-KKN....YIGYSKSPEE---------------------------------------------VKMMKDLKVHY--DP
YDIJ_ECOLI/281-539FR-AE.....YSPAFFGEEL---------------------------------------------FAELRKVKAAF--DP
A4XDV9_NOVAD/262-503MD-QIA....KTYKHNDGAL---------------------------------------------WDLHHRLKDVL--DP
B4R3E5_DROSI/291-531FL-KKD....YLHYSKDPVA---------------------------------------------IGYMREMKKLL--DP
Y2280_MYCTU/217-453RA-KTG....YFLELEDPVK---------------------------------------------ISLMRRIKQSF--DP
Q585R0_TRYB2/307-576YE-HVP....WMKRYNGEGG---------------------------------------------LDAIMKFKKAL--DP
Q7APS7_MYCLE/212-444SN-KRA....YLRMSRDPAD---------------------------------------------IAAMRTIKAAL--DP
LDHD_MOUSE/245-483LG-KRQ....LLQEEVGPVG---------------------------------------------VETMRQLKNTL--DP

PF08031

YGAK_BACSU/399-443----------WPRTYYG.EN.--------------------------------------------VERLRRVKTTY..DP
Q7RV07_NEUCR/421-465----------APQQYWG.SN.--------------------------------------------YEELRRVKKVW..DP
Q6LJC7_PHOPR/280-323----------RVPGAYG.AN.--------------------------------------------YERLAEVKAKY..DS
Q84PV7_ORYSJ/461-526----------WGAAYFG.NN.--------------------------------------------FNRLVSTKTTI..DP
Q6EUS8_ORYSJ/495-552----------WGEKYFR.GN.--------------------------------------------FRRLAMVKGEV..DP
Q8EGB1_SHEON/850-894----------.TARYFG.KN.--------------------------------------------YPLLQQVKASYCQDP
Q8XND2_CLOPE/404-448----------YEEEYYG.EN.--------------------------------------------KDKLREIRKKY..DE
Q92U94_RHIME/427-471----------RVEAAYG.AN.--------------------------------------------YGRLVEIKRHY..DP
Q7SB35_NEUCR/597-641----------FGEAYFG.SN.--------------------------------------------YERLSQIKKAV..DP
Q7NIA5_GLOVI/31-76----------RVTRAFGDAK.--------------------------------------------HGRLREIKGRF..DP
Q82GZ2_STRAW/449-493----------WETAYWG.SN.--------------------------------------------FDRLRKIKAKY..DP
YVDP_BACSU/400-444----------FGKEYYG.AN.--------------------------------------------FARLREIKAKY..DP
Q7SHH8_NEUCR/453-496----------.PEQMYG.RNK--------------------------------------------LHRLAKLKKQY..DP
Q84PV6_ORYSJ/334-398----------WGIRYFS.KN.--------------------------------------------FDRLVRAKTMI..DP
O64745_ARATH/479-537----------YGDSYFK.GN.--------------------------------------------YLRLVKIKARF..DR
Q869M2_DICDI/431-473----------.TDNYYG.EN.--------------------------------------------SKKLKELKLKY..DP
Q9SA85_ARATH/465-524----------YGKKYFA.GN.--------------------------------------------FERLVKIKTRV..DS
Q7V3Z6_PROMM/524-568----------WKQEFWG.PN.--------------------------------------------YERLLGIKRRY..DP
Q9FKU8_ARATH/476-534----------WGANYFK.NN.--------------------------------------------FNRLMMIKAKV..DP
Q7S915_NEUCR/469-516----------AERTYYG.ND.--------------------------------------------TKNLRLVKQQW..DP
Q9FKV2_ARATH/471-528----------WGFRYFG.SN.--------------------------------------------FKRLAIVKGKI..DP
Q81C29_BACCR/8-52----------WPDAYFS.CN.--------------------------------------------FDRLMEVKAEY..FA
Q81IH6_BACCR/396-440----------WQTSYYG.SN.--------------------------------------------FHRLRKVKTMY..DP
Q6ZB64_ORYSJ/480-545----------WGSAYFSPAN.--------------------------------------------FERLVGAKTLI..DR
Q9EX55_STRCO/495-548----------WHELYFK.GN.--------------------------------------------YPRLQRVKATW..DP
P71984_MYCTU/413-458----------HVETLYSTTE.--------------------------------------------FSRLVTLKNRL..DP
Q93S08_STRCO/490-543----------WNTLYFK.DG.--------------------------------------------YCRLQAAKTQW..DP
Q93ZA3_ARATH/477-530----------WGNRYFK.GN.--------------------------------------------FERLVEIKAKF..DP
Q9SA89_ARATH/469-526----------YGRKYFG.EN.--------------------------------------------FDRLVRVKTAV..DP
Q87IH1_VIBPA/415-459----------RTESAYG.PT.--------------------------------------------FARLQEVKKKF..DP
Q8Y3D0_RALSO/458-507----------WPQLYYGDGDL--------------------------------------------YAFLQRVKRRY..DP
Q9FKV0_ARATH/479-537----------WGPKYFK.GN.--------------------------------------------FDRLVKIKTKV..DP
O64743_ARATH/475-528----------WGAKYYK.GN.--------------------------------------------FERLVKIKGEF..DP
Q84PV5_ORYSJ/467-535----------WGERYFL.GN.--------------------------------------------YDRLVRAKTAI..DP
B8NRL4_ASPFN/503-546----------FQKYFYG.DN.--------------------------------------------YATLRKIKAKY..DP
F4HV09_ARATH/467-522----------YGVKYFK.NN.--------------------------------------------FERLVQVKTRV..DP
M1D3J3_SOLTU/322-380----------WGIKYFK.NN.--------------------------------------------FDRLVHVKTKV..DP
M1W0X9_CLAP2/412-456----------FQARYWGADN.--------------------------------------------YARLAATKAAW..DP
Q1K7N8_NEUCR/507-549----------FQHQFFG.SN.--------------------------------------------YNNLLCIKKKY..DP
Q7S1P7_NEUCR/454-499----------AVGNYYR.SS.--------------------------------------------LSRLQKVKAQY..DP
Q9FI21_ARATH/469-527----------WGVKYFK.NN.--------------------------------------------FERLVRVKTRV..DP
Q9FZC7_ARATH/490-547----------YGSKYFL.GN.--------------------------------------------LKRLMDVKAKY..DP
Q9SA88_ARATH/468-523----------YGAKYFK.DN.--------------------------------------------FERLVDIKTKF..DE
Q9SA99_ARATH/470-527----------FGRMYFG.EN.--------------------------------------------FDRL