Sequence alignment for CL0282

PF00273

Q5CZZ1_XENTR/223-395HFCWILDTHKERALKAINLAR..VSHRYPKSDFKLAHTFTEEITHFIKDCC.....HG.DMFECMSER...MELSKHTCD
I3MJG0_SPETR/414-592QNCDLYEQLGEYKFQNALLIR..YTQKAPQVSTPTLVEASRNLGRVGTKCC..KLPES.HRMPCVEDY..LTAILNTVCV
ALBU_BOVIN/413-591QNCDQFEKLGEYGFQNALIVR..YTRKVPQVSTPTLVEVSRSLGKVGTRCC..TKPES.ERMPCTEDY..LSLILNRLCV
G5B5P2_HETGA/222-394LKCASIQKFGERAFKAWALAR..MSQKFCKAEFIEISRIVNDLTKVNKECC.....RG.DLLECAADR...ASLVKYICA
F7AX94_MONDO/421-597TECGYFQNLGEEGFLNQCLLP..LTKKAPQLPPQELISHSKKLASFFAKCC..PLGEE.DQFACVDNA..VSLTIGELCG
I3MJG0_SPETR/30-202EIIKRFREFGEQEFKGLVLVT..FSQILQKTSYDDLAKFTTEVTDLAKACV....ADE.FGVDC..NKPLDTIFGEEACK
H3A4E6_LATCH/420-596SRCDILKKDGIEHLQQILLID..YTKKIPQAAPEVLFELSKQLTAVGVKCC....KKD.HPMPCTEEY..ISKIIGMVCE
F7G7M6_ORNAN/234-412DNCDLYDKLGEYAFQNTVLVR..YTRKLPQVSTPTLLDVSSHLARVGTRCC..KLDEG.HRLACADDY..LALVLDKMCR
G3WQH5_SARHA/414-592ENCDLFDKVGEYGFENALLVR..YTRKAPQVSTPTLLALGHKLAKVGSKCC..KVSDN.EKLGCAEGY..LAIVIDNLCR
FETA_MOUSE/410-588QSCALYQTLGDYKLQNLFLIG..YTRKAPQLTSAELIDLTGKMVSIASTCC..QLSEE.KWSGCGEGM..ADIFIGHLCI
I3MD87_SPETR/218-385RVCSQYAAYGKEKSRLSHLIK..LAQKVPTADLEAVLPLAEDITRILSKCC.....ES.TSEDCMAKE..LPEHTVKIC.
Q68FY4_RAT/218-385RVCSQYAAYGKEKSRMSHLIK..LAQKVPTANLEDVLPLAEDLTEILSRCC.....KS.TSEDCMARE..LPEHTLKIC.
W5MZW6_LEPOC/30-202TICQYYTALKEEGFKAIVLVG..LAQNLPKSTFEELVPLIRQSTAAAQGCC....GDS.PSADCSKDE..KELFQGVVCS
W5MZW6_LEPOC/222-396SICVIYQKYGLRILKAKKLVQ..YSQKLPQATFEEVVDMTDRIAAMTATCC.....SG.DMIQCMKQR...KELVDTVCS
Q5CZZ1_XENTR/33-203HIADVFNELTERTFKGLTLAI..VSQNLQKCSLEELSKLVNEITDFAKSCT....GND.KTPEC..DKKIDTLFYDKLCA
F7B1W2_ORNAN/414-591EDCAHFQKLGEDLYRQKYAIS..FTKQAPELPLTELTVHVERKTNDAAHCC..MQPDE.KQTACIERS..ANLLYGQICG
G1KNL0_ANOCA/220-388KACSRYAVFGKDKTKLSYFIT..FTQRSPTASFDDVLSLAEDSAEVLSKCC.....DS.MEEHCIQKE..VLAHTAKIC.
G1U9S2_RABIT/30-202EIAHRFNDVGEEHFIGLVLIT..FSQYLQKCPYEEHAKLVKEVTDLAKACV....ADE.SAANC..DKSLHDIFGDKICA
G3SMX8_LOXAF/415-593QNCEHFEQLGEYGFTNELVVR..YTRKVPQVSTPTLVEVSRKLGRVGSKCC..KLAEA.KRMPCAEDY..LSLVLNRLCV
W5PXI3_SHEEP/222-394NVCGALMKFGPQILQSINIAI..LSQKFPKIGFKQLTSLLEDVSSKYDGCC.....EG.DVVQCIHGR...SKVMSHICS
L9L5M3_TUPCH/18-190EIAHRFKDLGEENFKGLVLIA..FSQYLQQCPFEEHVKLVGEVTEFAKTCV....ADE.TAENC..DKSLPTLFGDKLCT
H9GH08_ANOCA/33-205.TITRASELPPDDFAGIAMIL..YSQSAQQATYEEVHKLMDDIVALAKKCG....ADEHSDPEC..GKPLHTVFLDEICH
G1R8T8_NOMLE/414-592HNCELFEQLGEYKFQNELLVR..YTKKVPQVSTPTLVEVSRNLGKVGSKCC..KHPEA.QRMPCTEDY..LSVVLNRLCV
G1P2E8_MYOLU/30-202EIAHRFKDLGEEYFRGLVLVT..FAQFLQQCPFEDQVKLAKEVTEFAKTCA....ADE.SAENC..DKSLHTLFGDKLCA
G1P311_MYOLU/222-393NVCGAFLRFGPTVLKSIYIAI..FSQKFPKTEFEELTSILEDVSSKYDGCC.....EG.DAVQCIRGR...SKLMSHICS
G3W8R1_SARHA/220-388RVCSQFAVYGMKKTRFSYIVK..YAQKVPTAALEDVVELAEDMTNVLSDCC.....NS.ILEDCMANE..LADHTVKVC.
L5LFJ8_MYODS/1290-1466QECEHFQNLGKDDLKYHYFIK..FTKIAPQLSTDELTFLGEEMVTALLTCC..TLSEE...FACVDNL..VDLAIGEICG
F7F9M8_MONDO/218-386RVCSAFTIYGMEKTRFSYIVK..FSQKAPAANLEDVIKVAESMTNVLSKCC.....DS.IMEDCMSKE..ITEYTVSAC.
I3M260_SPETR/36-202STLDSSQCSAEVNLVDLTTIF..FAQFVHGATYPEIRKMTNHVLAVIKKPT..........DEC..LENQMSAFLEEICH
G3W8R1_SARHA/29-201KVCKEFANLGKDDFRSLSFVL..YSRKFPSGTFEQVKALVNEVVSLTETCC....DVN.ADPNCYDTR..TSELSAKSCE
L5LFJ8_MYODS/826-1004RSCGLFQKLGEYYLQNAFLVA..YTKKAPQLTPPELMTYTRKMASAAATCC..RLSEE.KQLACGEGA..ADVIIGQLCI
ALBU_CHICK/226-398YFCGILKQFGDRVFQARQLIY..LSQKYPKAPFSEVSKFVHDSIGVHKECC.....EG.DMVECMDDM...ARMMSNLCS
G1P5R0_MYOLU/219-395.KCSMLQNRGESALQKWYFKK..LSKRFPNADFMIISKLATDFTKVHKECC.....QS.DILECADDW...ADLTKYMCE
F1QM90_DANRE/27-199KVCQDLQVIGIEKFKEMVTVL..YSQKFPNGTFEEVNCVADEMTTLAEKCC....KDD.ASPDCYDKG..ATEISEKSCR
U3K0R0_FICAL/418-596TNCELFKTHGEEEFLKGILVR..YTKKMPQVSTDTLLEIGKKMTAVGSKCC..NLPEQ.KRMSCSEHY..LSIVIEDMCK
L9L5M3_TUPCH/779-951HMCAVMRTFEPRTFQAITVTK..LSQKFTRANFTDIQKLVLDVAHVHEECC.....RG.NMLECLQDG...EKIMSYICS
H9GH08_ANOCA/417-595TRCDHYAQLGGYLYQNELLVA..YTKKAPELSFKDLQKYTGQFRDVAAKCC..KMDDA.HRLTCAEGY..ADLAIGSICQ
G1P311_MYOLU/33-202...NIIQKFIEDNVGYITIIT..FAQYVQEASFEEVEMLAKTMTEYRDQCL....ANS.KLPQC..SKLPNDALQEAICA
F6SKW5_XENTR/27-199KVCQELKFLGKDKFSAVALVM..NSRKYSNATFEEIGHLVTAIVSLSETCC....ATE.AAADCYDKK..ADALSVQSCD
ALBU_FELCA/30-202EIAHRFNDLGEEHFRGLVLVA..FSQYLQQCPFEDHVKLVNEVTEFAKGCV....ADQ.SAANC..EKSLHELLGDKLCT
F8VQ07_MOUSE/224-395HLCEIGTKFNEKVASAVELIL..LTKKQPKANFSEIAKLTMDVKNLHETCC.....EG.NTLVCALGR...RQLMNYTCS
U3JDX2_FICAL/243-411RICSRFSAYGKDKVSFSYLTS..LAQKVPSASFEELLPLAEDAAELSAQCC.....DS.LAEDCMQKK..LLEHTTKVC.
V8ND09_OPHHA/389-567SNCNNYKEIGDYFFQNEYLIK..YSKIIPQAPTSYLIELTKKVAKTAEKCC..NLDSN.HQVSCALEN..TDKVIGSICS
F7BJP5_MONDO/223-394.RCASLDKFGERAVKAGLVAR..LSQKFPKADFAEIHKIVEDLANVHKECC.....HG.DLLECADDR...AALSDYVCQ
H0VRQ1_CAVPO/414-592QECKHFQNLGEDGLKYHYLIK..LTKIAPQLSTEELISLGKEMVTALTTCC..TLSDE...FACVDDL..ADLVLGELCG
G3SMX8_LOXAF/223-395LKCANIHKFGERAFKAWAVTH..LSQRFPKADFAEVSKLATDLGKVYQECC.....HG.DLLECADDR...ADLAKYICD
F7G7M6_ORNAN/43-214.RCAAYQKFGERAMKAVLVAK..TSQRFPKADFGDIHKVVEDLAKVVKECC.....HG.DQLECMEDR...ADLTKYLCD
Q6WDN9_CAVPO/30-202EIAHRFNDLGEGHFKGLVLIT..LSQHLQKSPFEEHVKLVNEVTDFAKACV....ADE.SAQNC..GKAIATLFGDKVCA
G5B5P1_HETGA/222-393HVCAIIRNFGPRNFQAVTITK..LSQKFPKANFSEIQKLVLDVAHIHEECC.....HG.NVLECLHDG...EKIMSYICS
G1KNL0_ANOCA/29-201KICQEFNSLGKDKFRSITIVL..NSRKYCSATFEEISSIVNEIVALAEKCC....VEG.ADPECYNTE..STTLSAKSCD
F7CSG0_CALJA/222-394LKCASLQKFGERAFKAWSVAR..VSQRFPKADFTEVTKVVTDLTKVHTECC.....HG.DLLECADDR...AELAKYMCE
H0VRQ1_CAVPO/32-202..FNVTQKFINENTASMTIIA..FAQYVQEATFDDMEMLIKDMMKYKDKCL....GDK.TLPEC..SKLANNVLQEMMCS
G3SMX8_LOXAF/30-203EIAHRYKDLGEDLFKGLLLIS..FAQYLQKSPYDEHVQSVTAVTDLAKTCA....ADE.SAEHC..GDSLHTIFGDKLCA
G1TZC1_RABIT/225-397HLCEIKTKFNHTVANAVELVL..LTKKQPKANFSEIAKLTMDVKNLHEICC.....EG.NTVACALGR...SQLMDYTCS
G3WQV0_SARHA/36-203......QCSTEGNLVDIATIF..FAQFIPEATYQEVSKLVKDFLADFERPV....ANE.DPKDC..LERQLSALLEEICH
H2ZZM2_LATCH/135-303HVCLRYTYYGLETFKARSMIY..YCQKMPVANFDEILPAVDHFIQALSKCC.....SK.LDGDCLLKE..LTAYKEKVCT
H3A4E6_LATCH/31-204KPCEHLNVLGEERFKGVILVN..LAQNLPNSTYGELVALVRQIIVLANKCC....SDT.TDPECLKEE..IDIFENKICA
F1RUL9_PIG/7-176......QNSLEDNLRDATSIM..VAQFLQKLAYEEVQTIVKELLPLAEQCK.DLKSHE.SPSEC..CHQLMTTFLGHICN
G3WQH5_SARHA/223-394.RCSSLDEFGERAVKAGLVAR..LSQKFPKADFAEIHKIVEDLAKIHTECC.....HG.DLLECADDR...VALSEYLCN
F7BAY6_HORSE/413-591KNCDLFEEVGEYDFQNALIVR..YTKKAPQVSTPTLVEIGRTLGKVGSRCC..KLPES.ERLPCSENH..LALALNRLCV
I3LN42_PIG/218-385RLCSQYAAYGKDKSRLSHLIK..LAQKVPTANLEDVLPLAEDVATILSKCC.....DS.ASEDCMAKE..LPEYTVKIC.
C9JKR2_HUMAN/30-202EVAHRFKDLGEENFKALAVAR..LSQRFPKAEFAEVSKLVTDLTKVHTECC.....HG.DLLECADDR...ADLAKYICE
F6VJ19_MONDO/36-203......HSITEANLRDLATIF..FVQFIPEATYEEVDKLVKDFLADFEKLG....AKE.KSKEC..LEKQLSALLEEICH
G5B5P2_HETGA/30-202EIAHRFTDLGEKHFKGLALIT..FSQYLQKCSFEEHIKLVKEVTDFAKTCV....ADE.SAENC..DKSIHTLFGDKLCA
FETA_RAT/36-204STLDSSQCPTEKNMFNVATIV..VAQFVQDATKAEVNKMSSDALAAMKENT....GD.....GC..LENQLSVFLDEICH
L5K939_PTEAL/30-202EIAHRYNDLGEEHFRELVLIT..FSQYLQQCPFDEHSKLTNEVTEFAKTCV....ADE.SAANC..DKSLHTLFGDKLCT
AFAM_MOUSE/222-394NVCGALIKFGPKVLNSINVAV..FSKKFPKIGFKDLTTLLEDVSSMYEGCC.....EG.DVVHCIRSQ...SQVVNHICS
L5LH53_MYODS/221-396.KCSMLQNSGENALRDWFVSD..LTKRFPNADFMMVSKLATDFTTVHKECC.....QS.DMLECADDR...ADLTKYMCE
F7B1W2_ORNAN/222-394HLCRIAMGFGKRALRSGKVLY..FSQQFPKMELATLLNVMPDLLGEQDGCC.....EG.DVIECFRSR...AELVSSMCS
G1TZC1_RABIT/417-596NHCDLFKKLGESSFHNRLIVL..YTKKAPQLSAQEVVLFTKKMAAAATRCC..LLSGV.QQFLCVEDS..AKLILGALCR
F7IGI3_CALJA/28-200KVCKEFSDLGKGDFTSLSLVL..YSRKFPSGTFEQITKLVEEVVSLTETCC....AEG.ADPDCYDTR..TSALSAKSCE
U3K0R0_FICAL/34-206.IAHRFNDLKEETFKAVAMIT..FAQYLQKCSYDGLSKLVKDVVDLAHKCV....ANE.DAPEC..SKSLPSVFLDEICQ
ALBU_BOVIN/221-393LRCASIQKFGERALKAWSVAR..LSQKFPKAEFVEVTKLVTDLTKVHKECC.....HG.DLLECADDR...ADLAKYICD
Q5CZZ1_XENTR/415-593QNCDALQEHGEYLFENDALIR..YAKKMPTVSSKGLIGLAHQMADIGEHCC..ALPEN.QRLPCAEGD..LSILFGKLCE
F1RUN2_PIG/30-201EIAHRFKDLGEQYFKGLVLIA..FSQHLQQCPYEEHVKLVREVTEFAKTCV....ADE.SAENC..DKSIHTLFGDKLCA
M3YCX1_MUSPF/47-217.....SQNYLQENLRDITSIM..VAQFLQKLTFEEVQTIVEEVVDLADKCK.ILKAHE.SPSEC..SHQLMTTFLEHICH
F8VQ07_MOUSE/416-595TYCDLQKQLGSSSFQDRLTVL..YTKKAPQLSAQELVVFVKKMAAVARRCC..PLRDE.LQSACVEDQ..TKLILGELCR
G3UIJ9_LOXAF/215-386HVCALMRSFGLRNVQAIIFTK..MSQKFPRANFTEIQKMTLDSAHIHEECC.....RG.NVLECLHDG...QEVMSYICS
VTDB_MOUSE/27-199KVCNELAMLGKEDFRSLSLIL..YSRKFSSSTFEQVNQLVKEVVSLTEECC....AEG.ADPTCYDTR..TSELSVKSCE
H2QPN0_PANTR/31-202.NFNSTQKFIEDNIEYITIIA..FAQYVQEATFEEMEKLVKDMVEYKDRCM....ADK.TLPEC..SKLPNNVLQEKICA
L5LFJ8_MYODS/322-494LKCSSLQKFGDRAFKAWSVAR..LSQKFPNADFTEVSKLVTDLTKVHKECC.....SG.DMLECADDR...ADLAKYMCE
G1U9S2_RABIT/222-394LRCASIQKFGDRAYKAWALVR..LSQRFPKADFTDISKIVTDLTKVHKECC.....HG.DLLECADDR...ADLAKYMCE
G3WRB2_SARHA/228-401NICGVLRKFGPKGVKFQKIVE..ISQKFPKIDFSLLNKLLEDIPNMVDGCC.....EG.DVVHCFRLE...AKIINHICS
G1P5R5_MYOLU/216-383RICSQYAAYEKEKSRLSHLIK..LAQKAPTANLEDVLPLAEDVTTILSKCC.....GS.TSEDCMAKE..LPEHTVKIC.
H0X1I9_OTOGA/30-202SILDSSRCSTEVNLADIATIF..FAQFIQEAPYREISKMVKDVVTVIEKPT....GSG.QASGC..SENQISIFLEEICH
H9GU02_ANOCA/429-599.......RTDDSAFHNELLVR..YAKKAPQLSFEELYEYNKGFIDAAAKCC..KKDEA.YKQICIDRY..TNLVAGDICQ
G5B5P2_HETGA/414-592QNCELYEKLGEYGFQNALVVR..YTQKIPQISTATLVEASRNLGKVGTKCC..ALPES.KRLPCTENY..LALILNRLCV
E1BV96_CHICK/420-598TSCDIYKEKGDYYFQNELLLS..FTKKMPQLTSAELIKFTKQMTTIGSKCC..QLSQD.KLLPCAEEN..LDLVLGEICR
F6YY93_HORSE/40-209......QNNLEENLRDITSIM..VAQFLQKSTYEEVQTVVKELVDLTEKCK.SLQPRE.SSSEC..FHQLMTTFLENICK
F6VJ37_MONDO/216-381EACSNFAVNGMEKTRFSYIVE..FSQKAPIADLEDIELVAESMTNVLSECC.....DS.IIEDCMANG..IAEYTVSAC.
F7AX94_MONDO/229-401NTCGVLMKYGPKVLKHLKVVE..FSQKFPKIDFKDLGILLENMDHLFDECC.....EG.DVVQCFRNE...AKILNYICS
H0VRQ1_CAVPO/222-394NVCGALMKFGPKVLNSINIAV..FSKKFPKIEFRELTSLLKDVSSMYYGCC.....EG.DVLQCIHDQ...SKVMSHICS
H9GH08_ANOCA/225-397HVCAVMKKFGVETMQGLKMAQ..LSQKFPKASFETISKLTGDIVHIHEECC.....KG.DTLESMLDR...EKLTKYVCS
ALBU_CHICK/418-596TNCDLLHDHGEADFLKSILIR..YTKKMPQVPTDLLLETGKKMTTIGTKCC..QLGED.RRMACSEGY..LSIVIHDTCR
F6SKW5_XENTR/218-385TLCGRYNIYGEEKFKFSASIR..LAQKVPSADLKDVMQLVEQCAKVLAKCC.....NT.ITDDCMENE..LSMHVQQVC.
W5MZW6_LEPOC/417-596.MCEIEKQKGEDTFEKLMLVQ..YTKIMPQAPFEGLNVVAHRIGDVIDFCCKSKDLDH.TLMPCAEER..LTNVIDQTCS
AFAM_MOUSE/414-590QECKQFQELGKDTLQRHFLVK..FTKAAPQLPMEELVSLSKEMVAALTTCC..TLSDE...FACVDNL..ADLVLGELCG
FETA_BOVIN/222-395HICAVMGKFGPRTFRAITVTK..VSQKFPKANFTEIQKLVMDVAHIHEECC.....KG.NVLECLQDG...ERVMSYICS
G1TBD0_RABIT/415-593RSCDLYQKLGEYNFQNVFLVS..YTKKAPQLTSPELIALTRKMAAKAAMCC..HLSED.KRLACAETA..ADLVLGQLCI
G1TBD0_RABIT/223-394HVCSVMRNFSPLTFQAITVVK..MSQKLPKANFTEIQKLVLDVAHTHKECC.....QG.NVLECLQDG...ERIMSYICS
F7HAH7_MACMU/132-301HVCGALLKFGTKVVHFIYIAV..LSQKFPKIEFKELISLVEDISSNYEGCC.....EG.DVVQCIRDT...SQV.ALMCG
W5KYJ2_ASTMX/31-203KVCGGLRNVGAKNFKMVVIAL..YSQKFPNGTLEEVSSVADEMTKLAEECC....QDN.ASPDCYDKG..ATQISDKSCG
E1BV96_CHICK/228-399HTCGILKKFGERTIKALKLVQ..ISQRFPKADFFTVTKLVSDIANMHKDCC.....RG.DMLECMRDR...EEILHYVCT
V8ND09_OPHHA/197-369YTCYNLKKYGKDKLHALKFIE..THEKFVNANQETISHIVKVVVHIYEEIC.....KG.DSVEVLVDR...AALSQYVCE
U3IUC3_ANAPL/219-387RACSRFTVYGKDKVKFSYLTM..LAQMIPSASFEDLSPLAEDASEVFAQCC.....DS.VAEDCMQKK..LSEHTAKVC.
F7FAY5_RAT/37-205.......DHLEENLQASVSMM..VAQFLQDAAYDKVQAIAQELLDLTGKCK.LLKPHE.SPSEC..AQRLMATFLTHVCG
ALBU_CHICK/33-206EIAHRYNDLKEETFKAVAMIT..FAQYLQRCSYEGLSKLVKDVVDLAQKCV....ANE.DAPEC..SKPLPSIILDEICQ
G5B5P1_HETGA/30-202STLDSSQCSSEMNLADIATIF..FAQFVQEATYEEVSKMVTDLLTVVKKPT....GSE.QPAEC..FENRLSAFLEEICH
F6XRB3_CALJA/222-394HACAVMKNFGLQTFQAITITK..LSQKFTKVNFTEIRKLVLDVAHVHEHCC.....RG.DVVDCLQDG...EKIISYICS
G3WQV0_SARHA/223-394HICGILRKFGDRTFKAIMLTK..LSQKFPKANFTVIQNLVLDGAHVHMECC.....NG.NVPECLQDK...NEIMSYVCS
FETA_MOUSE/218-389HVCSVIRKFGSRNLQATTIIK..LSQKLTEANFTEIQKLALDVAHIHEECC.....QG.NSLECLQDG...EKVMTYICS
L9L5M3_TUPCH/432-610QNCELFEQLGEYGFQNALLIR..YTKKSPQVQTSTLVEIGRKLGSLGSRCC..KHPES.ERMHCAEEY..LSLVLNKMCL
M3YCY0_MUSPF/414-590RECEHFQNLGKDDLKYYYLIK..LTKIAPQLSTEELTFLGKEMVTALATCC..TLSEE...FACVDNL..MDLVLGELCG
FETA_BOVIN/37-202.......CSSGTNLVGLATIF..FAQSVQGATYEEVSQMVKDVLTIIEKPT....GSK.QPAGC..LENQVSAFLEEICR
L5LI30_MYODS/260-431.KCSMLQNSGENALQKWFVSD..LTKRFPNADFMMVSKLATDFTKVHKECC.....QS.DMLECADDW...ADLTKYMCE
FETA_MOUSE/30-198STLDSSQCVTEKNVLSIATIT..FTQFVPEATEEEVNKMTSDVLAAMKKNS....GD.....GC..LESQLSVFLDEICH
G3QZW5_GORGO/30-202SILDSYQCTAEISLADLATIF..FAQFVQEATYKEVSKMVKDALTAIEKPT....GDE.QSAGC..LENQLPAFLEELCH
F7BAY6_HORSE/30-201EIAHRFNDLGEKHFKGLVLVA..FSQYLQQCPFEDHVKLVNEVTEFAKKCA....ADE.SAENC..DKSLHTLFGDKLCT
W5PXI3_SHEEP/33-202...RITQKFIEDNVGYITIIA..FAQYIQEASFEEVEMLVKTMAEYRDKCL....ADR.TRPEC..SKLTNEVLLENICA
U3IUC3_ANAPL/28-200KVCQEFKTMGKDDFRTLTLIM..NSKKFSNATFEEISHLVREIVSLAETCC....TDG.ADPSCYDAG..SSALSAKSCG
U3JDX2_FICAL/52-224KVCQEYRTLGKENFRTLTIID..NSRKYSNGTFEEISHLVREIVSLAEKCC....AHG.ADPSCYDDG..STALSDKSCR
F7BAY6_HORSE/221-393LKCSSFQNFGERAVKAWSVAR..LSQKFPKADFAEVSKIVTDLTKVHKECC.....HG.DLLECADDR...ADLAKYICE
G3WRB2_SARHA/421-596LQCDFFQQLGEEGFFTQCLLF..LTKKAPQLSSQELISHSQKLVTSFSKCC..FLEEK.QQFACVDNL..AGLVLGELCG
F6VJ19_MONDO/223-395HVCDVLRKFGERSFKAILLTK..ISQKFPKANFTVIRDLVLDGAHAHIECC.....KG.NVLECLQDR...NEIMSYICS
L5LH53_MYODS/32-200ELAHRYKDLGKELFKGLLLVD..FSQFLRKSPLDMIVKLANELTDLADVCA....LNE.LAENC..GKSLHTLVGEKLCS
FETA_HORSE/222-394HVCAVIRNFGPRTLQAITVTT..LSQRYSKANFTEIQKLVLDVAHAHEECC.....RG.NVEECVQDG...EKLISYVCS
I3L5N3_PIG/155-334NLCDLREKLGDRSFHDRLIVL..YTKKAPQLSTQELVVFTKNMAAAASKCC..PLNDE.LQLACMEDS..AKLMLGALCR
L9L5M3_TUPCH/1319-1495QECDSFQNLGKEDLKYHLLIR..MTKKVPQLSTEELVFLGKEMVTVLTTCC..TQSEE...FACVDNL..ADLVLGEFCG
G5BE53_HETGA/218-385QVCSQYAAYGKEKSRLSHLIK..LAQKVPTADLKDVLPVAEDMTAILSKCC.....ES.TSEDCMAKE..LPEYTVRVC.
F7FAY5_RAT/417-596TYCDLHKQLGASNFQDRLTVL..YTKKAPQLSAQELVMLGKKMAASANRCC..PLRDE.LQSACLEDQ..AKLFLGDLCR
F7BJP5_MONDO/414-592QNCDIFEKAGEYGFANELVVR..YTKKMPQVSTPTVVELSQKLAKVGSKCC..KLSDD.EKMGCAEGY..LAIVVDKLCR
F6VJ19_MONDO/415-593RSCGLFQKLGEYHLQNVFLVA..YTKKAPQLISQELISFTKKMAATASLCC..QLSED.KQLACGEGA..ADLIIGQLCA
ALBU_MOUSE/414-592TNCDLYEKLGEYGFQNAILVR..YTQKAPQVSTPTLVEAARNLGRVGTKCC..TLPED.QRLPCVEDY..LSAILNRVCL
H0X1I5_OTOGA/30-202ELAHRYNDLGEEHFKALVLVT..FSQFLQKCPFEDHVKLVNEVTEFAKTCA....ADE.SAENC..DKSLHTLLGDKLCT
G3U4C2_LOXAF/253-434NLCALHEKLGDGNFHNRLIVL..YTKKAPQLSAEELVVFTKSMAAAASKCC..PLSDE.QQFACIEDSGKAKLILGALCR
ALBU_MOUSE/222-394MKCSSMQKFGERAFKAWAVAR..LSQTFPNADFAEITKLATDLTKVNKECC.....HG.DLLECADDR...AELAKYMCE
G1TZC1_RABIT/33-205...NATQNYLQENLRDITSIM..VAQFLQTATYEEVKTIARELLGLSEKCK.SMESHE.SLSPC..AHQLMTTFLEYICN
G3T7Q0_LOXAF/173-344NTCGAFLRFGPKTLSSMHCYKNIVSQKFPQIEFKEIISLLEDISSMLDGCC.....KG.DTVQCILLV...NKFIKHLCT
U3K0R0_FICAL/226-398HSCRVLEKYGERTFQAGKLAR..MSQKYPKAPFAELVKMVHDVKDVYKECC.....EG.DMVECVDDW...SELVASLCS
H2QPN0_PANTR/222-394HVCGALLKFGTKVVHFIYIVI..LSQKFPKIEFKELISLVEDVSSNYDGCC.....EG.DVVQCIRDT...SKVMNHICS
L5K939_PTEAL/414-592RNCELFENLGAYGFQNALIIR..YTKKMPQVSTPTLLVISKELANMGNKCC..TLPES.KRMACAEDY..LSLVLNRLCV
L5K939_PTEAL/222-394HKCASIQKFGERAFKAWSIAR..LSQRFPKADFMDLSKLVTDLSKIHKECC.....HG.DLLECADDR...EDLAKYVCD
F7IGI3_CALJA/219-386RVCSQYAAYGEKKSRLSNLIK..LAQKVPTADLEDVLPVAEDITNVLSKCC.....ES.TSDDCMAKE..LPLHTVKIC.
G3T7Q0_LOXAF/370-548QECERFQNLGKDDLKYHYLVK..FTKMAPQLSPNELISVSKLPAQSSAECI..SLGFG.RRVHWGHPR..VDLVLGELCG
Q6WDN9_CAVPO/222-394LKCASLQKFGERAFKAWSVAR..LSQKFPKAEFAEISTIVTSLTKVTKECC.....HG.DLLECADDR...QELAKYMCE
G1SHH2_RABIT/378-554QECKRFQNLGKDGLKYHYLIK..LTKTAPQLSTEELLSLGQEMVMALSTCC..TLSEE...FACVDNL..MDLVLGELCG
F7B3I5_HORSE/33-202...SITQKFIEENIGYITVIA..FSQYVQEASFEEVDRLVKIMTKYKGQCS....GEV.TLPDC..PRLTNDILLEKTCA
F7F9M8_MONDO/27-199KVCKEFANLGKDNFQSLSFVL..YSKKFSRGTFEEIKALVDEVVSLTEECC....DVN.AAPDCYDRR..TTELSSKSCE
G3WRB2_SARHA/37-208.DRNATQKFLENNTRDVTTVA..FAQFVQEATYEEITELVKQMIHYIDKCM....ANM.ELPEC..SRLANDVIQDKICE
G3WQH5_SARHA/30-202EIAKRYRDLGEENVKGLVLIT..FAQYLQKCPFEDHVKLVSEVVEFAKGCA....ADE.SAENC..GKSLHELLGDKLCK
W5PXZ3_SHEEP/7-176......QNYLEENLKAVTNIM..VAQFLQKLTYEEVQIIVQELLDLAEKCK.SLKSHE.LPSES..CHQLMTTFLEHICN
G1Q092_MYOLU/39-210....NSQNYLEENLRDIISIM..VAQFLQKSTYEEVQTIVEELLDFAEKCK.SLKLHE.SPLEC..SYQLMTTFLEHICN
F6XRB3_CALJA/414-592QSCGLFRKLGEYYLQNVFLIA..YTKKAPQLTSSELVAITRKMAATAATCC..QLSED.ELLACGEGA..ADIIIGHLCI
F8VQ07_MOUSE/37-204.......DHLEENLGVSVSIM..VAQFLQDAAYDQVQTIAKELLKLAEKCK.RLKP.E.SPSEC..AHQLVAAFLIHICN
G5B5P1_HETGA/414-592RSCSLFQKLGEYYLQNAFLIA..YTKKAPQLTSSELMAFTRKMVTTAATCC..QLSGD.KQLACGEGA..ADLIIGQLCI
M3YCX1_MUSPF/237-409HLCEIGIKFKHQVAKAVELVL..LTKKLPEGNFSEIARLAVDAQNLHQACC.....EG.DVVTCVLGR...SQLMNYTFS
AFAM_MOUSE/32-202..FNATQKFIDENTTYLAIIA..FSQYVQEASFDEVETLVKVMLDYRDRCW....ADN.TLPEC..SKTANDAIQDMLCD
E1BV96_CHICK/33-199SIGQRFSQLQENNFTAIAMIM..FAQYVQGNTFGQVVKMAEAVTDLAKKCT...EVDR.DNPNC..RKPLDWIFLNTICQ
ALBU_MOUSE/30-202EIAHRYNDLGEQHFKGLVLIA..FSQYLQKCSYDEHAKLVQEVTDFAKTCV....ADE.SAANC..DKSLHTLFGDKLCA
G1TBD0_RABIT/29-203SILDSSKCSAGMNLVDLATIF..VTQFAQEATYEEISKMVRDVLTIIKAPN....KDA.CSSASWLISLKLPAFLEEICH
G1SU82_RABIT/218-385RVCSQYAAYGKEKSRRSHLIK..LAQKAPTAALKEVLPLAEDITNILSKCC.....ES.TSEDCMAKE..LPEHTVKIC.
F7G172_ORNAN/199-365SMCSRYAAYGK.KFKYSSMLK..IAQKVPSADFKDAEFLSEDSIRMLSKCC.....DS.DAEDCMAL...LPEHVEKVC.
L9L5Y8_TUPCH/121-286.KLLIFKKFHKK.....ELVL..LTKKQPKADFSEIAKLTTDTKNLHQICC.....DG.NAVACALGR...AQLMSYICS
Q6WDN9_CAVPO/414-592QNCELFDKLGEYGFQNALAVR..YTQKAPQVSTPTLVEYARKLGSVGTKCC..SLPET.ERLSCTENY..LALILNRLCI
G1SHH2_RABIT/33-202...SVTQKFIEENAGYLTIIA..FAQYVQEATFEEVQMLMKDMLEYKDKCL....ADK.TLPEC..AETANNILQEKICA
M3X557_FELCA/30-202SILDSSQCSAEMNFVDLATIF..FAQFVQEATYKEVSKMVKDILTVIEKST....GSE.QPVGC..LENQLSAFLDEICH
F7G172_ORNAN/8-180KVCREFASLGKDDFRSLSIVM..HSKKYPRASFSEVIALVNEVVSLTETCC....AQG.ADPDCYDEG..ASALSAKSCE
ALBU_BOVIN/30-201EIAHRFKDLGEEHFKGLVLIA..FSQYLQQCPFDEHVKLVNELTEFAKTCV....ADE.SHAGC..EKSLHTLFGDELCK
H2QPN0_PANTR/414-590QECKHFQNLGKDGLKYHYLIR..LTKIAPQLSTEELVSLGEKMVTAFTTCC..TLSEE...FACVDNL..ADLVFGELCG
H3A4E6_LATCH/224-398SICQITKKFGTRVIQAKKLVE..YSQKLPQVSFSEVFQMIQKITAVNKLCC.....EG.DMMKCVLKR...KELIENVCS
M3YCX1_MUSPF/429-607HHCDLHEKLGEADFHDRLIIL..YTKKAPQLSAQELVMFTKNMAAAATKCC..PLRDE.QRFACMEDS..AKLILGALCR
H9GU02_ANOCA/233-405HSCHILKTFRKRAIMALKFVQ..LSQKFPKAEVLTIDKLAEDIARSQEKCC.....KG.DTLECFLER...ANVTSYICS
G3IMS6_CRIGR/247-425QSCALHQKLGDYYFQKVFLIA..YTRKIPQLTSAELIDLTRKMVSIASTCC..QLSEE.NWSACGEAA..ADLFIGHLCL
L5LFJ8_MYODS/514-692KNCETFDKLGEYGFQNALLVR..YTKKLPQVSTPTLVDVSRKLGRVGSYCC..KLPEV.KRMGCAEDY..LSVVLNWLCV
I3MJG0_SPETR/223-394.KCSVLEKYEERGLKAWLISR..LSRKFPQAEFTEITKIATDLTKIIKESC.....SG.DLLESTHDR...VTLANYICE
F7AX94_MONDO/38-209.YLNATQKFLENNIRDVTTVA..FAQFVQEATYEEITGLVKQMILYRDKCV....ADM.QQPEC..SELAIYVMQDKICR

PF09164

F6SKH8_XENTR/404-468ELCGDYHKYPFLEFKERLNKA--LSRRVPKLSTSQVKEMVEARSSLASTCC-----------------------------
M3YD76_MUSPF/405-469KLCADYSENTFTEYKKKLAEQ--LKAQLPDASALELQGLIDKRSDFASKCC-----------------------------
G1KNL0_ANOCA/408-471QLCDDYTDHIFLEFKKRLRDT--YVKKFPNATEAVLSALVQQRGRFASTCC-----------------------------
U3JDX2_FICAL/431-495QLCGLYHRLPFLDFKKRLREI--LAQAEPEAGPEHLEQLLEQRVSFASTCC-----------------------------
VTDB_RAT/405-469EMCADYSENTFTEYKKKLAER--LRTKMPNASPEELADMVAKHSDFASKCC-----------------------------
F7G172_ORNAN/385-447ELCGDYSELTFTEYKKGLTEK--FSQKQPDASPATIKELVERRATFASSCC-----------------------------
H2PDJ5_PONAB/424-488ELCADYSENTFTEYKKKLAER--LRAKLPDATPTELAKLVNKRSDFASNCC-----------------------------
F1NVF3_CHICK/407-471QLCGQYTELNFLDFKKRLRDS--IRQTRPDASPELLTQLTDQRADFASTCC-----------------------------
H0VTA4_CAVPO/405-467ELCADYSENTFTEYKKKLTER--LRTKLPGATPTELAGQVERHSDFASKCC-----------------------------
H2ZZM2_LATCH/323-387EVCLEYKKYDFTDYKKRVAEQ--FKEKLPTATPEELETRIEERTHFASTCC-----------------------------
G3W8R1_SARHA/408-472ELCGDFSQHTFTEYKKRLTEH--FKTKFPETNSKIIKEMVENRTDFASKCC-----------------------------

PF00273

Q5CZZ1_XENTR/223-395.HKDEL..SSKLGKCCDLP.VLERSYCI.VTLENDEVPAELSKPITE.........FTEDPHVCEKYAENQEVFL..GRY
I3MJG0_SPETR/414-592.MHEKNPVSERITKCCSES.FVNKRACF.SALS..VDDTYVPKEFHA......DT.FTFHADICTLPETEQQIKK..QTA
ALBU_BOVIN/413-591.LHEKTPVSEKVTKCCTES.LVNRRPCF.SALT..PDETYVPKAFDE......KL.FTFHADICTLPDTEKQIKK..QTA
G5B5P2_HETGA/222-394.NQETI..SSKLKECCEKP.LLEKAHCI.MEAERDELPDGLPELTTD.........FIEDRDVCTHYTGAKDVFL..GTF
F7AX94_MONDO/421-597.INRNRTINPGVDNCCKSS.YAFSSMCF.KDLT..TDETYTSPTFLP......EL.FTFNLTLCQG.KEEQQKKR..REL
I3MJG0_SPETR/30-202.IATLRDTYGDMADCCANQ.DLERFQCL.IKYK..EDTPTIPPLHPI...........DPDALCISFDESSQNVL..GHF
H3A4E6_LATCH/420-596.NEDLSHLSPNVIHCCNES.YSSRRPCF.TNMK..TDTSYMPPEFSV......DA.FIFHADVCTASPEEISKRK..SYF
F7G7M6_ORNAN/234-412.LHEKTPVSDRVTKCCTDS.FADRRPCF.SALG..VDETFVPKEFNA......DT.FTFHADLCTLPEDQQKAKK..QSV
G3WQH5_SARHA/414-592.LHEKTPVSDRITKCCKDS.LVNRRPCL.SALG..VDDTYVAKPFSA......DT.FTFHADLCTLPEEEKQDKK..QGI
FETA_MOUSE/410-588.RNEASPVNSGISHCCNSS.YSNRRLCI.TSFL..RDETYAPPPFSE......DK.FIFHKDLCQAQGKALQTMK..QEL
I3MD87_SPETR/218-385..DNLSTKNSKFEDCCQEKTPMDIFMCT.YFMP.AAQPPQLPDVQFP...........TNKDVCDAKNTKAM.....DQY
Q68FY4_RAT/218-385..GNLSKKNSKFEECCYETTPMGIFMCS.YFMP.TAEPLQLPAIKLP...........TSKDLCGQSATQAM.....DQY
W5MZW6_LEPOC/30-202.SQEVVTKNE.LADCCAKQ.GEERTKCF.IEHK.KKIPRDLSLMHHL...........PASEKCEEFEKDHIGYM..GHF
W5MZW6_LEPOC/222-396.RDDTLTRTKHLAECCKAS.VIDRGACI.ERMKADDKPKDLSAKVES.........FIKDKDICQKYKADHDAFL..GRF
Q5CZZ1_XENTR/33-203.DPKVGVNYEWTKDCCSKQ.DPERGECF.REHR.DVEHTPVKTL..............SPEQTCTLFKEHPDDLL..SVF
F7B1W2_ORNAN/414-591.FFANRSINPGVTNCCKS..FAFKEPCF.PSLK..VDETYTPPAFSP......EL.FTPNEDWCQLPDMELQRKK..LKL
G1KNL0_ANOCA/220-388..EKLPDSDDRIKQCCTSATDLRKYLCI.YSLP.WAKPVDLPDFVQA...........TEEVLCGEGQERAF.....YEY
G1U9S2_RABIT/30-202.LPSLRDTYGDVADCCEKK.EPERNECF.LHHK..DDKPDLPPFARP...........EADVLCKAFHDDEKAFF..GHY
G3SMX8_LOXAF/415-593.LHEKTPVSERITKCCTES.LVNRRPCF.TALQ..TDETYVPKEFNA......ET.FTFHADLCTLPEDQKQIKK..QSV
W5PXI3_SHEEP/222-394.KQDSI..SSKIKDCCEKN.IPERGECI.IYSNKDDRPNDLSLREAK.........FIESDNVCEKRDADQANFM..AEF
L9L5M3_TUPCH/18-190.IATLRETYGDMADCCAKQ.EPERNECF.LKHK..DDKPSLPALVRP...........EADVMCTSFQESENMFL..GKY
H9GH08_ANOCA/33-205.EQEFANKHG.FSDCCAKA.DAERNECF.LAHK.NATPGFIPPYQKP...........SADVACAKFAENKNEVL..GHY
G1R8T8_NOMLE/414-592.LHEKTPVSDRVTKCCTES.LVNRRPCF.SALE..VDETYVPKEFNA......ET.FTFHADICTLSEKDRQVKK..QTA
G1P2E8_MYOLU/30-202.VASLRDTYGDMADCCTKK.EPERHECF.LKHK..DDNPNLPALVRP...........EPEALCTAFKESDQKLL..GTY
G1P311_MYOLU/222-393.KQDSI..SSKIKECCEKK.IPERGECI.IQS.KDDKPKDLSLKEEK.........FTENKNVCEERNADQDTFM..AKF
G3W8R1_SARHA/220-388..EKLSTKDKRFEHCCGESSPMDIFLCI.YSMP.AAQALKLSEFIKP...........SHEEICSTENNKAL.....DRY
L5LFJ8_MYODS/1290-1466.VNGNRTINPAVDHCCNTN.FAFRRHCF.EALE..ADKTYVPPSASQ......GL.FTFRTDLCQAHDEELQRKK..DRF
F7F9M8_MONDO/218-386..EHLSDKEKEFKNCCGEKNPLDIFLCT.YSMP.AAQPIKLPDIVKP...........TNEEICNTENTNAI.....DRY
I3M260_SPETR/36-202.EKEIFEKYG.LSDCCSRS.GEERHSCL.LAHK.KAAPA.LPPFQVP...........EPATSCKAYEEDRETFM..NRC
G3W8R1_SARHA/29-201.KDAPYPKHPETDKCCTFE.GLERKLCM.AALT..HPPQEFPTYVEP...........TNNEICDSFRMDPRGFA..DEF
L5LFJ8_MYODS/826-1004.RHGETPINAAVGQCCTSS.YANRRPCF.SSLV..VDETYVPPPFSD......DK.FIFHKDLCQAQGVALQTMK..QQF
ALBU_CHICK/226-398.QQDVF..SGKIKDCCEKP.IVERSQCI.MEAEFDEKPADLPSLVEK.........YIEDKEVCKSFEAGHDAFM..AEF
G1P5R0_MYOLU/219-395.NSISV..SPKLEECCNKP.VLEKSHCL.AEKTGDNSDDNVVANTAV....VKSGTFVENKDVCKNYVEAKEDFL..GKF
F1QM90_DANRE/27-199.KDSPFPKHPGIEQCCTLQ.GHERKLCL.ASLR..YSADELPSLLEP...........TNEEICAEYTKDEKQYA..VRY
U3K0R0_FICAL/418-596.RQESTPINDQVSQCCNEL.YSYRRPCF.TAMG..VDAKYVPPPFDP......MM.FNFDAKMCSAPPAEREAGQ..LKM
L9L5M3_TUPCH/779-951.QQEIL..SSKIGKCCKLP.ILELGQCV.IHTENDDQPEGLSPNLNR.........FLGDRDFNQFSSREKNIFL..ASF
H9GH08_ANOCA/417-595.SHEENHINKQICKCCSDN.YFKRRPCF.SELG..VDPEFHPVAFDP......AL.FTFHGDYCDAKEEEQQSMK..QEL
G1P311_MYOLU/33-202.MEGVPQKHN.FSYCCNKG.GFERRLCF.FRNK.KADVGFLPPLPTL...........DPEVKCQAYKNNSESFL..SNY
F6SKW5_XENTR/27-199.PKSPFPKHPGVERCCVHK.GLERKLCL.ADLK..QPPKEFPTYTEP...........SNEKLCESFKENAQLFS..SRF
ALBU_FELCA/30-202.VASLRDKYGEMADCCEKK.EPERNECF.LQHK..DDNPGFGQLVTP...........EADAMCTAFHENEQRFL..GKY
F8VQ07_MOUSE/224-395.NQAIL..SSKFAECCEQP.EPFRGECI.VNSENDDKPDLSPLPLTR.........FTEDWSVCQQFSGNQDSFL..QEF
U3JDX2_FICAL/243-411..TALSGRDGRFADCCRGKNLMENHFCI.LAML.PAPAPQLPEAYEP...........TNKELCGKEGALHA.....TRF
V8ND09_OPHHA/389-567.YHDEHFTNKQVCHCCDSS.FISRWECI.SNLG..PDPSYVPPPFKP......KT.LDAPENLCSPNEETVQNSK..QGL
F7BJP5_MONDO/223-394.NKDSI..SSKLTKCCDKS.LVEKSQCI.ADLENDDLPADLPDFDET.........YVTSKEACQNYKEAKDLFL..ANY
H0VRQ1_CAVPO/414-592.INENRTINPAVDHCCTAN.FAFRRPCF.ESLK..PDKTYIPPPLSQ......DL.SVFPVDWCQSQNEELQGKKYSYRF
G3SMX8_LOXAF/223-395.NQETL..SSKLKECCDKP.VLAKSHCI.AELDKDDPPADLPSIVPD.........YVEDKDVCKNYQEAKDIFL..GTF
F7G7M6_ORNAN/43-214.NQDTF..SSKLKTCCDKP.LVVRSQCV.VDLENDDTPADLPTMASI.........YVEDKEVCNNYAGAKDLFL..ATF
Q6WDN9_CAVPO/30-202.IPSLRETYGELADCCAKE.DPDRVECF.LQHK..DDNPNLPPFERP...........EPEALCTAFKENNDRFI..GHY
G5B5P1_HETGA/222-393.KQDTL..SSKIAECCKLP.LLELGHCI.IHAENDDKPEGLSSDLSK.........FLGDRDFGRFSPGEKTMFL..ASF
G1KNL0_ANOCA/29-201.PNSPFPKHPGTAACCTEE.GLARKLCL.AALK..HPPKEFFTYMEP...........SSDEICEAFKKDPQDIE..DRF
F7CSG0_CALJA/222-394.NQDSL..SSKLKECCEKP.LLEKSHCL.AHVENDEMPADLHALTDD.........YVESKDVCKNYAEAKDVFM..GMF
H0VRQ1_CAVPO/32-202.MEGLPQKYN.FSHCCRKV.DFKRRLCF.FYNK.KANVGFLPPFPTL...........DPEEKCEAYKNTRDSFL..NQY
G3SMX8_LOXAF/30-203RVTAHQDTYGEFAECCGKQ.EPERNECF.LKHK..DDNPALPPLVRP...........PADALCASFEENERKFF..GVY
G1TZC1_RABIT/225-397.KQAIL..SSKITRCCEQP.VPFRGECI.IISENDDKPDLLPLPLSR.........FTEDQFVCKEFTDKQEDFL..QEF
G3WQV0_SARHA/36-203.EKDISEKYG.LADCCSKA.GGNRLECL.LAHKRRSSAASIPEFQIP...........DPSQSCKAHQENRVNFM..NRC
H2ZZM2_LATCH/135-303.GTTLPAKQERLAECCKKQ.TEEALSCM.HLME.QADPPELPELQEP...........SNDQLCTGDQLVI......SKF
H3A4E6_LATCH/31-204.EQGILDKHKGLSDCCSKA.GHERDECF.LKHR.KESPRDFPPIPKL...........ENEERCKKFQEDKLTFM..GQY
F1RUL9_PIG/7-176.NQGMAGKHV.FYDCCNIN.NTASHRCF.LLHK.KDDAAYSDIFHIS...........NPEQICGLDKENRMSVK..ERY
G3WQH5_SARHA/223-394.NKETI..STKLGECCDKP.LIEKSQCI.ADLGNDAIPDGLPDLLAE.........YVNTKDACQNYKEAKDLFL..ATY
F7BAY6_HORSE/413-591.LHEKTPVSEKITKCCTDS.LAERRPCF.SALE..LDEGYVPKEFKA......ET.FTFHADICTLPEDEKQIKK..QSA
I3LN42_PIG/218-385..DNLSSKNSKFTDCCQEKTPMDIFICT.YFMP.AAPRPELPDVKLP...........TNKDVCDKGNPKVL.....DQY
C9JKR2_HUMAN/30-202.NQDSI..SSKLKECCEKP.LLEKSHCI.AEVENDEMPADLPSLAAD.........FVESKDVCKNYAEAKDVFL..GMF
F6VJ19_MONDO/36-203.DKDISDKHG.LADCCSVV.GSDRLGCL.LAHKRRGSAASIPEFQVP...........EAVHSCKAHGENPATFM..NRY
G5B5P2_HETGA/30-202.IQTLRETYGALADCCAKQ.EPERNECF.LEHK..EDNPALPPFKRP...........EPEAMCTSFNEDNQLFM..GHY
FETA_RAT/36-204.ETELSNKYG.FSGCCNQS.GVERHQCL.LARK.KTAPDSVPPFHFP...........ETAESCPAYEENRAMSI..NTF
L5K939_PTEAL/30-202.VASLRETYGELADCCEKQ.DPERNECF.LKHK..DDDPNLPPVVKP...........EPEALCTAFQENNNKFL..ENY
AFAM_MOUSE/222-394.KQDSI..SSKIKVCCEKK.TLEREACI.INANKDDRPEGLSLREAK.........FTESENVCQERDSDPDKFF..AEF
L5LH53_MYODS/221-396.NQASI..SPTLKECCNKP.VLEKSHCL.AEKTGVDSTANLAANLAV....VAAG.FVEKNDICKNYMEAKDDFL..GKF
F7B1W2_ORNAN/222-394.NQKAI..SSQFSNCCDKP.VPERGECI.FRSVREDAPQDLPPTEEK.........FIRAQDVCQRYADKKDGFL..DEF
G1TZC1_RABIT/417-596.RHAAEPINAAVGHCCDDS.YAFRKPCF.DDLQ..IDRTYVAPSLSC......HQIIRLKEDLCGAQEEELHIEK..QKF
F7IGI3_CALJA/28-200.RNSPFPVHPGTAECCTKE.GLERKLCM.AALK..HPPEEFPSYVEP...........TNDEICEAFRKDPKEFA..NHF
U3K0R0_FICAL/34-206.VDKLRDSYGDMADCCGKA.DPERNQCF.LSYK.VHQPDFIPPYQRP...........AADVICNEYKDHRVQLL..GNF
ALBU_BOVIN/221-393.NQDTI..SSKLKECCDKP.LLEKSHCI.AEVEKDAIPENLPPLTAD.........FAEDKDVCKNYQEAKDAFL..GSF
Q5CZZ1_XENTR/415-593.KQKKNFANDGVAHCCSDS.YSGMRSCF.TALG..PDTNYVPPPVTD......DT.FHFDDKICTANEKEQQHIK..QTF
F1RUN2_PIG/30-201.IPSLREHYGDLADCCEKE.EPERNECF.LQHK..NDNPDIPKL.KP...........DPVALCADFQEDEQKFW..GKY
M3YCX1_MUSPF/47-217.NHGKADKEE.FSHCCNIN.NKARLKCF.LLYK.KDDAGYSDISQIP...........NPEQICEMDDENQVSVK..ERY
F8VQ07_MOUSE/416-595.RHGGKPVNAGVGHCCDDS.YAFRKPCF.DDLR..VDGTYISPPLSC......DQAISLKEDLCQAQDEELQMEK..QKL
G3UIJ9_LOXAF/215-386.QQDAL..SSKIAECCKLP.TLELAHCI.IQAENDDKPEGLSPNINR.........FLGDRDFNQFSSLEKDIFL..ASF
VTDB_MOUSE/27-199.SDAPFPVHPGTPECCTKE.GLERKLCM.AALS..HQPQEFPTYVEP...........TNDEICEAFRRDPKGFA..DQF
H2QPN0_PANTR/31-202.MEGLPQKHN.FSHCCSKV.DAQRRHCF.FYNK.KSDVGFLPPFPTL...........DPEEKCQAYESNRESLL..NHF
L5LFJ8_MYODS/322-494.NQDSV..SSKLKECCAKP.LLEKSQCL.AEVENDDLPSDLPSLNAD.........YVDDKDVCKNYKEAKDVFL..GTF
G1U9S2_RABIT/222-394.HQETI..SSHLKECCDKP.ILEKAHCI.YGLHNDETPAGLPAVAEE.........FVEDKDVCKNYEEAKDLFL..GKF
G3WRB2_SARHA/228-401.RPDSL..SSKIRDCCQLT.IPERGECILIHSENDDKPKDLSPRVER.........FLEGDDVCQRLHEDKENFL..IEF
G1P5R5_MYOLU/216-383..DNLSTKNDKFRDCCQERTPMDIFMCV.YFTP.ATQPPELPEVELP...........TSKDVCGKGNTKAM.....DRY
H0X1I9_OTOGA/30-202.EKEISEKYG.LSDCCSQS.DEDRLNCL.LTHK.KPTPVSIPPFQLP...........EPILSCKAYEEDRAAFI..NRY
H9GU02_ANOCA/429-599.RHEEHPINRKFGQCCEDS.YINRQECF.IGLG..IDEEYVPLPFDP......EL.FAFHGDFCLA.NTDQQVKQ..QRL
G5B5P2_HETGA/414-592.LHEKTPVSDRVTKCCTES.LVNRRPCF.SALQ..LDETYVPKQFTD......ET.FTIHADVCTLPEEEQQIMK..QMT
E1BV96_CHICK/420-598.RHLTNPINPAVCHCCSSS.YALRRPCM.GKLE..IDENYVPLSLTP......DL.FTFHEDLCTTEEEKLQHRK..QEM
F6YY93_HORSE/40-209.NQGMADKHM.FSDCCNVN.NTERQKCF.LLYK.KDDAGYSDMFQIP...........NPEQICEMDKENRMPVK..ERY
F6VJ37_MONDO/216-381..ESLSGKEKEFKNCCEEKNRMNIFLCI.YSMP.AAQPSKLSD..NP...........SNEKTCNTENTNKI.....EKY
F7AX94_MONDO/229-401.KPDSI..SSKIIDCCQLT.IPQGGECI.INSGNDDKPEDLSPRAER.........FTEGDDVCQSLHEDKENFQ..AKF
H0VRQ1_CAVPO/222-394.KQDSI..SSKIKECCEKK.IPEREDCI.INSNKDDRPKNVSLTEAK.........LTGSEHLCQERDTDPDNFF..AKF
H9GH08_ANOCA/225-397.HQNEI..SSKLSACCEKP.VVERGECI.VHLENDDKPADLSETVRE.........FVDNKEVCQHYADNKNQHL..AKF
ALBU_CHICK/418-596.KQETTPINDNVSQCCSQL.YANRRPCF.TAMG..VDTKYVPPPFNP......DM.FSFDEKLCSAPAEEREVGQ..MKL
F6SKW5_XENTR/218-385..KKFTSKDAKVAECCKKS.PIETLHCL.YTLP.SAEPVQLPTLQWP...........SSDELCKKGKNQEI.....VKY
W5MZW6_LEPOC/417-596.ETDPATVNPHIDQCCKES.YSARRPCI.LKIQ..PDQEFKPPALTD......DS.FPIGAALCDMKPHDLFGAA..KRL
AFAM_MOUSE/414-590.VNTNRTINPAVDHCCKTD.FAFRRHCF.EHLK..ADTTYELPSVSA......LV.SALHTDWCQPRKEDLQNKK..HRF
FETA_BOVIN/222-395.QQDIL..SRQIAECCKLPTTLELGHCI.IHAENDDKPEGLSPNVNR.........FLGDRDFNQLSSRDKDLSM..ARF
G1TBD0_RABIT/415-593.RHEATPVNPGVGQCCTSS.YANRALCF.NKLV..LDETYVPPPFSA......DK.FIFHADLCQAQGIALQTMK..QEF
G1TBD0_RABIT/223-394.QQHIL..PSTIAECCKLP.ILELGHCI.IHAENDDKPEGLSPHLHR.........FLGDRDFNQFSSQQKNIFL..ASF
F7HAH7_MACMU/132-301.YFAPV..KSECNFTFESE.FPRKSICI.VYGNSGTIDVKSSIQRGN.........ILNL..ICLEEVSFSNPFD..CRF
W5KYJ2_ASTMX/31-203.KDSPFPKHPGIEQCCTVQ.GHERRLCL.ATLR..YSSDELPSMMEP...........MPEEICTQYTKDPSGYA..MRY
E1BV96_CHICK/228-399.NQDVI..SSKIKKCCEKP.LLQRSECI.VNAENDDKPANLSPQVRE.........FIEDKGICERFAQEKDTHL..ARF
V8ND09_OPHHA/197-369.HKDAI..SSNVGHCCEKP.LVERPNCL.ATLENDASSPDLPPPSGE.........ILKESEACKSYTEHRDDYK..ESF
U3IUC3_ANAPL/219-387..AALSTKDERFADCCAGKDLMQNYFCI.TALK.PATAPKLPELQKP...........TNKHLCGDDGALHA.....RRY
F7FAY5_RAT/37-205.NQGLVDNQV.FTDCCKRE.NAARLRCF.LSYK.KDDADSRDTPLMP...........RPELICAMAEEGNVSLK..LRY
ALBU_CHICK/33-206.VEKLRDSYGAMADCCSKA.DPERNECF.LSFK.VSQPDFVQPYQRP...........ASDVICQEYQDNRVSFL..GHF
G5B5P1_HETGA/30-202.ERAIAGKYG.LADCCAHS.EEERHKCF.LARK.KAATVSIPPLQAP...........DVVTSCKVYEENREMFI..NKY
F6XRB3_CALJA/222-394.QQDTL..SNKIAECCKLT.TLERGHCV.INAENDEKPEGLSPNLNR.........FLGDKDFNQFSSEEKNIFL..ASY
G3WQV0_SARHA/223-394.QKDIL..SNQVQECCSLP.LRDRGECI.VGAENDGQPEGLSPNLRG.........FLEETKFHLYSSAEKDLFL..ARF
FETA_MOUSE/218-389.QQNIL..SSKIAECCKLP.MIQLGFCI.IHAENGVKPEGLSLNPSQ.........FLGDRNFAQFSSEEKIMFM..ASF
L9L5M3_TUPCH/432-610.AHEKAPVSDRITKCCSES.LVNRRPCF.SALP..PDDTFEPKKFEA......DS.FTFHADICTIPDTEKQIKK..QTA
M3YCY0_MUSPF/414-590.LNENRNINPDVDHCCKTN.FAFRRPCF.EGLE..ADKTYKPPCTPQ......DL.FVFHTDLCQSHNEELQRKK..DRF
FETA_BOVIN/37-202.EKEIPEKYG.LSDCCSRT.GEERHDCF.LAHK.KAAPASIPPFPVL...........EPVTSCKSYKENRELFI..NRY
L5LI30_MYODS/260-431.NQASI..SPTLKECCNKP.VLEKSHCL.AEKAGDNSAANVAANVAANLAPVTAA.FVENKDVCKNYMEAKDDFL..GKF
FETA_MOUSE/30-198.ETELSNKYG.LSGCCSQS.GVERHQCL.LARK.KTAPASVPPFQFP...........EPAESCKAHEENRAVFM..NRF
G3QZW5_GORGO/30-202.EKEILEKYG.LSDCCSQS.EEGRHNCF.LAHK.KPTPASIPLFQVP...........EPVTSCEAYEEDRETFM..NKF
F7BAY6_HORSE/30-201.VATLRATYGELADCCEKQ.EPERNECF.LTHK..DDHPNLPKL.KP...........EPDAQCAAFQEDPDKFL..GKY
W5PXI3_SHEEP/33-202.MEGLPQKYN.FSHCCRKV.DFERRLCF.FHNK.KADIGFLPPLPTL...........DPEEKCQTYKNNRESFL..NNY
U3IUC3_ANAPL/28-200.PDSPFPAHPGTAACCVHQ.GLEQKLCL.AALQ..HPPRQLPHYIEP...........SNEELCQAFKKDPKDFA..DRF
U3JDX2_FICAL/52-224.ADSPFPAHPGTAECCAQA.GLERKLCL.AALR..HPPQPLPRYLQP...........SDRELCQAFRRDPREFA..DRF
F7BAY6_HORSE/221-393.HQDSI..SGKLKACCDKP.LLQKSHCI.AEVKEDDLPSDLPALAAD.........FAEDKEICKHYKDAKDVFL..GTF
G3WRB2_SARHA/421-596.INKNRTINPTVDNCCASS.SAFRPLCF.NDLP..EDETYTPPTFLP......EM.FTFNISLCQ..EMELQRKR..REL
F6VJ19_MONDO/223-395.QQDVL..SSKIQECCSLP.LRDQGDCI.VNAENDDQPEGLSPDLRR.........FLGERKFNLYSSEEKDLFL..ARF
L5LH53_MYODS/32-200.VESL....GDLAECCAKQ.EPERNQCF.LKHK..DDDLDIPPLAAT...........DPSAICTAFHQFEQKVL..GKF
FETA_HORSE/222-394.QEDIL..SSSIVECCKLP.TVELAQCI.IHAENDDKPEGLSPNLNR.........LLGERDFNQFSSKEKDLFM..ARF
I3L5N3_PIG/155-334.RHETEPINAGVGHCCDDS.YAFRKPCF.DDLQ..VDGTYISPPLSC......DKVINLKEDLCKAQEQEFQTEK..QRF
L9L5M3_TUPCH/1319-1495.INKNRTINPAVDHCCLTN.PAFRRHCF.ESLE..ADKTYVPPPTSR......DL.FIFHTDLCQAPNEELQKKK..DRF
G5BE53_HETGA/218-385..DNLSKKNSKFENCCQEEAPLGIFTCI.YFMP.AALPLELPAIELP...........TSTEICDQRNTKAL.....DQY
F7FAY5_RAT/417-596.RHGGKPVNAGVGRCCDDS.YAFRKPCF.DDLQ..ADGTYISPPLAC......DQVISLKEDLCQAQDEELQTEK..QKL
F7BJP5_MONDO/414-592.QHEKTPVSDKITKCCTES.LVNRRPCF.TALG..VDETYEPKAFSA......DT.FTFHADLCTLPEEEKQTKK..QTV
F6VJ19_MONDO/415-593.RHEAQPINDGVGHCCDSS.YANRRPCF.SNFV..RDEKYVPPPFSH......DQ.FNFRQDLCHAQGEELQKKK..QEF
ALBU_MOUSE/414-592.LHEKTPVSEHVTKCCSGS.LVERRPCF.SALT..VDETYVPKEFKA......ET.FTFHSDICTLPEKEKQIKK..QTA
H0X1I5_OTOGA/30-202.VASLREKYGEMADCCAKQ.EPERNQCF.LDHK..DDKPDLPPLVRP...........EVDVMCTSFQDNEKTFL..GHY
G3U4C2_LOXAF/253-434.RHEAKPINAGVRHCCEDS.YAFRKPCF.DDLP..ADETYVSPSLSC......DQVISLKEDLCKAPEEKLQTEK..QKL
ALBU_MOUSE/222-394.NQATI..SSKLQTCCDKP.LLKKAHCL.SEVEHDTMPADLPAIAAD.........FVEDQEVCKNYAEAKDVFL..GTF
G1TZC1_RABIT/33-205.NPGMLDKHG.SSHCCNTS.NTARHKCF.LSYK.KDDADYSDIFQIP...........NAEHICEMDKENHVSVK..DRY
G3T7Q0_LOXAF/173-344.GQSST..SSKIKECCEKK.TSERHDCL.LHLD.KEKPKDLSLRVAK.........FTDSKDVCQHQDADQENFM..NKY
U3K0R0_FICAL/226-398.KQDVF..SSKIKPCCELP.VLERTRCI.IEADFDDKPDNLPSLVEK.........YIQDKEVCKSYEPNHDAFL..SEF
H2QPN0_PANTR/222-394.KQDSI..SSKIKECCEKK.IPERGQCI.INSNKDDRPKDLSLREGK.........FTDSENVCQERDADPDTFF..AKF
L5K939_PTEAL/414-592.LHEKTPVSDKITKCCTDS.LVNRRPCF.SSLE..ADETYVPKEFNA......ET.FTFHADVCTLPDHEKHLKT..QTA
L5K939_PTEAL/222-394.NQDSF..SSKLKECCDKP.LLEKSHCI.SELENDDLPNDLPSITTD.........FVEDKDVCKNYKEAKDVFL..GTF
F7IGI3_CALJA/219-386..EHLSTKNSKFEDCCQEKTPMDVFVCI.YFMP.AAQTPELPDVELP...........TNKDVCDSGNTKAL.....DKY
G3T7Q0_LOXAF/370-548.VNKNRTINPAMDQCCKSS.PAFGRHCF.EGLK..ADETYVPPSASK......GL.FTFHTDLCQARNGAFQRKK..ERY
Q6WDN9_CAVPO/222-394.HQDSI..SSKLKECCVKP.TLQKAHCI.LEIQRDELPTELPDLAVD.........FVEDKEVCKNFAEAKDVFL..GTF
G1SHH2_RABIT/378-554.IKENRTINPAVDHCCQTN.FAFRRPCF.EGLK..ADQTYVPPPTSQ......DF.FAFPLDWCQDQKEELQRKK..DRF
F7B3I5_HORSE/33-202.VKGLPQKYN.FSHCCSMV.DLERERCF.FHNK.KSDVGFLPPLPTL...........DLEEKCQTYKNNRESFL..NNC
F7F9M8_MONDO/27-199.HDAPFPKHPDTHKCCAQE.GLERKLCM.AALV..HPPQEFPTYKES...........SNEEICESFRKNPRDFA..EKF
G3WRB2_SARHA/37-208.VKELSEKYG.FSECCTED.ISKSRLCF.FERK.RTDVSFLTPFQIP...........DPEKGCQEYEADQETFL..NHY
G3WQH5_SARHA/30-202.VPSLRENYGEMADCCAKE.EPERHRCF.LSHK..DDQPNLPKIEAP...........EPETLCKNFQENENRVL..GFY
W5PXZ3_SHEEP/7-176.NEGMADKRV.FSDCCNIN.KTARHKCF.LLHK.KDDAGYSEIFQIS...........NPEQICEMDKENQVPVK..DQY
G1Q092_MYOLU/39-210.NQGMVDKHV.FSDCCNVN.NTARHKCF.LLNK.KDDDNYREILQIP...........NLEQICEVNKGNQVLVK..KRY
F6XRB3_CALJA/414-592.RHDTTPVNPGVGQCCTSS.YANRRPCF.GSLV..VDETYVPPAFSG......DK.FIFHKDLCQTEGLALHTMI..QEF
F8VQ07_MOUSE/37-204.NQGLVDSHV.FTDCCKMK.TAARLRCF.LSYK.KDDADSHDTPLIP...........RPELTCEVAAENNVSLK..ERF
G5B5P1_HETGA/414-592.RHDASPVNPGVGICCNSS.YANRRPCF.SSLV..VDETYVSPPFSA......DK.FIFHKDLCQAHGVALQEMK..QEL
M3YCX1_MUSPF/237-409.KQLSL..SSKISLCCAQL.APFRGECV.ISSENEQKPHLASLPLGR.........FTEDRSVCEQFSHEPDDFL..QEF
AFAM_MOUSE/32-202.MEGLPQKHN.FSHCCGKA.GFPRRLCF.FYNK.KANVGFLPPFPTL...........DPEEKCQAYKNNSESFL..HLY
E1BV96_CHICK/33-199.....EDNLPRFTDCCAKK.DPERNDCF.LSLK.NSSRGFISPFERP...........NAEAACKNYSEHRHSLP..GYF
ALBU_MOUSE/30-202.IPNLRENYGELADCCTKQ.EPERNECF.LQHK..DDNPSLPPFERP...........EAEAMCTSFKENPTTFM..GHY
G1TBD0_RABIT/29-203.ETEISEKCG.LAECCRQG.GDDRHRCF.LAHK.KAAHASIPPFQVP...........EPVSGCKAYEENREAFM..NRY
G1SU82_RABIT/218-385..DSLSTKNPKFEECCQEKTPMDIFVCT.YFMP.AAQPPEPANVELP...........TSKDVCDSKNINVM.....DQY
F7G172_ORNAN/199-365..DRLSTKDSQIQSCCQENTPMDIVLCL.YSKP.PAKSPKPADLPRP...........TNEDMCSTENPKAL.....DRY
L9L5Y8_TUPCH/121-286.NQAML..SSKITQCCEQP.APFRGECI.INSEND.RPALSSLPLSR.........FTEDPFVCKHFADKEDDFL..QEF
Q6WDN9_CAVPO/414-592.LHEKTPVSERVTKCCTES.LVNRRPCF.SALH..VDETYVPKPFHA......DS.FTFHADICTLPEKEKQVKK..QMA
G1SHH2_RABIT/33-202.MEGLSQRHN.FSHCCSKV.DFERRLCF.FYNK.KADVGFLPPFLTL...........DPEEKCQAYKNSRDSFL..NHY
M3X557_FELCA/30-202.EKEISEKYG.LSDCCSQS.EEERHNCL.LAHK.KATPSSIPPFQVP...........EPVTSCKAYEENRDMFL..NRY
F7G172_ORNAN/8-180.KDSPFPRHPDVAECCAKG.GLERKLCM.AALM..QPPQEFPTYVEP...........SNDETCEAFKKDPKGFA..EQF
ALBU_BOVIN/30-201.VASLRETYGDMADCCEKQ.EPERNECF.LSHK..DDSPDLPKL.KP...........DPNTLCDEFKADEKKFW..GKY
H2QPN0_PANTR/414-590.VNENRTINPAVDHCCKTN.FAFRRPCF.ESLK..ADKTYVPPPFSQ......DL.FTFHADMCQSQNEELQRKT..DRF
H3A4E6_LATCH/224-398.NQESIKRTKHLAECCNRP.LVERGLCI.TTMEPDEKPKDLSERIGE.........FIEDQQICKNFTEGQDLFL..GRF
M3YCX1_MUSPF/429-607.RHEAEPINAGVGHCCDDS.YAFRKLCF.DDLQ..VDGTYISPPLSC......DQVISLKENLCKAQ.EEFQTEK..QKL
H9GU02_ANOCA/233-405.HQDTL..SSKLEVCCQKP.FLEQNACI.MSMENDEKPADLSPDLRE.........FMDKEDQCPRYAENQNPLL..AEL
G3IMS6_CRIGR/247-425.RHEANPLNPGIGHCCNSS.YSNRRPCI.TSLV..MDESYVPPPFSA......DK.FTLNKDLCQAQGQALQTMK..QEL
L5LFJ8_MYODS/514-692.SHEKAPVSDRVTKCCTES.LVNRRPCF.SALE..ADETYAPKDFNA......DT.FTFHADVCALPVPEQQVKK..QTA
I3MJG0_SPETR/223-394.NQDKI..SKKVGECCVKP.LLERYHCI.IDLEEDDKLADLPALTAD.........YAEDKDVCKNYAEAKDIFL..GMF
F7AX94_MONDO/38-209.VKELSDKYG.LSECCTKN.STNRLPCF.FQRK.SADASFLTPFQGP...........DPEKACQEYAEDPEAFL..NHF

PF09164

F6SKH8_XENTR/404-468--------------------LINAPPVY----------------------------------------------------
M3YD76_MUSPF/405-469--------------------SINSPPLY----------------------------------------------------
G1KNL0_ANOCA/408-471--------------------FLNAPPSY----------------------------------------------------
U3JDX2_FICAL/431-495--------------------LPDAPPLL----------------------------------------------------
VTDB_RAT/405-469--------------------SINSPPRY----------------------------------------------------
F7G172_ORNAN/385-447--------------------ISNAPPRY----------------------------------------------------
H2PDJ5_PONAB/424-488--------------------SINSPPLY----------------------------------------------------
F1NVF3_CHICK/407-471--------------------PANSPPLY----------------------------------------------------
H0VTA4_CAVPO/405-467--------------------SINSPPRY----------------------------------------------------
H2ZZM2_LATCH/323-387--------------------SQQAPTIY----------------------------------------------------
G3W8R1_SARHA/408-472--------------------LMNSPPLY----------------------------------------------------

PF00273

Q5CZZ1_XENTR/223-395LHAVSR..KHQELSKEFLVQSAKEYETLLNKCCKTDNPPDCY
I3MJG0_SPETR/414-592LAELVK..HKPTATIDQLKTVMGDFVAFLDKCCKADDKDTCF
ALBU_BOVIN/413-591LVELLK..HKPKATEEQLKTVMENFVAFVDKCCAADDKEACF
G5B5P2_HETGA/222-394LFEYSR..RNPDYSIGMLLRLAKAYEAKLEKCCAEADPPACY
F7AX94_MONDO/421-597MVHLLQ..QKPHLGVDQVMPLLSDFSKMTD.CCEVEEKETCF
I3MJG0_SPETR/30-202VYEVAR..RNPYLCGQKVMYFAEKYKGFLTECCKAADKGECL
H3A4E6_LATCH/420-596LTKLVK..WKPTINDEQLKKTIKVFEDLKDQCCKTDDPGNCF
F7G7M6_ORNAN/234-412LVELVK..HKPKATDDQLKGIVTDFTAMVTKCCGEADKEACF
G3WQH5_SARHA/414-592LVELVK..HKPKITDDQLKGVITDFTAFVDKCCKADNQEACF
FETA_MOUSE/410-588LINLVK..QKPELTEEQLAAVTADFSGLLEKCCKAQDQEVCF
I3MD87_SPETR/218-385AFELSR..RTH.IPEVFLSKILTLTLKTLSECCDSQNPASCF
Q68FY4_RAT/218-385TFELSR..RTQ.VPEVFLSKVLDTTLKTLRECCDTQDSVSCF
W5MZW6_LEPOC/30-202IFRFSK..RNVLLQPQVILGIADGYEKTLTECCKAADAKHCL
W5MZW6_LEPOC/222-396IYEYSR..RHQELSIQMILRIGKAYEEILKKCCETDDPPACY
Q5CZZ1_XENTR/33-203IHEEAR..HHPDLYPPAVLLLTKQYQKTVEHCCEEEDKEQCF
F7B1W2_ORNAN/414-591LINLVK..HKPQTPDDQLQTALTDFSDVVKKCCQASGPGACF
G1KNL0_ANOCA/220-388IHYTAR..KFPRAPEAIHTALYDAGQKFVNACCSDPDFNACF
G1U9S2_RABIT/30-202LYEVAR..RHPYFYAPELLYYAQKYKAILTECCEAADKGACL
G3SMX8_LOXAF/415-593LVELVK..HKPKATDEQLKTVTGQFTGMVEKCCAAEDKEACF
W5PXI3_SHEEP/222-394LYEYSR..RHPELSTPELLRIAKVYEDLLKECCNMENPPECY
L9L5M3_TUPCH/18-190LYEVAR..RHPYFYAPELLYYAQKYKTALKECCAEADKAACL
H9GH08_ANOCA/33-205IYEVSR..RSPFAPVATVYKSTAAYEHVLTSCCAKEDKGACF
G1R8T8_NOMLE/414-592LVELVK..HKPKATKEQLKTVMEDFAAFVEKCCKADDKETCF
G1P2E8_MYOLU/30-202LYEVAR..RHPFFYGPELLYFAQEYKGVLTECCEAADKAACL
G1P311_MYOLU/222-393LYEYSR..RHQELSTPELLRIARVYDDLLRECCNAENPPDCY
G3W8R1_SARHA/220-388MYEQSR..RKPNIPEVFVTKLHGLMFKVMSDCCKSVEPEACL
L5LFJ8_MYODS/1290-1466LVNLVK..LKPELTDEELRSSLTEFTNLVDKCCKAEGPEACF
F7F9M8_MONDO/218-386TYEISR..RNPYIPEVFITKVHSLSKEVLSECCKAVEPQACL
I3M260_SPETR/36-202IYEISR..RHPFLYAPTILSLAAGYDKIIPLCCKAENAAECF
G3W8R1_SARHA/29-201LYEYSS..NYGQAPLPLLVSYTRNYLSMVGTCCTSANPTACF
L5LFJ8_MYODS/826-1004LINLVK..QKPQISEEQLEAVIADFSGLLEKCCQGQEQEVCF
ALBU_CHICK/226-398VYEYSR..RHPEFSIQLIMRIAKGYESLLEKCCKTDNPAECY
G1P5R0_MYOLU/219-395LYEYSR..KHPHYSVSLLLRLAQMYEATLEKCCATDDAHACY
F1QM90_DANRE/27-199AYEFAR..RHRNIPAGFVLNATQHHVRMAARCCRPAVKNSCF
U3K0R0_FICAL/418-596LINLIK..RKPQMTEEQLKTIGEGFTAMMEKCCKQADIELCL
L9L5M3_TUPCH/779-951IHEYSR..RHLELAVPVILRVAKGYQEVLEKCFQSENPLECQ
H9GH08_ANOCA/417-595LVNLIK..HRPTISNEQLAVATVDFVTMVTKCCAVENHVECL
G1P311_MYOLU/33-202IYEVSR..RNPFVFTPTLLTVMGLIEEMAKTCCEEQDKANCF
F6SKW5_XENTR/27-199LYDYSS..NYAQTPFLVVVNYTEKYLKMITECCTKPRQTQCF
ALBU_FELCA/30-202LYEIAR..RHPYFYAPELLYYAEEYKGVFTECCEAADKAACL
F8VQ07_MOUSE/224-395LYEYSR..RHLELAVPVILRVFETYKRVLEKCCKLENSLEC.
U3JDX2_FICAL/243-411LFEQAR..RRPCLPDAVLAKLYDSSGKLRAGCCSTKDPSACL
V8ND09_OPHHA/389-567LSDLIK..SKPNIADEELAVGILAFRELQTDCCAAENKKECF
F7BJP5_MONDO/223-394LYDSAR..RGANLAVTTLLRLAKGYETTLEECCATDDPPSCY
H0VRQ1_CAVPO/414-592LIQLVR..LKLQLADKELLSLLTQFITGVKKCCTAPEPEACF
G3SMX8_LOXAF/223-395LYEYSR..RHPEYSAFLLLRIAKEYEATLERCCAAADPHACY
F7G7M6_ORNAN/43-214LYDYAR..RHTDFSSVLLLRVAKGYQAKLTECCAGDDPNACL
Q6WDN9_CAVPO/30-202LYEVSR..RHPYFYAPELLYYAEKYKNALTECCEAADKAACL
G5B5P1_HETGA/222-393IHEYSR..RHTELAVSIILRVANGYQELLEKCFQSENTLEC.
G1KNL0_ANOCA/29-201LYEYSS..DNSHTPLPLLLASTTTYLSIVGKCCTDANPVACF
F7CSG0_CALJA/222-394LYEYSR..RHPDYSAMLLLRLAKAYEATLEKCCATADPHGCY
H0VRQ1_CAVPO/32-202IYEVAR..RNPFVFAPTLLTVAARFEEVAKTCCEEQQKANCF
G3SMX8_LOXAF/30-203LYEVAR..RHPYFYAPELIYYSEKYKDILTECCHADDKAACL
G1TZC1_RABIT/225-397LYEYSR..RHPELAVPVILRVNTVYENLLGNCCKLENPLECY
G3WQV0_SARHA/36-203IYEISR..RHPFLYAPAILSLAARYDQIIFNCCQAENAMECF
H2ZZM2_LATCH/135-303VFELSR..RNTKLPPVVLTKIYDGFLKMINGCCSAVDSNACF
H3A4E6_LATCH/31-204VYEVAR..RQCELPSQVALLIGIKYEKMFEDCCKAEKPSDCI
F1RUL9_PIG/7-176IYEISR..KHPFLYGPTILTMSACYKTAVQSCCQEENKTECF
G3WQH5_SARHA/223-394LYDNGR..RHPELAVTTLLRIAKDYETTLEECCATADPPTCY
F7BAY6_HORSE/413-591LAELVK..HKPKATKEQLKTVLGNFSAFVAKCCGAEDKEACF
I3LN42_PIG/218-385IFELSR..KTH.IPEVFLSKILEPTLKSLDECCHSEDSTACF
C9JKR2_HUMAN/30-202LYEYAR..RHPDYSVVLLLRLAKTYETTLEKCCAAADPHECY
F6VJ19_MONDO/36-203IYEITR..RHPFLYAPTILSLAARYDKIISTCCQAENAVECF
G5B5P2_HETGA/30-202LYEVAR..RHPYFYAPELLYYAERYMDVLTECCQAADKATCL
FETA_RAT/36-204IYDVSK..RNPFLYAPTILYLAAQYDKAVPACCKADNMEECF
L5K939_PTEAL/30-202LYEVAR..RHPYFYGPELLYYVKQYKAILTECCQAADKATCL
AFAM_MOUSE/222-394IYEYSR..RHPDLSTPELLRITKVYMDFLEDCCSRENPAGCY
L5LH53_MYODS/221-396LYEYSK..RHPDYPVSLLLRLAKRYEATLEKCCASTDVQACY
F7B1W2_ORNAN/222-394VYEYSR..KHQKVSGPVIRRVLEKYQDLLEKCCQTADPHQCY
G1TZC1_RABIT/417-596LSNLVK..QKLYASETQFQAVLGNFTHLVQVCCRTEKSEICF
F7IGI3_CALJA/28-200MWEYST..NYGQAPLSLLVSYTKSYLSMVGSCCISANPTTCF
U3K0R0_FICAL/34-206VYTVAR..RNPFLHAPAILGLAAEYENALKSCCPESDVGSCL
ALBU_BOVIN/221-393LYEYSR..RHPEYAVSVLLRLAKEYEATLEECCAKDDPHACY
Q5CZZ1_XENTR/415-593LVKLIQ..VSPKMEKNHIDECSAEFLKMVQKCCTADEHQGCF
F1RUN2_PIG/30-201LYEIAR..RHPYFYAPELLYYAIIYKDVFSECCQAADKAACL
M3YCX1_MUSPF/47-217IYETSR..KHPFLYGPTILTMSACYETAIQSCCQERNKTECF
F8VQ07_MOUSE/416-595LSTLVK..QKPHAAEDVFHSIGENFVQLVEKCCGAQRRDVCF
G3UIJ9_LOXAF/215-386TYEYAR..RHPELAVPVVLRVVKGYQELSEKCSQSENRLEC.
VTDB_MOUSE/27-199LYEYSS..NYGQAPLPLLVAYTKNYLSMVGSCCTSANPTVCF
H2QPN0_PANTR/31-202LYEVAR..RNPFVFAPTLLTVAAHFEEVAKSCCEEQNKVDCF
L5LFJ8_MYODS/322-494LYEYSR..RHPDYAVSLLLRLAKGYEATLEKCCASDDSHACV
G1U9S2_RABIT/222-394LYEYSR..RHPDYSVVLLLRLGKAYEATLKKCCATDDPHACY
G3WRB2_SARHA/228-401LHEYSR..QHLELPHSVLLRIAVIYEELLEKCCKTENPKECY
G1P5R5_MYOLU/216-383TFELSR..RTD.VPEVFLSKILEPTFKSLGECCDSKDPAVCF
H0X1I9_OTOGA/30-202IYEIAR..RNPFLYAPVVLSFAARYDKIIPPCCKAANAIECF
H9GU02_ANOCA/429-599LVNLIK..HKPTITDEQLQVVVKEFLDMVTKCCEADNHEECF
G5B5P2_HETGA/414-592LAELVK..HKPKATAEQMKDIMKNFGIFLEKCCHAENKDDCF
E1BV96_CHICK/420-598LINLIK..YKPQITQEQLTSITVAFTAMREQCCKEENREACF
F6YY93_HORSE/40-209IYEISR..KHPFLYGPTILTTSACYETAIQSCCREENKTQCL
F6VJ37_MONDO/216-381IFE.QR..RKPNIPEVFITRVHRLCVEALSQCCKNEKPQACL
F7AX94_MONDO/229-401LYEYSR..RHPELPFSVLLRIGVMYENLLEMCCKTENPKECY
H0VRQ1_CAVPO/222-394LYEYSR..RHPDLSTSELLRITGVYEDFLGDCCSRETPTDCY
H9GH08_ANOCA/225-397LYQYGR..RHPELSPQLLARSTRGYEELLDECCATEHPETCL
ALBU_CHICK/418-596LINLIK..RKPQMTEEQIKTIADGFTAMVDKCCKQSDINTCF
F6SKW5_XENTR/218-385TLERAR..RNTKLPLLFINKLYDSFKELVNGCCISQTPNVCL
W5MZW6_LEPOC/417-596LYTLVR..MKTTITNDQLQTISKHFYDIKDKCCAEADKAACF
AFAM_MOUSE/414-590LVNLVK..WMPGITDEEWLCLFTKFTAAREECSEVQEPESCF
FETA_BOVIN/222-395TYEYSR..RHTKLAVPIILRVAKGYQELLEKCSQSENPSECQ
G1TBD0_RABIT/415-593LINLVK..QKPQITQEQLEAVIADFSGMLEKCCHGQEREACF
G1TBD0_RABIT/223-394VYEYSR..RHPELPVTVILRITKGYQELLEKCFQTGNPLEC.
F7HAH7_MACMU/132-301TFEYSR..RHPDLSIPGLLRIVQIYKDLLRNCCNTENPPGCY
W5KYJ2_ASTMX/31-203VYESAR..RHRSIPAGFILNTTQNHVQTAEKCCSPAASTPCF
E1BV96_CHICK/228-399LYEYSR..RHPEFSAQMLLRIGKGYEDLLDECCKTGSPDNC.
V8ND09_OPHHA/197-369LFTLTR..NHPELSKLIDLELLHKYEELLEKCCQLEDHVQCL
U3IUC3_ANAPL/219-387MFELSR..RHTNVPDVFLGKLYDASENVIRECCSAKDSSACL
F7FAY5_RAT/37-205IYEMSR..RHPFLYGPTLLTMSACYEIAVQSCCQKENAMECL
ALBU_CHICK/33-206IYSVAR..RHPFLYAPAILSFAVDFEHALQSCCKESDVGACL
G5B5P1_HETGA/30-202IYEVSR..RHPFLYTPTALSLAARYDKIFPSCCKAENAAECF
F6XRB3_CALJA/222-394VHEYSR..RHPQLAVSIILRVAEGYQELLEKCFQTENPLECQ
G3WQV0_SARHA/223-394VYEYSR..RHQELPVPVILRIAKGYQIALEKCPQTENPLEC.
FETA_MOUSE/218-389LHEYSR..THPNLPVSVILRIAKTYQEILEKCSQSGNLPGC.
L9L5M3_TUPCH/432-610LVELVK..HKPHATNDQLKTVMGDFTAFVDKCCKAEDKEACF
M3YCY0_MUSPF/414-590LVNVVK..RGPELTEAVLRPLLSDFTDVVAKCCKAEDPETCF
FETA_BOVIN/37-202IYEIAR..RHPVLYAPTILSVANQYNKIIPHCCKAENATECF
L5LI30_MYODS/260-431LYEYSK..RHPDYPLDEFQPLVNEPHEIVKKTCE........
FETA_MOUSE/30-198IYEVSR..RNPFMYAPAILSLAAQYDKVVLACCKADNKEECF
G3QZW5_GORGO/30-202IYEIAR..RHPFLYAPTILLWAARYDKIIPSCCKAENAVECF
F7BAY6_HORSE/30-201LYEVAR..RHPYFYGPELLFHAEEYKADFTECCPADDKAGCL
W5PXI3_SHEEP/33-202IYEVSR..RNPFVFAPTLLTVAARFEEMTKTCCEEQEKANCF
U3IUC3_ANAPL/28-200LYEYVS..SYGQAPLPVLLGSTRNFLSMVSTCCISSAPTVCF
U3JDX2_FICAL/52-224LYEYSS..SYSQAPLPVLVGSTRTFLSMVSTCCISSAPTPCF
F7BAY6_HORSE/221-393LYEYSR..RHPDYSVSLLLRIAKTYEATLEKCCAEADPPACY
G3WRB2_SARHA/421-596IVNLVR..QKPVLETQQVMQMFSDFPTLIN.CCKTEERESCF
F6VJ19_MONDO/223-395VYEYSR..RHQDLAVPVILRVAKGYQEALEKCSKTENPSECQ
L5LH53_MYODS/32-200IYEIAR..RHPYFYGPELLYYTQEYKGDLTECCEAADKAACL
FETA_HORSE/222-394TYEYSR..RHTKLAVPVILRVAKGYQEFLEKCSQSENPLECQ
I3L5N3_PIG/155-334LSHLVK..QKPHAAEMKFQSIIVDFAHLVERCCQAEKSEMCF
L9L5M3_TUPCH/1319-1495LVNLVK..LKPGFADQELRSLFLTFTAAVEKCCKAQEPEACF
G5BE53_HETGA/218-385TFELTR..RTP.IPEVFLSKIVETTLRSLNECCDWEDSAACF
F7FAY5_RAT/417-596LSNLVK..QKPQTAEEAFHSIGEGFLLLLGKCCHAQRREACF
F7BJP5_MONDO/414-592LAELVK..HKPKITQDQLKAVISDFTAFVDKCCKADSQEGCF
F6VJ19_MONDO/415-593LINLVK..QKPHITEEQLKAVTTDFTGLLENCCKGKQQEACF
ALBU_MOUSE/414-592LAELVK..HKPKATAEQLKTVMDDFAQFLDTCCKAADKDTCF
H0X1I5_OTOGA/30-202LYEVAR..RHPYFYGPELLFFAEKYKAAFTECCQAADKAACL
G3U4C2_LOXAF/253-434LSNLVK..QNPHAAETQFQSVITDFTRLVEMCCQAEKREMCF
ALBU_MOUSE/222-394LYEYSR..RHPDYSVSLLLRLAKKYEATLEKCCAEANPPACY
G1TZC1_RABIT/33-205SFEISR..TYPFLYGPTILTMSACYETAVQSCCQEENKTKCL
G3T7Q0_LOXAF/173-344FKDFTRMIRHHSLTKPXLLELWKYYQNPLGNCCKTDNS....
U3K0R0_FICAL/226-398VYEYSR..RHPEFSTQLIMRITKGYETLLDKCCKTDNPAECY
H2QPN0_PANTR/222-394TFEYSR..RHPDLSIPELLRIVQIYKDLLRNCCNTENPPGCY
L5K939_PTEAL/414-592LVELLK..HKPKAADEQLKTVMGNFSAFIEKCCTADDKEACF
L5K939_PTEAL/222-394LYEYSR..RHPEYAVSLLLRIAKGYEATLERCCATDDAHACY
F7IGI3_CALJA/219-386TFELSR..RTR.LPEVFLSKVLDPTLKRLGECCDVEDSTACF
G3T7Q0_LOXAF/370-548FVELVK..LKPQRTEEELRSLLTDFINVVEKCCKAEGPEACF
Q6WDN9_CAVPO/222-394LYEYSR..RHPEYSIGMLLRIAKGYEAKLEKCCAEADPHACY
G1SHH2_RABIT/378-554LVNLVK..LKPELPDEELQSLFTNFTDTLEKCCNAKGPEACF
F7B3I5_HORSE/33-202IYEVSR..RNPFVFAPTLLTVATRFEEMAKTCCEEQDKANCF
F7F9M8_MONDO/27-199LHKFSS..SYGQAPLPLLVSYTKNYLSMVSTCCASSDITACF
G3WRB2_SARHA/37-208IYEIAR..RNPFIFAPTLLALVARYKEVSTSCCQEENKHECF
G3WQH5_SARHA/30-202LYEVAR..RHPYFYAPALLAYAHQYKEAVKGCCQEADKGACF
W5PXZ3_SHEEP/7-176IYETSR..KHPFVYGPSILTMSVCYETAVQSCCQEENKTECF
G1Q092_MYOLU/39-210IYETSR..KHPFLYGPTILTMSACYETAVQSCCQEENKTECF
F6XRB3_CALJA/414-592LINLVK..QKPQITEEQLGAVTADFAGMLEKCCQGQEQEVCL
F8VQ07_MOUSE/37-204SYEISR..RHPFLYGPTILSMSACYDTAVQSCCQEENETECL
G5B5P1_HETGA/414-592LINLVK..QKVQITEGQLETIIQDFSGFLEKCCHHQEQEACF
M3YCX1_MUSPF/237-409LYEYSR..RHSELAVPVILRVDTVYQNLLANCCKLENPLECY
AFAM_MOUSE/32-202MYEVAR..RNPFVFAPVLLAVAAWFEEAATTCCEQQQKATCF
E1BV96_CHICK/33-199IYEVSR..RHPFLYAPTILSVAIHYDEMMKDCCRSAED....
ALBU_MOUSE/30-202LHEVAR..RHPYFYAPELLYYAEQYNEILTQCCAEADKESCL
G1TBD0_RABIT/29-203IYEISR..RHPFLYAPTILSLATRYDKIIPPCCKAENAVECF
G1SU82_RABIT/218-385TFELSR..KTH.IPEVFLSKVLEPTLKSLSECCHSADSTACL
F7G172_ORNAN/199-365IFEIGR..RYAHVPEVFLSKILDGITRAVSGCCSGEDPHTCL
L9L5Y8_TUPCH/121-286LYEYSR..RHPELAVTVILRVEEAYKKELENCCKLENPLECY
Q6WDN9_CAVPO/414-592LVELVK..HKPKASEEQMKTVMGDFAAFLKKCCDADNKEACF
G1SHH2_RABIT/33-202IYEVAR..RNPFAFAPTLLTVAAQFEELTNRCCEEQHKASCF
M3X557_FELCA/30-202IYEIAR..RHPFLYAPTILSLATHYGKIIPPCCKTENAVECF
F7G172_ORNAN/8-180LYEYSS..NYGQAPLRLLLGYTKSYLSMVGTCCFSPKPNTCF
ALBU_BOVIN/30-201LYEIAR..RHPYFYAPELLYYANKYNGVFQECCQAEDKGACL
H2QPN0_PANTR/414-590LVNLVK..LKHELTDEELQSLFTNFANVVDKCCKAESPEVCF
H3A4E6_LATCH/224-398LYEYAR..RHPELSTQLILRIGKGYEELLTKCCQTDNPYQCY
M3YCX1_MUSPF/429-607LSHLVK..QKPYAREMQFQSMTDSFAHVVEKCCPAETREMCF
H9GU02_ANOCA/233-405VYEYAR..RHPEFSAQLILRLGEEYEELLEKCCKTEKPKECL
G3IMS6_CRIGR/247-425LINLVK..QKPDMTEEQHEAVTADFSGFLEKCCQDQEQEDCF
L5LFJ8_MYODS/514-692LVELLK..HKPKATEEQLKTVMGDFTTFFQKCCAAADKEACF
I3MJG0_SPETR/223-394LYEYSR..RHPEYGSLLLLRIAKAYEAKLEKCCAEADPPACY
F7AX94_MONDO/38-209IYEIAR..QNPFGFAPTLLSGAAIYKEAITRCCQEENKHECF

PF09164

F6SKH8_XENTR/404-468--------------------------------CREMINKF--
M3YD76_MUSPF/405-469--------------------------------CDSEIDVE--
G1KNL0_ANOCA/408-471--------------------------------CGMKVKT.--
U3JDX2_FICAL/431-495--------------------------------CAAKVSSE--
VTDB_RAT/405-469--------------------------------CSSQIDAE--
F7G172_ORNAN/385-447--------------------------------CSTQVP..--
H2PDJ5_PONAB/424-488--------------------------------CDSEIDAE--
F1NVF3_CHICK/407-471--------------------------------CVAQVTAE--
H0VTA4_CAVPO/405-467--------------------------------CDAQVR..--
H2ZZM2_LATCH/323-387--------------------------------CGKMYSAF--
G3W8R1_SARHA/408-472--------------------------------CNTQIDTE--

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window