Sequence alignment for CL0278

PF06094

Q4WA95_ASPFU/67-168--YFFY...GTLTDP.LMIA-----EILELNEEP.KLRPAHIIGYECKMW..----------------------------
O49580_ARATH/12-109--LFVY...GSLQEP.EVVY-----VLL..........NRVPDHVSAVLS..----------------------------
Q2JLB7_SYNJB/6-110--YFAY...GSNLDA.QQMG-----HRTVDFKEARRARLQGYRLTFNKRG..----------------------------
Q5LS50_SILPO/14-116--LFFY...GTLRHA.PLLE-----VVLGTT.......DPRPEITAASLP..----------------------------
Q9RXI5_DEIRA/41-150--VFVY...GTLLPG.ERNA-----HIAAQ........GGEFTVRPATLR..----------------------------
A2LDA_DANRE/4-115--VFVY...GTLKKG.QPNY-----FRLIDSS....NGQAEFITCARTVE..----------------------------
Q383C9_TRYB2/67-211--VFVY...GTLQRG.ENNY-----PWWLANP.....RHAAFITVAITRRRY----------------------------
Q8XNC6_CLOPE/3-99--YFAY...GSNLCL.EQMK-----KRCPEAIPMISVHLDDYKLVYNK....----------------------------
Q9HEJ2_NEUCS/18-141--AFFYARKGTLMVP.EVFF-----TVCYNLKIVPDVVARQHVFTPAILH..----------------------------
Q2H7M0_CHAGB/69-178--YFFY...GTLTKP.HILQ-----GVLGLDSAPTPLHPAQIHHHELTAW..----------------------------
Q87SW3_VIBPA/5-97--IFVY...GTLRKG.EYNH-----HYLS.........SAQFLGLHETDA..----------------------------
Q8KR42_ESCFE/4-106--LFVY...GTLRPG.HANA-----HILENI.......GGEWHAGFVTGT..----------------------------
Q3A851_PELCD/5-112--LFVY...GTLQQH.GGAH-----ELLAG........QASLLGPARLQG..----------------------------
YKQA_BACSU/5-100--LFVY...GTLRKH.EKNH-----HLLAQSACINEQARTKGSLFAAKEG..----------------------------
Q2H7F6_CHAGB/70-187--VFLY...GTLMMP.EVFY-----KTIYGTTDPPEATRKLHPFQPAMLD..----------------------------
Q4MP50_BACCE/4-106--VFVY...GTLRKK.QTNA-----HYMQ.........GAICIADKAWTN..----------------------------
Q2W041_MAGSA/18-119--MFFF...GTLMDE.DVLT-----TVLGHP.......VTPQALEPARLS..----------------------------
Q2JFJ8_FRASC/12-111--LFVY...GTLLFP.EVVR-----ALI..........GRVPEVGPATVT..----------------------------
Q8XKH2_CLOPE/10-118--IFVY...GSLRTG.FFNY-----.............EKYLKGKVIKSELG----------------------------
Q2TWK7_ASPOR/158-259--YFFY...GTLTDP.ETLA-----RKICLPVLP.VLQQATVKGGKMKMW..----------------------------
Q8ZZP7_PYRAE/4-98--LFVY...GTLKSG.CGNH-----RYLK.........NAQFLGEAEVEG..----------------------------
Q3M3A4_ANAVT/3-110--VFVY...GTLKPG.EVNY-----QRYC.........AGKVVSAEKATT..----------------------------
Q6MR31_BDEBA/67-174--FFVY...GSFCEG.MVHF-----SKIQNFVESSVFARVKATAYRLKVG..----------------------------
Q604S5_METCA/32-130--LFAY...GTLQLP.EVMA-----AVT..........GRTFAAVPAWLF..----------------------------
A5D070_PELTS/19-124--YFAY...GSNLNI.EQMK-----ARCPGSKPVAVAVVPNYRLTFKGSH..----------------------------
Q2HBF9_CHAGB/25-142--AFFY...GTLMAA.DVFH-----TVCYGTKDVPEEISNLHTSHPAVLH..----------------------------
Q5KZG5_GEOKA/8-107--VFVY...GTLLTG.EENH-----EVVAPYVR..AVCSGKVNGRLYNV...----------------------------
Q2VYS1_MAGSA/26-133--VFAY...GSLMWNPEFRH-----EEARTARLSGYHRALCILSHQWRGT..----------------------------
Q55181_SYNY3/15-121--VFVY...GTLMPG.ECNH-----QAYC.........HRQIEPPTLGYV..----------------------------
Q5WWC1_LEGPL/9-115--LFSY...GTLRYE.KVQI-----ANFGRKMQGQEDVLQGFKLTTIEIK..----------------------------
Q8H9V7_9CAUD/3-106--VFVY...GTLMHG.FGNH-----CLLE.........GARFVGHATSQE..----------------------------
Q1ZWH9_PHOAS/5-108--LFVY...GTLAPE.QSNA-----YVLSDL.......KGSWRKASAIGF..----------------------------
Q4D422_TRYCC/14-158--LFVY...GTLQRG.ENNY-----AWWMADP.....KHATFVATARTVKRY----------------------------
Q9MBH1_ARATH/11-110--VFVY...GSILEP.AVAA-----VIL..........DRTADTVPAVLH..----------------------------
Q6FE92_ACIAD/4-107--LFAY...GTLRPD.QPNA-----HILAKL.......NGEWQTGYVHGV..----------------------------
Q2JV02_SYNJA/2-94--VFVY...GSLLRG.GQYH-----SLLQ.........GAEFLGPDSLNH..----------------------------
Q4J6G9_SULAC/12-113--IFVY...GSLRFGFELNH-----FLK..........NSRFVGLGLVEG..----------------------------
Q5WBE2_BACSK/9-110--LFVY...GTLRKG.GTND-----HYLQ.........QSELVEDTCWII..----------------------------
Q65ZK1_CAEEL/7-113--VFVY...GTLKTG.EPNY-----KVLSETD.....GEYRFISSGTTVE..----------------------------
Q28QV3_JANSC/4-101--IFLF...GTLCHQ.PLLD-----LVA..........GMSVRMEPAHLP..----------------------------
Q72G69_THET2/4-107--VFVY...GTLKRG.ERNH-----GLVAPYL....HRVLPGFVEGFRLY..----------------------------
B9LD46_CHLSY/4-116--FFVY...GTLKRG.QSNY-----ARL..........LAGYTLREVRAW..----------------------------
Q9MBH2_ARATH/12-111--VFVY...GSFQEP.SVVN-----LIL..........ECSPVMVPAQLH..----------------------------
Q4H4F0_BACCI/21-123--LFVY...GTLREG.ENNH-----KYMK.........EATLLSRKASIA..----------------------------
Q3AE37_CARHZ/3-104--VFVY...GTLMQN.HRAN-----FLLS.........RQKYIGPGEIYG..----------------------------
Q82BN4_STRAW/15-124--FFVY...GTLRPG.EHNH-----DLFLR........GRTESEEPARLR..----------------------------
Q2NW46_SODGM/3-94--IIVY...GSLRRK.QGNS-----HWMT.........NAQWLGDYTIP...----------------------------
Q84T74_ORYSJ/28-136--VFTY...GTLKRG.FSNH-----GLLQDLAR...DGDASFVGAATTAP..----------------------------
A3DFK6_CLOTH/18-122--VFVY...GTLMKD.FCNY-----KRY..........LEGRISRITPGK..----------------------------
Q39NJ7_BURS3/12-118--LFSY...GTLQLE.PVQL-----ATFGRKLDGREDAMPGYAMTMLKID..----------------------------
Q9HWL7_PSEAE/4-107--LFVY...GSLGPG.RPNE-----HLMQKI.......GGQWQAASLRGR..----------------------------
Q9FIQ3_ARATH/9-123--IFVY...GTLKRN.HRNH-----FLLEDLIS...TNDAVYIGQRTTR...----------------------------
Q1N025_9GAMM/5-106--LFIY...GTLAPG.KENH-----HQLKGI.......DGQWQSAKVKGE..----------------------------
Y434_METJA/122-222--VFAY...GELMKK.ERLL-----ELINRVPKMIEGRVYGYEKFFDETI..----------------------------
Q236U4_TETTS/9-115--FFVF...GTLKPG.FTQF-----SW...........NLQIHNDHFKLACH----------------------------
A5FA74_FLAJ1/4-105--LFSY...GTLRSK.QIQM-----QIFNKVLSGTPDQILGFKLKSLQIE..----------------------------
Q1NFJ0_9SPHN/6-113--LFVY...GTLRSD...HA-----GPVADRL....RREGRLIGPATTAG..----------------------------
Q5Z825_ORYSJ/23-122--VFVY...GSLMQD.EVVR-----TII..........KRVPPSSPALLP..----------------------------
Q2RAS4_ORYSJ/25-134--VFVY...GTLKRG.FPNH-----PLLAAS.......GSPLVGAASTAT..----------------------------
A2LD1_MOUSE/4-118--IFVY...GTLKRG.QPNH-----KVMLDHS....HGLAAFRGRGCTVE..----------------------------
Q5YT56_NOCFA/18-111--LFAY...GTLRFA.PVLD-----RLL..........GRCPATTPVTLP..----------------------------
Q7QE28_ANOGA/8-116--VFVY...GTLKRG.EPNH-----HWLTDAA....NGQARFIAKGRTVG..----------------------------
Q2UEF9_ASPOR/49-153--CFFY...GTLMDP.NTLC-----KVLGSSKPPPIMRPARIIGYEIKLW..----------------------------
Q8XZP0_RALSO/7-114--VFAY...GTLRAG.EAND-----LRVAASRR..GIAEPKLIGHATLHG..----------------------------
Q2CFF4_9RHOB/3-102--LFVY...GTLRHK.PLLA-----TLLGRD.......PDTLDLTPARLP..----------------------------
A5ER73_BRASB/6-115--LFVY...GTLMRGFDHPM-----ARLLAA.......NADFVGEASCRG..----------------------------
Q20ZZ6_RHOPB/4-103--VFAY...GTLKRG.LKNH-----HLMA.........RARFLGLAASVP..----------------------------
Y1514_METJA/4-103--VFVY...GSLRKGFWNHE-----PYLK.........NSKFIGKGKTKE..----------------------------
Q8DJS9_THEEB/12-121--LFVY...GTLKPG.YPPH-----DRFC.........RPWLSAHQAALV..----------------------------
A4XHE3_CALS8/3-100--LFVY...GSLLSH.NSHN-----YLLK.........GCKFIGKAILEG..----------------------------
Q2UB51_ASPOR/36-154--RFVY...GVLMLP.TVLK-----YFIGEDP....ATDITKRMTRACIS..----------------------------
Q310I6_DESDG/23-158--LFVY...GTLKRG.YWNH-----QRFC.........AQARSTEPAVVW..----------------------------
Q8PXB2_METMA/34-136--MALY...GSLRDG.LYNS-----RRLNLP.......NRSDFLGITRIK..----------------------------
Q8R9J5_THETN/4-110--LFVY...GTLMRGFENYN-----KYLKD........KVKEIKKGYTYG..----------------------------
Q1Z4M5_PHOPR/5-100--VLVY...GTLRAG.QSNH-----HWLK.........TADFLGACKLDS..----------------------------
A8LC77_FRASN/9-104--LFVY...GTLRFD.VVVD-----ALL..........GRVPTITPAAVG..----------------------------
Q3J7N1_NITOC/11-114--YFAY...GSNMAV.ERLR-----ARVPSARRIVTARLMGYALRFHKKG..----------------------------
Q72AR6_DESVH/8-149--VFVY...GTLKRG.GRHH-----AAHC.........ADALRVRTGCTR..----------------------------
A5WAV3_PSEP1/11-117--LFSY...GTLQDK.AVQL-----ANFGRELNGQADRMPGYRMDWVEIT..----------------------------
Q1QVN8_CHRSD/14-112--VAVY...GTLKRG.LHNH-----HWLQ.........DAEYLGRDTL.T..----------------------------
Q2G9Q2_NOVAD/6-118--FFFY...GTLTQD.HDTV-----MNRQILPFLQGGRPGFVRGRLLALR..----------------------------
YS11_DROME/11-118--VFVY...GTLKRG.EPNH-----HWLTKKE....NGQARFLGRGKTET..----------------------------
Q62J87_BURMA/13-120--VFCY...GTLRAG.EIND-----IGRAAATH..GIAAPRLVGAVAVAG..----------------------------
Q2A3D2_FRATH/4-110--LFSY...GTLQQE.EVQL-----SVFGRKLVGQKDSLKGYIVSEVEIL..----------------------------
Q8U329_PYRFU/10-99--IAVY...GTLRKG.KPLH-----WYLKEAKFLGEDWIKGYQLYFEFLP..----------------------------
Q2SNX2_HAHCH/20-118--LFCY...GTLRHP.HVMQ-----RLL..........GWTPEASAARLP..----------------------------
Q21ER9_SACD2/5-107--IFTY...GSLMFA.PVWR-----GIVDGKYRHLSAAATGIKRVKIVGQ..----------------------------
TINA1_DROME/14-122--LFVY...GALKYG.QPSN-----SILASSG....NGFAKFWCKATTTQ..----------------------------
Q2H7L9_CHAGB/70-175--YFFY...GTLTSP.HILK-----EVLGLKADP.VLRSAKIVGYGLTNW..----------------------------
Q1LNL0_RALME/4-111--VFVY...GTLRAG.EVND-----LNRAATRH..GIEAPTLVGTGTIAG..----------------------------

PF13772

B3KMN7_HUMAN/17-99---SEL---NWLGQMWLKFG-----CSGFRQEGVK...SGMYVVIEVKV.------------------------------
B5FXG3_TAEGU/70-152---EVW---GIVWKMNTCNL-----SSLDKQEGVE...DGIYVPIEVNV.------------------------------
B4PJ24_DROYA/44-142---HVY---GAIWEIDMCNL-----KDLDDQESVP...DGVYIPISVPV.------------------------------
B4L056_DROMO/63-165---DVF---GAIWEIDMCNL-----KDLDSQEGVS...DGLYIPINVPV.------------------------------
Q17PV6_AEDAE/68-162---RVW---GAIWQINIENL-----PDLDKQEGVH...NQVYKPLTLPI.------------------------------
B4K1W6_DROGR/63-161---QVF---GAIWEIDMCNL-----KDLDNQEGVS...DGIYIPISVPV.------------------------------
B3M8A6_DROAN/49-147---HVY---GAIWEIDMSNL-----KDLDDQESVS...DRDYIPISISV.------------------------------
B4GZW8_DROPE/49-148---HVY---GAIWEIDMCNL-----KDLDDQESVP...DGVYIPISVPV.------------------------------
B4N450_DROWI/103-203---SLW---GTLWDIDLGNL-----ADIDNQEGVH...LGLYVPVTVQV.------------------------------
D3TRN9_GLOMM/100-196---TVL---GTLWEIDLINL-----SNLDKQEGVA...QEIYRPLSLSI.------------------------------
B3M8A5_DROAN/108-205---SLW---GTLWEIDLSNL-----PDIDNQEGVH...LGIYEPRTVYV.------------------------------
C4WSY7_ACYPI/69-159---HVW---GVLWQLNTSDL-----SNLDKQEGVE...KKIYVPFEANI.------------------------------
Q5DCE9_SCHJA/59-142---YVL---GTVWKMCISDL-----HTLDLQESAP...V.LYSPVEIPV.------------------------------
A8XCM1_CAEBR/77-156---EVW---GCVWKMPNEYS-----ESLDEQEK.......GYHRLMVPV.------------------------------
B1XJ34_SYNP2/53-137---HVE---GVLYHLPWRVS-----EKLDLREEVP...TNGYRQTQVTV.------------------------------
Q7NPN7_GLOVI/75-159---EVE---GVLYRLPWHLG-----GLLDGREGVA...QGDYRHEFVEV.------------------------------
D0L8N2_GORB4/62-143---RVF---VVLYDVPMEDA-----DNLDRWEGSE...LGIHRKVRARV.------------------------------
Q9YW48_MSEPV/61-148---IVF---GILYNFNNSIM-----NKINKQEFVH...KNLYSLAKVNV.------------------------------
Q5Z180_NOCFA/73-158---RVF---VVLYDVSPEDE-----QRLDRWEGSD...FGIHKKIRLRV.------------------------------
A0PRM1_MYCUA/59-145---KVF---VVLYDMTPADE-----KNLDHWEGSE...FGIHQKIRCRVE------------------------------
Q6MNB0_BDEBA/85-169---SVF---GRLFEIPEKEW-----PIIQHKEGVV...TGMSVETTLRV.------------------------------
B9KUL9_RHOSK/61-147---RVQ---GVLYRLSRREA-----DQFDAARGVKLNGTGTHFHFPVEV.------------------------------
B9JT38_AGRVS/65-148---HIF---GTLNLMPQAGF-----DILDIYENVE...TQQYEQLEVDV.------------------------------
C0AC99_9BACT/83-169---DVW---GVLYQLSFQDG-----EVLDVWQDARQDGGGAYFHYPTEV.------------------------------
A6EXE0_9ALTE/62-151---RVL---GVLHECPDEAL-----SLLDQAEAYG...HG.YNRIEIEVE------------------------------
A5XY08_BURML/54-137---RVE---GTLNAMSARAL-----DALDSIELVP...L.HYRRAGVLV.------------------------------

PF04752

CHAC1_MOUSE/34-209LWIFGY---GSLVWKPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDRE....................
Q9VCI9_DROME/57-235CWVFGY---GSLCWHPGFNYTKCITGYIRGYVRRFWQGNVTHRGCEEKPGRVATLVEDKE....................
CHAC2_MOUSE/1-174MWVFGY---GSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPG....................
Q9A674_CAUCR/10-179RWVFGY---GSLMWRPGFPFIDRRTAVLHGRRRAFCIYSVHHRGTYERPGLVLGLAPG......................
Q9LPF2_ARATH/1-161MWVFGY---GSLIWKTGFPFDESLPGFIKGYRRVFHQGSTDHRGTPDFPGRTVTLEAAHE....................
CHAC_YEAST/8-231IWVLGY---GSLIYKPPSHYTHRIPAIIHGFARRFWQSSTDHRGTPANPGRVATLIPYEDIIRQTAFLKNVNLYSESAPI
O49579_ARATH/3-204MWVFGY---GSLVWNPGFHYDEKVLGFIKGYKRVFDLACIDHRGTPEHPARTCTLEKAEE....................
Q98G14_RHILO/15-184FWVFGY---GSLIWRPGFAHVETRRAHLHGYRRSLCVYSFVHRGTRERPGLVLGLDHG......................
CHAC_SCHPO/10-198LWVFGY---GSLIWHPPPHYDYSIPCFIKGYVRRFWMRSEDHRGTVNSPGLVLTLIPYEEWKQFSD............WS
Q98IT6_RHILO/66-235LKLFAY---GSLLWKPAGEVRGGERAVARGWHRSFCFTVQRFRGTLEQPGLMMALDRG......................
O81489_ARATH/3-162LWVFGY---GSLIWNPGFDFDEKLIGYIKDYKRVFDLACIDHRGTPEHPARTCTLEQSTG....................
Q9GZE8_CAEEL/50-228LWIFGY---GSLIWNPGFTFSTSRKAYAIGWARRMYQGNTYHRGDEKLPGRVATLIEETN....................
CHAC_ECOLI/47-216VWIFGY---GSLMWNPALEFTESCTGTLVGWHRAFCLRLTAGRGTAHQPGRMLALKEG......................
Q9VYK7_DROME/74-251VWIFGY---GSLVWKTDFPYIDRRRGFVWGFKRRFYQHSIDHRGIPERPGRVVTLLP...GD..................
Q98K42_RHILO/55-225LWVFAY---GSLIWKPEFESVEQRLATAFGWHRSFCLDMVRWRGSAAQPGLMMALER.......................

PF06094

Q4WA95_ASPFU/67-168-----...........G-QYPALLD...........CPDS................................VVEGA.AY
O49580_ARATH/12-109-----....GLFRLKGR-VYPTILP...........DGTG................................KVNGKVLK
Q2JLB7_SYNJB/6-110-----........NDGT-GKANIVR...........DPSG................................VVWGV.AY
Q5LS50_SILPO/14-116-----..DHAVFSIQGQ-PFPMIQT...........APGA................................RAEGLLVR
Q9RXI5_DEIRA/41-150-----..GFRLFDLRPE-SYPGIVP...........GAADD...............................LIHGA.LL
A2LDA_DANRE/4-115-----..PYPLVITGEC-NIPFLLN...........VPGSG..............................QRVYGE.IY
Q383C9_TRYB2/67-211-----PLFVNLLPGSSS-CSPCLLNLPEEGEEDFPEGSFAGVDSDG.....................RVTAHHVVGE.LF
Q8XNC6_CLOPE/3-99-----............-.YADIIP...........CEGE................................KVYGA.IY
Q9HEJ2_NEUCS/18-141-----..GYCRRRVKSA-DYPGITE...........DAGH................................SVFGMLAE
Q2H7M0_CHAGB/69-178-----...........G-NYRMLID...........SSNPE..............................AVVDGY.AY
Q87SW3_VIBPA/5-97-----....QFSLYDVG-SYPALSE...........GQR.................................SIQGE.VY
Q8KR42_ESCFE/4-106-----..FYERGWGAAA-DFPGIVL...........HPDGP...............................RVEGF.LF
Q3A851_PELCD/5-112-----......RLYQVG-HYPGAVL...........STCPE..............................DRVRGE.LF
YKQA_BACSU/5-100-----............-..PTVVF...........NDEDE..............................GYIYGE.VY
Q2H7F6_CHAGB/70-187-----..GYQRFRVMDV-VYPGIIP...........TKGR................................KVYGTLVS
Q4MP50_BACCE/4-106-----....GKLFDTNE-GYPAMTY...........SSEE................................KVYGE.VY
Q2W041_MAGSA/18-119-----..GWRRLTIAGR-TYPMLVP...........HATG................................TVDGLLAH
Q2JFJ8_FRASC/12-111-----..GWRAARLRGR-LYPGLVP...........TAEADGP...........................DRATAGLVLL
Q8XKH2_CLOPE/10-118-----RVKGTLYHMPKK-GYPALIE...........GDG.................................FVYGE.VM
Q2TWK7_ASPOR/158-259-----..........GG-KYKALID...........GPSSS...............................VVNGW.AY
Q8ZZP7_PYRAE/4-98-----......YTLIGV-IIPYAVE...........APGC................................KVKGE.LY
Q3M3A4_ANAVT/3-110-----...LGQLFALPM-GYPAMTT...........GES.................................TVHGYLLS
Q6MR31_BDEBA/67-174-----............-.FPAVVK...........GGSD................................LVPGQ.LI
Q604S5_METCA/32-130-----..DHARYRLRHR-IYPGLRR...........ETGA................................VTAGTLFL
A5D070_PELTS/19-124-----........RRGY-GVADIEQ...........AKTGG..............................YQVFGA.LY
Q2HBF9_CHAGB/25-142-----..GFCRRRVKYA-DYPGIIE...........DKDH................................NVVGTFVT
Q5KZG5_GEOKA/8-107-----...........G-PYPALVL...........GEEG................................EVEGE.WL
Q2VYS1_MAGSA/26-133-----...........P-ERPGLVM...........GLDRG..............................GSCRGR.AF
Q55181_SYNY3/15-121-----..LGQIYHLQYF-GYPALAI...........GED.................................RVWGY.CL
Q5WWC1_LEGPL/9-115-----..NSAVVATSGD-NFHPIIS...........YTGNPS.............................DKVPGI.VF
Q8H9V7_9CAUD/3-106-----....RGRMYSCG-GFPILSF...........KHRED...............................LVTGE.VW
Q1ZWH9_PHOAS/5-108-----..IYPNGKGATL-GYPAFVP...........QSEGE...............................RVQGL.LF
Q4D422_TRYCC/14-158-----PLFVKLLPGSDG-CSPCLLNQPAAGDVGDVSNCNERNNDAG.....................GVTPQFVVGE.LF
Q9MBH1_ARATH/11-110-----..GYHRYKLKGL-PYPCIVS...........SDSG................................KVNGKVIT
Q6FE92_ACIAD/4-107-----..IHTLDWGPDQ-GLPAIVL...........DSSAP...............................QVEGL.VF
Q2JV02_SYNJA/2-94-----.....IDLYDLG-PYPMAVP...........GRN.................................RLYGE.RY
Q4J6G9_SULAC/12-113-----.....YKMYDLG-SYPGVVR...........GDS.................................VVHGE.VY
Q5WBE2_BACSK/9-110-----....GEMHNTPF-GYPIVRF...........RGQE................................KIRGE.LY
Q65ZK1_CAEEL/7-113-----..KFPLVVGTKY-NIPFLLD...........DAGNG..............................NNIEGE.MY
Q28QV3_JANSC/4-101-----..GYRAAWVKDA-SWPMLEV...........CADQ................................HAQGA.LI
Q72G69_THET2/4-107-----..HLPRGPHRPY-AYPGMVP...........GEG.................................RVFGE.VL
B9LD46_CHLSY/4-116-----..LPAAAIYTAG-PYPFLVQ...........AADLVPA...........................GAIVFGE.LI
Q9MBH2_ARATH/12-111-----..GYHVYRLKGR-LHACISP...........SENG................................LINGKILT
Q4H4F0_BACCI/21-123-----....GSLVDTGN-GYPGLLL...........ENQ.................................LVAGE.WY
Q3AE37_CARHZ/3-104-----....FSLYKVSN-WYPGVVP...........REGD................................RVKGE.IY
Q82BN4_STRAW/15-124-----....DAVLYEGP-GYPYAVE...........EPGAG...............................PVCGELVT
Q2NW46_SODGM/3-94-----....GYELYDLG-HYQAVVS...........GNG.................................AVYGE.VY
Q84T74_ORYSJ/28-136-----...RLPLVCGPY-RVPFLLN...........LPGAG..............................HRVSGE.LY
A3DFK6_CLOTH/18-122-----..TYGLLYHLPE-GYPGLLP...........GSG.................................IIEGEIVE
Q39NJ7_BURS3/12-118-----..DPEVVATSGK-THHPVVA...........YTGQSG.............................DRVTGT.VF
Q9HWL7_PSEAE/4-107-----..LLEKGWGAGM-GFPGLAI...........DADGE...............................EIHGH.VF
Q9FIQ3_ARATH/9-123-----..LQYPLVTGLY-GIPYLIN...........KSGSG..............................QKIRGE.LY
Q1N025_9GAMM/5-106-----.......KRMHD-PYPNCVG...........VDIRKT............................RRWVDGL.LF
Y434_METJA/122-222-----............-GYYGARK...........KEGS................................YIDGIILL
Q236U4_TETTS/9-115-----KAYLRDYELYQC-KYPTIIQ...........EAGK................................YVEGY.II
A5FA74_FLAJ1/4-105-----......EEFGMA-DYVVAVP...........SENLE..............................DIIHGV.VF
Q1NFJ0_9SPHN/6-113-----.....VLYRISD-YYPGLVP...........GGNA................................KVVGD.LY
Q5Z825_ORYSJ/23-122-----..NYHRFNIKGR-IYPAILP...........VQSK................................KVAGKVIT
Q2RAS4_ORYSJ/25-134-----...PASLVVGPY-SVPFLLP...........RPSSSSG...........................SHLVSGE.LY
A2LD1_MOUSE/4-118-----..SFPLVIAGEH-NIPWLLY...........LPGKG..............................HCVTGE.IY
Q5YT56_NOCFA/18-111-----..GWRAARLPGR-VYPGLVR...........APGG................................CAPGVLLT
Q7QE28_ANOGA/8-116-----..RYPLVVATRH-NVPFLLD...........VRGTG..............................HSVVGE.IY
Q2UEF9_ASPOR/49-153-----...........G-PYPALLD...........KPLH................................PVDGM.VC
Q8XZP0_RALSO/7-114-----......RLYDFG-AYPGLVP...........DPTGT...............................AVRGD.VY
Q2CFF4_9RHOB/3-102-----..GWRARAVAGH-DFPVLVP...........GEG.................................AAEGL.LF
A5ER73_BRASB/6-115-----......RLYRIQ-HYPGLVL...........SDDAA..............................DLVHGE.LF
Q20ZZ6_RHOPB/4-103-----.....HYRMIAG-DYPVLFE...........QGAGL..............................LPVSGE.LF
Y1514_METJA/4-103-----.....KYAMYVN-IIPYVVE...........NEKIS...............................HIVGE.VY
Q8DJS9_THEEB/12-121-----...RGRLYHLPM-GYPGLTP...........EEG.................................WVQGELLL
A4XHE3_CALS8/3-100-----.....FGLYKVS-WYPAIVP...........KENS................................KVLGE.VY
Q2UB51_ASPOR/36-154-----..GYMLYQISPK-SPPVVVE...........TSNPH..............................DTVHGMLVL
Q310I6_DESDG/23-158-----....GRLYHLHA-GFPALEV...........PEGLILARGTDDPLADASRQQEIGTPRFDRPTGDWDLIHGE.LV
Q8PXB2_METMA/34-136-----..GYALYSL..G-PYPAVYS...........AENG................................SVVAE.VR
Q8R9J5_THETN/4-110-----....NLYHLIRE-SCPALIE...........GKE.................................KIWGE.II
Q1Z4M5_PHOPR/5-100-----....GYALYDLG-LYPALLE...........NHDCT..............................LPLYGE.VY
A8LC77_FRASN/9-104-----..GWRAAALPGR-SYPGLVP...........ARPGD...............................VCAGRCLS
Q3J7N1_NITOC/11-114-----........MDGS-GKCDVVS...........TGNPA..............................DCVHGI.VF
Q72AR6_DESVH/8-149-----....GRLVDLPA-GYPTLHVPGSSVLAIGTSDLAADAWRGMHCTLPGTP.....TSEDFIAPALPCALVRGE.VI
A5WAV3_PSEP1/11-117-----..DPDVLATSGK-THHPIVS...........PSSQAN.............................DSVAGM.VF
Q1QVN8_CHRSD/14-112-----....HITLYDLG-HCPGAKQ...........EPSR................................GIEVE.VY
Q2G9Q2_NOVAD/6-118-----........APGG-WYPLLEE...........GAG.................................RVWGR.LY
YS11_DROME/11-118-----..KFPLVVGTRY-NIPFLLA...........RPGEG..............................NHIEGE.VY
Q62J87_BURMA/13-120-----......RLYDFG-NYPGMVA...........GGGRD...............................LVWGD.VY
Q2A3D2_FRATH/4-110-----..DQRVIKVSGK-KYHPILK...........KTENIL.............................DEVHGT.VF
Q8U329_PYRFU/10-99-----............-...YAVK...........GEG.................................KLKVE.VY
Q2SNX2_HAHCH/20-118-----..GYRCLQVVGK-AYPGLWR...........DRNA................................DCTGYLYH
Q21ER9_SACD2/5-107-----........SASE-SYPVAFR...........HPSAP...............................WLTGQLYL
TINA1_DROME/14-122-----..KLPLVIATRY-NIPFLLN...........KPGVG..............................YYVTGE.IY
Q2H7L9_CHAGB/70-175-----...........G-QYKALID...........KPGA................................VVTGY.AY
Q1LNL0_RALME/4-111-----......RLYDFG-TYPGLVL...........DAAAG...............................PVAGD.IY

PF13772

B3KMN7_HUMAN/17-99-----....AT...QEG.KE.ITCR-----------------------------------------------------SY
B5FXG3_TAEGU/70-152-----....HT...QTG.KV.LTCR-----------------------------------------------------SY
B4PJ24_DROYA/44-142-----....HL..LNTD.TS.ITCR-----------------------------------------------------AY
B4L056_DROMO/63-165-----....QS..LNTN.SE.IICR-----------------------------------------------------AY
Q17PV6_AEDAE/68-162-----....RT...SSG.EV.LQCR-----------------------------------------------------IY
B4K1W6_DROGR/63-161-----....HS..LTTK.DE.VICR-----------------------------------------------------AY
B3M8A6_DROAN/49-147-----....FS..LASN.SN.LTCR-----------------------------------------------------AY
B4GZW8_DROPE/49-148-----....LS..LTSN.TD.IICR-----------------------------------------------------AY
B4N450_DROWI/103-203-----....QLIGQEDK.TNLTAAR-----------------------------------------------------AY
D3TRN9_GLOMM/100-196-----....AH...PPN.RT.TVAR-----------------------------------------------------VY
B3M8A5_DROAN/108-205-----....KR...QNASES.TPAR-----------------------------------------------------AY
C4WSY7_ACYPI/69-159-----....VT...PNG.DN.VLSR-----------------------------------------------------CY
Q5DCE9_SCHJA/59-142-----....TLV.SENL.SM.INCR-----------------------------------------------------TY
A8XCM1_CAEBR/77-156-----....HT...PHG..V.ILCR-----------------------------------------------------TY
B1XJ34_SYNP2/53-137-----....EC...QGQ.RF.PSVR-----------------------------------------------------TY
Q7NPN7_GLOVI/75-159-----....SC...RGR.VH.REVR-----------------------------------------------------TY
D0L8N2_GORB4/62-143-----....DT...ADG..P.VLAW-----------------------------------------------------LY
Q9YW48_MSEPV/61-148-----...LDL...LSN.KI.ISTQ-----------------------------------------------------AY
Q5Z180_NOCFA/73-158-----....TPN.PGSG.TEPRLAW-----------------------------------------------------LY
A0PRM1_MYCUA/59-145-----R.LSSD...TTT.DP.VLAW-----------------------------------------------------LY
Q6MNB0_BDEBA/85-169-----....SV....DG.QE.FEAT-----------------------------------------------------AF
B9KUL9_RHOSK/61-147-----....RT...EDG.TS.VPAL-----------------------------------------------------IL
B9JT38_AGRVS/65-148-----....VD..MSTH.TT.VKAI-----------------------------------------------------TY
C0AC99_9BACT/83-169-----....ID...KDG.RG.HLVL-----------------------------------------------------LY
A6EXE0_9ALTE/62-151-----PDNPSA...AMA.PK.VSAL-----------------------------------------------------TY
A5XY08_BURML/54-137-----....RD..GATG.RL.TLAV-----------------------------------------------------TY

PF04752

CHAC1_MOUSE/34-209.....GCTWGVAYQVRGEQV.NEALKYLNVREAVLGGYDTKEVTFYP..................QDTPDQPL..TALAY
Q9VCI9_DROME/57-235.....GITWGCAYRITGST....ALDYLKQRECTLGGYATIDTKFFPR..............VASQDTPFSGEAVEVLVY
CHAC2_MOUSE/1-174.....GSVWGVAYKLPVGKE.EEVKTYLDFREK..GGYRTTTVIFYP..................KDSTTKPF..SVLLY
Q9A674_CAUCR/10-179.....GSVRGMAYRVAAAEW.EGVYAYLREREQPTE...........TYFE........TWREVKVD.GGDKA..PALVF
Q9LPF2_ARATH/1-161.......................EVCHLEVREKQYD..QKEYLDFFT.................QDSNASEPAVAGVMVY
CHAC_YEAST/8-231QDPDDLVTIGVVYYIPPEHA.QEVREYLNVREQ..NGYTLHEVEVHLETNREHEAELGEALEQLPRHNKSGKRVLLTSVY
O49579_ARATH/3-204.....AICWGTAFCVRG...................GPEKERLAM...................EEDDPLKPAVTGVIVF
Q98G14_RHILO/15-184.....GSCVGLAFRVPGELR.DEVIAYLRERELVTS...........VYLE........RALKVRLD.GGGTV..EAVAY
CHAC_SCHPO/10-198FTPFDEGCWGMAFRIPAKYA.TQVREYLDDRE..VNGYTAHSVPVYA..................HTGDEIPVLENCLVY
Q98IT6_RHILO/66-235.....GQCQGMVFEIAAPVA.EN.LEALLRREMTI..LPAVNVPRW...................LQVSTEGGASRALGF
O81489_ARATH/3-162.....AICWGAAYCVRG...................GPEKEKLAM...................EENDTSTPIVTGVIVF
Q9GZE8_CAEEL/50-228.....SYTNGVVFRVDGKSAIATAVKYLEQREC.DNGYAFRMVPVQI.................RSAAHRRPTVVMALTC
CHAC_ECOLI/47-216.....GRTTGVAYRLPEETL.EQELTLLWKREMITG...........CYLP........TWCQLDLD.DGRTV..NAIVF
Q9VYK7_DROME/74-251..PAQDRVYGVAYRIAASQK.GAVLDHLDYREK..NGYERCSLEFHE.................YPTDGAEPI..QVIMY
Q98K42_RHILO/55-225....GGRCNGVIYRLPEGEK.PAQIERLLRREISDH.ESVSSVRWLP....................VHTAQGALRALGF

PF06094

Q4WA95_ASPFU/67-168HV..---R---TT....QD..AERLAAY.....-------------------....ETG.NYRAEDCLIR..........
O49580_ARATH/12-109GI..---.---TD....DE..LKMLDEF.....-------------------....EDV.EYDRKTVEVM..........
Q2JLB7_SYNJB/6-110LC..---.---SS....DR..LERMDRYEG...-------------------....IPGGHYRRQQVQVR..........
Q5LS50_SILPO/14-116GL..---.---TP....LQ..LDRLNFYE....-------------------....GGF.AYDLQAVEVT..........
Q9RXI5_DEIRA/41-150TY..---.---GPADWEQA..LALLDELEGV..-------------------..DEMPP.VYTREQVRLT..........
A2LDA_DANRE/4-115SV..---.---DQ....KM..LEFLDWFEE...-------------------....CPD.WYQRTLIQLEI.........
Q383C9_TRYB2/67-211AV..---.---TE....TM..KRWLDVLED...-------------------...VETG.LYSVGTIDVVPLGNAQFVER
Q8XNC6_CLOPE/3-99EI..---.---SL....ND..LKNLDKYEE...-------------------....YSD.LYEKIDLIVQ..........
Q9HEJ2_NEUCS/18-141GL..---.---TK....AN..LDKLDIF.....-------------------....EGA.EYERRTVKVKVLKKVGDVTG
Q2H7M0_CHAGB/69-178HVQF---A---EE........AHKLGYY.....-------------------....EPN.AYVLTDCTIH..........
Q87SW3_VIBPA/5-97LI..---.---DD....DT..LVALDKLED...-------------------....VPV.EYRRESIATP..........
Q8KR42_ESCFE/4-106IS..---.---DS....LSAHWPMLDEFED...-------------------........GYDRVEVNVT..........
Q3A851_PELCD/5-112RM..---.---RH....PEVLLARLDVYEEVGP-------------------.QFPEPH.EYRRAEVVVM..........
YKQA_BACSU/5-100EA..---.---......DELCIHKLDQFFQ...-------------------........GYHKQTVFVE..........
Q2H7F6_CHAGB/70-187GL..---.---TK....AH..IQKLDKY.....-------------------....EGD.QYDRRSVTVNLVKR....LG
Q4MP50_BACCE/4-106EV..---.---ND....EI..LHKLDELEEYT.-------------------.GNAETD.LYDRITQTVY..........
Q2W041_MAGSA/18-119GL..---.---DE....RD..RSRLDFY.....-------------------....EGP.EYRVGLLPVR..........
Q2JFJ8_FRASC/12-111GL..---.---AA....RE..RAILDAF.....-------------------....EGE.AYETRPLLLT..........
Q8XKH2_CLOPE/10-118TI..---.---LD....YENVINAMDLMEGYLG-------------------.VNNKNN.EYNRIEMDVE..........
Q2TWK7_ASPOR/158-259EVNS---E---EE........EEQLRYY.....-------------------....ETD.QYEVVRCEIH..........
Q8ZZP7_PYRAE/4-98RV..---.---SQ....EE..LEAIDQLE....-------------------....IPA.GYARVEVEAR..........
Q3M3A4_ANAVT/3-110FA..---.---......DVRILDALDTLEDYQP-------------------EREMSEN.LYNRLEVKVK..........
Q6MR31_BDEBA/67-174EL..---.---KG....SDLLLSLMDEFHGYNR-------------------.MDPDKS.LYSREEIEVH..........
Q604S5_METCA/32-130GL..---.---DP....QA..LARLDRF.....-------------------....EDG.FYTRTGVMVS..........
A5D070_PELTS/19-124RI..---.---TA....ED..LITLDRYEG...-------------------....YPR.MYDRYYIPVV..........
Q2HBF9_CHAGB/25-142GL..---.---TN....AN..MARLDHF.....-------------------....EGS.QYERRPVTVSLLKK....LT
Q5KZG5_GEOKA/8-107TV..---.---TE....EG..LKAMDELEDYV.-------------------.EGRSNN.EYERVWV.............
Q2VYS1_MAGSA/26-133RV..---.---AAPEVPEV..MAQIYRREM...-------------------....PTG.VYAPRFVPVT..........
Q55181_SYNY3/15-121TFPP---G---FS........LEHLDSLEDYQP-------------------GRSPQEN.VYDRCWAEIF..........
Q5WWC1_LEGPL/9-115TI..---.---SK....EE..LAQADKY.....-------------------....EVS.EYKRVNVKLN..........
Q8H9V7_9CAUD/3-106ELPG---G---DE....GKEMLNNLDRLEG...-------------------....YPG.WYDRSPKNFR..........
Q1ZWH9_PHOAS/5-108TS..---.---DE....LTTHWQRIDDF.....-------------------....EGE.GYDRVVITVI..........
Q4D422_TRYCC/14-158LV..---.---TP....TL..KSCLDVIED...-------------------...VEEG.VYTVGEIDVLPLDNEQVVER
Q9MBH1_ARATH/11-110GV..---.---SD....AE..LNNFDVI.....-------------------....EGN.DYERVTVEVV..........
Q6FE92_ACIAD/4-107SS..---.---DQ....LEDHWQMLDEF.....-------------------....EGF.QYERVMIDVL..........
Q2JV02_SYNJA/2-94RI..---.---......PLGLLPRLDELED...-------------------....HPR.LYERQWVQLE..........
Q4J6G9_SULAC/12-113EI..---.---ND....EL..LNVLDEVEDY..-------------------..RGSPDDLYIREKVRVY..........
Q5WBE2_BACSK/9-110AV..---.---TS....EE..LIRIDELEGYNP-------------------.EGKSEN.EYERVECTVY..........
Q65ZK1_CAEEL/7-113EV..---.---CE....KK..LKVLDELEA...-------------------....YPT.LYDRKKVEIK..........
Q28QV3_JANSC/4-101DP..---.---DP....DA..LARLDFYE....-------------------....ACF.GYARAGVTVI..........
Q72G69_THET2/4-107FL..---.---RP....EA..LSLLDALEE...-------------------....EGE.EYKRVRVRVE..........
B9LD46_CHLSY/4-116EV..---.---QPDHYQRL..LQLLDGLEDYV.-------------------.PGRAGN.LYERIVVTVQ..........
Q9MBH2_ARATH/12-111GL..---.---TD....SQ..LENLDMI.....-------------------....EGS.EYVRKTVEVV..........
Q4H4F0_BACCI/21-123EV..---.---SE....ET..LKRIDELEEYFG-------------------.PGDTRN.LFDRIECQVN..........
Q3AE37_CARHZ/3-104ELIH---E---AE....KT..LTRLDDYEG...-------------------....EGS.LYQRILTKAV..........
Q82BN4_STRAW/15-124ALPE---A---YG....EL..LGALDRLEEYV.-------------------.PGDPGN.LYERVALHVT..........
Q2NW46_SODGM/3-94RI..---.---DS....TT..LAELDALRT...-------------------....KSG.EYKRVLIGTP..........
Q84T74_ORYSJ/28-136AV..---.---TP....RG..LDRLDELEG...-------------------...VSRA.HYERLPISVL..........
A3DFK6_CLOTH/18-122PV..---.---DK....KL..LKSLDRLEGYN.-------------------.KGSSNN.LYVRELRNIL..........
Q39NJ7_BURS3/12-118AI..---.---TP....EE..LQHADDY.....-------------------....EVD.SYRRDRVVLE..........
Q9HWL7_PSEAE/4-107VS..---.---DR....LAEHWPALDEF.....-------------------....EGS.EYRRVATRVT..........
Q9FIQ3_ARATH/9-123SV..---.---SK....RG..LVRLDELEG...-------------------...IKVN.HYERLPIEVI..........
Q1N025_9GAMM/5-106SS..---.---TE....LVDIWQHLDNF.....-------------------....EGP.GYKRSLHKVE..........
Y434_METJA/122-222DI..---.---TD....KE..LGIFDDYED...-------------------....LDV.YYIREKTTAV..........
Q236U4_TETTS/9-115TS..---.---EK....WDELVKICDEIEE...-------------------....YPA.YYTRFQVQVE..........
A5FA74_FLAJ1/4-105EV..---.---SS....QE..MLKVDQF.....-------------------....ESN.SYKRVQVKLK..........
Q1NFJ0_9SPHN/6-113AL..---.---GD....PQSTLAWLDDYEECSP-------------------.AFPRPW.EYRRALIPAA..........
Q5Z825_ORYSJ/23-122GV..---.---TD....AE..LQILDEF.....-------------------....EDV.EYVRTRVEIS..........
Q2RAS4_ORYSJ/25-134AV..---.---SP....RA..LVDLDALEG...-------------------...THLG.VYERRKVTVV..........
A2LD1_MOUSE/4-118EV..---.---DE....QM..LRFLDDFED...-------------------....CPS.MYQRTALQVQVLE......W
Q5YT56_NOCFA/18-111GL..---.---SV....AE..RALLDAY.....-------------------....EGD.EYRLDTVEFG..........
Q7QE28_ANOGA/8-116EI..---.---DD....RM..LGRLDVLED...-------------------....YPQ.LYDRRPEEIR..........
Q2UEF9_ASPOR/49-153GLLS---P---RQ........LDRLAAY.....-------------------....ETD.KCRLRSCLIN..........
Q8XZP0_RALSO/7-114RI..---.---DP....GL..VPVLDTIEAVY.-------------------..PGGGA.LFLRETHTVM..........
Q2CFF4_9RHOB/3-102EP..---.---DA....EA..RARLDFY.....-------------------....EGGYAYGCRRLDVE..........
A5ER73_BRASB/6-115RL..---.---RQ....PAPMLREFDMYEACGE-------------------.GFAPPT.EYLRQRLEVT..........
Q20ZZ6_RHOPB/4-103EV..---.---DD....AT..LVELDKLES...-------------------....VGT.LYDRKTVAIA..........
Y1514_METJA/4-103EV..---.---DE....KT..LKRIDCLEG...-------------------....HPD.YYRRKKVSII..........
Q8DJS9_THEEB/12-121FE..---.---HP....PSRLLAQLDAFEGYSP-------------------NLSPEMN.AYHRQEVPVY..........
A4XHE3_CALS8/3-100QI..---.---DP....ST..LNKIDEFED...-------------------....EGK.LYKRKEIEVI..........
Q2UB51_ASPOR/36-154GL..---.---DV....NQ..RNLIYELEG...-------------------....GLM.NLVDVRAQIR..........
Q310I6_DESDG/23-158TF..---.---TD....PQHDLPPIDRLEGFR.-------------------..PGGHS.MYQRVMVAVL..........
Q8PXB2_METMA/34-136RF..---.---SGKKQLEV..AKSIDYMELF..-------------------..GG.....YHREYVDLE..........
Q8R9J5_THETN/4-110TF..---.---YD....DGNVLSSIDELELYF.-------------------..GDKHEIMYLREKREVF..........
Q1Z4M5_PHOPR/5-100KV..---.---DN....LT..LQALDRLEG...-------------------....YPT.LYERHLVSTV..........
A8LC77_FRASN/9-104GL..---.---TR....VE..RELLDLF.....-------------------....EGD.PYEARELALV..........
Q3J7N1_NITOC/11-114EI..---.---AT....AE..KPALDRVEG...-------------------...P....RYIQQNVQLA..........
Q72AR6_DESVH/8-149DF..---.---AD....APAALHRLDKLEEFA.-------------------..PGGIS.LYLRVLLPVL..........
A5WAV3_PSEP1/11-117QI..---.---SE....DE..LAAADRY.....-------------------....EVA.DYKRVAVTLA..........
Q1QVN8_CHRSD/14-112RV..---.---......NASGLAALDRLEDYRV-------------------.RAPSRG.TYDRSVHATT..........
Q2G9Q2_NOVAD/6-118RA..---.---GPGFSARH..LRMLDSYEAYDP-------------------.RRPSRS.EYVRRRVRVT..........
YS11_DROME/11-118EV..---.---DE....TM..LSKLDILED...-------------------....YPD.YYDREQQTIL..........
Q62J87_BURMA/13-120AI..---.---DE....RL..VPVLDEIEEVY.-------------------..PGVEG.LFVRQRASVE..........
Q2A3D2_FRATH/4-110EL..---.---TT....NE..IKLSDKY.....-------------------....EVD.SYVRKKVTLN..........
Q8U329_PYRFU/10-99EV..---.---DK....ET..FERINEIE....-------------------....TGA.GYKLVEVSTK..........
Q2SNX2_HAHCH/20-118GL..---.---TQ....HD..ITRLDHY.....-------------------....EGD.DYVRRYCMVR..........
Q21ER9_SACD2/5-107NV..---.---EP....SD..LQKLDAF.....-------------------....EGS.YYQRETIQVI..........
TINA1_DROME/14-122EV..---.---DD....RM..LNSLDNLED...-------------------....CEE.IYTREMHDMN..........
Q2H7L9_CHAGB/70-175KVQS---V---DD........ELKLAYY.....-------------------....ETN.AYELAPCEIS..........
Q1LNL0_RALME/4-111DI..---.---PD....AL..LPVLDEIEEVY.-------------------..PGQAT.LFVRETQPVA..........

PF13772

B3KMN7_HUMAN/17-99LMTN...Y...ES....AP..............-------------------.....PSPQYKKIICMGA----------
B5FXG3_TAEGU/70-152QMKD...Y...VS....GP..............-------------------.....PSPQYKKVICMGA----------
B4PJ24_DROYA/44-142HLTN...Q...PQ....TDLHAGGGQ....EII-------------------PLDRQPSQTYLKVLVKGA----------
B4L056_DROMO/63-165HLSN...Q...PE....TIVHGQAAAAAADVEV-------------------PSNRQPSHTYLKVLVKGA----------
Q17PV6_AEDAE/68-162QLVK...N...PP....KLEGTESG.......R-------------------PFERQPSKTYMNIIVRGA----------
B4K1W6_DROGR/63-161HLSN...Q...PD....TIVHAESAV....TDV-------------------PQNRQPSCTYLKVLVKGA----------
B3M8A6_DROAN/49-147HLTN...Q...PD....TIVHATGAQ....ECI-------------------PLDRQPSETYLKVLVKGA----------
B4GZW8_DROPE/49-148HLTN...Q...PL....SEVHGQSVPP...PSI-------------------PLDRQPSQTYLKVLVKGA----------
B4N450_DROWI/103-203MLTH...Q...PE....TNLYEFPDD.....QV-------------------PESRQPSKTYLKCLVKGA----------
D3TRN9_GLOMM/100-196MLVN...Q...PS....TDLKLLQPD.....DT-------------------PFNRQPSKTYLKCLIKGA----------
B3M8A5_DROAN/108-205LLIQ...Q...PE....TNLYELSQE.....SI-------------------PASRQPSKTYLQCLVQGA----------
C4WSY7_ACYPI/69-159MLVN...Q...PA....KQIPLP..........-------------------.LDRRPSKAYLETIILGA----------
Q5DCE9_SCHJA/59-142MLNS...C...EP....GD..............-------------------.....PSPYYLDIILRGA----------
A8XCM1_CAEBR/77-156QYSD...L...QAD..PMP..............-------------------.....PSPHYKLVIVEGA----------
B1XJ34_SYNP2/53-137VVVN...K...TPQ..EVP..............-------------------.....PDDWYFYIVMRGA----------
Q7NPN7_GLOVI/75-159TVVD...KL.SEE....LA..............-------------------.....PNEWYSSVVLRGA----------
D0L8N2_GORB4/62-143VLDA...F...EG....GL..............-------------------.....PSARYLGVMAEAA----------
Q9YW48_MSEPV/61-148ILND...K...NQYFYDAP..............-------------------.....NRNIYKNIIISGL----------
Q5Z180_NOCFA/73-158VLDA...Y...EG....GL..............-------------------.....PSARYLGVMADAA----------
A0PRM1_MYCUA/59-145VLDA...W...EG....GL..............-------------------.....PSARYLGVMADAA----------
Q6MNB0_BDEBA/85-169VTSP...S...RRS.LDGP..............-------------------.....VSERYLEALVRGA----------
B9KUL9_RHOSK/61-147KKDR...R...GA...PRL..............-------------------.....PSTEYLARLVEGA----------
B9JT38_AGRVS/65-148ISLK...H...NVD..GLK..............-------------------.....PRTGYMNHILAGA----------
C0AC99_9BACT/83-169KKDV...L...GA...PQP..............-------------------.....PSRDYLEFVVQGA----------
A6EXE0_9ALTE/62-151VGMP...QFIDND....CR..............-------------------.....PSRRYLNIVLEGG----------
A5XY08_BURML/54-137VANPAMVR...PN....LR..............-------------------.....PTRDYLDHLLAAA----------

PF04752

CHAC1_MOUSE/34-209VA---------TP...QNPGYLGPA.PEEVIAT..............QILACRGFSGHNLEYLLRLADFM----------
Q9VCI9_DROME/57-235VA---------TP...ENIYWLGDD.PVEEIAQ..............QIVSCRGPSGHNAEYLLRLALFM----------
CHAC2_MOUSE/1-174IG---------TC...DNPNYLGPA.PLEDIAE..............QIFNAAGPSGRNTEYLFELADSV----------
Q9A674_CAUCR/10-179LS---------DM...KHSQWAGDL.TLEQQAA..............LIAGAVGLSGPNIDYLRDLVMHL----------
Q9LPF2_ARATH/1-161IA---------SPDKKSNNNYLGPA.PLEDIAK..............QIVKAKGPSGPNRDYLFNLEEAL----------
CHAC_YEAST/8-231IG---------TI...DNEAFVGPE.TVDETAK..............VIAVSHGPSGSNYEYLAKLEQAL----------
O49579_ARATH/3-204TS---------TPDKVSNKYYLGPA.PLEDMARFLSSHLAVILYIQRQIATANGPCGNNRDYLFLLEKAM----------
Q98G14_RHILO/15-184IV---------DR...KHEQYAGAL.DAAHAAA..............VVRGAVGQSGNNEDYVFSTLKHL----------
CHAC_SCHPO/10-198VG---------T...SKSPQFQPSD.DLTQMAK..............IISTRRGKSGDNFVYLFELAKCL----------
Q98IT6_RHILO/66-235VV---------DP...ANPRYAGKL.DKSAVAA..............TLARAVGHWGSGAQYLFETIRHL----------
O81489_ARATH/3-162TS---------TPDKVSNKYYLGPA.PLEEMAR..............QIATASGPCGNNREYLFKLEKAM----------
Q9GZE8_CAEEL/50-228VA---------D...QQNELYLGPD.DLIKMAR..............EIVTAKGCAGPNCEYVLNLAENL----------
CHAC_ECOLI/47-216IM---------DP...RHPEYESDT.RAQVIAP..............LIAAASGPLGTNAQYLFSLEQEL----------
Q9VYK7_DROME/74-251VA---------TQ...ANDSYAGDVWQVPCIAR..............QIFSSAGPSGPNREYLFNLAAAM----------
Q98K42_RHILO/55-225WV---------GV...KGRGTSPGQ.PLDRVAS..............ILARACGHIGSGAEYLYNTVSHL----------

PF06094

Q4WA95_ASPFU/67-168...YIDGKEPS........----------------EDLGYTFKYV------
O49580_ARATH/12-109...LTDTSEK.........----------------.LQVETYVWK------
Q2JLB7_SYNJB/6-110...SDEGEVI.........----------------..EAMTYVAG------
Q5LS50_SILPO/14-116...LPTGGSA.........----------------..KAQVFFPQ------
Q9RXI5_DEIRA/41-150...LEGGETL.........----------------..TAWVYVYA------
A2LDA_DANRE/4-115..LKGNGETEV........----------------.EEAFVYTKT------
Q383C9_TRYB2/67-211VLLVGEGEAI.........----------------..RALVYFRE------
Q8XNC6_CLOPE/3-99...DINGISY.........----------------..EAFAYVMN------
Q9HEJ2_NEUCS/18-141EGNM.EGEEK.........----------------..DAQVYVFL------
Q2H7M0_CHAGB/69-178...FTDPSQGSSSS...PP----------------VVEGKTFKYA------
Q87SW3_VIBPA/5-97...FG..............----------------..QAWIYLYQ------
Q8KR42_ESCFE/4-106...TPDGKQV.........----------------..NAWIYQLQ------
Q3A851_PELCD/5-112...TADHMPR.........----------------..TAWTYLYN------
YKQA_BACSU/5-100...TDVGIK..........----------------..IALIYFMN------
Q2H7F6_CHAGB/70-187GGNLADAGKA.........----------------..VADVYIFK------
Q4MP50_BACCE/4-106...ATD.REI.........----------------..EAYVYIAQ------
Q2W041_MAGSA/18-119...AADGEDV.........----------------..TAEVYLCL------
Q2JFJ8_FRASC/12-111...DGL.............----------------..PAMAYLWR------
Q8XKH2_CLOPE/10-118...ILGKKSS.........----------------.EKCYVYYYG------
Q2TWK7_ASPOR/158-259...IVDSGDI.........----------------.VKGLTFRFI------
Q8ZZP7_PYRAE/4-98...TPWGAY..........----------------..KAWMYAYP------
Q3M3A4_ANAVT/3-110...NPLGLSL.........----------------.GWAWVYLMN------
Q6MR31_BDEBA/67-174...PEGMSAP.........----------------.VKAWIYFLN------
Q604S5_METCA/32-130...TVELGCQ.........----------------..PAQVYLIP------
A5D070_PELTS/19-124...LEDGTEV.........----------------..LAFAYQMA------
Q2HBF9_CHAGB/25-142NGKLGEGTKV.........----------------..EAETYIFL------
Q5KZG5_GEOKA/8-107...RDACKPI.........----------------..EGYVYVYL------
Q2VYS1_MAGSA/26-133...LDDGRRV.........----------------..EAWAFIAR------
Q55181_SYNY3/15-121...DPQDQVM.........----------------.TEAWLY..R------
Q5WWC1_LEGPL/9-115...SGV.............----------------..NAWVYINA------
Q8H9V7_9CAUD/3-106...INGEMI..........----------------..TALVYHQD------
Q1ZWH9_PHOAS/5-108...LDDGSEQ.........----------------..SAFVYRLS------
Q4D422_TRYCC/14-158TLHVGKGEAV.........----------------..RALVYFRT------
Q9MBH1_ARATH/11-110...RMDNSEK.........----------------.VKVETYVWV------
Q6FE92_ACIAD/4-107...LDSNQWI.........----------------..QAWTYQMN------
Q2JV02_SYNJA/2-94...SGT.............----------------..FAWVYLGR------
Q4J6G9_SULAC/12-113...FDDKRKY.........----------------.YLDNVYIYV------
Q5WBE2_BACSK/9-110...TDE.SET.........----------------..NAYTY..I------
Q65ZK1_CAEEL/7-113...LPSGTTE.........----------------..TAFIYLLK------
Q28QV3_JANSC/4-101...RDG.AEV.........----------------..AAEAWFPS------
Q72G69_THET2/4-107...TEEGPL..........----------------..EAWAYLYL------
B9LD46_CHLSY/4-116...TADGAR..........----------------..EAWVYVAG------
Q9MBH2_ARATH/12-111...LTDTSEK.........----------------.KQVETYVWA------
Q4H4F0_BACCI/21-123...ESGGTH..........----------------..LGWTYVYN------
Q3AE37_CARHZ/3-104...DQKGEEH.........----------------..EVFVYVYN------
Q82BN4_STRAW/15-124...RGDGAAV.........----------------..RAWVYVAA------
Q2NW46_SODGM/3-94...YG..............----------------..SAWMYLYQ------
Q84T74_ORYSJ/28-136...LAEGAQV.........----------------..DAVAYYAH------
A3DFK6_CLOTH/18-122...TED.GEE.........----------------.VPCWIYIYA------
Q39NJ7_BURS3/12-118...SGV.............----------------..AAWVYVDA------
Q9HWL7_PSEAE/4-107...LADGAQV.........----------------..DAYVYALR------
Q9FIQ3_ARATH/9-123...EEDDEEEESN.....G----------------VVLAEAYFAH------
Q1N025_9GAMM/5-106...LATGETV.........----------------..QAYIYAIN------
Y434_METJA/122-222...SEDGRKY.........----------------..DVYIYLRK------
Q236U4_TETTS/9-115...LDEDPQKK........----------------.VTAWVYQMQ------
A5FA74_FLAJ1/4-105...SGR.............----------------..IAWVYTEN------
Q1NFJ0_9SPHN/6-113...GPQAQV..........----------------..DAWTYIYA------
Q5Z825_ORYSJ/23-122...LTDTSET.........----------------.MLADTYVWA------
Q2RAS4_ORYSJ/25-134...VEGGSGEV........----------------.VEAEAYFAH------
A2LD1_MOUSE/4-118EGDGDPGDSV.........----------------..QCFVYTTA------
Q5YT56_NOCFA/18-111...NA..............----------------..RAWVYIWT------
Q7QE28_ANOGA/8-116...NETSSAV.........----------------.ECCWVYLIR------
Q2UEF9_ASPOR/49-153...VLNNDGGAE......K----------------TIEGVSFMWN------
Q8XZP0_RALSO/7-114...LGSEPL..........----------------..DCIVYPVS------
Q2CFF4_9RHOB/3-102...TADGPV..........----------------..TADVYVPE------
A5ER73_BRASB/6-115...LADGTAR.........----------------..EAWTYVYN------
Q20ZZ6_RHOPB/4-103...LGDAGVT.........----------------..DAFIYIGR------
Y1514_METJA/4-103...LDSGKEI.........----------------..EAWLYFYP------
Q8DJS9_THEEB/12-121...DLTHKPL.........----------------.GTAWAYIMS------
A4XHE3_CALS8/3-100...LDDSRKI.........----------------..KAWAYIYL------
Q2UB51_ASPOR/36-154...LKD.GSLPCHDICSGR----------------MVDAGMFVWH------
Q310I6_DESDG/23-158...CGRTSI..........----------------..PAWTYWMP------
Q8PXB2_METMA/34-136...IEQ.QKV.........----------------..KGLIYVYD------
Q8R9J5_THETN/4-110...YENGEKE.........----------------..YIDVYVYK------
Q1Z4M5_PHOPR/5-100...WG..............----------------..EAWVYTYQ------
A8LC77_FRASN/9-104...GGG.............----------------..SAVAYLWR------
Q3J7N1_NITOC/11-114...LADGNWV.........----------------..DAFLYVVA------
Q72AR6_DESVH/8-149...VDDVLL..........----------------..PCWTYVSP------
A5WAV3_PSEP1/11-117...SGL.............----------------..TAWVYVRA------
Q1QVN8_CHRSD/14-112...FG..............----------------..PAWLYLYN------
Q2G9Q2_NOVAD/6-118...VRGEAAV.........----------------..LAEAYVHN------
YS11_DROME/11-118...MEQNETI.........----------------..QCWLYLIR------
Q62J87_BURMA/13-120...LGGRRY..........----------------..DCLYYPVG------
Q2A3D2_FRATH/4-110...SGN.............----------------..SAWIYTEA------
Q8U329_PYRFU/10-99...FG..............----------------..KAFLWEWS------
Q2SNX2_HAHCH/20-118...TPGGGRL.........----------------..IAWVYLYR------
Q21ER9_SACD2/5-107...ADGTPY..........----------------..QADIYLLK------
TINA1_DROME/14-122...IGVGEGT.........----------------.VPCWVYLLQ------
Q2H7L9_CHAGB/70-175...FTDDPEKEED....RG----------------PVIGHTFKYA------
Q1LNL0_RALME/4-111...LAGAAT..........----------------..DCLLYPVA------

PF13772

B3KMN7_HUMAN/17-99---KENGLP----------------------------LEYQEKL-------
B5FXG3_TAEGU/70-152---KQNGLP----------------------------TDYQEKL-------
B4PJ24_DROYA/44-142---TESGVP----------------------------EDYIKWL-------
B4L056_DROMO/63-165---EESGIP----------------------------GDYVKWL-------
Q17PV6_AEDAE/68-162---IESGLP----------------------------SDYVEKL-------
B4K1W6_DROGR/63-161---EETGIP----------------------------EIYIKWL-------
B3M8A6_DROAN/49-147---KETGIP----------------------------DEYISWL-------
B4GZW8_DROPE/49-148---LETGIP----------------------------EEYVKWL-------
B4N450_DROWI/103-203---IESSIP----------------------------QSYIQRL-------
D3TRN9_GLOMM/100-196---IETGLA----------------------------SDYVNWL-------
B3M8A5_DROAN/108-205---IESSIP----------------------------EDYVRRL-------
C4WSY7_ACYPI/69-159---NESGLP----------------------------LDYLQFL-------
Q5DCE9_SCHJA/59-142---VQSQLP----------------------------KSYIDRL-------
A8XCM1_CAEBR/77-156---KEHKLP----------------------------SEYIKGL-------
B1XJ34_SYNP2/53-137---MTAGLS----------------------------RDYSWRL-------
Q7NPN7_GLOVI/75-159---LTCGLS----------------------------ESYCWRL-------
D0L8N2_GORB4/62-143---EIAGAP----------------------------AEYVQDL-------
Q9YW48_MSEPV/61-148---IENNIP----------------------------SWYIRHI-------
Q5Z180_NOCFA/73-158---EKAGAP----------------------------ADYVHAL-------
A0PRM1_MYCUA/59-145---EIAGAP----------------------------SDYVHDL-------
Q6MNB0_BDEBA/85-169---RASGLP----------------------------EAYVASL-------
B9KUL9_RHOSK/61-147---RAHGLP----------------------------AAWIAAL-------
B9JT38_AGRVS/65-148---D..VLP----------------------------AAYIDYL-------
C0AC99_9BACT/83-169---VERGLP----------------------------ASYVNEL-------
A6EXE0_9ALTE/62-151---RQAGLD----------------------------GKYLESL-------
A5XY08_BURML/54-137---..DVLP----------------------------RAYLDHV-------

PF04752

CHAC1_MOUSE/34-209---QLCG..........................PQAQDEHLEAIVDAVGTL
Q9VCI9_DROME/57-235---HEEIP.........................G.VRDDHLFELEQLVLEE
CHAC2_MOUSE/1-174---RKLVP.........................E.DADEHLFSLEKLVKER
Q9A674_CAUCR/10-179---HEDG............................VRDHAMEKLLKMVEAR
Q9LPF2_ARATH/1-161---AQLG............................FKDKHVTDLANQVRHI
CHAC_YEAST/8-231---AQMPIMK.....................ERGRITDHYLTALLETVNKY
O49579_ARATH/3-204---HDIGFVVKGSDLDGFKRDIVFDVLSHFLFHTGHEEDYVIELANEVRKV
Q98G14_RHILO/15-184---EALG............................IRDHWLEDVARGIAPS
CHAC_SCHPO/10-198---RHLSP.........................E.SKDIHVFELEAEVRKQ
Q98IT6_RHILO/66-235---DAC............................GIRDRNLWQLQELVAQE
O81489_ARATH/3-162---FDI............................EHEEEYVIELANEVRKQ
Q9GZE8_CAEEL/50-228---RKLFP.........................N.DEDDHLFQLEHHVRIA
CHAC_ECOLI/47-216---IKLG............................MQDDGLNDLLVSVKKL
Q9VYK7_DROME/74-251---DQL.F........................PG.AVDEHLEELVACVKRY
Q98K42_RHILO/55-225---EAFG............................IHDRNLWRLQELVADE

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window