Sequence alignment for CL0277

PF08031

YGAK_BACSU/399-443--------------------------------------------------------------------------------
Q7RV07_NEUCR/421-465--------------------------------------------------------------------------------
Q7S1P7_NEUCR/453-499--------------------------------------------------------------------------------
MCRA_STRLA/395-442--------------------------------------------------------------------------------
Q6LJC7_PHOPR/280-323--------------------------------------------------------------------------------
Q8LSM7_HELAN/478-533--------------------------------------------------------------------------------
Q8NIW9_NEUCS/507-551--------------------------------------------------------------------------------
Q84WI1_ARATH/431-489--------------------------------------------------------------------------------
Q84N20_NICLS/354-412--------------------------------------------------------------------------------
Q84PV7_ORYSJ/461-526--------------------------------------------------------------------------------
Q8NK91_ASPOZ/503-547--------------------------------------------------------------------------------
Q6EUS8_ORYSJ/495-552--------------------------------------------------------------------------------
Q93Y11_ARATH/480-538--------------------------------------------------------------------------------
Q8EGB1_SHEON/850-894--------------------------------------------------------------------------------
Q8GTB6_CANSA/480-538--------------------------------------------------------------------------------
Q6NNH8_ARATH/100-155--------------------------------------------------------------------------------
Q8XND2_CLOPE/404-448--------------------------------------------------------------------------------
Q92U94_RHIME/427-471--------------------------------------------------------------------------------
Q7SB35_NEUCR/597-641--------------------------------------------------------------------------------
Q9LNL9_ARATH/467-522--------------------------------------------------------------------------------
Q7X2G7_9ACTO/444-497--------------------------------------------------------------------------------
Q7NIA5_GLOVI/31-76--------------------------------------------------------------------------------
Q8VWA5_9ACTO/433-486--------------------------------------------------------------------------------
Q82GZ2_STRAW/449-493--------------------------------------------------------------------------------
YVDP_BACSU/400-444--------------------------------------------------------------------------------
Q6PW77_ACRST/450-496--------------------------------------------------------------------------------
Q9X5T1_STRLA/421-468--------------------------------------------------------------------------------
O94206_CLAPU/412-457--------------------------------------------------------------------------------
Q8X0G1_NEUCS/561-604--------------------------------------------------------------------------------
Q7SHH8_NEUCR/453-496--------------------------------------------------------------------------------
Q84PV6_ORYSJ/334-398--------------------------------------------------------------------------------
O64745_ARATH/479-537--------------------------------------------------------------------------------
Q869M2_DICDI/431-473--------------------------------------------------------------------------------
Q9AYM8_VIGUN/473-530--------------------------------------------------------------------------------
Q9SA85_ARATH/465-524--------------------------------------------------------------------------------
Q7V3Z6_PROMM/524-568--------------------------------------------------------------------------------
Q9FKU8_ARATH/476-534--------------------------------------------------------------------------------
Q7WZ62_9ACTO/469-522--------------------------------------------------------------------------------
Q7S915_NEUCR/469-516--------------------------------------------------------------------------------
Q9ALN1_9PSEU/476-529--------------------------------------------------------------------------------
RETO_ESCCA/455-517--------------------------------------------------------------------------------
Q9ZPP5_BERST/452-514--------------------------------------------------------------------------------
RETO_PAPSO/459-521--------------------------------------------------------------------------------
Q8KSY2_9ACTO/421-466--------------------------------------------------------------------------------
Q8RWA4_ARATH/490-547--------------------------------------------------------------------------------
Q9FKV2_ARATH/471-528--------------------------------------------------------------------------------
Q81C29_BACCR/8-52--------------------------------------------------------------------------------
Q81IH6_BACCR/396-440--------------------------------------------------------------------------------
Q6ZB64_ORYSJ/480-545--------------------------------------------------------------------------------
Q9EX55_STRCO/495-548--------------------------------------------------------------------------------
P93762_CHOCR/484-535--------------------------------------------------------------------------------
Q8KY45_STRCU/463-508--------------------------------------------------------------------------------
P71984_MYCTU/413-458--------------------------------------------------------------------------------
Q94KD7_ARATH/470-527--------------------------------------------------------------------------------
Q93S08_STRCO/490-543--------------------------------------------------------------------------------
Q93ZA3_ARATH/477-530--------------------------------------------------------------------------------
Q9KHK2_9ACTO/415-460--------------------------------------------------------------------------------
Q948L1_DAUCA/449-503--------------------------------------------------------------------------------
Q8GXL5_ARATH/76-133--------------------------------------------------------------------------------
Q9SA89_ARATH/469-526--------------------------------------------------------------------------------
Q87IH1_VIBPA/415-459--------------------------------------------------------------------------------
Q8Y3D0_RALSO/458-507--------------------------------------------------------------------------------
Q9FKV0_ARATH/479-537--------------------------------------------------------------------------------
O64743_ARATH/475-528--------------------------------------------------------------------------------
Q8SA59_HELAN/476-534--------------------------------------------------------------------------------
Q9HGH9_ASPOZ/508-552--------------------------------------------------------------------------------
Q84PV5_ORYSJ/467-535--------------------------------------------------------------------------------

PF09265

Q9FE45_9ASPA/238-524-PQSVRWMRLMYTDFELFTKDQELLISIKAEGEG....--WKLNYVEGSLLME.HSLKSNWRSP.............FFS
CKX8_ORYSJ/239-523-PPKVRWVRAFYDSFETFTGDQELLVSMPEQ.......--..VDYVEGFMVLNEQSLHSSSVAF................
CKX7_ARATH/239-520-PDMVRWIRVVYTEFDEFTQDAEWLVSQKNESS.....--..FDYVEGFVFVNGADPVNGWPTV.............PLH
CKX3_ORYSJ/232-512-PQKVKWVRAFYDDFATFTKDQELLVSMPVL.......--..VDYVEGFIVLNEQSLHSSSIAF................
Q8H6F6_HORVU/238-510-PQMVRWIRVLYLDFMSFTEDQEMLISAEKT.......--..FDYIEGFVIINRTGILNNWRSS..............FN
CKX4_ARATH/250-523-PTRVKWSRILYSDFSAFKRDQERLISMTNDLG.....--..VDFLEGQLMMS.NGFVDTS................FFP
Q709Q4_MAIZE/241-516-PKMVRWIRVLYSDFESFTEDQEMLIMAENS.......--..FDYVEGFVIINRTGVLNNWRAS..............FK
CKX5_ORYSJ/244-525-PHRVRWIRALYSNFTEFTADQERLISLQHGGR.....--.RFDYVEGFVVAA.EGLINNWRSS.............FFS
CKX2_ORYSJ/256-560-PARARWVRFVYTTAAAMTADQERLIAVDRAGGAGAVG--GLMDYVEGSVHLN.QGLVETWRTQPQPPSPSSSSSSSFFS
CKX7_ORYSJ/234-513-PKRVRWVRLAYSDVATFTKDQELLISKRASEA.....--.GFDYVEGQVQLNRTLTEGPKSTP.............FFS
CKX10_ORYSJ/246-530-PKRVKWVRIAYSDVHPFTTDQELLISKWASGS.....--.GFDYVEGQVQLNRTLTQGRRSSS.............FFS
Q5WY14_LEGPL/211-449-P.RVKTFFLVYADQNQWFEDIYKIQGK..........--..VDYMEIFCSPSIQG......................AR
CKX1_ARATH/263-539-PHMVKWIRVLYSDFSAFSRDQEYLISKEKT.......--..FDYVEGFVIINRTDLLNNWRSS..............FS
CKX5_ARATH/242-520-PQRVRWIRVLYSSFKVFTEDQEYLISMHGQLK.....--..FDYVEGFVIVD.EGLVNNWRSS.............FFS
CKX1_MAIZE/246-533-PARARWVRFVYTDFAAFSADQERLTAPRPGGGGAS.F--GPMSYVEGSVFVNQSLATDLANTG.............FFT
CKX11_ORYSJ/219-503-PQTVRWTRVVYASFADYAADAEWLVTRPPHEA.....--..FDYVEGFAFVRSDDPVNGWPTV..............PI
CKX2_ARATH/227-501-PKRAKWFRMLYSDFTTFTKDQERLISMANDIG.....--..VDYLEGQIFLS.NGVVDTS................FFP
CKX3_ARATH/244-517-PKRAKWLRFLYIDFSEFTRDQERVISKTDG.......--..VDFLEGSIMVD.HGPPDNWRST.............YYP

PF02913

D2HDH_ARATH/309-551KLSSVNLAFIACKDYLSCQ..KLLVEAKRNLGEILSAF--EFLDNNSMDLVLNHLDGV..................RNPV
DLD_ARATH/319-560IPQHSVVAVCNFPTVKDAA..DVAIATMMS.GIQVSRV--ELLDEVQIRAINMANGK.......................
Q9RJ97_STRCO/274-525APEVRRYEGWRFASFDEGT..AALRRLAQD.GPRPTVL--RLSDETETLIGLAQPDAV.................GASLE
Q9RTM9_DEIRA/229-469PPKFTRTLMSHFAEVGQAA..EAVSSAIAA.GAVPSKL--EFMDRACVGAVEDYLHL.....................GL
Q987T8_RHILO/164-381AETEVTLAVRGLLDDAAAS..AMALALGSS.AEVSSAA--HLPERIAARVAGGALGS.......................
DLD1_KLULA/320-566RSTFETVAVVPFPTVSDAA..SCSSHLIQA.GIQLNAM--ELLDDNMMKIINQSGAT....................SKD
ADAS_RAT/370-643TPEYQKYGSVAFPNFEQGV..ACLREIAKQ.RCAPASI--RLMDNQQFQFGHALKPQVSSIFTSFLDGFKKFYITKFKGF
P72842_SYNY3/220-430LPSHSQTVFLTGDTNQLA...KLSQALRRS.GLAPTAA--LICSPALVQALNLGEEL.......................
Q9A317_CAUCR/209-458LLASRAVAIVGLASPANAI..QLLARAKDETGGAVEAF--ELMGRLGFELTVRNVPGL..................RDPL
Q987U0_RHILO/206-447KPETARALLIGFPTSEQGG..QCVADIIGA.GIIPGGM--EMMDRPAIHAAEDFVHA.....................GY
Q9S2F6_STRCO/248-487KPPEQLVLAAEFASASAAC..DAICRIMEG.GHVPSLL--ELMDRTTVKAVNDLAHM.....................GL
Q9HTK3_PSEAE/230-471RPPVAKVLLASFDDVESAG..RAVADLIGA.GIVPAGL--EMMDNLSIRAAEDFIHA.....................GY
O29450_ARCFU/211-460LPENIVYAGAFFDSPEKAM..QAVVEIKHM...WPAIM--EFLDSDLVKAGREISGI.......................
O53525_MYCTU/223-473IPESTRYEAWSFPDFATGV..AALRTITQT.GTGPTVV--RLSDEAETGVNLATTEA...................IGET
Q9KSQ8_VIBCH/286-544IPKARTLVNVKYDSFDSAL..RNAPLMVEA...KALSV--ETVDSKVLNLAKEDIIWHSVK............DLLTDVP
O29393_ARCFU/221-445LPEEFLTLSVEYDGIGEAV..RDAKALMQL...RPALM--RIFDDEESLRYFDSESF.......................
Q97G30_CLOAB/221-465LPKKAISLLVPFPNLTKAI..ETVPKIVKS.KTIPTSI--EFMERDVILAAEEFLGK....................KFP
Q9I6H4_PSEAE/216-461TPKNLTAMVLGTPDFDSIM..PVLHAFQSK..LDLTAF--EFFSDKALAKVLARGDV...................PRAF
Q9K9B9_BACHD/216-457KPESKQTMLALYQDIEAAA..QTVSSIIAN.KVIPTTL--EFLDQPTLKVVEAHAQI.....................GL
YN53_SCHPO/272-525RPSSTNVAFFGVPSYENVL..KAFSETRSHLTEILSAF--ELMDNTSQTLVDKYSGT...................QRPL
Q986B0_RHILO/224-475NPKGREVAFAGLSSPEAAL..SLFSLAMDRAGASLTAF--ELIGKRPYDFTLKHGQGV..................VRPL
O29853_ARCFU/209-439QMRDMTVLAIPFPTMEDAM..NCVVEVARK..MLPMAL--EFMEKRAVEIGEKVSGE....................RWV
DH4C_PSEPU/270-513MSNTIPNSVVIASTLWEAGSAHLTRAQYTT.EPGHTPD--SVIKQMQKDTGMGAWNL.......................
Q9F3A3_STRCO/294-548LDRRVSSGLLFFPSLTAAA..AAVPLFNEA...GALAV--ELMDGNTLRASVSVRGVP.................ADWAG
Q9PGF5_XYLFA/218-457QPQAIAGLRAFYQDTTAAA..AAVSRLMSQ.PAIPATL--EFMDHKAIELLYRNDSN.......................
Q9HZI0_PSEAE/264-527LAEDERFYSVFLPNWQQAL..QATRELAQA.RVPLSML--RLSNAVETMTQLALAGHPGQIAW........LEKYLALRG
ADAS_CAEEL/313-584IPEVKRFGSFVFPNFESGV..NFFREVAIQ.RCQPASL--RLMDNDQFVMGQALKVASDSWWADLKSSVSKMYITSWKGF
Q11061_MYCTU/215-454AQNASSIVVASFGSVQAAV..DAVLGVTGR..LRPAML--EFMDSVAINAVEDTLRM.....................DL
Q9D635_MOUSE/239-480CAEATVAATCAFPSVQAAV..DSTVQILQA.AVPVARI--EFLDDVMMDACNRHSKL.......................
ADAS_DROME/337-605LPSLRRYGSLAFPNFEQGV..LFMREVARR.RCQPASV--RLMDNEQFMFGQALKPEKSWWASVVD.AMKQRYVTSWKGI
O07406_MYCTU/211-446TPSHRVTAVCGFAELAALV..DAGRMFRDV..EGIAAL--ELIDGRAAALTREHLGV.....................RP
O05784_MYCTU/269-523RPRWQVTVSVVFDDWAAAV..AATRTIAQA.GLYPANC--RLLDPAEALLNAGTSVG.......................
Q97B62_THEVO/212-457KPQKVARLVAFYQDIESAG..RAVNELKVS..TIPEMA--EFLDKISLDSVPEAITY.......................
O86004_SPHAR/248-488LNMVVANGVAVGNALHEAALLG.KRRADFE.GQGPMAA--SAVKAAGEVLGLGYWNL.......................
Y2280_MYCTU/214-454RLDHNASVLAPFADFDQVM..AAVPKILAS.GLAPDIL--EYIDNTSMAALISTQNLEL...............GIPDQI
Q9YEU4_AERPE/215-469MPENVVVVLAFFPTLRQLV..DAVIEVKSR.AIDTLLM--EFMDVDSARLAAETLGA......................A
Q9YFD3_AERPE/238-468LPEFTGALAYRLPGFREGL..EAARRLTLW..RGARLL--RLLDPSEASMLYGVDGA.......................
Q55124_SYNY3/222-464TPESICVVLADFLSLEATA..QSVADIIAA.GIVPAGM--EIMDNFSINAVEDVVAT....................NCY
O86000_SPHAR/265-508VNQVIPNAAVAVDLLWEVS.AKTTRRHYFD.GKGPIPD--SIRKKIASDHGLGMWNF.......................
Q9F2Y0_STRCO/247-482SPRARALAVLGYTDEAGAA..EAAA......GLLPLGP--LTVEGMAVDLVPSTEGL.......................
Q9HMR2_HALSA/293-559VPAETAVAMLTYDDVRDAM..QDVAPVLDH...DPSAV--EVMDDVFLDLARDTDEFAD................VVGLL
Q9RVK1_DEIRA/212-453LPAEVVVLRCNFGTVAEAA..ACAVTVMGA.ALQPERL--ELIDEHEIHAVNVQLER.......................
Q9RDU1_PSESP/269-511ITQLIPNVVLFMHGMYETAICR.TRAEVTS.DPGPISE--ADARKAFKELGVGYWNV.......................
Q986W2_RHILO/218-457KPASEVNAFCALASLDAAI..ALLGLLRQRLGPLLSAY--EVNFAPLYDVMAASMAM...................PAPL
VAOX_PENSI/301-546LGMALQNVPTIRHILLDAAVLG.DKRSYSS.RTEPLSD--EELDKIAKQLNLGRWNF.......................
Q9KKW5_VIBCH/271-520EHAHKASALLVFADIEQAS..QAVTTLSKT...PVAAV--EMMDGRALRSVADKKGMP.................EFIAK
ADAS_TRYBB/307-576LPEVKRYEGWLFPSFEVAF..TAFHTCTRK.GIHPCTM--RLYDEDDTRLSFAASTDSGLVSTFFS.KCFKKYIATVKGW
O46096_DROME/289-531SSRAVNVAFIGLNSFDDVL..KTFVSAKRNLGEILSSC--ELIDERALNTALEQFKF...................LNSP
ADAS_DICDI/317-586VPQAVEYYGFLFPTFAHAV..SALQQIRSS.EVIPTMI--RVYDPEETQLSFAWKPSKGAVSEFTS.AMVKKYLHYIRSF
Q98KG4_RHILO/325-565IPQAISGGVCPFPSVEAAC..NAVIATIQM.GIPVARI--ELVNALQMRAMKNYSKL.......................
O67645_AQUAE/239-479KPKARMTALALFDDLETVG..KAVTKILTS.GVFPSAL--EFMDRDAIRAVEDFKPV.....................GL
Q9I3S8_PSEAE/214-458LQRPGATALLGLPDVDAAI..TIAARLRREHAERLFAC--EILWHDYLQCTAAPMGD...................SAPS
Q88EH0_PSEPK/279-533IPKYAVLVNVRYTSFMDAL..RDANALMAH...KPLSI--ETVDSKVLMLAMKDIVWHSVA............EYFPADP
Q97U60_SULSO/203-443KPEVSKTILASFNSIDDAG..KAVVSVYKA.GVTPAAM--EFLDKNSIIAIENTQYK.....................AN
O06093_MYCLE/211-446APAHRVTAVCGFSDLGALV..DASRAFRDV..YGIAAL--ELIDGRASSLIREHLGV.....................SS
Q9HKQ4_THEAC/212-457KPERIARILAFFRTIDDAG..NAISEVKER..IIPEMA--EFMDKISLDSVPDAIKY.......................
Q9HV36_PSEAE/265-514EHPHKASALLVFPTVETCC..TAVAVLKRQ...PVSAV--ELLDRRSLRSVENMQGMP.................EWVKS
GLCD_BACSU/216-457KPETKKTLLALYENIDAAA..QTVSDIIAA.KIIPATL--EFLDQPTLLVIEDYAKI.....................GL
Q9CMN0_PASMU/284-542IPQYRTLINVKYSSFDAAL..RNAPFMVKA...NALSV--ETVDSKVLNLAKQDIIWHSVS............ELLTEQE
DLD2_YEAST/277-529KPKAFNVSYLSVESFEDVQ..KVFVRARQELSEILSAF--EFMDAKSQVLAKSQLKDA..................AFPL
Q97Y18_SULSO/215-449LAPYHTDLSFLFPNFHNAI..KFTREYVLR.TSPPHRI--VVHDKESSEMMLNIPYN.......................
YDIJ_ECOLI/281-539LPKVRRLVNVKYDSFDSAL..RNAPFMVEA...RALSV--ETVDSKVLNLAREDIVWHSVS............ELITDVP

PF09330

DLD_ECOLI/278-567--------VFYIGTNQPEVLTEIRRHILANFENLPVAG--EYMHRDIYDIAEKYGKDTFLMIDKLGTDKMPFFFNLKGRT
LDHD_HAEIN/272-562--------VFYIGTNQTSVLSDIRRHMLVNFEVLPISG--EYIHRDAFDIAAKYGKDTFWVIKKFGTHWLPKLFSLKSNV
Q1NHT9_9SPHN/271-556--------TFYVGTNDPARLTRLRRTILRDFSALPIAG--EYMHRDAFDIADRYGKDMFVAIERMGTARLPRLFAAKSWV
A5WED9_PSYWF/295-585--------TFYIGSNSIGELAQLRRQILLGFTNIPEVG--EYMHRDIFDVSTKYGKDTFLSIKHLGTDTLPRLFSIKGAI
Q1VBS3_VIBAL/273-563--------VFYLGTNDPAKLTKLRKDFLSTFDNLPEMG--EYLHRDIFNMAEKYGKDVFLSIDLLGTDKLPKMFALKAKV
Q1YWQ9_PHOPR/273-563--------VFYIGTDDAEKLTQLRRDILSKFDNLPEMG--EYMHRDIFNLSEKYGKDVFLSINHLGTESLPKFFALKAKV
Q2BK95_9GAMM/272-562--------VYYIGTNDPQELTDIRRHILQHFENLPEVA--EYMHKDIYDIAEKYGKDTFMMINYFGTDPLPKLFAIKGKI
Q2VHK1_9LACT/268-556--------MFYIGTNNPDELEDIRRHIMTTFKELPVSG--EYMHKNAYKLAKKYGKDSLIVIEKIGTGHLPQMFALKAWG
Q5F898_NEIG1/272-561--------VFYIGTNDINELTDIRRAALGEFESLPVSG--EYIHRHAFDIADVYGKDTFYVIKKFGTHQLPKLFDLKARV
Q5FRI2_GLUOX/282-571--------VFYIGTNNTSDLEDLRRHVLTHFDELPIAG--EYLHRDAFNIAEKYGKDTFAVIRYFGTKYLPMFFSMKSRF
Q5NQX4_ZYMMO/284-573--------VFYIGTNDPDELTELRRQVLKSFKYLPISG--EYMHRHAYDIAAKYGKDTFLAIEYLGTDRLPQLFAMKGWF
Q66D31_YERPS/279-568--------VFYIGTNQTQVLTELRRIILRDFKHLPIAG--EYLHRDIFDIAETYGKDTFVMINSMGTNNMPRFFTLKGKI
Q6D2B5_ERWCT/284-573--------VFYIGTNQPQVLTELRRHMLADFKNLPVAG--EYMHRDIFDIAETYGKDTFMMIDKLGTDKLPLFFNLKGQV
Q6FFS0_ACIAD/279-567--------VFYVGSNDADDLTAIRRYLLTSLPSLPIAG--EYIHRDAYQIGEKYGKDTFLFIEKFGTANVPKAFAMKDKI
Q6WB82_ALCFA/276-564--------VFYIGTNEPDELTAVRRHLLTQLPRLPIAG--EYIHRTAYDIGEQYGKDTFLLIDRFGTAKVPSAFAMKSRI
Q7N371_PHOLL/278-567--------VFYIGTNQTGVLTELRRHILANFHNLPMAG--EYMHRDIFDIAEIYGKDAFIMIDKLGTDKMPTYFTLKGRM
Q7V9S2_PROMA/275-565--------VFFVGTNNAEHLTHLREKILTNMNSLPDMG--EYMHFSYFDGSAKYCKDTFLFLKYFGTKYLPKLLEAKRYI
Q7VS08_BORPE/283-572--------VFYIGTNDPGELTAIRRHMLTRLPALPIAG--EYLHRDAFDIADVYGKDTFLAIRQLGTARLPRLFAIKARI
Q8NRY8_CORGL/279-570--------VFYIGTNNTHELEEIRRLFLEADMPLPISG--EYMGRSAFDLAEKYGKDTFVFLKFMSPALQTRMFSFKTWA

PF04030

ALO_DEBHA/202-551VTLRTIPKYTIKSKQEI.......IKFDTLLKNWDTVW..LDSEFIRVWWFPYSGNCVCWRASKSSEPL..---------
GGLO_RAT/180-438VTLQCVPQFHLQETSFP.......STLKEVLDNLDSHL..KRSEYFRFLWFPHTENVSIIYQDHTNKAP..---------
A5WEE3_PSYWF/185-441LTLKVVDLYGLKESNEP.......IDFEQGLAGFYDTA..RAHRHMEWFLFPGTNKIQQKTLSVVAPQPMR---------
A7GLB1_BACCN/179-430IKLKVIPAYSLVYESRK.......EPFSLVMEKLEEY...KQNRHFEFFVFPYSNHVQVKFANETEREAG.---------
A9VEW0_BACWK/179-430IKLKVIPAYSLVYESEK.......QSLSTVMNKLEEY...KKNRHFEFFVFPYSDEVQVKFTNETTSKES.---------
Q8EQI8_OCEIH/179-431AKIRVVPSPVYRYISNH.......VYYPTLLNNLETYI..QDNQHFEFFMFPYADQVQTKTMNPTNTSPK.---------
Q47NJ0_THEFY/176-430ITMAVEPAFLLHARETP.......MPLGEVLERLEELR..TTNDHFEFFWFPHTERTITKRNNRVPGPARP---------
Q82KJ4_STRAW/182-436ITFSVEPVFLLTAREEP.......MSFDKVTADFDELF..AENEHFEFYWFPHTGNCNTKRNNRSAGPERP---------
Q2JG59_FRASC/206-462VTLQAVPLFALQVQEGP.......MRLDEVLDTYDDLV..DQTDHLRFSWFPHTTTALVRRGQRRPLDDGL---------
Q4JW76_CORJK/189-446VEMDVVDTFVLHAVERA.......EPNDEVVENFAERV..RGKDHLEFYWFPGTDVAHVKTNTRLPGNTPT---------
O06804_MYCTU/172-425VTLQTVPLFTLHRHDQR.......RSLAQTLERLDEFV..DGNDHFEFFVFPYADKALTRTMHRSDEQPK.---------
Q5YR83_NOCFA/174-426VTLQLVPSFVLEGIERP.......VPVDEVLAELDSYV..DGNEHFEFYMFGHSPLAMTKRNSRVDLPEQP---------
Q390J8_BURS3/172-425IGLRLVPAFKLRLERGG.......MQLDDCLAQADTLI..AKHRSFEFYWFPHTDTVLTKAWDMTDEPAD.---------
Q92X65_RHIME/187-406TTLKLEPLHDLHRQEWC.......LAFEPCMEVLDKLS..RENRNFDFYWYPRSDEVKIRCLNPPGEEKD.---------
Q9HTM8_PSEAE/186-438VRLQNRAAYRLRERQWI.......ARTEELLEDVEKNT..RENQHWEMLVVTHSDYALSIALNETDEPKTP---------
Q983S0_RHILO/175-424VTLNNIATYRLRRRKWV.......LPIGDMLRDFEKMM..TAHRSAEFYYIPFSGYAQFIASDFSTEATTT---------
Q4DPS1_TRYCC/258-491STSRKIPQSLNLVKPSS...........DAALEYQTWL..EDQKRLY........................---------
Q57ZU1_TRYB2/262-506ATLPMTAGNTITKLTSSKLRNFSSEKCNSTGEDYQMWL..RNQRTLR........................---------
Q4QE54_LEIMA/258-489APVQLSPAALQEESRTN.......ESAERAGDRSISLIVKSALKYIA........................---------
Q4PIL2_USTMA/445-677VTIASSTSDTAGSRDEQ.......QQL..LIRDIGQSL....AHNGNVGGYAESEPSLLWLQS........---------
Q5K700_CRYNJ/204-464VEIEVEDAFRLRETKEG.......KRVEEVLESLDEIR..KSAEHVRVWWYPYGKGAVVGRASRTYEP...---------
Q2H4W5_CHAGB/168-472VTLRAVPAFSLAWSQTI.......DADARLFEGWDDVL.WKQAEFVRVWWFPYMRRAVVWKADRVEKEEIE---------
ALO_NEUCR/210-513VTFKAVPAFSLAWSQAI.......DSDKRIFEKWEKDL.WSQAEFVRIWWFPYMRRAAVWTANVVDPVDLK---------
Q2UQI3_ASPOR/199-482VTFKAEASFKVAWRQTR.......RALSSVLAEWSTGL.WTSHEFVRVWWMPYEKSAIVWQADKTDLPL..---------
ALO_CANAL/202-552VTLRTCPKYTIKSKQEI.......INFETLLNNWDNLW..LESEFIRIWWFPYTNKCVLWRANKSTDPL..---------
ALO_CANGA/188-518ATVRVVPAFNIKSTQEV.......IKFETLLEKWDSLW..TSSEFIRIWWYPYTRKCILWRGVKTNEPQ..---------
ALO_YEAST/186-516ATIRVVPGFNIKSTQEV.......ITFENLLKQWDTLW..TSSEFIRVWWYPYTRKCVLWRGNKTTDAQ..---------
ALO_ASHGO/192-522ATIRVVPAFNIHSTQEV.......INFETLLDNWETIW..TSSEFIRCWWYPYVRKCVLWRGVKTSEPA..---------
ALO_KLULA/190-520ATIRVIPEFNIKSTQEV.......IHFETLLNNWETIW..TSSEFIRCWWYPYTRKVVLWRGSKTEEPL..---------
ALO_YARLI/189-523ATLRTVPAYTIHSTQHV.......ITFETLIREWDNLW..TASEYIRVWWFPYAERCILWRASKSELPL..---------
ALO_SCHPO/187-459ITISVVPAFDLVATEDV.......TTVTDLFQDWKNNLIWESAEFVRVHVFPYANRAVVWRANKVEPNTV.---------
GGLO_SCYTO/180-438VTIQCVPAFRIHLQQFP.......KTLTEVLGDLDTHL..KQSEYFRFFWFPHTDKVTVFYADRTNKPI..---------
Q5U4Z7_XENLA/180-438VTIQCRSAFHLKEVPFS.......STLQEVLDNLDTHL..NSSEYFRFYWFPHTENVSVFYQDPTDKPP..---------
Q22YW5_TETTS/180-449VTFRTIPMEILTCKKIT.......TNFDTLCSVYSQMN..EKSDYAKAWWFPESDDVHIWDVNKASEEEQE---------

PF09129

Q2T0X3_BURTA/323-645-RLQCESFVDIPASELF-------APAGSRGRTVESFV--RRSGRIEAIWFPFTDYPWLKVWTVRPTRPSG.........
Q7SID9_BREST/223-561-RQRCQSYTDIPWRELF-------APKGADGRTFEKFV--AESGGAEAIWYPFTEKPWMKVWTVSPTKPDSSNEVGSLGS
Q9HWP1_PSEAE/277-597-RMRCQSYVNIPASEMF-------AAAGSGGRTFDSFL--QKSGRAEAIWFPFTDKPWLKVWTPTPRCPFG.........

PF08031

YGAK_BACSU/399-443-----------------------------------------------------------------------DYVNWPD--
Q7RV07_NEUCR/421-465-----------------------------------------------------------------------TYAGYVD--
Q7S1P7_NEUCR/453-499-----------------------------------------------------------------------MYINYAD--
MCRA_STRLA/395-442-----------------------------------------------------------------------TNLNFA.--
Q6LJC7_PHOPR/280-323-----------------------------------------------------------------------VYVNFIS--
Q8LSM7_HELAN/478-533-----------------------------------------------------------------------AYMNYND--
Q8NIW9_NEUCS/507-551-----------------------------------------------------------------------AYMNEGN--
Q84WI1_ARATH/431-489-----------------------------------------------------------------------AYVNFKD--
Q84N20_NICLS/354-412-----------------------------------------------------------------------AYINYRD--
Q84PV7_ORYSJ/461-526-----------------------------------------------------------------------AYVNYLD--
Q8NK91_ASPOZ/503-547-----------------------------------------------------------------------AYLNEAD--
Q6EUS8_ORYSJ/495-552-----------------------------------------------------------------------AYINYRD--
Q93Y11_ARATH/480-538-----------------------------------------------------------------------AYVNYRD--
Q8EGB1_SHEON/850-894-----------------------------------------------------------------------AFINFKD--
Q8GTB6_CANSA/480-538-----------------------------------------------------------------------AYLNYRD--
Q6NNH8_ARATH/100-155-----------------------------------------------------------------------AFLNYRD--
Q8XND2_CLOPE/404-448-----------------------------------------------------------------------SFINFPF--
Q92U94_RHIME/427-471-----------------------------------------------------------------------AYVNFMP--
Q7SB35_NEUCR/597-641-----------------------------------------------------------------------GYLNEGD--
Q9LNL9_ARATH/467-522-----------------------------------------------------------------------AFLNYRD--
Q7X2G7_9ACTO/444-497-----------------------------------------------------------------------CYINYPD--
Q7NIA5_GLOVI/31-76-----------------------------------------------------------------------AYYNFLR--
Q8VWA5_9ACTO/433-486-----------------------------------------------------------------------TFINYPD--
Q82GZ2_STRAW/449-493-----------------------------------------------------------------------AYVNVPN--
YVDP_BACSU/400-444-----------------------------------------------------------------------SYVNVPD--
Q6PW77_ACRST/450-496-----------------------------------------------------------------------KYFNYAD--
Q9X5T1_STRLA/421-468-----------------------------------------------------------------------VCLNFLA--
O94206_CLAPU/412-457-----------------------------------------------------------------------SYRNLGD--
Q8X0G1_NEUCS/561-604-----------------------------------------------------------------------AYINEAD--
Q7SHH8_NEUCR/453-496-----------------------------------------------------------------------VYVNYAH--
Q84PV6_ORYSJ/334-398-----------------------------------------------------------------------AYVNYLD--
O64745_ARATH/479-537-----------------------------------------------------------------------AFFNYRD--
Q869M2_DICDI/431-473-----------------------------------------------------------------------DYSNIND--
Q9AYM8_VIGUN/473-530-----------------------------------------------------------------------AYVNYRD--
Q9SA85_ARATH/465-524-----------------------------------------------------------------------SFFNYRD--
Q7V3Z6_PROMM/524-568-----------------------------------------------------------------------SYVNEGN--
Q9FKU8_ARATH/476-534-----------------------------------------------------------------------AYVNYRD--
Q7WZ62_9ACTO/469-522-----------------------------------------------------------------------AYINYPD--
Q7S915_NEUCR/469-516-----------------------------------------------------------------------AFINFPD--
Q9ALN1_9PSEU/476-529-----------------------------------------------------------------------SYINYPD--
RETO_ESCCA/455-517-----------------------------------------------------------------------GYVNHID--
Q9ZPP5_BERST/452-514-----------------------------------------------------------------------AYVNHVD--
RETO_PAPSO/459-521-----------------------------------------------------------------------GYVNHID--
Q8KSY2_9ACTO/421-466-----------------------------------------------------------------------SYINFPD--
Q8RWA4_ARATH/490-547-----------------------------------------------------------------------AFFNFRD--
Q9FKV2_ARATH/471-528-----------------------------------------------------------------------AYLNYRD--
Q81C29_BACCR/8-52-----------------------------------------------------------------------VYVNTPD--
Q81IH6_BACCR/396-440-----------------------------------------------------------------------DYVNWPD--
Q6ZB64_ORYSJ/480-545-----------------------------------------------------------------------AYVNYVD--
Q9EX55_STRCO/495-548-----------------------------------------------------------------------CYINYAD--
P93762_CHOCR/484-535-----------------------------------------------------------------------CYFNYPD--
Q8KY45_STRCU/463-508-----------------------------------------------------------------------SYINFPS--
P71984_MYCTU/413-458-----------------------------------------------------------------------AYVNFTA--
Q94KD7_ARATH/470-527-----------------------------------------------------------------------AYLNYRD--
Q93S08_STRCO/490-543-----------------------------------------------------------------------AFINYAD--
Q93ZA3_ARATH/477-530-----------------------------------------------------------------------AYVNYRD--
Q9KHK2_9ACTO/415-460-----------------------------------------------------------------------GYVNFMN--
Q948L1_DAUCA/449-503-----------------------------------------------------------------------SYVNYRD--
Q8GXL5_ARATH/76-133-----------------------------------------------------------------------TYINYRD--
Q9SA89_ARATH/469-526-----------------------------------------------------------------------SYLNYRD--
Q87IH1_VIBPA/415-459-----------------------------------------------------------------------AYINFLT--
Q8Y3D0_RALSO/458-507-----------------------------------------------------------------------CYINYPD--
Q9FKV0_ARATH/479-537-----------------------------------------------------------------------AYVNYRD--
O64743_ARATH/475-528-----------------------------------------------------------------------AYVNYRD--
Q8SA59_HELAN/476-534-----------------------------------------------------------------------AFLNYRD--
Q9HGH9_ASPOZ/508-552-----------------------------------------------------------------------AYLNEAD--
Q84PV5_ORYSJ/467-535-----------------------------------------------------------------------AYINYMD--

PF09265

Q9FE45_9ASPA/238-524EKDLKKIKKLASG.NEGVIYCLEASFYYDYGHEMNFSRA...D.KAQMDQDIEELLRKLSFVSGFAFRNDVSYMGFLNRV
CKX8_ORYSJ/239-523PAQLNFSPDFGSKGRKKVYYCIEFAVHDF........QQ...D.SSRADHVVKLVSAKLSYLRPHVYSVEVSYFDFLNRV
CKX7_ARATH/239-520PDHEFDPTRLPQS.CGSVLYCLELGLHYR........DS...DSNSTIDKRVERLIGRLRFNEGLRFEVDLPYVDFLLRV
CKX3_ORYSJ/232-512PTNVDFNPDFGTKNNPKIYYCIEFAVHDY........QN...K.NINVEQVVEVISRQMSHIASHLYSVEVSYFDFLNRV
Q8H6F6_HORVU/238-510PQDPERASRFET..DRKVLFCLEMTKNFN........PE...E.ADIMEQEVHALLSQLRYTPASLFHTDVTYIEFLDRV
CKX4_ARATH/250-523LSDQTRVASLVN..DHRIIYVLEVAKYYD........RT...T.LPIIDQVIDTLSRTLGFAPGFMFVQDVPYFDFLNRV
Q709Q4_MAIZE/241-516PQDPVEASHFQS..DGRVLYCLELTKNFN........SD...D.TDTMEQEVTVLLSRLRFIQSTLFHTDVTYLEFLDRV
CKX5_ORYSJ/244-525PQNPVKLSSLKH..HSGVLYCLEVTKNYD........DS...T.AVTVDQDVEALLGELNFIPGTVFTTDLPYVDFLDRV
CKX2_ORYSJ/256-560DADEARVAALAKE.AGGVLYFLEGAIYFGGA....AGPS.....AADVDKRMDVLRRELRHERGFVFAQDVAYAGFLDRV
CKX7_ORYSJ/234-513SSDIGRLAGLASKSVSGVIYVIEGTMYYN........ES...T.STTMDQKLESILGQLSFEEGFVFTKDVRYVQFLDRV
CKX10_ORYSJ/246-530ATDLARLTGLAIDTGSVAIYYIEGAMYYD........DN...T.AASVDQKLDALLEELSFVRGFVFVRDASYVEFLDRV
Q5WY14_LEGPL/211-449LKEDKRIP......MAYWLYGLHLSVEYD....................RHAENILGQLKPW.NVLNIQDESTLSYFLRH
CKX1_ARATH/263-539PNDSTQASRFKS..DGKTLYCLEVVKYFN........PE...E.ASSMDQETGKLLSELNYIPSTLFSSEVPYIEFLDRV
CKX5_ARATH/242-520PRNPVKISSVSS..NGSVLYCLEITKNYH........DS...D.SEIVDQEVEILMKKLNFIPTSVFTTDLQYVDFLDRV
CKX1_MAIZE/246-533DADVARIVALAGERNATTVYSIEATLNYD........NA..TAAAAAVDQELASVLGTLSYVEGFAFQRDVAYAAFLDRV
CKX11_ORYSJ/219-503PDGAHFDASLLPANAGPVLYCLEVALYQR........GGGGDGGGDDMDKRVGEMMRQLKYVRGLEFAAGVGYVDFLSRV
CKX2_ARATH/227-501PSDQSKVADLVK..QHGIIYVLEVAKYYD........DP...N.LPIISKVIDTLTKTLSYLPGFISMHDVAYFDFLNRV
CKX3_ARATH/244-517PSDHLRIASMVK..RHRVIYCLEVVKYYD........ET...S.QYTVNEEMEELSDSLNHVRGFMYEKDVTYMDFLNRV

PF02913

D2HDH_ARATH/309-551SSSENFYILIETTGSDE..TNDREKLEA.------------------------------------------FLLKSLEKG
DLD_ARATH/319-560NLTEAPTLMFEFIGTE...AYTREQTQ..------------------------------------------IVQQIASKH
Q9RJ97_STRCO/274-525RQDAGCLAVVGFEGTGE..DTAHRREGAA------------------------------------------EILRESGGT
Q9RTM9_DEIRA/229-469PRDADAVLLVDTDGDDA..EIVAAELE..------------------------------------------LVAQACAAA
Q987T8_RHILO/164-381....EAATLLRVEGFGP..SVVYRIA...------------------------------------------TLKTLLGKA
DLD1_KLULA/320-566NWVESPTLFFKIGGRSE..QIIQEVIK..------------------------------------------EVEKIASQH
ADAS_RAT/370-643DPNQISVATLLFEGDRE..KVLQHEKQVY------------------------------------------DIAAKFGGL
P72842_SYNY3/220-430......GLLVRFQNLEP..VVQAQIDEVK------------------------------------------KLAQTLT..
Q9A317_CAUCR/209-458PEAHPWYVLIEIASGEP..GAAEAALER.------------------------------------------LLAGALERG
Q987U0_RHILO/206-447PLDVEALLIVELDGPG...VEVDHLIT..------------------------------------------AVEAIAISN
Q9S2F6_STRCO/248-487PESTEALLLAAFDTTDP.....AADLA..------------------------------------------AVGALCEAA
Q9HTK3_PSEAE/230-471PVDAAAILLCELDGVE...ADVHEDCE..------------------------------------------RVRELFEAA
O29450_ARCFU/211-460.DEEGNMLVVGIECNH...EASERIAS..------------------------------------------ALESILSQT
O53525_MYCTU/223-473QITGGCLGITVFEGTQE..HTESRHAETR------------------------------------------ALLAARGGT
Q9KSQ8_VIBCH/286-544GKEMQGINMVEYAGQDS..AQINQQVA..------------------------------------------QLTARLDEM
O29393_ARCFU/221-445......TLIAVFEGRAA..SAKLKEARNL------------------------------------------VRGRLVEGR
Q97G30_CLOAB/221-465DSAADAYLLLTFDGNST..EEIEKDYE..------------------------------------------SAANIVLNE
Q9I6H4_PSEAE/216-461ETDCPFYALLEFEATTE..EVANEALA..------------------------------------------TFEHCVEQG
Q9K9B9_BACHD/216-457PTDVQAVLLIEQDGPS...EVVKREME..------------------------------------------KMHALCEQG
YN53_SCHPO/272-525EDEHPFYVLVETQGSNK..EHDEQKITA.------------------------------------------LVEDLLEKE
Q986B0_RHILO/224-475ADDWPWYVLMQISSGRS..EADGRALIEE------------------------------------------VLADGLQQG
O29853_ARCFU/209-439SREGEAHLLMVFESFD........EAE..------------------------------------------EAAKIAQSL
DH4C_PSEPU/270-513.....YAALYGTQEQV........DVNWK------------------------------------------IVTDVFKKL
Q9F3A3_STRCO/294-548LPRETAALLVEFRAPDEAGQAAFERAAAR------------------------------------------VVERLELVA
Q9PGF5_XYLFA/218-457IPMAGAMLLIEGDGNH...DTLPYILQ..------------------------------------------ALAQAASGE
Q9HZI0_PSEAE/264-527AGEGKCMLTFGVTGNRR..QNGLSLSQAK------------------------------------------ALLKRFGGV
ADAS_CAEEL/313-584KVDEICAATCVYEGNRE..EVDQHEERLN------------------------------------------KLAEQFHGV
Q11061_MYCTU/215-454DRDAAAMLVAGSDERG...RAATEDAA..------------------------------------------VMAAVFAEN
Q9D635_MOUSE/239-480NCPVAPTLFLEFHGSQ...QTLAEQLQ..------------------------------------------RTEAITQDN
ADAS_DROME/337-605DLNQICAATLLFEGDLK..DVQRQEALIY------------------------------------------EIAEKFQGF
O07406_MYCTU/211-446PVEADWLLLVELAADHD............------------------------------------------QTDRLADLL
O05784_MYCTU/269-523....GGLLVLAFESADH..PIDPWLHRAV------------------------------------------AITAEHGGT
Q97B62_THEVO/212-457PPGTKYALIIDVSGPP...ELLGKKKT..------------------------------------------ETEELLKRY
O86004_SPHAR/248-488.....YGSLYGLPGNV........AILWD------------------------------------------MVKGAFSSI
Y2280_MYCTU/214-454RDSCEAYLLVALENRIA..DRLFEDIQ..------------------------------------------TVGEMLMEL
Q9YEU4_AERPE/215-469IRPDGHMLLVGVPVNR...EASTRVLE..------------------------------------------EMVSIAKAA
Q9YFD3_AERPE/238-468......VLMVEVEAPDR..GLLEAMEGYV------------------------------------------EKVASASGG
Q55124_SYNY3/222-464PRDAAAILLVELDGLP...IEVELNQA..------------------------------------------KVEEICRNN
O86000_SPHAR/265-508.....YAALYGPPPII........ENNWK------------------------------------------LVEEAMMSI
Q9F2Y0_STRCO/247-482.PRGGAWLFVETGGDTE..AEARARAE..------------------------------------------...AVVRAA
Q9HMR2_HALSA/293-559PDGTDSTLLVEFYADSP..AEARRRVADL------------------------------------------LADRLPSAT
Q9RVK1_DEIRA/212-453DYPERPTLWIELASPSR..AALEESLS..------------------------------------------VCSDLCRDA
Q9RDU1_PSESP/269-511.....YFALYGTEEQI........AVNEK------------------------------------------IVRGILEPT
Q986W2_RHILO/218-457PVGSPVYVLAEIQGNEP..ERDGERFAE.------------------------------------------VLMQAVEDG
VAOX_PENSI/301-546.....YGALYGPEPIR........RVLWE------------------------------------------TIKDAFSAI
Q9KKW5_VIBCH/271-520LDLEAAALLIESHASDA..QTLHAQCEQ.------------------------------------------VMSALQRYH
ADAS_TRYBB/307-576NLSKISLVVVGFEGTKA..QTNCQRSELV------------------------------------------GVFQAFGAT
O46096_DROME/289-531ISGFPFYMLIETSGSNG..DHDEEKINQ.------------------------------------------FIGDGMERG
ADAS_DICDI/317-586DFKNVCLSIIGFEGPKK..VVDFHRTSVF------------------------------------------DILSKNAAF
Q98KG4_RHILO/325-565DYPESPCLFVEFHGSD...AGVAEQAE..------------------------------------------TFGMIAEEN
O67645_AQUAE/239-479PRDVEALLLIEVDGHP...LTVKEEIK..------------------------------------------EVGKILEEL
Q9I3S8_PSEAE/214-458LAPCPLYLLVELAEDRH..LDAGEALTA.------------------------------------------LLEDCFEDG
Q88EH0_PSEPK/279-533ERPTLGINLVEFCGDEP..AEVNAKVQ..------------------------------------------AFIQHLQSD
Q97U60_SULSO/203-443YPMAEAILLIELDGYSV..NVEEEEVR..------------------------------------------VVSAIRNNN
O06093_MYCLE/211-446PVDGDWLLLVELAADHD............------------------------------------------QTNRLAELS
Q9HKQ4_THEAC/212-457PEGTNYALIVDASGPP...ETLQRRRE..------------------------------------------QIEGILKKY
Q9HV36_PSEAE/265-514LSAGACALLIESRAASR..TLLHEQLGR.------------------------------------------IMASIAEYP
GLCD_BACSU/216-457PTSAKAVLLIEQDGPF...ETVERDME..------------------------------------------KIEAICKKG
Q9CMN0_PASMU/284-542ENPILGLNIVEYASNDK..GQIHRQVQ..------------------------------------------ALCAELDKK
DLD2_YEAST/277-529EDEHPFYILIETSGSNK..DHDDSKLET.------------------------------------------FLENVMEEG
Q97Y18_SULSO/215-449......IALIRVRGYDE..DLVNVNEKII------------------------------------------RQLAMRHNA
YDIJ_ECOLI/281-539DQEMLGLNIVEFAGDDE..ALIDERVN..------------------------------------------ALCARLDEL

PF09330

DLD_ECOLI/278-567DAMLEKVKFFRPHFTDRAMQKFGHLFPSHLPP---------------------------------------RMKNWRDKY
LDHD_HAEIN/272-562DRIGKKFFFLPQHLSDKFMQTVSKFIPEHLPQ---------------------------------------SLWDYRNKY
Q1NHT9_9SPHN/271-556D....NLPCIRPGWSDRMMQRFGRLLPDHLPP---------------------------------------EMRRFRDRF
A5WED9_PSYWF/295-585DAKLNKWSWMPKHFTDKVMQFIANIFPNHLPK---------------------------------------RMTQYRNKY
Q1VBS3_VIBAL/273-563ENFLERIPFVSKYLPDTILYYASKLFPQHLPE---------------------------------------RMLDFRDKY
Q1YWQ9_PHOPR/273-563ENFLGRIPYVNKYLPDTILYYVSKLFPQHLPK---------------------------------------RMLDFRNKY
Q2BK95_9GAMM/272-562AAYLNKISFLPKDIPDRVMQFACKLWPNIIPK---------------------------------------RMRDFREKY
Q2VHK1_9LACT/268-556ERFLKHIPFFKPYFPDRLLQTLSNLFPNQMPK---------------------------------------RLDDYYEKY
Q5F898_NEIG1/272-561DRFGKKVSFLPKHFSDKAMQFVSKFLPDHLPK---------------------------------------SMRDYRDKY
Q5FRI2_GLUOX/282-571DVFAQRLPFLSDHFSDLAMQFLSRFLPKQLPQ---------------------------------------RMCDYRDRF
Q5NQX4_ZYMMO/284-573DGLNNRVSFLPRYLSDRVMQFASTLFPHHLPK---------------------------------------RMDDFRDRY
Q66D31_YERPS/279-568DARLNKIPHLVDHLTDRVMQGFSQILPNHLPK---------------------------------------RLKTYRNQY
Q6D2B5_ERWCT/284-573DTIFSKVPFLPSHLVDRTMQFLGRLLPSHLPA---------------------------------------RMKTYRDRF
Q6FFS0_ACIAD/279-567DGVLEKLKI..KGLTDHLLQALTFCLPSHLPK---------------------------------------RMTEFRDLY
Q6WB82_ALCFA/276-564DGFFERFGW..RGVTDRVIQAVMNRLPSHLPA---------------------------------------RMRQWRDRF
Q7N371_PHOLL/278-567DAIFNRVPFLPVNLIDRIMQGLSRLLPSHLPK---------------------------------------RLKEYRNRF
Q7V9S2_PROMA/275-565DQLTGQVTFLPENISDRLMQFIADILPNHLPI---------------------------------------RLLSFRKKF
Q7VS08_BORPE/283-572DSFCERVPLLPKYLSDRVLQFASRLFPDHLPR---------------------------------------RLREYRDAY
Q8NRY8_CORGL/279-570NGLFSKIPGIGPTFADTVSQAMFSVLPNQLPK---------------------------------------RMMEYRNRF

PF04030

ALO_DEBHA/202-551------........SKPRDSWYGTWFGRK------------------------------------------FYESLLWIS
GGLO_RAT/180-438------........SSASNWFWDYAIGFY------------------------------------------LLEFLLWTS
A5WEE3_PSYWF/185-441------......RAQKLKDHFESIVILNG------------------------------------------AFYLLSELA
A7GLB1_BACCN/179-430------........DLKWHKLKIELLENK------------------------------------------VFSLLSNGC
A9VEW0_BACWK/179-430------........DLKWHKLKVELLENR------------------------------------------MFSLLSKGC
Q8EQI8_OCEIH/179-431------........SIKRHQWNNLIVENY------------------------------------------MYQAVSHLC
Q47NJ0_THEFY/176-430------.......LSAFRAWLDDEFLSNS------------------------------------------VFEVVNRMA
Q82KJ4_STRAW/182-436------.......VGQLSGWIEDEFLSNG------------------------------------------VFQVANLLG
Q2JG59_FRASC/206-462------A.....PLPRLRCWVDDELVSNT------------------------------------------LFGALMTTG
Q4JW76_CORJK/189-446------N.....PIPRWKEVLDDELLNNG------------------------------------------AYRAMCDLA
O06804_MYCTU/172-425------.......PTPGWQRMVGENFENG------------------------------------------GLSLICQTG
Q5YR83_NOCFA/174-426------.......RAKAVDWLADIVLSNY------------------------------------------TFDALCRLG
Q390J8_BURS3/172-425------.......SVHWASRASESFLENT------------------------------------------VFGALCGLG
Q92X65_RHIME/187-406------.......................------------------------------------------.YGAFARLA
Q9HTM8_PSEAE/186-438------.......PLDPAKEGGNEFVG..------------------------------------------LIEGLDKYL
Q983S0_RHILO/175-424------R.....PT.......DDDEGSLR------------------------------------------TLRRLRTGL
Q4DPS1_TRYCC/258-491------........TRLCKALKGNWLRHG------------------------------------------VVQAVLAAA
Q57ZU1_TRYB2/262-506------........TRICKILKGSWLRHG------------------------------------------VVEAALAAA
Q4QE54_LEIMA/258-489------................TDFVRHQ------------------------------------------VVECSLYAA
Q4PIL2_USTMA/445-677------........SVPVGSLN.......------------------------------------------.........
Q5K700_CRYNJ/204-464------........AQPTSDLVGHILGFH------------------------------------------VTQFFLYVA
Q2H4W5_CHAGB/168-472------AG..RVRHSQPPTSFQDSRLGYI------------------------------------------VYQNLLALA
ALO_NEUCR/210-513------TG..AVKHREPPTSYYDSWLGYY------------------------------------------VYHNLLALS
Q2UQI3_ASPOR/199-482------........RAPPATFYGETIGYH------------------------------------------IYHNLLALA
ALO_CANAL/202-552------........SDPRPSWYGTKLGRF------------------------------------------FYESLLWVS
ALO_CANGA/188-518------........TKSRYSWWGSTLGRF------------------------------------------FYQTLLFIS
ALO_YEAST/186-516------........NGPAKSWWGTKLGRF------------------------------------------FYETLLWIS
ALO_ASHGO/192-522------........EKSRSSWWGTTLGRL------------------------------------------VYESLLWLT
ALO_KLULA/190-520------........TAPRKSWWGSTFGRF------------------------------------------IYESLIWIS
ALO_YARLI/189-523------........SAPRPSWYGTWLGRL------------------------------------------FYETLLWVS
ALO_SCHPO/187-459------.......PHTPKPSLFRLKLDSF------------------------------------------VYQCLLFVG
GGLO_SCYTO/180-438------........KTTSSWFWNYAIGYY------------------------------------------LLEFLLWIS
Q5U4Z7_XENLA/180-438------........SSKANWFRDTFLGHY------------------------------------------LLEFLLWIS
Q22YW5_TETTS/180-449------LYFQNNRELTQISQQTDNQLNEA------------------------------------------IDQIILKMS

PF09129

Q2T0X3_BURTA/323-645..........ARVVDQPYNYPFSDSISQH------------------------------------------VSDLVSRIV
Q7SID9_BREST/223-561AGSLVGKPPQAREVSGPYNYIFSDNLPEP------------------------------------------ITDMIGAIN
Q9HWP1_PSEAE/277-597..........ARAVNGPFNYPFSDNIPKA------------------------------------------LSDLLAAIN

PF08031

YGAK_BACSU/399-443-----------------------------------------------------------IEIR.................
Q7RV07_NEUCR/421-465-----------------------------------------------------------PELK.................
Q7S1P7_NEUCR/453-499-----------------------------------------------------------PTMK.................
MCRA_STRLA/395-442-----------------------------------------------------------...GVED..............
Q6LJC7_PHOPR/280-323-----------------------------------------------------------EDE..................
Q8LSM7_HELAN/478-533-----------------------------------------------------------LDLGFDSA.............
Q8NIW9_NEUCS/507-551-----------------------------------------------------------FQQP.................
Q84WI1_ARATH/431-489-----------------------------------------------------------MDLGMYLGKK..........K
Q84N20_NICLS/354-412-----------------------------------------------------------LDIGVNNKKG..........N
Q84PV7_ORYSJ/461-526-----------------------------------------------------------LDLGANNWTHPIG....GSSM
Q8NK91_ASPOZ/503-547-----------------------------------------------------------FRQP.................
Q6EUS8_ORYSJ/495-552-----------------------------------------------------------LDLGQNVEG...........N
Q93Y11_ARATH/480-538-----------------------------------------------------------LDLGQNKDNS..........K
Q8EGB1_SHEON/850-894-----------------------------------------------------------NTIP.................
Q8GTB6_CANSA/480-538-----------------------------------------------------------LDLGKTNHAS..........P
Q6NNH8_ARATH/100-155-----------------------------------------------------------IDIGSSGN.............
Q8XND2_CLOPE/404-448-----------------------------------------------------------KDLK.................
Q92U94_RHIME/427-471-----------------------------------------------------------EDEM.................
Q7SB35_NEUCR/597-641-----------------------------------------------------------VMEP.................
Q9LNL9_ARATH/467-522-----------------------------------------------------------IDIGKNLN.............
Q7X2G7_9ACTO/444-497-----------------------------------------------------------ADLLDPA..............
Q7NIA5_GLOVI/31-76-----------------------------------------------------------GDEQ.................
Q8VWA5_9ACTO/433-486-----------------------------------------------------------VDLADPR..............
Q82GZ2_STRAW/449-493-----------------------------------------------------------IGMQ.................
YVDP_BACSU/400-444-----------------------------------------------------------QNIE.................
Q6PW77_ACRST/450-496-----------------------------------------------------------TTLT.................
Q9X5T1_STRLA/421-468-----------------------------------------------------------GHNT.................
O94206_CLAPU/412-457-----------------------------------------------------------PQEK.................
Q8X0G1_NEUCS/561-604-----------------------------------------------------------PFQP.................
Q7SHH8_NEUCR/453-496-----------------------------------------------------------GDET.................
Q84PV6_ORYSJ/334-398-----------------------------------------------------------LDLGTNTWRNATD....GTSN
O64745_ARATH/479-537-----------------------------------------------------------VDIGITTPG...........Y
Q869M2_DICDI/431-473-----------------------------------------------------------TFLS.................
Q9AYM8_VIGUN/473-530-----------------------------------------------------------LDIGVNNNG...........Y
Q9SA85_ARATH/465-524-----------------------------------------------------------VDLGINSHNG.........KI
Q7V3Z6_PROMM/524-568-----------------------------------------------------------FFEP.................
Q9FKU8_ARATH/476-534-----------------------------------------------------------LDLGRNTKDV..........K
Q7WZ62_9ACTO/469-522-----------------------------------------------------------SDLADPG..............
Q7S915_NEUCR/469-516-----------------------------------------------------------EVLS.................
Q9ALN1_9PSEU/476-529-----------------------------------------------------------TDLADPL..............
RETO_ESCCA/455-517-----------------------------------------------------------LDLGGIDWGNKT......VVN
Q9ZPP5_BERST/452-514-----------------------------------------------------------LDLGRLDWTNST......IAS
RETO_PAPSO/459-521-----------------------------------------------------------LDIGGIDWRNKS......STT
Q8KSY2_9ACTO/421-466-----------------------------------------------------------SRTP.................
Q8RWA4_ARATH/490-547-----------------------------------------------------------IDIGSNPSG...........E
Q9FKV2_ARATH/471-528-----------------------------------------------------------LDLGMNRGV...........N
Q81C29_BACCR/8-52-----------------------------------------------------------LSIK.................
Q81IH6_BACCR/396-440-----------------------------------------------------------IDIK.................
Q6ZB64_ORYSJ/480-545-----------------------------------------------------------LDLGTNALAGNV.....SSPS
Q9EX55_STRCO/495-548-----------------------------------------------------------ADLADPA..............
P93762_CHOCR/484-535-----------------------------------------------------------VDLNNW...............
Q8KY45_STRCU/463-508-----------------------------------------------------------SRVG.................
P71984_MYCTU/413-458-----------------------------------------------------------DDAP.................
Q94KD7_ARATH/470-527-----------------------------------------------------------LDLGSTKGI...........N
Q93S08_STRCO/490-543-----------------------------------------------------------ADLADPA..............
Q93ZA3_ARATH/477-530-----------------------------------------------------------LDLGMNG..............
Q9KHK2_9ACTO/415-460-----------------------------------------------------------PGEA.................
Q948L1_DAUCA/449-503-----------------------------------------------------------ADLGIGSR.............
Q8GXL5_ARATH/76-133-----------------------------------------------------------LDIGVNTPG...........P
Q9SA89_ARATH/469-526-----------------------------------------------------------IDIGVNDHG...........A
Q87IH1_VIBPA/415-459-----------------------------------------------------------QDEA.................
Q8Y3D0_RALSO/458-507-----------------------------------------------------------VDML.................
Q9FKV0_ARATH/479-537-----------------------------------------------------------LDFGQNKNNA..........K
O64743_ARATH/475-528-----------------------------------------------------------LDLGTNE..............
Q8SA59_HELAN/476-534-----------------------------------------------------------LDIGINSHG...........R
Q9HGH9_ASPOZ/508-552-----------------------------------------------------------FHQP.................
Q84PV5_ORYSJ/467-535-----------------------------------------------------------LDLGMNNWSNLRMYGGDGIPN

PF09265

Q9FE45_9ASPA/238-524-HDGE----------------LKLRAMGLWDVPHPWLNLFVSKSN-IMDFHIGVFKGI.MKNSKSMGPILVYPTKRSKWD
CKX8_ORYSJ/239-523-RMEE----------------ESLRSRGLWDVPHPWLNVFVPKHG-ITQFKGLLMDTV..SADDFEGPILVYPLLTDKWD
CKX7_ARATH/239-520-KRSE----------------EIAKENGTWETPHPWLNLFVSKRD-IGDFNRTVFKEL.VKNGVN.GPMLVYPLLRSRWD
CKX3_ORYSJ/232-512-RMEE----------------MSLRNSGLWEVHHPWLNMFVPSAG-ISDFRDLLMDSI..SPDNFEGLILIYPLLRHKWD
Q8H6F6_HORVU/238-510-HSSE----------------MKLRAKGLWEVPHPWLNLIIPRST-IHTFAEQVFGKI.LEDNNN.GPILLYPVKKSRWD
CKX4_ARATH/250-523-RNEE----------------DKLRSLGLWEVPHPWLNIFVPGSR-IQDFHDGVINGLLLNQTSTSGVTLFYPTNRNKWN
Q709Q4_MAIZE/241-516-HTSE----------------LKLRAQGLWEVPHPWLNLLIPRSS-IRRFAKEVFGKI.LKDSNN.GPILLYPVNRSKWD
CKX5_ORYSJ/244-525-HKAE----------------LKLRGKGMWEVPHPWLNLFVPASR-IADFDRGVFRGV.LGSRTAGGPILIYPMNRHKWD
CKX2_ORYSJ/256-560-HDGE----------------LKLRAAGLWDVPHPWLNLFLPRSG-VLAFADGVFHGI.LSRTPAMGPVLIYPMNRNKWD
CKX7_ORYSJ/234-513-REEE----------------RVLRSIGMWDVPHPWLNLFVPRSR-ILDFDAGVFKGV.FAGANPVGVILMYPMNTNMWD
CKX10_ORYSJ/246-530-GREE----------------QNLRSAGAWDVPHPWLNLFVPRSR-ILHFDAAVFKGI.LRNANPVGLILMYPMNKDMWD
Q5WY14_LEGPL/211-449-NSRF----------------DMMKLTGQWDLLHPWYECFVPTS.-...FLTGVLSQL.LEELPLHYASLVHVVPIAKQK
CKX1_ARATH/263-539-HIAE----------------RKLRAKGLWEVPHPWLNLLIPKSS-IYQFATEVFNNI.LTSNNN.GPILIYPVNQSKWK
CKX5_ARATH/242-520-HKAE----------------LKLRSKNLWEVPHPWLNLFVPKSR-ISDFDKGVFKGI.LGNKTS.GPILIYPMNKDKWD
CKX1_MAIZE/246-533-HGEE----------------VALNKLGLWRVPHPWLNMFVPRSR-IADFDRGVFKGI.LQGTDIVGPLIVYPLNKSMWD
CKX11_ORYSJ/219-503-NRVE----------------DEARRNGSWAAPHPWLNLFISSRD-IAAFDRAVLNGM.LADGVD.GPMLIYPMLKSKWD
CKX2_ARATH/227-501-HVEE----------------NKLRSLGLWELPHPWLNLYVPKSR-ILDFHNGVVKDILLKQKSASGLALLYPTNRNKWD
CKX3_ARATH/244-517-RTGE----------------LNLKSKGQWDVPHPWLNLFVPKTQ-ISKFDDGVFKGIILRNNITSGPVLVYPMNRNKWN

PF02913

D2HDH_ARATH/309-551-LVSD.............G..VIAQDINQAS..SFWR...IREGI-TE..............ALQKAGAVYKYDLSLPVE
DLD_ARATH/319-560-NGSD.............F..MFAEEPEAKK..ELWK...IRKEA-LW...........ACYAMAPGHEAMITDVCVPLS
Q9RJ97_STRCO/274-525-FAGE.........................EPGERWA...HGRYS-AP.........YLRDALLDAGALAETLETAALWS
Q9RTM9_DEIRA/229-469-GGTV................RRAANDAEAD..ALWR...ARRSI-SP.............SLGRIRPQRMNEDIVVPRS
Q987T8_RHILO/164-381-GPLE................EIAGEASH....LIWR...DVRDI-RP...............FADGSEKPVWRVSMAPF
DLD1_KLULA/320-566-NNTK.............F..EFATDEDSKL..ELWE...ARKVA-LWS.......TIDTGRKTNPDANIWTTDVAVPIS
ADAS_RAT/370-643-AAGE.........................DNGQRGY...LLTYV-IA.........YMRDLGLEYYVVGESFETSAPWD
P72842_SYNY3/220-430-....................LASQSFDNQAESELWQ...RWENA-MA...............GQGTTETILCKFGLLPA
Q9A317_CAUCR/209-458-LIAD.............A..AVAQTETQMK..AFWH...IREGH-SA..............GQKPEGAVWKHDVSVPVS
Q987U0_RHILO/206-447-GSTT.............C..RISQSEAERL..SFWA...GRKAA-FP.............AVGRISPDYYCMDGTIPRK
Q9S2F6_STRCO/248-487-GATQ.............V..VPAEDAAESE..LLLQ...ARRLA-LT.............ALEAVKGTTMIDDVCVPRS
Q9HTK3_PSEAE/230-471-GATS.............V..RQAQDEAERQ..RFWA...GRKNA-FP.............AVGRISPDYYCMDGSIPRR
O29450_ARCFU/211-460-ARRV................IIARNQRELEEKNLLA...LRRAF-YPLA.....IKLASKEFGTKKSLVLIEDISVPVS
O53525_MYCTU/223-473-SLGE.........................GPARAWE...RGRFA-AP.........YLRDSLLAAGALCETLETATVWS
Q9KSQ8_VIBCH/286-544-MANQQA.........GIIGYQVCSDLASIN..RIYN...MRKKA-VG.........LLGAAKGRAKPVAFTEDTCVPPE
O29393_ARCFU/221-445-A...............................EKWL...EKRFD-VS..........DISRIVPLGFIFDTIEVACFWK
Q97G30_CLOAB/221-465-GALD.............I..FIADTDERKE..AIWS...ARGAF-LE.............AIKASTTEMDECDVCVPRN
Q9I6H4_PSEAE/216-461-WVLD.............G..VMSQSEQQLQ..NLWK...LREYI-SE...............TISHWTPYKNDISVTVS
Q9K9B9_BACHD/216-457-QAIS.............V..QIAESEDEAE..ALRT...ARRSA-LS.............ALARLKPTTILEDATVPRS
YN53_SCHPO/272-525-IISD.............G..VLAQDESQLR..VLWE...RREGI-TE.............CLAKAGSGVYKYDVSLPLP
Q986B0_RHILO/224-475-IVGD.............A..VVAASLAQGD..AFWN...FRETL-PE..............CQKPEGASIKHDISVPIA
O29853_ARCFU/209-439-GAID.............V..YAATTKKDQD..RLLK...VRGMI-YE...............GLRKEVIEVLDACVPPA
DH4C_PSEPU/270-513-GKGR................IVTQEEAGDT..QPFK...YRAQL-MSGVPNLQEFGLYNWR.GGGGSMWFAPVSEARGS
Q9F3A3_STRCO/294-548-PVAS.............VTNAFTRDAKVIS..GYWK...ARKAF-VT..........AVGGSRPAGTTLITEDFAVPPS
Q9PGF5_XYLFA/218-457-GLID.............L..DVAMDGAARD..QLWV...ARKSL-SP.............MLRTIKPGKLNEDVVVPVS
Q9HZI0_PSEAE/264-527-FTGT.........................LLGRKWA...QNRFR-FP.........YLREALWQAGYAVDTLETATDWS
ADAS_CAEEL/313-584-VGGA.........................ENGQYGY...RLTFA-IA.........YLRDLGMNHGVLGESFETSVPWD
Q11061_MYCTU/215-454-GAID.............V..FSTDDPDEGE..AFIA...ARRFA-IP..............AVESKGALLLEDVGVPLP
Q9D635_MOUSE/239-480-GGSH.............F..SWAKEAEKRN..ELWA...ARHNA-WY...........AALALSPGSKAYSTDVCVPIS
ADAS_DROME/337-605-PAGG.........................QNGERGY...ILTFV-IA.........YIRDFGLHQGIVAESFETSVPWD
O07406_MYCTU/211-446-GGARM...........CGEPAVGVDAAAQQ..RLWR...TRESL-AE..............VLGVYGPPLKFDVSLPLS
O05784_MYCTU/269-523-VTAQ.............RSRGTTSDATEHNAAANWR...SAFLR-MP.........YQRDALVRRGVIAETFETACTWD
Q97B62_THEVO/212-457-AIST................KSTTDPAEME..KIYR...ARKGL-YA.........SILKLRKSEKEYIVIGDIVVPVS
O86004_SPHAR/248-488-SGAR................VITDGKGIDP..KLWA...WRMGT-MTGVVADPPARTAGWS..GDLALTVNPVSPVDGE
Y2280_MYCTU/214-454-GAVD................AYVLEGGSAR..KLIE...AREKA-FW..............AAKALGADDIIDTVVPRA
Q9YEU4_AERPE/215-469-GAAS.............V..YTAKSMEEAEEKKLLE...IRRSL-FATQ.....ALLTQKQFKGRKVMMLMEDIAVPPS
Q9YFD3_AERPE/238-468-SRVE.........................GVYEKWA...RARYM-YD.........EHVRQLWSAGLWVDTIDTAAPWS
Q55124_SYNY3/222-464-GARN.............T..AIAYDQETRL..KMWK...GRKAA-FA.............AAGKLSPSYFVQDGVVPRT
O86000_SPHAR/265-508-SGAK................LHLNREND....PAWD...YRVRL-MRGEPNMTEFSIMNWI.GGGGHINFSPISAPDGK
Q9F2Y0_STRCO/247-482-DVVD.............A..LVVTDPAGQR..TLWR...IREDA-SG.........TATRMPDGSEAWPGWEDCAVPPA
Q9HMR2_HALSA/293-559-PAADPPGATTTDAPVHAVDALEAYDDDRQA..HFWK...MRKAG-LP.........ILLSRTSDEKHYPYIEDTAIPAD
Q9RVK1_DEIRA/212-453-GGQD.............L..AVATSAEERA..AVWE...ARHKA-YS...........SMVAMYPGHVNLSTDVCVPLH
Q9RDU1_PSESP/269-511-GGE.................ILTEEEAGDN..ILFH...HHKQL-MNGEMTLEEMNIYQWRGAGGGACWFAPVAQVKGH
Q986W2_RHILO/218-457-VVDD.............V..VVSQSPREFR..ALWD...VREDA-NR..............VLFSIKGLIGVDISIPLA
VAOX_PENSI/301-546-PGVK................FYFPEDTPEN..SVLR...VRDKT-MQGIPTYDELKWIDWL.PNGAHLFFSPIAKVSGE
Q9KKW5_VIBCH/271-520-IIES.............V..PFTSESKTVA..TLWG...IRKGM-FP..........AVGAVREVGTTVIIEDVAFPVE
ADAS_TRYBB/307-576-CLGT.........................KPGNTWQ...EKKYD-LP.........YLRDFALAHNFWADVFETSVLYT
O46096_DROME/289-531-EIQD.............G..TVTGDPGKVQ..EIWK...IREMV-PL..............GLIEKSFCFKYDISLPLR
ADAS_DICDI/317-586-GLGS.........................APGKTWA...EKRYD-LP.........YIRDFLLDHNMWVDVAETTVSYA
Q98KG4_RHILO/325-565-GGGP.............F..LWTSVAEERT..KLWK...ARHDA-YW...........ASLTLRPGAKGLSTDVCVPIS
O67645_AQUAE/239-479-GAKV................QVAQSEEEAQ..KLWS...ARKNL-GP.............ALGNLKTGKINEDIVFPRT
Q9I3S8_PSEAE/214-458-LVED.............A..LLAANETQRL..AIWR...LREDS-DA..............AIHAGVDSLSFDVSLPVP
Q88EH0_PSEPK/279-533-TSVE............RLGHTLAEGAEAVT..RVYT...MRKRS-VG.........LLGNVEGEVRPQPFVEDTAVPPE
Q97U60_SULSO/203-443-GEV.................FIPKDEEEKN..RWWW...GRKGA-FP.............SFAYYSPAYLTLDANVPRS
O06093_MYCLE/211-446-MAVQM...........CGVPAVGVDAGAQQ..RLWR...VRESL-AE..............VLGVYGPPLKFDVSLPLS
Q9HKQ4_THEAC/212-457-AIET................RSTTDKAEMN..RIYL...ARKGL-YA.........SILRLRKSEKEYIVIGDIVVPVS
Q9HV36_PSEAE/265-514-LEKQ.............V..DFSEDPAVYN..QLWR...IRKDT-FP..........AVGAVRETGTTVIIEDVTFPVE
GLCD_BACSU/216-457-DAVS.............V..QTAQTEEEAF..ALTE...ARRSA-LS.............ALARLKPTTILEDATVPRS
Q9CMN0_PASMU/284-542-ITHQQD.........AIIGYQVCSDLASIE..RIYA...MRKKA-VG.........LLGNAKGMAKPIPFVEDSCVPPE
DLD2_YEAST/277-529-IVTD.............G..VVAQDETELQ..NLWK...WREMI-PE..............ASQANGGVYKYDVSLPLK
Q97Y18_SULSO/215-449-NEGD........................RSLIRSWREVFARKYE-EQ...........MTKIISQGLWNDTLDLGATWS
YDIJ_ECOLI/281-539-IASHQA.........GVIGWQVCRELAGVE..RIYA...MRKKA-VG.........LLGNAKGAAKPIPFAEDTCVPPE

PF09330

DLD_ECOLI/278-567-EHHL----------------LLKMAGDGVGEAKSWLVDYFKQAE..GDFFVCTPEEGSKAFLHRFAAAGAAIRYQAVHS
LDHD_HAEIN/272-562-EHHL----------------IIKMGGKGIQEAREYLESYIADGS.KGGYFECNAIETQAAMLHRFAVASAAIRYRAIHE
Q1NHT9_9SPHN/271-556-AHHL----------------LLKMPARAAAEARELLAADFDGGE..ADHFECTPALAAKAFLHRFVAAGAAVRYRAVHR
A5WED9_PSYWF/295-585-EHHL----------------ILKMSDAGIIEAQVFLEKFFADST.TGDYFECSDEESESAFLHRFAAAGAALRYEVIHQ
Q1VBS3_VIBAL/273-563-EHHL----------------VLKMSDGGIAEAQKYLKEVWAVED.DCDFFECTPEEGKKAYLHRFAAAGAAIRYETIHR
Q1YWQ9_PHOPR/273-563-QHHL----------------ILKMSDEGIEEAKAYLENNWGEGS.GGSYFACTADEGKKALLHRFAAAGAAIRYETIHR
Q2BK95_9GAMM/272-562-DHYL----------------VLKMSDGGIKEADKFLKQFFAASD.KGDYFECDADEAKKAYLHRFAAAGAAIRYQIIHQ
Q2VHK1_9LACT/268-556-DHYL----------------QLKMAGNGIEEAREYLKSYFDKAS..GDYFEADANETSNAATHRYVTAGVAIRYQELKQ
Q5F898_NEIG1/272-561-EHHL----------------ILKMGGKGVDEARAFLKEYFSHHG..GAFFECNAEETQAAMLHRFAVASAAIRYRSVHD
Q5FRI2_GLUOX/282-571-EHHL----------------MLKVSAHMTAPVRAYLEQWASSTG..GAFFECTPDEGTRAFLHRFAAAGAAVRYRAVHT
Q5NQX4_ZYMMO/284-573-EHHL----------------ILKVSEEGTEEARSFLKDFFEKAS..GGYFECSDEEGKKAFLHRFAAAGAAIRYRDVHQ
Q66D31_YERPS/279-568-EHHL----------------LLKMSGDGITEAQQHLRAFFATAE..GNFIACTADEGKKAFLHRFAAAGAAVRYHAVHA
Q6D2B5_ERWCT/284-573-EHHL----------------MVKMAGDGIDEAHRWLEEYFHDAD..GEFFVCTPEEGAKAFLHRFAAAGAAIRYHAVHS
Q6FFS0_ACIAD/279-567-QHHL----------------ILRIEKNSKALTEQFLTEYFALHS.TGAYFLCDQDEGRKAFLHRFAIAGAAIRYRDTHR
Q6WB82_ALCFA/276-564-EHHL----------------LLRVSNDTAQATRDYLQQQFGDST.QGAYFECDAEEGRKAFLHRFAIAGAAIRYRESHP
Q7N371_PHOLL/278-567-EHHL----------------ILKMSGDGVEEARSWLEDYFSRVE..GDFFACTPEEGAKAFLHRFSAGGSAIRYQAVHS
Q7V9S2_PROMA/275-565-NYYM----------------LLLASNNSIEEMKLLLDIETEKSE.DFEYIECTESEGKDALLHRYVAGAAPARYKILNP
Q7VS08_BORPE/283-572-AHHL----------------MIKVPGKIGDQTRRFLQAYFDDAT..GASFECTPEEGKAAFLLRFAAAGAAVRYRAVHA
Q8NRY8_CORGL/279-570-EHHL----------------LLTVSESQKAASEKMLKEFFAEPEHTGEFFICTSDEEKSASLNRFGAASAATRYAALKR

PF04030

ALO_DEBHA/202-551VHICP----------------HLTPLIEKFVFKNQYGDVE..TLGHGDVAVQNSVEGLNMDCLF..SQFVNEWST--PLS
GGLO_RAT/180-438.TYLP----------------CLVGWINRFFFWMLFN........CKKESSNLSHKIFTYECRF..KQHVQDWAI--PRE
A5WEE3_PSYWF/185-441.RMNP----------------KLTKKVSEISANSIPN..........THRQGYSYEVFPTPRGV..RFNESEYFI--KLS
A7GLB1_BACCN/179-430.RRFP----------------SISKRVSQLSAKAVPN..........MKIIGQSFRVFATSRNV..PFYEMEYSI--PAQ
A9VEW0_BACWK/179-430.KWFP----------------SISKGVSRLSAKAVPN..........TKIIGSSYEVFATSRTV..PFYEMEYSV--PSK
Q8EQI8_OCEIH/179-431.LLYP----------------SLTRSVSRLSAKLVSK..........STIDAKSYQLFATPRKV..RFLEMEYGI--PIE
Q47NJ0_THEFY/176-430.RRLP----------------RLIPAINQISARALTA..........REYVDVSYRVFTSPRRV..KFVEMEYAI--PVE
Q82KJ4_STRAW/182-436.RAVP----------------ATIPTLARVSSRALSA..........RTYTDIPYKVFTSPRRV..RFVEMEYAV--PRE
Q2JG59_FRASC/206-462.RRMP----------------AAVRPIAHVSARASGS..........RTFRDLSYRVFTSHRRV..RFKEMEYAL--PRA
Q4JW76_CORJK/189-446.HHFP----------------SLSRPFAKLSAKTLAQ..........REYSNVAHDVFVSARRV..RFNEMEYSV--PLA
O06804_MYCTU/172-425.RRFP----------------SVAPRLNRLMTNMMSS..........STVQDRAYKVFATQRKV..RFTEMEYAI--PRE
Q5YR83_NOCFA/174-426.RAQP----------------RTIPWIHRAAAYAGSY..........RRQVDRSYRVFASPRLI..RFTEMEYAI--PRE
Q390J8_BURS3/172-425.KRVP----------------SLCPALSRLCASTVSA..........GRHVDASYAMLSTVRRV..RFNEMEWSV--PAE
Q92X65_RHIME/187-406.....----------------..........................KDETGPPHEVIPQHSDLPHRFEEMEYSM--PAE
Q9HTM8_PSEAE/186-438.SDFP----------------ETRRTLLNSLRHFARF..........DERVDDSYAVYANVRNV..RFNEMEYSV--PAE
Q983S0_RHILO/175-424.AWLP----------------SLRRRLILGAVAKVPS..........EDYVQDWLNVYASDRQT..KFNEMEYHL--PFE
Q4DPS1_TRYCC/258-491.TFYP----------------QMQPYINRAYRKIFYS........ASEVQYGTPIECFTFDCLF..KQWACEWAV--DAS
Q57ZU1_TRYB2/262-506.VIQP----------------GIQPYINRTYRRLFYN........APEVQYGTSLECFTFDCLF..KQWACEWAI--DIS
Q4QE54_LEIMA/258-489.CLCP----------------AIQPYVNKAYRRAFFS........APQVQRGSALECFTFDCLF..KQWANEWAI--DAS
Q4PIL2_USTMA/445-677.TFPP----------------DSAAPRPLTVGNPVWS............EVGRSDRIFNMDCLF..PQYTDEWAI--PLN
Q5K700_CRYNJ/204-464.RIFP----------------SLTSLVGRWAWWLSKE.........DSVMVDDGYKVLNFDCLF..PQYALEWAI--DAK
Q2H4W5_CHAGB/168-472.RWFP----------------RVTPWIEWFVFGLNYGFRN..GESTRVSGCQESYKAFLLNCLY..SQFVNEWAI--PLH
ALO_NEUCR/210-513.RWIP----------------RITPWIEWFVFGMQYGFKN..GEVTRIGAVQPSQKAFLLNCLY..SQSVNEWAI--PLH
Q2UQI3_ASPOR/199-482.NYFP----------------RILPWVEWFVFGLQYGFRS...EAKVTEAVEPARAGLLLNCLY..SQFVNEWAL--PLE
ALO_CANAL/202-552VHLFP----------------RLTPFVEKFVFGQQYGEVE..TLGKGDIAVQNSVEGLNMDCLF..SQFVNEWSS--PLN
ALO_CANGA/188-518TKIYP----------------PLTPYVERFVFRRQYGEVE..TLGKGDVAIEDSVTGFNMDCLF..SQFVDEWGC--PMD
ALO_YEAST/186-516TKIYA----------------PLTPFVEKFVFNRQYGKLE..KSSTGDVNVTDSISGFNMDCLF..SQFVDEWGC--PMD
ALO_ASHGO/192-522VNVYP----------------SLTPFVERFIFRQQYGKVE..TFGNGDEAVQTSIDGLNMDCLF..SQFVDEWAC--PLN
ALO_KLULA/190-520VKIYP----------------ALTPYVESFVFHQQYGRVE..TYGSGDVSVQTSIAGLNMDCLF..SQFVDEWGC--PLN
ALO_YARLI/189-523VRLWP----------------SLTPSVERFIFSRQYGMEDTLGSGTGSEAVQGSVEGLNMDCLF..SQFVNEWGM--PLD
ALO_SCHPO/187-459.KCVN----------------RVTPYLERFWFKCHYGSK....LGTALQVAGPGFDVLQMFCYF..SQHVSEWGI--PLE
GGLO_SCYTO/180-438.VFVP----------------RLVPWINRLFYWLLYS........AKAEQVKRSDKAFNFDCLF..KQHVSDWAL--PIK
Q5U4Z7_XENLA/180-438.TFIT----------------GMVPWINRFFFWLLFA........SKSEQVNISHKVFNFDCLF..KQHVQDWAI--PIE
Q22YW5_TETTS/180-449YETCD----------------DKFEGRQFETVQRFKS.........VTNVVGDIYQVFCKGIPV..PQINCEIAV--PFE

PF09129

Q2T0X3_BURTA/323-645LNGEI----------------QLAPLFGKTQYTITYL-GLTNIFGPRTNLWGWSRSVLHYVRPTTLRVTANGYAVLTRRE
Q7SID9_BREST/223-561.AGNP----------------GIAPLFGPAMYEITKL-GLAATNA..NDIWGWSKDVQFYIKATTLRLTEGGGAVVTSRA
Q9HWP1_PSEAE/277-597.TGHP----------------ELTPLLGKLQYDLVVG-GMALTLG..YDLWGWSKDLLLYIKPSTLRVTANGYAVLTRRR

PF08031

YGAK_BACSU/399-443........-N----------------------------------------------------------------------
Q7RV07_NEUCR/421-465........-D----------------------------------------------------------------------
Q7S1P7_NEUCR/453-499......RA-E----------------------------------------------------------------------
MCRA_STRLA/395-442..ISPAS.-.----------------------------------------------------------------------
Q6LJC7_PHOPR/280-323........-D----------------------------------------------------------------------
Q8LSM7_HELAN/478-533.AYEEAS.-E----------------------------------------------------------------------
Q8NIW9_NEUCS/507-551........-D----------------------------------------------------------------------
Q84WI1_ARATH/431-489TKYEEGK.-S----------------------------------------------------------------------
Q84N20_NICLS/354-412TSYAQAK.-V----------------------------------------------------------------------
Q84PV7_ORYSJ/461-526EAVARARS-S----------------------------------------------------------------------
Q8NK91_ASPOZ/503-547........-N----------------------------------------------------------------------
Q6EUS8_ORYSJ/495-552TSYEEAR.-V----------------------------------------------------------------------
Q93Y11_ARATH/480-538SNFIEAK.-V----------------------------------------------------------------------
Q8EGB1_SHEON/850-894........-.----------------------------------------------------------------------
Q8GTB6_CANSA/480-538NNYTQAR.-I----------------------------------------------------------------------
Q6NNH8_ARATH/100-155STYEEGK.-I----------------------------------------------------------------------
Q8XND2_CLOPE/404-448........-D----------------------------------------------------------------------
Q92U94_RHIME/427-471........-D----------------------------------------------------------------------
Q7SB35_NEUCR/597-641........-E----------------------------------------------------------------------
Q9LNL9_ARATH/467-522STYEEGK.-V----------------------------------------------------------------------
Q7X2G7_9ACTO/444-497..RNRSGE-P----------------------------------------------------------------------
Q7NIA5_GLOVI/31-76........-Q----------------------------------------------------------------------
Q8VWA5_9ACTO/433-486..WNTSGV-P----------------------------------------------------------------------
Q82GZ2_STRAW/449-493........-D----------------------------------------------------------------------
YVDP_BACSU/400-444........-N----------------------------------------------------------------------
Q6PW77_ACRST/450-496......KE-E----------------------------------------------------------------------
Q9X5T1_STRLA/421-468......SR-E----------------------------------------------------------------------
O94206_CLAPU/412-457........-E----------------------------------------------------------------------
Q8X0G1_NEUCS/561-604........-K----------------------------------------------------------------------
Q7SHH8_NEUCR/453-496........-.----------------------------------------------------------------------
Q84PV6_ORYSJ/334-398NSVIHAK.-S----------------------------------------------------------------------
O64745_ARATH/479-537NATYEGAK-V----------------------------------------------------------------------
Q869M2_DICDI/431-473........-.----------------------------------------------------------------------
Q9AYM8_VIGUN/473-530TSYHQAS.-I----------------------------------------------------------------------
Q9SA85_ARATH/465-524SSYVEGK.-R----------------------------------------------------------------------
Q7V3Z6_PROMM/524-568........-N----------------------------------------------------------------------
Q9FKU8_ARATH/476-534TCIKQAQ.-V----------------------------------------------------------------------
Q7WZ62_9ACTO/469-522..LNTSGV-P----------------------------------------------------------------------
Q7S915_NEUCR/469-516.....SAT-G----------------------------------------------------------------------
Q9ALN1_9PSEU/476-529..WNTSGV-A----------------------------------------------------------------------
RETO_ESCCA/455-517NAIEISR.-S----------------------------------------------------------------------
Q9ZPP5_BERST/452-514NAIEIAR.-T----------------------------------------------------------------------
RETO_PAPSO/459-521NAVEIAR.-N----------------------------------------------------------------------
Q8KSY2_9ACTO/421-466.......P-D----------------------------------------------------------------------
Q8RWA4_ARATH/490-547TNVDEAK.-I----------------------------------------------------------------------
Q9FKV2_ARATH/471-528TSFEDAK.-L----------------------------------------------------------------------
Q81C29_BACCR/8-52........-N----------------------------------------------------------------------
Q81IH6_BACCR/396-440........-N----------------------------------------------------------------------
Q6ZB64_ORYSJ/480-545SSVSRARS-T----------------------------------------------------------------------
Q9EX55_STRCO/495-548..LNRSGI-P----------------------------------------------------------------------
P93762_CHOCR/484-535...KNGKY-G----------------------------------------------------------------------
Q8KY45_STRCU/463-508.......G-D----------------------------------------------------------------------
P71984_MYCTU/413-458........-M----------------------------------------------------------------------
Q94KD7_ARATH/470-527TSFEDAR.-K----------------------------------------------------------------------
Q93S08_STRCO/490-543..LNTSGI-G----------------------------------------------------------------------
Q93ZA3_ARATH/477-530.KGSDAR.-E----------------------------------------------------------------------
Q9KHK2_9ACTO/415-460........-D----------------------------------------------------------------------
Q948L1_DAUCA/449-503.TFQQAS.-I----------------------------------------------------------------------
Q8GXL5_ARATH/76-133NSYRVAE.-V----------------------------------------------------------------------
Q9SA89_ARATH/469-526DGYRKGE.-I----------------------------------------------------------------------
Q87IH1_VIBPA/415-459........-E----------------------------------------------------------------------
Q8Y3D0_RALSO/458-507.....AYP-F----------------------------------------------------------------------
Q9FKV0_ARATH/479-537VNFIEAK.-I----------------------------------------------------------------------
O64743_ARATH/475-528.GETDAR.-E----------------------------------------------------------------------
Q8SA59_HELAN/476-534NAYTEGM.-V----------------------------------------------------------------------
Q9HGH9_ASPOZ/508-552........-D----------------------------------------------------------------------
Q84PV5_ORYSJ/467-535PEVEAAR.-V----------------------------------------------------------------------

PF09265

Q9FE45_9ASPA/238-524KRMSTSIP.D...EEVF-------------------------YSIGILL-------------------------------
CKX8_ORYSJ/239-523GNTSAVVP.AA.PDGVM-------------------------YIFGVLR-------------------------------
CKX7_ARATH/239-520DRTSVVIP.E..EGEIF-------------------------YIVALLR-------------------------------
CKX3_ORYSJ/232-512TNTSVVLPDSGSTDQVM-------------------------YAVGILR-------------------------------
Q8H6F6_HORVU/238-510NRTSVVIP.D...EEVF-------------------------YLVGFLS-------------------------------
CKX4_ARATH/250-523NRMSTMTP.D...EDVF-------------------------YVIGLLQ-------------------------------
Q709Q4_MAIZE/241-516NRTSVVIP.D...EEIF-------------------------YLVGFLS-------------------------------
CKX5_ORYSJ/244-525PRSSVVTP.E...EDVF-------------------------YLVAFLR-------------------------------
CKX2_ORYSJ/256-560SNMSAVIT.DDDGDEVF-------------------------YTVGILR-------------------------------
CKX7_ORYSJ/234-513DCMMAVAS.D...DDVF-------------------------YAVGLLR-------------------------------
CKX10_ORYSJ/246-530DRMTAMTP.D...EDVF-------------------------YAVGLLR-------------------------------
Q5WY14_LEGPL/211-449AGFMMLPD.....CDSI-------------------------CEFMILN-------------------------------
CKX1_ARATH/263-539KHTSLITP.N...EDIF-------------------------YLVAFLP-------------------------------
CKX5_ARATH/242-520ERSSAVTP.D...EEVF-------------------------YLVALLR-------------------------------
CKX1_MAIZE/246-533DGMSAATP.S...EDVF-------------------------YAVSLLF-------------------------------
CKX11_ORYSJ/219-503PATSVALP.N...GEIF-------------------------YLVALLR-------------------------------
CKX2_ARATH/227-501NRMSAMIP.EI.DEDVI-------------------------YIIGLLQ-------------------------------
CKX3_ARATH/244-517DRMSAAIP.E...EDVF-------------------------YAVGFLR-------------------------------

PF02913

D2HDH_ARATH/309-551EIYNIVNDLRGRLGDLA---------------...........NVMGYG-------------------------------
DLD_ARATH/319-560HLAELISRSKKELDASS---------------..........LLCTVIA-------------------------------
Q9RJ97_STRCO/274-525RLPALYAAVREALTATL---------------TAA...GTPPLVMCHIS-------------------------------
Q9RTM9_DEIRA/229-469ALPDVVREIRALGDASP---------------..........FHLVQFG-------------------------------
Q987T8_RHILO/164-381HAHQMVLTLRMQAAVSA---------------................F-------------------------------
DLD1_KLULA/320-566KFADVINATKEEMNASG---------------..........LLTSLVG-------------------------------
ADAS_RAT/370-643RVIDLCRNVKERIRREC---------------KERG.VQFAPLSTCRVT-------------------------------
P72842_SYNY3/220-430KAADFLQQLPGL.....---------------................G-------------------------------
Q9A317_CAUCR/209-458KIPDFIGQANAAIEKSF---------------P........GTRIVAFG-------------------------------
Q987U0_RHILO/206-447ELPRVLAGMRELSEKYG---------------..........LGVANVF-------------------------------
Q9S2F6_STRCO/248-487RLGDMLEGIDRVAAKYG---------------..........LTIGVCA-------------------------------
Q9HTK3_PSEAE/230-471ELPRVLHGIAELSREYG---------------..........LRVANVF-------------------------------
O29450_ARCFU/211-460KLPEAIRGIKEIARKYD---------------..........FTVFIAG-------------------------------
O53525_MYCTU/223-473NTPVLKAAVTEALTTSL---------------AAS...GTPALVMCHVS-------------------------------
Q9KSQ8_VIBCH/286-544NLADFIVEFRALLDSKN---------------..........LAYGMFG-------------------------------
O29393_ARCFU/221-445DAERVYSEVLKAIRSVE---------------G.......TVTASAHAS-------------------------------
Q97G30_CLOAB/221-465KIAEFINYTYKLQDKFD---------------..........IRIKNFG-------------------------------
Q9I6H4_PSEAE/216-461RVPAFLKDIDAIVEANY---------------P........DFEVVWFG-------------------------------
Q9K9B9_BACHD/216-457EIANMVKVINEIAEKYE---------------..........LTICTFG-------------------------------
YN53_SCHPO/272-525VLYDLVNDTKKRLIEFN---------------LLDDTPEHPVIDVVGFG-------------------------------
Q986B0_RHILO/224-475SIPRFIAEAAGAVASVS---------------A........GARVVCFG-------------------------------
O29853_ARCFU/209-439KIAEYWRRSNELAEEYG---------------..........IELITYG-------------------------------
DH4C_PSEPU/270-513ECKKQAAMAKRVLHKYG---------------...............LD-------------------------------
Q9F3A3_STRCO/294-548RLADACEDLLGLQAEHG---------------..........FDAAVAG-------------------------------
Q9PGF5_XYLFA/218-457RIPDLVAGIEVLAAESG---------------..........LPIVTFG-------------------------------
Q9HZI0_PSEAE/264-527NVDGLLQKIEASLRDGL---------------AAE...GEKVHVFTHLS-------------------------------
ADAS_CAEEL/313-584KVLSLCRNVKELMKREA---------------KAQG.VTHPVLANCRVT-------------------------------
Q11061_MYCTU/215-454ALGELVTGIARIAEERN---------------..........LMISVIA-------------------------------
Q9D635_MOUSE/239-480RLPEILVETKEEIKASK---------------..........LTGAIVG-------------------------------
ADAS_DROME/337-605RCSLLCRSVKQRVVSEC---------------SKRS..INYYTISCRVT-------------------------------
O07406_MYCTU/211-446AISGFARDAVALVHRHV---------------PD.....SPEALPLLFG-------------------------------
O05784_MYCTU/269-523GFDTLHAAVTDAARTAI---------------WKV...CGTGVVTCRFT-------------------------------
Q97B62_THEVO/212-457ELPTSLKEIEKKRDEDG---------------..........VRAAIFG-------------------------------
O86004_SPHAR/248-488EAVKLYELSRDICAKNG---------------...............FD-------------------------------
Y2280_MYCTU/214-454SMPKFLSTARGLAAAAD---------------..........GAAVGCG-------------------------------
Q9YEU4_AERPE/215-469KLLDAVERLKELEAKYG---------------..........FKTVLGG-------------------------------
Q9YFD3_AERPE/238-468RVEDLNRRLLEDLAGIP---------------G.......VVAVMSHAG-------------------------------
Q55124_SYNY3/222-464QLVQILSDINDLSKKYG---------------..........FAIANVF-------------------------------
O86000_SPHAR/265-508EALSQYNLIKQRCHDFG---------------...............FD-------------------------------
Q9F2Y0_STRCO/247-482RLGGYLRDFRRLLTAHE---------------..........LRGTPYG-------------------------------
Q9HMR2_HALSA/293-559HLPAFVADFQAILDDLD---------------..........TVASYYA-------------------------------
Q9RVK1_DEIRA/212-453RLPAVVAATRAKCDERG---------------..........LNASFVG-------------------------------
Q9RDU1_PSESP/269-511EAEQQVKLAQKVLAKHG---------------...............FD-------------------------------
Q986W2_RHILO/218-457RMGAFLQEADAAIHAVD---------------P........SADIYVFG-------------------------------
VAOX_PENSI/301-546DAMMQYAVTKKRCQEAG---------------...............LD-------------------------------
Q9KKW5_VIBCH/271-520KLAAGVRDLQALFDKYH---------------.........YNEAIIFG-------------------------------
ADAS_TRYBB/307-576DAIHCWRAVKKSFAEVM---------------AEN...GKNAWIGCHTA-------------------------------
O46096_DROME/289-531DFYNIVDVMRERCGPLA---------------..........TVVCGYG-------------------------------
ADAS_DICDI/317-586NLQTLWKDAKQTFVKHF---------------KDQ...GIPAWICAHIS-------------------------------
Q98KG4_RHILO/325-565RFAECVTETEADIAEMG---------------..........LIAPIVG-------------------------------
O67645_AQUAE/239-479YLHEALPKLREIAKKYN---------------..........LTMVVFG-------------------------------
Q9I3S8_PSEAE/214-458ALAGYVERIRRRLDDLV---------------K........GMQVFLFG-------------------------------
Q88EH0_PSEPK/279-533QLADYIADFRALLDGYG---------------..........LAYGMFG-------------------------------
Q97U60_SULSO/203-443TLPTMLRFTYEISKKYG---------------..........LPVANSF-------------------------------
O06093_MYCLE/211-446AISGFAKEAATLIDAQV---------------SD.....VQEALPVLFG-------------------------------
Q9HKQ4_THEAC/212-457ELPSALKEIEKARDVDG---------------..........VRCALFG-------------------------------
Q9HV36_PSEAE/265-514RLAEGVNRLIELFDKHR---------------.........YDEAILFG-------------------------------
GLCD_BACSU/216-457EIANMVKAINDIAAKYD---------------..........ISICTFG-------------------------------
Q9CMN0_PASMU/284-542HLADYIAEFRALLDAHK---------------..........LDYGMFG-------------------------------
DLD2_YEAST/277-529DLYSLVEATNARLSEAE---------------LVGD.SPKPVVGAIGYG-------------------------------
Q97Y18_SULSO/215-449AMPKLYDKLKESLNSMK---------------G.......IKNVLSRVT-------------------------------
YDIJ_ECOLI/281-539HLADYIAEFRALLDSHG---------------..........LSYGMFG-------------------------------

PF09330

DLD_ECOLI/278-567DEVEDILALDIALRRND---------------TEWYEHLPPEIDSQLVH-------------------------------
LDHD_HAEIN/272-562KEVEEIVALDVALRRND---------------QDWFEVLPPEIDNRIIS-------------------------------
Q1NHT9_9SPHN/271-556QAVADIVALDIALPRNA---------------TAWQEILPADLAAQSIH-------------------------------
A5WED9_PSYWF/295-585EEVGDILALDIAIPRNE---------------LAWFEALPEEINQHLEK-------------------------------
Q1VBS3_VIBAL/273-563KDVEDIVALDIALRRND---------------EEWLETLPEEVSKNLVQ-------------------------------
Q1YWQ9_PHOPR/273-563NEVEEIVALDIALRRND---------------REWVEKLSEEITKNMVT-------------------------------
Q2BK95_9GAMM/272-562NEVEDILALDIALRRND---------------PDWVENLPEEISQHIVH-------------------------------
Q2VHK1_9LACT/268-556DSI.DILPLDIALASND---------------YKWFEHLPKEIEDKIEH-------------------------------
Q5F898_NEIG1/272-561DEVEDLVALDIALRRDD---------------RDWFEKLPPEIDNKIIH-------------------------------
Q5FRI2_GLUOX/282-571KTAEDIVALDVALRRND---------------REWFEVLPKEIEDRIIV-------------------------------
Q5NQX4_ZYMMO/284-573DEVEDIVALDIALPRNN---------------RAWEEHLPSEITDKISH-------------------------------
Q66D31_YERPS/279-568DQVEDILALDIALRRNE---------------KQWFETLPPEIEKCLIA-------------------------------
Q6D2B5_ERWCT/284-573NDVENILALDIALRRND---------------REWFEHLPADISDMLVH-------------------------------
Q6FFS0_ACIAD/279-567NEVEDIVALDIALRRND---------------RQWVEQLPEEMEKKILH-------------------------------
Q6WB82_ALCFA/276-564NSVEDIVALDIALRRND---------------REWVEQLPDDMEKDIVH-------------------------------
Q7N371_PHOLL/278-567NEVGNILSLDIALRRND---------------REWFEQLPPEFDDVLVH-------------------------------
Q7V9S2_PROMA/275-565DLAGDLLPLDIAFPRNF---------------KDWDQLLPQDILNEMSD-------------------------------
Q7VS08_BORPE/283-572GQVEDIVALDIALKRND---------------RDWLEQLPPDVEAPILM-------------------------------
Q8NRY8_CORGL/279-570RHIAGLIPIDVALRRDD---------------WNWLEVLPEEIDDQLEV-------------------------------

PF04030

ALO_DEBHA/202-551SGQDVLIKLNDVIQTAREQ.............NRFYVHAPIEVRCSNLTYSEKPFVDENDEPSLYPNKKWLAKRDRLSPG
GGLO_RAT/180-438KTKEALLELKAMLEAHP................KVVAHYPVEVRFTRGD...............................
A5WEE3_PSYWF/185-441DFDQCITEINDILLQDD.................KRSHFPIEVRTHKAE...............................
A7GLB1_BACCN/179-430YMRNVVKEIYELIQEKE.................YQVHFPIECRYVKGD...............................
A9VEW0_BACWK/179-430YMRAVVEEISNLIEKKK.................YKVHFPIECRYVRGD...............................
Q8EQI8_OCEIH/179-431YFHDAIQEIRETIVKNQ.................YKVHFPIECRTVKQD...............................
Q47NJ0_THEFY/176-430HLPDVLHDMRAVFASSR.................HRISFPVEVRFAPAD...............................
Q82KJ4_STRAW/182-436ALVETLRELKSMVDRSP.................LRVSFPVEVRTAPAD...............................
Q2JG59_FRASC/206-462DLAATLRELVYAMGSAD.................VRAVFPVEVRCAAAD...............................
Q4JW76_CORJK/189-446DAREILRDVQHTMNTCG.................EQVLFPIEVRATAAD...............................
O06804_MYCTU/172-425NGREALQRVIDLVRRRS.................LPIMFPIEVRFSAPD...............................
Q5YR83_NOCFA/174-426HSAEAIRAIKEIAAR...................FDTPMPIEVRWVAPD...............................
Q390J8_BURS3/172-425RGADALREIRSFIARRS.................FPLMFPIEYRWVRGD...............................
Q92X65_RHIME/187-406AGPECLGKLRARIKERW................RRSVGWRLLFRYIKAD...............................
Q9HTM8_PSEAE/186-438HGPACLREILALIRDKD.................LRTWFPIEYRYVKAD...............................
Q983S0_RHILO/175-424EGPKALAEIIELTEKRF.................PEVYFPMEVRSVAPD...............................
Q4DPS1_TRYCC/258-491KAIEAFALLREMIASEN.................FSVHFPVEFRFTDAD...............................
Q57ZU1_TRYB2/262-506NVMPAFHYLRGLISSEN.................LSVHFPVEFRFTGAD...............................
Q4QE54_LEIMA/258-489RAVEAFNRLRDMIDREG.................MLLHFPVEFRFTAPD...............................
Q4PIL2_USTMA/445-677RAAAAIRAMRDWLDEEQAA............SDGDRIHFPVEIRFADAD...............................
Q5K700_CRYNJ/204-464EAKACLQEMKKWLDREAAD............PAGLRVHFPIEIRWSCAD...............................
Q2H4W5_CHAGB/168-472KGPEALQRLGAWLNRLQPGDPGYVDHRIPFSADGLWVHSPVEVRVSDTTVHTDS..........................
ALO_NEUCR/210-513KGPEALQRLGAWLQNLKPGDPGYVEHGIPYSAEGLWVHSPVEVRASDSTVYTS...........................
Q2UQI3_ASPOR/199-482KGPEAIIRLSAWLNGDTETARI......PFPVEGLWVHCPIEVRVTDSTHN.............................
ALO_CANAL/202-552SGPEILTELKKIITDASQT.............GDFFVHAPIEVRCSNVTYSDEPFTDDKNQKSLYPSQEWLSNRSKTSAG
ALO_CANGA/188-518NGLEVLRSLDHSIAQAAAN.............KDFYVHVPVEVRCANTTLPKEQPETSFRS..............NTSRG
ALO_YEAST/186-516NGLEVLRSLDHSIAQAAIN.............KEFYVHVPMEVRCSNTTLPSEPLDTSKRT..............NTSPG
ALO_ASHGO/192-522NGPEVLRSLDHSIAQAAQN.............KEFFVHVPIEVRCSNTTLPHEYKCPEDRT..............VTAPG
ALO_KLULA/190-520NGPEVLRSLDYSITQAAQN.............KEFFVHVPVEVRCSNTTLPAEIPDYSNRT..............KTSAG
ALO_YARLI/189-523NGPDVLRALRAKIEAAAKD.............NIYYVHSPVEVRCSNMSVPDSGDRNVEPNTQ.........EFSASRRG
ALO_SCHPO/187-459SAPDALEKLINYTVDDAGK.............IGAYTHWPIEVRVCAPTP..............................
GGLO_SCYTO/180-438QTRAALEQLKDWLDNNP................NVRAHFPVEVRFVRAD...............................
Q5U4Z7_XENLA/180-438KTKDALMQLKGWLEKNP................HVVAHFPVEVRFARGD...............................
Q22YW5_TETTS/180-449QITEVLHALRDWYRKSE.................HKPHYPFILRCTGAS...............................

PF09129

Q2T0X3_BURTA/323-645NVQRAINEFVGAYRQRI---------ADYRAAGRYPVNGPVEIRVTGVDTPADVG.PGAV--------------------
Q7SID9_BREST/223-561NIATVINDFTEWFHERI---------EFYRAKGEFPLNGPVEIRCCGLDQAADVKVPSVG--------------------
Q9HWP1_PSEAE/277-597DVQRVINEFYLQYQTMV---------AAYRANGHYPMNGPVEIRVSGLDQPGESIVPGAQ--------------------

PF08031

YGAK_BACSU/399-443--------------------------------------------------------------------------------
Q7RV07_NEUCR/421-465--------------------------------------------------------------------------------
Q7S1P7_NEUCR/453-499--------------------------------------------------------------------------------
MCRA_STRLA/395-442--------------------------------------------------------------------------------
Q6LJC7_PHOPR/280-323--------------------------------------------------------------------------------
Q8LSM7_HELAN/478-533--------------------------------------------------------------------------------
Q8NIW9_NEUCS/507-551--------------------------------------------------------------------------------
Q84WI1_ARATH/431-489--------------------------------------------------------------------------------
Q84N20_NICLS/354-412--------------------------------------------------------------------------------
Q84PV7_ORYSJ/461-526--------------------------------------------------------------------------------
Q8NK91_ASPOZ/503-547--------------------------------------------------------------------------------
Q6EUS8_ORYSJ/495-552--------------------------------------------------------------------------------
Q93Y11_ARATH/480-538--------------------------------------------------------------------------------
Q8EGB1_SHEON/850-894--------------------------------------------------------------------------------
Q8GTB6_CANSA/480-538--------------------------------------------------------------------------------
Q6NNH8_ARATH/100-155--------------------------------------------------------------------------------
Q8XND2_CLOPE/404-448--------------------------------------------------------------------------------
Q92U94_RHIME/427-471--------------------------------------------------------------------------------
Q7SB35_NEUCR/597-641--------------------------------------------------------------------------------
Q9LNL9_ARATH/467-522--------------------------------------------------------------------------------
Q7X2G7_9ACTO/444-497--------------------------------------------------------------------------------
Q7NIA5_GLOVI/31-76--------------------------------------------------------------------------------
Q8VWA5_9ACTO/433-486--------------------------------------------------------------------------------
Q82GZ2_STRAW/449-493--------------------------------------------------------------------------------
YVDP_BACSU/400-444--------------------------------------------------------------------------------
Q6PW77_ACRST/450-496--------------------------------------------------------------------------------
Q9X5T1_STRLA/421-468--------------------------------------------------------------------------------
O94206_CLAPU/412-457--------------------------------------------------------------------------------
Q8X0G1_NEUCS/561-604--------------------------------------------------------------------------------
Q7SHH8_NEUCR/453-496--------------------------------------------------------------------------------
Q84PV6_ORYSJ/334-398--------------------------------------------------------------------------------
O64745_ARATH/479-537--------------------------------------------------------------------------------
Q869M2_DICDI/431-473--------------------------------------------------------------------------------
Q9AYM8_VIGUN/473-530--------------------------------------------------------------------------------
Q9SA85_ARATH/465-524--------------------------------------------------------------------------------
Q7V3Z6_PROMM/524-568--------------------------------------------------------------------------------
Q9FKU8_ARATH/476-534--------------------------------------------------------------------------------
Q7WZ62_9ACTO/469-522--------------------------------------------------------------------------------
Q7S915_NEUCR/469-516--------------------------------------------------------------------------------
Q9ALN1_9PSEU/476-529--------------------------------------------------------------------------------
RETO_ESCCA/455-517--------------------------------------------------------------------------------
Q9ZPP5_BERST/452-514--------------------------------------------------------------------------------
RETO_PAPSO/459-521--------------------------------------------------------------------------------
Q8KSY2_9ACTO/421-466--------------------------------------------------------------------------------
Q8RWA4_ARATH/490-547--------------------------------------------------------------------------------
Q9FKV2_ARATH/471-528--------------------------------------------------------------------------------
Q81C29_BACCR/8-52--------------------------------------------------------------------------------
Q81IH6_BACCR/396-440--------------------------------------------------------------------------------
Q6ZB64_ORYSJ/480-545--------------------------------------------------------------------------------
Q9EX55_STRCO/495-548--------------------------------------------------------------------------------
P93762_CHOCR/484-535--------------------------------------------------------------------------------
Q8KY45_STRCU/463-508--------------------------------------------------------------------------------
P71984_MYCTU/413-458--------------------------------------------------------------------------------
Q94KD7_ARATH/470-527--------------------------------------------------------------------------------
Q93S08_STRCO/490-543--------------------------------------------------------------------------------
Q93ZA3_ARATH/477-530--------------------------------------------------------------------------------
Q9KHK2_9ACTO/415-460--------------------------------------------------------------------------------
Q948L1_DAUCA/449-503--------------------------------------------------------------------------------
Q8GXL5_ARATH/76-133--------------------------------------------------------------------------------
Q9SA89_ARATH/469-526--------------------------------------------------------------------------------
Q87IH1_VIBPA/415-459--------------------------------------------------------------------------------
Q8Y3D0_RALSO/458-507--------------------------------------------------------------------------------
Q9FKV0_ARATH/479-537--------------------------------------------------------------------------------
O64743_ARATH/475-528--------------------------------------------------------------------------------
Q8SA59_HELAN/476-534--------------------------------------------------------------------------------
Q9HGH9_ASPOZ/508-552--------------------------------------------------------------------------------
Q84PV5_ORYSJ/467-535--------------------------------------------------------------------------------

PF09265

Q9FE45_9ASPA/238-524-------------------------SS.-------....-------.EMNDLEHLES-----HNAEILKFC......D..
CKX8_ORYSJ/239-523-------------------------STD-------PA.R-------CGRACVDSIMA-----RHRRVADEACRDGGGG..
CKX7_ARATH/239-520-------------------------FVP-------PC..-------AKVSSVEKMVA-----QNQEIVHWC......V..
CKX3_ORYSJ/232-512-------------------------SAN-------PDDG-------CSHHCLQELLL-----RHRRLAGAA.........
Q8H6F6_HORVU/238-510-------------------------SA.-------....-------IGPHSIEHTLN-----LNNQIIEFS......N..
CKX4_ARATH/250-523-------------------------SA.-------....-------GGSQNWQELEN-----LNDKVIQFC......E..
Q709Q4_MAIZE/241-516-------------------------SAP-------SL..-------SGYGSIAHSMN-----LNKQIVEFC......E..
CKX5_ORYSJ/244-525-------------------------SAV-------PGST-------DPAQSLEALER-----QNREILEFC......D..
CKX2_ORYSJ/256-560-------------------------SA.-------....-------AAAGDVGRLEE-----QNDEILGFC......E..
CKX7_ORYSJ/234-513-------------------------SA.-------....-------AVIGDVERLEK-----ENEAVLAFC......H..
CKX10_ORYSJ/246-530-------------------------SAV-------AG..-------GSGGDVEQLER-----ENAAVLELC......DLA
Q5WY14_LEGPL/211-449-------------------------PGV-------PY.S-------LEESCLKAIEN-----LDKHLLQNN.........
CKX1_ARATH/263-539-------------------------SAV-------PN.S-------SGKNDLEYLLK-----QNQRVMNFC......A..
CKX5_ARATH/242-520-------------------------SAL-------TD.G-------EETQKLEYLKD-----QNRRILEFC......E..
CKX1_MAIZE/246-533-------------------------SS.-------....-------VAPNDLARLQE-----QNRRILRFC......D..
CKX11_ORYSJ/219-503-------------------------FCR-------PY.P-------GGGPPVDELVA-----QNNAIIDAC......R..
CKX2_ARATH/227-501-------------------------S..-------....-------ATPKDLPEVES-----VNEKIIRFC......K..
CKX3_ARATH/244-517-------------------------S..-------....-------AGFDNWEAFDQ-----ENMEILKFC......E..

PF02913

D2HDH_ARATH/309-551-------------------------HLG.......DGNL-------HLNISAAEYND.....KLLGLIEPYVYEW.....
DLD_ARATH/319-560-------------------------HAG.......DGNF-------HTCIMFDPSSE.....EQRREAERLNHFM....V
Q9RJ97_STRCO/274-525-------------------------HVY.......ENGA-------SLYFTVVS........AQGEDAVAHWTRAKHAAN
Q9RTM9_DEIRA/229-469-------------------------HIG.......DGNL-------HPNIMFDPRT......EDTHAVHDLAHKI....A
Q987T8_RHILO/164-381-------------------------YDW.......QGGL-------VWLRM...........EEGDPEASLLRGL.....
DLD1_KLULA/320-566-------------------------HAG.......DGNF-------HAFIIYNT........EQRKTAETIVENM....V
ADAS_RAT/370-643-------------------------QTY.......DAGA-------CIYFYFAFNYR.....GISDPL.TVFEQTEAAAR
P72842_SYNY3/220-430-------------------------HVQ.......LGNG-------IGWVRFGQLDR.....EKLNQQRQICQNY.....
Q9A317_CAUCR/209-458-------------------------HVG.......DGNV-------HYDVLQPVGGDGDAHGAQREAGAKIVHDI.....
Q987U0_RHILO/206-447-------------------------HAG.......DGNL-------HPLILYDANVP.....GELDKAESFGADI....L
Q9S2F6_STRCO/248-487-------------------------HAG.......DGNT-------HPTVCFDVQDP.....DESRRARESFDEI....M
Q9HTK3_PSEAE/230-471-------------------------HAG.......DGNM-------HPLILFDANLA.....GELERAEALGGRI....L
O29450_ARCFU/211-460-------------------------HVG.......DGNL-------HPTIWTSPEDE.....ELMSRSHKFYTEV....M
O53525_MYCTU/223-473-------------------------HVY.......PTGA-------SLYFTVVA........GQRGDPIEQWLAAKKAAS
Q9KSQ8_VIBCH/286-544-------------------------HVD.......AGVL-------HVRPALDLCDP.....KQELLMREISDQV....V
O29393_ARCFU/221-445-------------------------HFY.......ESGL-------CFYFTFA.........GLPADIESYYFEVWRRAI
Q97G30_CLOAB/221-465-------------------------HAG.......DGNL-------HVYILKDE........MTEDSWNKKLPEVFKCMY
Q9I6H4_PSEAE/216-461-------------------------HIG.......DGNL-------HLNILKPENLGKDEFFAKCATVNKWVFET.....
Q9K9B9_BACHD/216-457-------------------------HAG.......DGNL-------HPTCLTDIRNH.....EEIERVEKAFAEI....F
YN53_SCHPO/272-525-------------------------HMG.......DGNL-------HLNIAVRQFDK.....RVEKCLEPWVYEW.....
Q986B0_RHILO/224-475-------------------------HMG.......DGNL-------HYNISRPIDGDDEAFLALYHPMNKAVHDV.....
O29853_ARCFU/209-439-------------------------HAG.......DGNV-------HQHP............LVYEGWEKSYFEFRKSLL
DH4C_PSEPU/270-513-------------------------YVAEFIVAPRDMHH-------VIDVLYDRTNP.....EETKRADACFNEL....L
Q9F3A3_STRCO/294-548-------------------------HAA.......HGNL-------HFLLAFDASKP.....SDVDRYAAFMDDF...CR
Q9PGF5_XYLFA/218-457-------------------------HAG.......NGNL-------HVNIMYDDQDA.....EDITRAQATLPKL....F
Q9HZI0_PSEAE/264-527-------------------------HVY.......GEGS-------SIYTTYVFRPA.....ASYAATLERWKRLKHAAS
ADAS_CAEEL/313-584-------------------------QVY.......DAGA-------CVYFYFGFNAR.....GLKNGL.EVYDRIETAAR
Q11061_MYCTU/215-454-------------------------HAG.......DGNT-------HPLLVYDPADA.....AMLERAHLAYGEI....M
Q9D635_MOUSE/239-480-------------------------HVG.......DGNF-------HCILLVDPDDA.....EEQRRVKAFAENL....G
ADAS_DROME/337-605-------------------------QTY.......DAGA-------CIYFYFGFRST.....DVADPV.ELFEAIEHSAR
O07406_MYCTU/211-446-------------------------HIG.......EGNL-------HLNVLR..........CPPDREPALYAKM....M
O05784_MYCTU/269-523-------------------------HVY.......PDGP-------APYYGIYAG.......GRWGSLDAQWDEIKAAVS
Q97B62_THEVO/212-457-------------------------HIG.......DGNI-------HANIFADLGDN.....SAMDKVNRFMMDL....A
O86004_SPHAR/248-488-------------------------FVGETTAIWRSANH-------RQVLPHAAGKG.....EDAVRAKTCAEAL....I
Y2280_MYCTU/214-454-------------------------HAG.......DGNV-------HMAIAC..........KDPEKKKKLMTDI....F
Q9YEU4_AERPE/215-469-------------------------HIG.......DGNL-------HPTISYPVDDE.....KAKEAALKWYYDV....M
Q9YFD3_AERPE/238-468-------------------------HFY.......SGGA-------SLYHT...........VVMERRLDTYWRVWSRVA
Q55124_SYNY3/222-464-------------------------HAG.......DGNL-------HPLILYDQKVP.....GAWEKVEELGGEI....L
O86000_SPHAR/265-508-------------------------YIGEFLVGWRDMHH-------ILMIMYDRADD.....GMRKSAYDLFGKL....V
Q9F2Y0_STRCO/247-482-------------------------HFG.......DGCI-------HVRIDFDLLSE.....AGVARFRRFSEEL....A
Q9HMR2_HALSA/293-559-------------------------HAG.......PGVL-------HVRPLVTLADE.....AGVAKMAEIADRV....T
Q9RVK1_DEIRA/212-453-------------------------HVG.......DGNF-------HVLFHAAPDDR.....ATWDAIHATYDEM....M
Q9RDU1_PSESP/269-511-------------------------YTAGFAIGWRDLHH-------VIDVLYDRSNA.....DEKKRAYACFDEL....I
Q986W2_RHILO/218-457-------------------------HLG.......DGNL-------HYQVLT..........ADPAAAYGIVYRG.....
VAOX_PENSI/301-546-------------------------FIGTFTVGMREMHH-------IVCIVFNKKDL.....IQKRKVQWLMRTL....I
Q9KKW5_VIBCH/271-520-------------------------HAL.......EGNL-------HFVFTQGFDKQ.....SEIERYGAFMDDV...AE
ADAS_TRYBB/307-576-------------------------HQY.......RFGC-------CLYFTFIGG.......QADENDLKIFLQVKKRAM
O46096_DROME/289-531-------------------------HLG.......DSNL-------HLNVSCEEFND.....EIYKRVEPFVYEY.....
ADAS_DICDI/317-586-------------------------HTY.......TNGV-------CLYFIFASK.......QNENKDMAQYIEAKKLMT
Q98KG4_RHILO/325-565-------------------------HAG.......DGNF-------HVLVLMDVNDP.....KEIALSEKFVARL....N
O67645_AQUAE/239-479-------------------------HIG.......DGNL-------HVNLLYDKSNK.....EEEERAERAVDEV....F
Q9I3S8_PSEAE/214-458-------------------------HFL.......DGNL-------HVMLAADVPLL.....PLHQAVEEILYGE.....
Q88EH0_PSEPK/279-533-------------------------HVD.......AGVL-------HVRPALDMKDP.....VQAALVKPISDAV....A
Q97U60_SULSO/203-443-------------------------HAG.......DGTL-------HPLIGFDPKNA.....DETIKAIKAAEEI....T
O06093_MYCLE/211-446-------------------------HVG.......EGNL-------HLNVLR..........CPPDREKTLTAAM....M
Q9HKQ4_THEAC/212-457-------------------------HIG.......DGNI-------HANIFADLSNE.....EAMAKVNKFMMDM....A
Q9HV36_PSEAE/265-514-------------------------HAL.......EGNL-------HFVFTQGFDSP.....EQIARYSAFMDDV...AH
GLCD_BACSU/216-457-------------------------HAG.......DGNL-------HPTCTTDIRNK.....DEMERVEQAFAEI....F
Q9CMN0_PASMU/284-542-------------------------HVD.......AGVL-------HVRPALNLCDK.....AQVKLFKEISDQV....V
DLD2_YEAST/277-529-------------------------HVG.......DGNL-------HLNVAVREYNK.....NIEKTLEPFVYEF.....
Q97Y18_SULSO/215-449-------------------------HVY.......TNGA-------SLYNV...........VVMEQDLELLKRVWETAA
YDIJ_ECOLI/281-539-------------------------HVD.......AGVL-------HVRPALDMCDP.....QQEILMKQISDDV....V

PF09330

DLD_ECOLI/278-567-------------------------KLY-------YGHF-------MCYVFHQ---------DYIVKKGVDVHALKEQML
LDHD_HAEIN/272-562-------------------------KLY-------YGHF-------MCHVFHQ---------DYIVKKGYDYEELEYEML
Q1NHT9_9SPHN/271-556-------------------------SLY-------YGHF-------FCHVFHQ---------DYIVRRGVDPLAFEHRIW
A5WED9_PSYWF/295-585-------------------------KLY-------YGHF-------FCYVFHQ---------DYILKKGSDAQQVKHFML
Q1VBS3_VIBAL/273-563-------------------------ALY-------YGHF-------MCYVFHQ---------DYIFKKGTDTKLMKKLML
Q1YWQ9_PHOPR/273-563-------------------------SLY-------YGHF-------MCHVFHQ---------DYIFKKGTDTKKMKKLML
Q2BK95_9GAMM/272-562-------------------------SLY-------YGHF-------MCHVFHQ---------DYILKKGADGKAVKKMML
Q2VHK1_9LACT/268-556-------------------------KIY-------YGHL-------LDHVMHQ---------DYILKPGVDAHELKKEML
Q5F898_NEIG1/272-561-------------------------KLY-------YGHF-------MCHVFHQ---------DYIIKKGNGCMALEHEML
Q5FRI2_GLUOX/282-571-------------------------KLY-------YGHF-------FCHVMHQ---------DYVIKKGYNAMKVEHDML
Q5NQX4_ZYMMO/284-573-------------------------ILY-------YGHF-------FCQVFHQ---------DYIVKKGGNCADIEHAMW
Q66D31_YERPS/279-568-------------------------KLY-------YGHF-------LCHVFHQ---------DYIVKKGVDVKALKEKML
Q6D2B5_ERWCT/284-573-------------------------RLY-------YGHF-------MCHVFHQ---------DYIVKKGVDVHELKERML
Q6FFS0_ACIAD/279-567-------------------------KLY-------YGHF-------FCHVFHQ---------DYIIQKGVNPLEMEHEMW
Q6WB82_ALCFA/276-564-------------------------KLY-------YGHF-------LCHVFHQ---------DYIIKKGVAPLEMEHRMW
Q7N371_PHOLL/278-567-------------------------KLY-------CGHF-------MCYVFHQ---------DYIVKKGVDVQALKARMI
Q7V9S2_PROMA/275-565-------------------------SFE-------MAHF-------LCMVFHL---------DFVVKKGVDSKLLKEKIL
Q7VS08_BORPE/283-572-------------------------KLY-------YGHF-------FCHVFHQ---------DYIVKKGEDCLALEHRMW
Q8NRY8_CORGL/279-570-------------------------KAY-------YGHF-------FCHVMHQ---------DYVAKQGVDLEALHDRIQ

PF04030

ALO_DEBHA/202-551PIPGNNLRPYLDNSSNL.RYDGDGANVT-------NDQL-------TLFINATMYRP-----FHTNVN...SQEWYQLFE
GGLO_RAT/180-438.......DILL..............SPC-------FQRD-------SCYMNIIMYRP-----YGKDVP...RLDYWLAYE
A5WEE3_PSYWF/185-441.......IGML..............SPT-------QGED-------CAVLSFHVYKG-----MD.......SEPLFNWLY
A7GLB1_BACCN/179-430.......DIWL..............SPA-------YERD-------SAYIAVHMYKG-----MK.......YADYFGAVE
A9VEW0_BACWK/179-430.......DIWL..............SPA-------YGRD-------SAYIAVHMYKG-----MK.......YAAYFGEVE
Q8EQI8_OCEIH/179-431.......DIWL..............SPS-------YKRD-------SAFIAFHVYKG-----ME.......YQTYFRDME
Q47NJ0_THEFY/176-430.......DVWL..............SPG-------YGRE-------SAYVAVHVYQG-----CP.......WQEYFADLE
Q82KJ4_STRAW/182-436.......DITL..............STA-------SGRD-------SAYIAVHMFRG-----TP.......YQAYFTAAE
Q2JG59_FRASC/206-462.......EIPI..............STA-------YGRD-------TAYIAVHVDHR-----GA.......HGDYFGLAE
Q4JW76_CORJK/189-446.......DVPL..............STA-------KGRE-------SCYIAIHRYNK-----DS.......HQALFRHIE
O06804_MYCTU/172-425.......DSFL..............STA-------YGRD-------TCYIAVHQYAG-----ME.......FESYFRAVE
Q5YR83_NOCFA/174-426.......DALL..............SPA-------GDRA-------TCYIAVHQYRG-----MA.......WEPFFRACE
Q390J8_BURS3/172-425.......DIWL..............SPD-------YGRD-------SVRISVHQYRG-----MP.......FDAYFSGVQ
Q92X65_RHIME/187-406.......DSWL..............SEA-------YGRD-------SVSISLHQNAT-----LP.......YWDFFLDLE
Q9HTM8_PSEAE/186-438.......DIPL..............SMF-------EGRD-------SCSISVHQHYS-----MD.......HHNFFAAVE
Q983S0_RHILO/175-424.......KFWL..............SPF-------YNRP-------TCSIAIHHDAA-----SD.......PLPFMQAAE
Q4DPS1_TRYCC/258-491.......KTAL..............SPA-------HGRK-------TCWIGIVMYRP-----YLLYAR..DTLRYYQAFS
Q57ZU1_TRYB2/262-506.......TAAL..............SPA-------HGRQ-------TCWIGIVMYRP-----YLRHAR..DTLRYYDAFS
Q4QE54_LEIMA/258-489.......VSDM..............SPA-------VGRP-------TCWIGVVMYRP-----YGQEAR..DTRRCYDGFC
Q4PIL2_USTMA/445-677.......AIWL..............SHA-------QGRK-------TCYIGIVQYRP-----YNRPVR...YRQLFAKFE
Q5K700_CRYNJ/204-464.......DIWL..............SPS-------YGRD-------TCWIGVVTYRP-----YGLSVP...YRQFHEKFS
Q2H4W5_CHAGB/168-472..TTRNNRPFL.............DITP-------DDGP-------ALYLNATMYRP-----YYRDPPHEATERYYRAFE
ALO_NEUCR/210-513..REANTRPFL.............DPTQ-------SDGP-------TLYLNAIMYRP-----YHREPTYNATERYYLGFE
Q2UQI3_ASPOR/199-482....KNPRPFL.............DPSH-------HDGP-------TLYLNATLYRP-----YLRDPP..CKDRYYEAFE
ALO_CANAL/202-552PIPGNNLRPYLDNSPKL..PYSKDGKIT-------NDQL-------TLFINATMYRP-----FGTNVE...THKWFQLFE
ALO_CANGA/188-518PVYGNLLRPYLDNTPSQ.CSYAPIHSVT-------NSQL-------TLYINATIYRP-----FHTNAP...IHKWFTLFE
ALO_YEAST/186-516PVYGNVCRPFLDNTPSH.CRFAPLENVT-------NSQL-------TLYINATIYRP-----FGCNTP...IHKWFTLFE
ALO_ASHGO/192-522PVYGNLLRPYLDNTPSH.LRYAPLSDVT-------NSQL-------TLYINATIYRP-----FGTNTP...IHKWFTLFE
ALO_KLULA/190-520PVFGNTLRPYLDATPRH.LRYAPLSDVT-------NSQL-------SLYINATIYRP-----FGSNSP...IHKWFTLFE
ALO_YARLI/189-523AITGNTLRPLLDINPRDRPYASPHGHVT-------NSNL-------TLYINATMYRP-----FGVNSP...VGKWYRDFE
ALO_SCHPO/187-459.....EDECWL..............STD-------CKVP-------TCYIEAIMYRP-----FSTSIN...YKPYFKALE
GGLO_SCYTO/180-438.......DILL..............SPC-------YRQD-------SCYINIIMYRP-----YGKEVP...REGYWAMYE
Q5U4Z7_XENLA/180-438.......DILM..............SPC-------YHQD-------SCYMNIIMYRP-----YGKDVP...HQEYWVEYE
Q22YW5_TETTS/180-449.......EAYL..............SGS-------YNRR-------VCWVGFLVYLA-----KDGSFIK.GSLEMMKELQ

PF09129

Q2T0X3_BURTA/323-645-------PPSL--------------SAI-------RPRPDHPDWNAAIWFDILTIPG-----TPD------ANRFYREIE
Q7SID9_BREST/223-561-------PPTI--------------SAT-------RPRPDHPDWDVAIWLNVLGVPG-----TPG------MFEFYREME
Q9HWP1_PSEAE/277-597-------VPSL--------------SAI-------RPRPDQPEWDTAIWLDILSLPG-----TPQ------ANAFYHEFE

PF08031

YGAK_BACSU/399-443-------------------------------------------------------------WPRTYYG.EN.VERLRRVK
Q7RV07_NEUCR/421-465-------------------------------------------------------------APQQYWG.SN.YEELRRVK
Q7S1P7_NEUCR/453-499-------------------------------------------------------------AVGNYYR.SS.LSRLQKVK
MCRA_STRLA/395-442-------------------------------------------------------------.VEAAYTPAD.FARLRAVK
Q6LJC7_PHOPR/280-323-------------------------------------------------------------RVPGAYG.AN.YERLAEVK
Q8LSM7_HELAN/478-533-------------------------------------------------------------WGERYWKREN.FKKLIRIK
Q8NIW9_NEUCS/507-551-------------------------------------------------------------FQHQFFG.SN.YNNLLCIK
Q84WI1_ARATH/431-489-------------------------------------------------------------WGVKYFK.NN.FERLVRVK
Q84N20_NICLS/354-412-------------------------------------------------------------WGIKYFK.NN.FDRLVQVK
Q84PV7_ORYSJ/461-526-------------------------------------------------------------WGAAYFG.NN.FNRLVSTK
Q8NK91_ASPOZ/503-547-------------------------------------------------------------FQKYFYG.DN.YATLRKIK
Q6EUS8_ORYSJ/495-552-------------------------------------------------------------WGEKYFR.GN.FRRLAMVK
Q93Y11_ARATH/480-538-------------------------------------------------------------WGANYFK.DN.FNRLVRIK
Q8EGB1_SHEON/850-894-------------------------------------------------------------.TARYFG.KN.YPLLQQVK
Q8GTB6_CANSA/480-538-------------------------------------------------------------WGEKYFG.KN.FNRLVKVK
Q6NNH8_ARATH/100-155-------------------------------------------------------------YGAKYFK.DN.FERLVDIK
Q8XND2_CLOPE/404-448-------------------------------------------------------------YEEEYYG.EN.KDKLREIR
Q92U94_RHIME/427-471-------------------------------------------------------------RVEAAYG.AN.YGRLVEIK
Q7SB35_NEUCR/597-641-------------------------------------------------------------FGEAYFG.SN.YERLSQIK
Q9LNL9_ARATH/467-522-------------------------------------------------------------YGVKYFK.NN.FERLVQVK
Q7X2G7_9ACTO/444-497-------------------------------------------------------------WHHLYYK.DN.YARLRSAK
Q7NIA5_GLOVI/31-76-------------------------------------------------------------RVTRAFGDAK.HGRLREIK
Q8VWA5_9ACTO/433-486-------------------------------------------------------------WYTLYYK.GN.YPRLQRVK
Q82GZ2_STRAW/449-493-------------------------------------------------------------WETAYWG.SN.FDRLRKIK
YVDP_BACSU/400-444-------------------------------------------------------------FGKEYYG.AN.FARLREIK
Q6PW77_ACRST/450-496-------------------------------------------------------------AQKLYWR.GN.LEKLQAIK
Q9X5T1_STRLA/421-468-------------------------------------------------------------TTRSAYTPED.YARLQALK
O94206_CLAPU/412-457-------------------------------------------------------------FQTRYWGADN.YARLAATK
Q8X0G1_NEUCS/561-604-------------------------------------------------------------WQTAFWG.DN.YPKLLQLR
Q7SHH8_NEUCR/453-496-------------------------------------------------------------.PEQMYG.RNKLHRLAKLK
Q84PV6_ORYSJ/334-398-------------------------------------------------------------WGIRYFS.KN.FDRLVRAK
O64745_ARATH/479-537-------------------------------------------------------------YGDSYFK.GN.YLRLVKIK
Q869M2_DICDI/431-473-------------------------------------------------------------.TDNYYG.EN.SKKLKELK
Q9AYM8_VIGUN/473-530-------------------------------------------------------------WGLKYFS.NN.FKRLATVK
Q9SA85_ARATH/465-524-------------------------------------------------------------YGKKYFA.GN.FERLVKIK
Q7V3Z6_PROMM/524-568-------------------------------------------------------------WKQEFWG.PN.YERLLGIK
Q9FKU8_ARATH/476-534-------------------------------------------------------------WGANYFK.NN.FNRLMMIK
Q7WZ62_9ACTO/469-522-------------------------------------------------------------WHDLYYK.GN.HPRLRKVK
Q7S915_NEUCR/469-516-------------------------------------------------------------AERTYYG.ND.TKNLRLVK
Q9ALN1_9PSEU/476-529-------------------------------------------------------------WHDLYYK.DN.YPRLQRAK
RETO_ESCCA/455-517-------------------------------------------------------------WGESYFL.SN.YERLIRAK
Q9ZPP5_BERST/452-514-------------------------------------------------------------WGEKYFL.SN.YERLVRAK
RETO_PAPSO/459-521-------------------------------------------------------------WGERYFS.SN.YERLVKAK
Q8KSY2_9ACTO/421-466-------------------------------------------------------------WEADHYG.EN.AARLRAVK
Q8RWA4_ARATH/490-547-------------------------------------------------------------YGSKYFL.GN.LKRLMDVK
Q9FKV2_ARATH/471-528-------------------------------------------------------------WGFRYFG.SN.FKRLAIVK
Q81C29_BACCR/8-52-------------------------------------------------------------WPDAYFS.CN.FDRLMEVK
Q81IH6_BACCR/396-440-------------------------------------------------------------WQTSYYG.SN.FHRLRKVK
Q6ZB64_ORYSJ/480-545-------------------------------------------------------------WGSAYFSPAN.FERLVGAK
Q9EX55_STRCO/495-548-------------------------------------------------------------WHELYFK.GN.YPRLQRVK
P93762_CHOCR/484-535-------------------------------------------------------------ALELYFL.GN.LNRLIKAK
Q8KY45_STRCU/463-508-------------------------------------------------------------WETEYFG.AN.RFRLRAVK
P71984_MYCTU/413-458-------------------------------------------------------------HVETLYSTTE.FSRLVTLK
Q94KD7_ARATH/470-527-------------------------------------------------------------WGETYFK.GN.FKRLGLVK
Q93S08_STRCO/490-543-------------------------------------------------------------WNTLYFK.DG.YCRLQAAK
Q93ZA3_ARATH/477-530-------------------------------------------------------------WGNRYFK.GN.FERLVEIK
Q9KHK2_9ACTO/415-460-------------------------------------------------------------RTREAYGAAK.FERLQGVK
Q948L1_DAUCA/449-503-------------------------------------------------------------WGKKYYK.NN.FDRLVKIK
Q8GXL5_ARATH/76-133-------------------------------------------------------------FGRMYFG.EN.FDRLVKVK
Q9SA89_ARATH/469-526-------------------------------------------------------------YGRKYFG.EN.FDRLVRVK
Q87IH1_VIBPA/415-459-------------------------------------------------------------RTESAYG.PT.FARLQEVK
Q8Y3D0_RALSO/458-507-------------------------------------------------------------WPQLYYGDGDLYAFLQRVK
Q9FKV0_ARATH/479-537-------------------------------------------------------------WGPKYFK.GN.FDRLVKIK
O64743_ARATH/475-528-------------------------------------------------------------WGAKYYK.GN.FERLVKIK
Q8SA59_HELAN/476-534-------------------------------------------------------------YGHKYFKETN.YKRLVSVK
Q9HGH9_ASPOZ/508-552-------------------------------------------------------------FKTAFFG.NN.YDKLRAIK
Q84PV5_ORYSJ/467-535-------------------------------------------------------------WGERYFL.GN.YDRLVRAK

PF09265

Q9FE45_9ASPA/238-524QQGMNY-KQ-----YLPHY..TSIED..---------------------------------W.KKHFG.KK-WERFVEMK
CKX8_ORYSJ/239-523GRGIGA-KQ-----YLARQ..PSPAR..---------------------------------W.RDHFG.AG-WGRFAARK
CKX7_ARATH/239-520KNGIDY-KL-----YLPHY..KSQEE..---------------------------------W.IRHFG.NR-WSRFVDRK
CKX3_ORYSJ/232-512ASGLGA-KQ-----YLAHH..PTPAG..---------------------------------W.RRHFG.RR-WERFADRK
Q8H6F6_HORVU/238-510KASIGV-KQ-----YLPNY..TTEPE..---------------------------------W.KAHYG.AR-WDAFQQRK
CKX4_ARATH/250-523NSGIKI-KE-----YLMHY..TRKED..---------------------------------W.VKHFG.PK-WDDFLRKK
Q709Q4_MAIZE/241-516EAGIGM-KQ-----YLAPY..TTQQQ..---------------------------------W.KAHFG.AR-WETFERRK
CKX5_ORYSJ/244-525EAGIGA-KQ-----YLPNH..KAQRE..---------------------------------W.EAHFG.AR-WARFARLK
CKX2_ORYSJ/256-560VAGIAY-KQ-----YLPYY..GSQAE..---------------------------------WQKRHFGANL-WPRFVQRK
CKX7_ORYSJ/234-513NEDIGC-KQ-----YLPYY..TSQDG..---------------------------------W.QRHFG.AK-WSRVADLK
CKX10_ORYSJ/246-530GGGIGC-RQ-----YLPHH..ASRDG..---------------------------------W.RRHFG.AK-WGRVADLK
Q5WY14_LEGPL/211-449.....G-KR-----YLSGFLGTELPDNY---------------------------------W.LKHFG.EK-YDSWVGLK
CKX1_ARATH/263-539AANLNV-KQ-----YLPHY..ETQKE..---------------------------------W.KSHFG.KR-WETFAQRK
CKX5_ARATH/242-520QAKINV-KQ-----YLPHH..ATQEE..---------------------------------W.VAHFG.DK-WDRFRSLK
CKX1_MAIZE/246-533LAGIQY-KT-----YLARH..TDRSD..---------------------------------W.VRHFGAAK-WNRFVEMK
CKX11_ORYSJ/219-503SNGYDY-KI-----YFPSY..HAQSD..---------------------------------W.SRHFG.AK-WSRFVDRK
CKX2_ARATH/227-501DSGIKI-KQ-----YLMHY..TSKED..---------------------------------W.IEHFG.SK-WDDFSKRK
CKX3_ARATH/244-517DANMGV-IQ-----YLPYH..SSQEG..---------------------------------W.VRHFG.PR-WNIFVERK

PF02913

D2HDH_ARATH/309-551..TSKH-RG-----SISAEHGLGVMKAN-----------------------------....EIFYSKSPET-VALMASIK
DLD_ARATH/319-560HSALSM-DG-----TCTGEHGVGTGKMK-----------------------------....YLEKELGIEA-LQTMKRIK
Q9RJ97_STRCO/274-525DAILAA-GG-----TITHHHAVGTDHRD-----------------------------....WYVREAGPLG-VEALRAVK
Q9RTM9_DEIRA/229-469LVAIRH-GG-----VLSGEHGIGTMKRD-----------------------------....FMRDAVDPVT-LNVLRDVK
Q987T8_RHILO/164-381.LRKHG-GG-----HATLVRATPAHRAA-----------------------------...LPVFEPQPPAL-AALSQRLK
DLD1_KLULA/320-566KRAIDA-EG-----TCTGEHGVGIGKRD-----------------------------....YLLEEVGEDT-VAVMRKLK
ADAS_RAT/370-643DEILAN-GG-----SLSHHHGVGKLRKQ-----------------------------....WLKESISDVG-FGMLKSVK
P72842_SYNY3/220-430......-GG-----YVTVLEASPECKKH-----------------------------....WDVWGQSGHG-LAMMGRLK
Q9A317_CAUCR/209-458..TAGF-GG-----SISAEHGLGAMKTA-----------------------------....EALTYKDPIE-VAALRAIR
Q987U0_RHILO/206-447RLCVKV-GG-----VLTGEHGVGVEKRD-----------------------------....LMPEMFNQVD-LDQQMRIK
Q9S2F6_STRCO/248-487ALGLEL-GG-----TITGEHGVGVLKKE-----------------------------....WLAREIGPVG-LEMQRAVK
Q9HTK3_PSEAE/230-471ELCVAV-GG-----SITGEHGVGREKIN-----------------------------....QMCAQFNADE-LTLFHAVK
O29450_ARCFU/211-460ELALRL-GG-----TISAEHGIGVVKKE-----------------------------GLEMEMKYKKSEKA-LEIMREIK
O53525_MYCTU/223-473DAIMAT-GG-----TITHHHAVGSDHRP-----------------------------....WMRAEVGDLG-VTLLRTIK
Q9KSQ8_VIBCH/286-544KLVAKY-GG-----LMWGEHGKGYRSE.-----------------------------....YGPEFFGEEL-FTELRRVK
O29393_ARCFU/221-445EASLKN-GG-----NLTHHHGVGRLRKR-----------------------------....WLSAEIGG.Y-YPLLRDLK
Q97G30_CLOAB/221-465KKAREL-KG-----QVSGEHGIGYAKKK-----------------------------....YLNEQIGEAN-LTLMRNIK
Q9I6H4_PSEAE/216-461..VEKY-NG-----SISAEHGVGMTKRD-----------------------------....YLTYTRSETE-IAYMKALK
Q9K9B9_BACHD/216-457EKAIAL-GG-----TITGEHGVGVMKAP-----------------------------....YLERKLGEAG-MAAMKAIK
YN53_SCHPO/272-525..VSRH-RG-----SISAEHGLGLLKKP-----------------------------....FVGYSKSKEM-IHLMKTLK
Q986B0_RHILO/224-475..VRSF-HG-----SISAEHGIGQLKRD-----------------------------....ELIATAPPMA-IDLMRRVK
O29853_ARCFU/209-439SLAVSL-GG-----VISGEHGIGAVKLS-----------------------------....ELEELF.PEQ-FELMRQIK
DH4C_PSEPU/270-513DEFEKE-GY-----AVYRVNTRFQDRVA-----------------------------.......QSYGPVK-RKLEHAIK
Q9F3A3_STRCO/294-548MTVERF-DG-----SLKAEHATGRNIAP-----------------------------....FLELEWGPRA-TELMWRLK
Q9PGF5_XYLFA/218-457KLVLTL-GG-----TLSGEHGIGVAKRD-----------------------------....FMTQAFDTPT-LAAMRAVK
Q9HZI0_PSEAE/264-527QAIVDN-RG-----TISHQHGVGKDHAP-----------------------------....YLPREKGELG-VAALRAMA
ADAS_CAEEL/313-584DEIIAC-GG-----SISHHHGVGKIRKQ-----------------------------....WMLTTNGAVG-IALLKAIK
Q11061_MYCTU/215-454DLAVGL-GG-----TITGEHGVGRLKRP-----------------------------....WLAGYLGPDV-LALNQRIK
Q9D635_MOUSE/239-480RRALAL-GG-----TCTGEHGIGLGKRQ-----------------------------....LLQEEVGPVG-VETMRQLK
ADAS_DROME/337-605DEILSC-GG-----SLSHHHGVGKIRSH-----------------------------....WYRNAVTETG-SSLYSAAK
O07406_MYCTU/211-446GLIAEC-GG-----NVSSEHGVGSRKRA-----------------------------....YLGMSRQAND-VAAMRRVK
O05784_MYCTU/269-523EAISAS-GG-----TITHHHAVGRDHRA-----------------------------....WYDRQRPDPF-AAALRAAK
Q97B62_THEVO/212-457MVAVKH-GG-----SVSAEHGIGIEKKQ-----------------------------LLIEEMKYNNNLRT-LDIMKAIK
O86004_SPHAR/248-488AAQAEA-GF-----GQIMTDPGLGAAVA-----------------------------....KTYEKGGRS.-.ALHARVK
Y2280_MYCTU/214-454ALAMEL-GG-----AISGEHGVGRAKTG-----------------------------....YFLELEDPVK-ISLMRRIK
Q9YEU4_AERPE/215-469RMAIEL-GG-----TVSAEHGIGVLKKE-----------------------------ALRLELERMGSVKA-LEIMAGIK
Q9YFD3_AERPE/238-468EAVRQL-GA-----SITHQHGWGLLRKP-----------------------------....YLGFLGGN..-YRVFCRVK
Q55124_SYNY3/222-464KRCVEL-GG-----SLSGEHGIGIDKNC-----------------------------....FMPNMFNEVD-LETMQWVR
O86000_SPHAR/265-508DEAAGA-GF-----GEYRTHLAFMDQIA-----------------------------....KTYKHNDGAL-WDLHHRLK
Q9F2Y0_STRCO/247-482DVVVAH-GG-----SLSGEHGDGQARAE-----------------------------....LLPRMYGPET-VALFERAK
Q9HMR2_HALSA/293-559DLVVEY-GG-----AVSGEHGDGRARSQ-----------------------------....WNRKFYGEDL-WASFRRTK
Q9RVK1_DEIRA/212-453TLTLAA-GG-----TCSGEHGIGLHKQK-----------------------------....YLAQERAD.T-LELMREVK
Q9RDU1_PSESP/269-511DVFAAE-GF-----ASYRTNIAFMDKVA-----------------------------.......SKFGAEN-KRVNQKIK
Q986W2_RHILO/218-457..VAAA-GG-----GVSAEHGIGLDKKQ-----------------------------....WLHLVRSDAE-IATMRRLK
VAOX_PENSI/301-546DDCAAN-GW-----GEYRTHLAFMDQIM-----------------------------....ETYNWNNSSF-LRFNEVLK
Q9KKW5_VIBCH/271-520LVAVKY-QG-----SLKAEHGTGRNMAP-----------------------------....YVELEWGKEG-YALMQKIK
ADAS_TRYBB/307-576EVMLQH-RG-----NLTHHHGIGYEHVP-----------------------------....WMKRYNGEGG-LDAIMKFK
O46096_DROME/289-531..TSKL-KG-----SISAEHGIGFLKKD-----------------------------....YLHYSKDPVA-IGYMREMK
ADAS_DICDI/317-586DIIFKY-GG-----SLSHHHGVGYEHVP-----------------------------....WMTRYATRGW-INVYRSLK
Q98KG4_RHILO/325-565LRAIAM-DG-----TCTGEHGIGQGKIG-----------------------------....FLRPELGH.G-VDIMRSIK
O67645_AQUAE/239-479ELALNY-NG-----SITGEHGVGLTKRK-----------------------------....FLKWQFGETG-YELLKGIK
Q9I3S8_PSEAE/214-458..LGEC-AG-----VISAEHGIGLEKKE-----------------------------....ALGRYADPLK-LALMAQIK
Q88EH0_PSEPK/279-533ALTKRY-GG-----LLWGEHGKGLRSE.-----------------------------....YVPEYFGE.L-YPALQRLK
Q97U60_SULSO/203-443KLAIKV-GG-----VPSGEHGIGIEKIK-----------------------------....FMKLYYSEDD-LTLMRRLK
O06093_MYCLE/211-446ELIAQA-GG-----NVSSEHGVGSNKRA-----------------------------....YLRMSRDPAD-IAAMRTIK
Q9HKQ4_THEAC/212-457MISVRH-GG-----SVSAEHGIGLEKKK-----------------------------LFVEEMRFHDNMRT-LDLMRSIK
Q9HV36_PSEAE/265-514LVAVEY-GG-----SLKAEHGTGRNMAP-----------------------------....FVELEWGEDA-YRLMWQLK
GLCD_BACSU/216-457EKAIEL-GG-----TITGEHGVGEMKAP-----------------------------....YLEMKLKKEG-IDAMKALK
Q9CMN0_PASMU/284-542ALTHKY-GG-----LIWGEHGKGMRSQ.-----------------------------....YGETFFTPEL-WQELRYIK
DLD2_YEAST/277-529..VSSK-HG-----SVSAEHGLGFQKKN-----------------------------....YIGYSKSPEE-VKMMKDLK
Q97Y18_SULSO/215-449RVIMQL-GG-----TISHHHGVGILKKN-----------------------------....WVKEELGE.Q-YDLLLLIK
YDIJ_ECOLI/281-539ALTAKY-GG-----LLWGEHGKGFRAE.-----------------------------....YSPAFFGEEL-FAELRKVK

PF09330

DLD_ECOLI/278-567ELLQQR-GA-----QYPAEHNVGHLYKA--------------------------------------------PETLQKFY
LDHD_HAEIN/272-562KLLDKR-GA-----QYPAEHNVGHLYEA--------------------------------------------KPTLRKFY
Q1NHT9_9SPHN/271-556ALLDER-GA-----EYPAEHNVGHLYRA--------------------------------------------KPTLERFY
A5WED9_PSYWF/295-585ELLNTR-GA-----KYPAEHNVGHLYEA--------------------------------------------EPDLQNFY
Q1VBS3_VIBAL/273-563EHLNSR-GA-----KYPAEHNVGHLYEA--------------------------------------------ENSLQKFY
Q1YWQ9_PHOPR/273-563ELLEQK-GA-----KYPAEHNVGHLYEA--------------------------------------------ENTLQEFY
Q2BK95_9GAMM/272-562DLLKEK-GA-----KYPAEHNVGHLYEA--------------------------------------------EEGLQNFY
Q2VHK1_9LACT/268-556KILDER-HA-----VYPAEHNVGHLYLA--------------------------------------------APALIKHY
Q5F898_NEIG1/272-561HLLDQR-GA-----QYPAEHNVGHLYEA--------------------------------------------KPALKQFY
Q5FRI2_GLUOX/282-571PGLDAR-GA-----RYPAEHNVGHLYKA--------------------------------------------PEEMVEHY
Q5NQX4_ZYMMO/284-573KILDSR-HA-----EYPAEHNVGHLYYA--------------------------------------------KDSLKTHY
Q66D31_YERPS/279-568SLLNDK-GA-----EYPAEHNVGHLYLA--------------------------------------------KPALKDFY
Q6D2B5_ERWCT/284-573ALLDQR-GA-----EYPAEHNVGHLYQA--------------------------------------------KPQLKAFY
Q6FFS0_ACIAD/279-567KLLDAR-RA-----EYPAEHNVGHLYIA--------------------------------------------KPALANFY
Q6WB82_ALCFA/276-564KLLDER-QA-----EYPAEHNVGHLYVA--------------------------------------------KPALAGFY
Q7N371_PHOLL/278-567ELLDKR-GA-----EYPAEHNVGHLYQA--------------------------------------------KPQLKAFY
Q7V9S2_PROMA/275-565KFLDSI-NA-----KYPAEHNVGHLYKA--------------------------------------------EKSLEVFY
Q7VS08_BORPE/283-572KLLDER-GA-----EYPAEHNVGHLYDA--------------------------------------------KPELKAFY
Q8NRY8_CORGL/279-570HLLEER-GA-----KLPAEHNYGRIYKL--------------------------------------------PESMEEHF

PF04030

ALO_DEBHA/202-551DIMTNA.SG-----RPHWAKNFIGVNGAHRTDQDLRKQLEF..GGKTSYSMKGFNPILKKWF------GEN-LVEYNKVR
GGLO_RAT/180-438TIMKKF.GG-----RPHWAKAHNCTQKD.............................FEEMY------.PT-FHKFCDIR
A5WEE3_PSYWF/185-441DYMKKW.QG-----RPHWGKINKLSSDE.............................LQVLY------.PQ-MKRFLQIR
A7GLB1_BACCN/179-430QIFQKY.EG-----RPHWGKMHTMTYEQ.............................LRAMY------.PK-LHSFLQVR
A9VEW0_BACWK/179-430KNFLKY.EG-----RPHWGKMHTLTYEK.............................LQNIY------.PE-LHSFLKVR
Q8EQI8_OCEIH/179-431AIMKKY.NG-----RPHWGKLHQQKAKD.............................LCEMY------.PK-WDQFIQLR
Q47NJ0_THEFY/176-430AIFTAA.AG-----RPHWGKMHTRTLSY.............................LDKVY------.PR-LRDALEVR
Q82KJ4_STRAW/182-436RIFTAH.EG-----RPHWGKVHTRDAEY.............................FSGVY------.PR-FGEFTALR
Q2JG59_FRASC/206-462KIMLSV.GG-----RPHWGKLHSLDAAT.............................LRGLY------.PR-FDDFLAVR
Q4JW76_CORJK/189-446PIFKAASGG-----RPHWGKLHTLTHED.............................LLERH------.ED-LARACEIR
O06804_MYCTU/172-425EIMDDY.AG-----RPHWGKRHYQTAAT.............................LRERY------.PQ-WDRFAAVR
Q5YR83_NOCFA/174-426AVFDRY.QG-----RPHWGKRHFQTADT.............................LRERY------.PH-WDRFAQVR
Q390J8_BURS3/172-425AICRNH.GG-----RPHWGKVHAMKAAE.............................LAACY------.PH-WDDFLALR
Q92X65_RHIME/187-406PIMRDH.GG-----RPHWAKKHSLRAAE.............................LRPLY------.PM-WDRFLALR
Q9HTM8_PSEAE/186-438PIFWKY.AG-----RPHWGKLHGLNAHQ.............................LQGLY------.PR-WKAFAEVR
Q983S0_RHILO/175-424PIFRRY.GG-----RPHWGKMHSLKAAD.............................FKKLY------.PR-WDDAMAVR
Q4DPS1_TRYCC/258-491DAMTAM.GG-----RPHWAKYYTWGPAQ.............................LKEAY------GQN-WEEFLQLR
Q57ZU1_TRYB2/262-506KAMTVM.GG-----RPHWAKYYTWGPEQ.............................MLKAY------GKN-WEDFLLFR
Q4QE54_LEIMA/258-489RVMEEM.GG-----RPHWAKYYDWGHRE.............................ITATY------GDH-WERFLALR
Q4PIL2_USTMA/445-677ALMRHY.SG-----RPHWAKAHSCSPTE.............................LSQLY------.PH-WHDFLATR
Q5K700_CRYNJ/204-464SLLKSY.GG-----RPHWAKQHILGPKT.............................LEVIY------.PK-FKDFQQVL
Q2H4W5_CHAGB/168-472WLMRDL.GG-----RPHWAKTFSVSPGE.............................FATWY------GAD-WRRFCAVR
ALO_NEUCR/210-513WLMREL.GG-----KPHWAKTFTATQAD.............................LARWY------GDD-FQRWGAVR
Q2UQI3_ASPOR/199-482WLMREM.GA-----KPHWAKNFKVTGRH............................ELQGLY------GKN-MDEWLKVR
ALO_CANAL/202-552DVMSKA.GG-----KPHWAKNFIGLTQDEKYDKQQDLKTQLEFGGKPFYTMLGFKPVMQDWF------GKD-LVAFNKVR
ALO_CANGA/188-518DTMSAA.GG-----KPHWAKNFLGSTSFAQGQVKAEGQY.......QDYEMRGMATRVKEWY------GSD-LETFKKVR
ALO_YEAST/186-516NTMMVA.GG-----KPHWAKNFLGSTTLAAGPVKKDTDY.......DDFEMRGMALKVEEWY------GED-LKKFRKIR
ALO_ASHGO/192-522DTLGAA.GG-----KPHWAKNFLGSTATAAGPVKSSDEY.......QDYEMRGMATKIKEWY------GDN-LKQFQKVR
ALO_KLULA/190-520DTMGAA.GG-----KPHWAKNFLGATSMAAGKVKDEKDY.......DDYEMRGMATKIKEWY------GED-LLKFREIR
ALO_YARLI/189-523GIVAEA.GG-----KPHWAKNFLGPETAELKDNESED...........GKMLGLKPIIDEWY------GDD-LKQWKSLR
ALO_SCHPO/187-459DIANQY.NG-----KPHWAKEYSLTKEQ.............................LLERY------.PN-LSKWLSLR
GGLO_SCYTO/180-438EIMKRN.GG-----RPHWAKAHSLLRQD.............................FEKIY------.PA-FHKFCSIR
Q5U4Z7_XENLA/180-438NIMKKV.GG-----RPHWAKAHTCTRKD.............................FEKMY------.PA-FSTFKSIR
Q22YW5_TETTS/180-449IILAKF.QG-----VPHLGKHFIKEIFD.............................FEANL------.PK-WNTFKQLR

PF09129

Q2T0X3_BURTA/323-645QWMLSNYSGDYATVRPEWSKGWGYADTAAWSDGAMLGTT------------------IPDLFRLGLSPADN-WDAALRTL
Q7SID9_BREST/223-561QWMRSHYNNDDATFRPEWSKGWAFGPD.PYTDNDIVTNK------------------MRATYIEGVPTTEN-WDTARARY
Q9HWP1_PSEAE/277-597AWLFDHFSGDYASLRVEWSKGWGYSPAAAWDEPTVVDQL------------------VAQSLRQGLVADND-WDSAVRQL

PF08031

YGAK_BACSU/399-443TTY..DPENVFRFEQSIP------
Q7RV07_NEUCR/421-465KVW..DPKEVFWNPQSVR------
Q7S1P7_NEUCR/453-499AQY..DPNEVFYYPQSVE------
MCRA_STRLA/395-442AQY..DPDNMFRVNFNIP------
Q6LJC7_PHOPR/280-323AKY..DSDNFFRLNQNIS------
Q8LSM7_HELAN/478-533AKV..DPENFFRHPQSIP------
Q8NIW9_NEUCS/507-551KKY..DPTNLFYATAAVG------
Q84WI1_ARATH/431-489TRV..DPTDFFCDEQSIP------
Q84N20_NICLS/354-412TKV..DPSNVFRNEQSIP------
Q84PV7_ORYSJ/461-526TTI..DPSNVFNNAQSIP------
Q8NK91_ASPOZ/503-547AKY..DPDNLFYATTAVG------
Q6EUS8_ORYSJ/495-552GEV..DPDQLFWSEQSIP------
Q93Y11_ARATH/480-538SKV..DPDNFFRHEQSIP------
Q8EGB1_SHEON/850-894ASYCQDPLNHFRSRKSII------
Q8GTB6_CANSA/480-538TKV..DPNNFFRNEQSIP------
Q6NNH8_ARATH/100-155TKF..DEINFWRNEQSIP------
Q8XND2_CLOPE/404-448KKY..DENRFFAFEQGIK------
Q92U94_RHIME/427-471RHY..DPLNLFRMNQNVR------
Q7SB35_NEUCR/597-641KAV..DPTGLLWAPTAVG------
Q9LNL9_ARATH/467-522TRV..DPDNIFRYEQSIP------
Q7X2G7_9ACTO/444-497RAW..DPLNTFHHSMSIG------
Q7NIA5_GLOVI/31-76GRF..DPANAFHLNLNIE------
Q8VWA5_9ACTO/433-486ARW..DPRDVFRHALSVR------
Q82GZ2_STRAW/449-493AKY..DPRNVFQYEQSIP------
YVDP_BACSU/400-444AKY..DPENVFRFPQSIP------
Q6PW77_ACRST/450-496AKY..DPEDVFGNVVSVE------
Q9X5T1_STRLA/421-468SQY..DPGNVFRFNPNIP------
O94206_CLAPU/412-457AAW..DPSHLFMTSLGVG------
Q8X0G1_NEUCS/561-604QKW..DPSGVF.YSVSTP------
Q7SHH8_NEUCR/453-496KQY..DPSSVFGFHNPLP------
Q84PV6_ORYSJ/334-398TMI..DPENVFNNAQSIP------
O64745_ARATH/479-537ARF..DRTNFFRSQQGIP------
Q869M2_DICDI/431-473LKY..DPNNFFNNNPNIN------
Q9AYM8_VIGUN/473-530TKV..DPHNFFRNEQSIP------
Q9SA85_ARATH/465-524TRV..DSGNFFRNEQSIP------
Q7V3Z6_PROMM/524-568RRY..DPTNLFRVHHGVG------
Q9FKU8_ARATH/476-534AKV..DPENFFRHEQSIP------
Q7WZ62_9ACTO/469-522AAY..DPRNHFHHALSIR------
Q7S915_NEUCR/469-516QQW..DPDNFFKWKQGIK------
Q9ALN1_9PSEU/476-529ARW..DPQNIFQHGLSIK------
RETO_ESCCA/455-517TLI..DPNNVFNHPQSIP------
Q9ZPP5_BERST/452-514TLI..DPKNVFHHPQSIP------
RETO_PAPSO/459-521TLI..DPNNVFNHPQSIP------
Q8KSY2_9ACTO/421-466RAY..DPDGFFRHGRSIG------
Q8RWA4_ARATH/490-547AKY..DPDNFFKNEQSIP------
Q9FKV2_ARATH/471-528GKI..DPTNFFRNEQSVP------
Q81C29_BACCR/8-52AEY..FAKNVFNFPQSIP------
Q81IH6_BACCR/396-440TMY..DPCDVFHFQQSIP------
Q6ZB64_ORYSJ/480-545TLI..DRSNVFSNAQSIP------
Q9EX55_STRCO/495-548ATW..DPRNVFSHRLGIR------
P93762_CHOCR/484-535WLW..DPNEIFTNKQSIP------
Q8KY45_STRCU/463-508RAY..DPEDFFRHAQSIG------
P71984_MYCTU/413-458NRL..DPDNVFRNNHNIR------
Q94KD7_ARATH/470-527GKI..DPTNFFRNEQSIP------
Q93S08_STRCO/490-543TQW..DPRNVFTHALGIE------
Q93ZA3_ARATH/477-530AKF..DPENFFRHEQSIP------
Q9KHK2_9ACTO/415-460AKY..DPTNLFRLNQNIP------
Q948L1_DAUCA/449-503SIV..DPLNFFNHKQSIP------
Q8GXL5_ARATH/76-133TAV..DPQNFFRGEQSIP------
Q9SA89_ARATH/469-526TAV..DPDNFFRNEQSIP------
Q87IH1_VIBPA/415-459KKF..DPNNLFRMNQNIK------
Q8Y3D0_RALSO/458-507RRY..DPNNIFHHAMSVR------
Q9FKV0_ARATH/479-537TKV..DPENFFRHEQSIP------
O64743_ARATH/475-528GEF..DPDNFFRHEQSVP------
Q8SA59_HELAN/476-534TKV..DPDNFFRNEQSIP------
Q9HGH9_ASPOZ/508-552AKY..DPNDLFYALTAVG------
Q84PV5_ORYSJ/467-535TAI..DPDNVFRNAQSIP------

PF09265

Q9FE45_9ASPA/238-524SRY--DPKAILSPGQKIF------
CKX8_ORYSJ/239-523ARF--DPLHVLGPGQGIF------
CKX7_ARATH/239-520AMF--DPMAILSPGQKIF------
CKX3_ORYSJ/232-512ARF--DPRCILGPGQGIF------
Q8H6F6_HORVU/238-510NTY--DPLAILAPGQKIF------
CKX4_ARATH/250-523IMF--DPKRLLSPGQDIF------
Q709Q4_MAIZE/241-516HRY--DPLAILAPGQRIF------
CKX5_ORYSJ/244-525AEF--DPRAMLATGQGIF------
CKX2_ORYSJ/256-560SKY--DPKAILSRGQGIF------
CKX7_ORYSJ/234-513AKY--DPHRILSPGQRIF------
CKX10_ORYSJ/246-530ARY--DPRAILSPGQGIF------
Q5WY14_LEGPL/211-449KQY--DPAGI.......F------
CKX1_ARATH/263-539QAY--DPLAILAPGQRIF------
CKX5_ARATH/242-520AEF--DPRHILATGQRIF------
CKX1_MAIZE/246-533NKY--DPKRLLSPGQDIF------
CKX11_ORYSJ/219-503ARY--DPLAILAPGQNIF------
CKX2_ARATH/227-501DLF--DPKKLLSPGQDIF------
CKX3_ARATH/244-517YKY--DPKMILSPGQNIF------

PF02913

D2HDH_ARATH/309-551KLL--DPKGILNPYKV--------
DLD_ARATH/319-560KTL--DPNDIMNPGKL--------
Q9RJ97_STRCO/274-525RSL--DPAGLLSPG.V--------
Q9RTM9_DEIRA/229-469RAL--DPANGLNPGKI--------
Q987T8_RHILO/164-381QEF--DPKNILNPGRM--------
DLD1_KLULA/320-566LAL--DPKRILNPDKI--------
ADAS_RAT/370-643DYV--DPSNIFGNRNL--------
P72842_SYNY3/220-430NQF--DPHNTFSPGRF--------
Q9A317_CAUCR/209-458GAL--DPQRIMNP.RV--------
Q987U0_RHILO/206-447CAF--DPNHLLNPGKV--------
Q9S2F6_STRCO/248-487EVF--DPLGILNPGKL--------
Q9HTK3_PSEAE/230-471AAF--DPAGLLNPGKN--------
O29450_ARCFU/211-460KLF--DPKNILNPGKV--------
O53525_MYCTU/223-473ATL--DPAGILNPGKL--------
Q9KSQ8_VIBCH/286-544AAF--DPHNKMNPGKI--------
O29393_ARCFU/221-445SVL--DRRNILNRG.V--------
Q97G30_CLOAB/221-465LAF--DSKNILNPGKV--------
Q9I6H4_PSEAE/216-461AVF--DPNGIMNPGKI--------
Q9K9B9_BACHD/216-457EAL--DPNHIMNPGKV--------
YN53_SCHPO/272-525NVF--DPNGIMLPYKY--------
Q986B0_RHILO/224-475AAF--DPAGIMNPGKV--------
O29853_ARCFU/209-439LLF--DPKNILNPGKV--------
DH4C_PSEPU/270-513RAV--DPNNILAPGRS--------
Q9F3A3_STRCO/294-548RLI--DPEGVLAPRVV--------
Q9PGF5_XYLFA/218-457AAF--DPDGILNPGKV--------
Q9HZI0_PSEAE/264-527GHF--DPAGRLNRG.T--------
ADAS_CAEEL/313-584SEL--DPANIFAS..A--------
Q11061_MYCTU/215-454QAL--DPQGILNPGSA--------
Q9D635_MOUSE/239-480NTL--DPRGLMNPGKV--------
ADAS_DROME/337-605RHL--DPKNIFA...L--------
O07406_MYCTU/211-446AAL--DPTGYLNAA.V--------
O05784_MYCTU/269-523SAL--DPAGILNPG.V--------
Q97B62_THEVO/212-457QVF--DPKNILNRGNI--------
O86004_SPHAR/248-488QAL--DPNSIFA..SV--------
Y2280_MYCTU/214-454QSF--DPAGILNPG.V--------
Q9YEU4_AERPE/215-469RVF--DPKGILNPGKV--------
Q9YFD3_AERPE/238-468NTL--DPGNVLNPNGI--------
Q55124_SYNY3/222-464QCF--NPDNLANPGKL--------
O86000_SPHAR/265-508DVL--DPNGILSPGKQ--------
Q9F2Y0_STRCO/247-482AVW--DPDDLLNPGML--------
Q9HMR2_HALSA/293-559AAF--DPDWILNPGPV--------
Q9RVK1_DEIRA/212-453ALF--DPQGLLNPGKI--------
Q9RDU1_PSESP/269-511AAL--DPNGIIAPGKS--------
Q986W2_RHILO/218-457TAL--DPKNILNPGRV--------
VAOX_PENSI/301-546NAV--DPNGIIAPGKS--------
Q9KKW5_VIBCH/271-520ALF--DPNRLLNPG.V--------
ADAS_TRYBB/307-576KAL--DPKNICNPGKL--------
O46096_DROME/289-531KLL--DPNSILNPYKV--------
ADAS_DICDI/317-586ETI--DPKDICNPRKL--------
Q98KG4_RHILO/325-565QAL--DPQNIMNPGKI--------
O67645_AQUAE/239-479KLF--DPKNLFNPGKV--------
Q9I3S8_PSEAE/214-458ELL--DPSGLFNPGKV--------
Q88EH0_PSEPK/279-533GAF--DPHNQLNPGKI--------
Q97U60_SULSO/203-443ATF--DPKRLLNPCKL--------
O06093_MYCLE/211-446AAL--DPTGYLNAA.V--------
Q9HKQ4_THEAC/212-457RIF--DPKNILNRGNI--------
Q9HV36_PSEAE/265-514RLL--DPRGILNPG.V--------
GLCD_BACSU/216-457AAF--DPRNILNPGKM--------
Q9CMN0_PASMU/284-542FLF--DPDNRLNPGKI--------
DLD2_YEAST/277-529VHY--DPNGILNPYKY--------
Q97Y18_SULSO/215-449RMI--DSNNIMNPGKV--------
YDIJ_ECOLI/281-539AAF--DPHNRLNPGKI--------

PF09330

DLD_ECOLI/278-567REN--DPTNSMNPGIGKTSKRKNW
LDHD_HAEIN/272-562KEL--DPTNSFNPGIGKTTRKKYW
Q1NHT9_9SPHN/271-556RSL--DPRNQCNPGLGQTTRQRYW
A5WED9_PSYWF/295-585QRL--DPTNSFNPGIGKMSKTKRN
Q1VBS3_VIBAL/273-563HEL--DPTNTFNPGIGKMDKYKRN
Q1YWQ9_PHOPR/273-563HKL--DPTNTFNPGIGKMSKYKRN
Q2BK95_9GAMM/272-562FDL--DPTNSFNPGIGKTQKTRCG
Q2VHK1_9LACT/268-556KKN--DPTNSFNPGVGKQTMSKYW
Q5F898_NEIG1/272-561RKL--DPTNSFNPGIGKTSKKKNW
Q5FRI2_GLUOX/282-571RSL--DPCNCFNPGIGLATKKRNW
Q5NQX4_ZYMMO/284-573HEL--DPTNSFNPGIGHTSKAAYW
Q66D31_YERPS/279-568QQI--DPTNSFNPGIGKTSKRKRW
Q6D2B5_ERWCT/284-573QKS--DPTNSLNPGIGKTTKLKNW
Q6FFS0_ACIAD/279-567QRL--DPTNRFNVGIGHTSKLKYW
Q6WB82_ALCFA/276-564REL--DPTNTFNPGIGHTSRRKWW
Q7N371_PHOLL/278-567RMS--DPTNTLNPGIGKTSKLKNW
Q7V9S2_PROMA/275-565REL--DPTNTFNSGIGKMSKRKNY
Q7VS08_BORPE/283-572RGL--DPCNQFNPGIGRTSKLQGW
Q8NRY8_CORGL/279-570KEL--DPTNTFNAGIGGTSPHKDW

PF04030

ALO_DEBHA/202-551ESM--DPDNVFLSGKDWAV.RN--
GGLO_RAT/180-438EKL--DPTGMFLN..SYLE.KV--
A5WEE3_PSYWF/185-441QIY--DPDNVFMN..RWLEQKF--
A7GLB1_BACCN/179-430QLL--DETGLFLN..PYIE.KI--
A9VEW0_BACWK/179-430KSL--DETGIFLS..PYTE.KL--
Q8EQI8_OCEIH/179-431QQL--DPERMFVN..RYLD.EL--
Q47NJ0_THEFY/176-430ERV--DPHRRFTN..AYLD.RV--
Q82KJ4_STRAW/182-436DRL--DPERRFGN..DYLR.RV--
Q2JG59_FRASC/206-462DAA--DPTGVFAN..AYLD.RV--
Q4JW76_CORJK/189-446AKV--DPQGMMRN..AMID.RV--
O06804_MYCTU/172-425DRL--DPDRVFLN..DYTR.RV--
Q5YR83_NOCFA/174-426KRF--DPEGLFAN..EYLT.RV--
Q390J8_BURS3/172-425ERM--DPLGRFLT..PYLR.TL--
Q92X65_RHIME/187-406QEM--DPGGRFLT..RYLR.GL--
Q9HTM8_PSEAE/186-438QAL--DPRGRFLN..AHLS.SI--
Q983S0_RHILO/175-424RDI--DPQNRFVS..PYMA.GL--
Q4DPS1_TRYCC/258-491KKL--DPGDLFVN..DWWK.SL--
Q57ZU1_TRYB2/262-506KKM--DPEGVFLN..GWFN.SL--
Q4QE54_LEIMA/258-489RRM--DPDDIFVN..GWFR.NL--
Q4PIL2_USTMA/445-677QRY--DPQEVFVN..PYVA.RH--
Q5K700_CRYNJ/204-464RRV--DPSGVLLS..ENVR.RH--
Q2H4W5_CHAGB/168-472DKA--DPEGMFVG..PWHR.RY--
ALO_NEUCR/210-513ESV--DPEGMFVG..PWHR.RY--
Q2UQI3_ASPOR/199-482QEV--DPDGMFLG..EWHR.RN--
ALO_CANAL/202-552KET--DPDGVFLSGKVWAE.RN--
ALO_CANGA/188-518REQ--DPDNIFLANKQWAL.IN--
ALO_YEAST/186-516KEQ--DPDNVFLANKQWAI.IN--
ALO_ASHGO/192-522REQ--DPHNVFIANKDWAV.KN--
ALO_KLULA/190-520SQQ--DPNNVFMANKEWAI.RN--
ALO_YARLI/189-523EKY--DPTGVFLSGKVWMD.RN--
ALO_SCHPO/187-459KLL--DPKGVFWN..DYLQ.RH--
GGLO_SCYTO/180-438EEL--DPSGMFLN..NYLE.KT--
Q5U4Z7_XENLA/180-438EKL--DPTGMFLN..AYLE.KV--
Q22YW5_TETTS/180-449KQY--DPSGKFEN..EYLK.NL--

PF09129

Q2T0X3_BURTA/323-645ERY--DPRRVFSS--PLLD-RLMG
Q7SID9_BREST/223-561NQI--DPHRVFTN--GFMD-KLLP
Q9HWP1_PSEAE/277-597NEA--DPHRLFSS--PLLD-RLMP

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window