Sequence alignment for CL0283

PF02900

DIOXL_SCHPO/24-294PALYLAHGSPFLMLPQ..SSDDEVFSNDSKLGGLHYQFLEQLGPFLLEK...FRPKGIIVFSAHYES....RGS.-----
MHPB_ECOLI/4-306YLHCLSHSPLV.GYVD..PAQEVLDE.VNGV.......IASARERIAAF....SPELVVLFAPDHYNGFFYDVMP-----
Q8Y3G5_RALSO/3-283PVLYLSHGSPMLAADP..GPVGA......AL............AALGRDVAALSPRAIVVVSPHWMT....RRP.-----
Q8PCD0_XANCP/6-275GGIGTSHVPTIGVAYDKGKQQDPLWKPLFDG.......YTPVANWLAEQ....QPDVLVFFYNDHCTTFFFDLYP-----
Q8L3U9_ORYSJ/2-267DTFFLSHGTPTLSIDD..TMPAQ......HF.......FRSWLPAAVAGA..QPPRAILIVSGHWET....ATPT-----
Y1956_THETN/2-265GCYLMPHPPIIVHEVGRGEERKI..QKTIDS.......LENISQEIKQK....RPDTVIVITPHGYV....FKDA-----
Q9CKS5_PASMU/6-280LAAKITHVPSMYLSEQ.PGKHYGCRASAIEG.......HKEISRRCRDL....GVDTIIVFDTHWLV......NS-----
Y1420_CLOAB/5-268GFYLLPHPPIVVPEVGRGEEKKI..ENTTKS.......FEAIAKDIAGK....APNTIIIVTPHGTM....FQDY-----
Q9HWQ7_PSEAE/6-281LAAKITHVPSLYLSEL.PGPRHGCRQPAIDG.......HREIGRRCREL....GVDTIVVFDTHWLV......NA-----
A0AWP0_ARTS2/153-424.ALFTSHVPAIGAAMDLGKTEEPYWKKVFSG.......YEWTREWAKEN....LPDVVILVYNDHATAFDSSIIP-----
C5CXA1_VARPS/7-280.AAKITHVPSMYLSEF.PGPNFGCRDAAING.......HKEIDRRCRAL....GVDTIVVFDVHWQV......NS-----
D0IZN4_COMT2/7-282.SVFTSHVPAIGAAMDMGKTQEAYWAPLFKG.......YDFSRQWMKDN....KPDVIFLVYNDHATAFSLDCIP-----
G2IQQ3_9SPHN/8-273..ITSSHIPALGAAIQTGTSDNDYWGPVFKG.......YQPIRDWIKQPG..NMPDVVILVYNDHASAFDMNIIP-----
Q7N7W4_PHOLL/7-279.AAKITHVPSMYLSEL.PGKHHGCRQGAIDG.......HKEISRRCREM....GVDTIIVFDTHWLV......NS-----

PF01875

YJX8_YEAST/5-334---PATHAGSWYSNRAQELSQQLHTYLIKSTLKGPIHN...ARIIIC.......PHAGYRYCGPTMAYSYASLDLN...R
Y403_METJA/6-285---YPAVAGLFYPSHPDELIDMIEQCYLHKFGPKSMPVHGTYEKP....IGLLCPHAGYVYSGPIQAHSYYELSKRVDAL
Y890_AQUAE/5-265---EPAVAGTFYPKDKEELNKLMD..LLCGFEP........KEKIKP..KAILVPHAGYIYSGKTACEVYKRIEI....P
Y1336_AQUAE/104-372---EPSHAGQAYPENPQELKNFIEETVNKNSEKFK......ARGILV.......PHMDLRVASGVYGSVYSAIKE....N
Y2310_ARCFU/3-258---HPRVAGSFYPANPESLLAMLR...EYTYPAK....D..ESVIA.....CVSPHAGYVYSGRTAGKVHSLLPD....A
Y924_THET8/60-325---PMRLAGLSYPEGEREARAFLEAFRASYPGEGEE.....ARVLLM.......PHLEPSRVPEVYGAALAALEKT...P
YAY4_SCHPO/7-308---EATHAGSWYLDDTELLTKQLKSFIKNPTPETG......KRFVIS.......PHAGYMYSGKVASQGFQQLDF....S
Y066_SULSO/4-281---LPAVAGSFYESDPKKLKMQIEWSFRHNIGPRDIPKQ.SYEKKKRDNLFFIVPHAGYIYSGPVAAHSYYYLAS...EG
Y045_METTH/4-277---RPAVAGAFYERDPAALRRRIEWCFEHELGPGTLPAVGSMRRIKG....VIAPHAGYMYSGPVAAHAYHELVS...DG
TG253_CAEEL/60-344---SASHAGSWYNANQRDLDRQLT.KWLDNAGPR....IGTARALIS.......PHAGYSYCGETAAYAFKQVVS....S

PF02900

DIOXL_SCHPO/24-294--VEVYSRDDENPLFY-DYY..GFPDYLYQIKFHSKGSKRIADQIISALKE------YQIPAKT........VSGDRGLD
MHPB_ECOLI/4-306--PFCLGVGA..TAIG-DFG.........SAAGELPVPVELAEACAHAVMK------SGIDLAV.........SYCMQVD
Q8Y3G5_RALSO/3-283--A..VTARPQQEAWH-DFG..GFPPQLYALEYAPPGAPVLAERIRTLIDG------NIVPGLEEQA..STVLDPRQPLD
Q8PCD0_XANCP/6-275--TFALGVGERFPIAD-E.......GAGLRDLPPIRGDVKLQAHIAECLVN------DEFDLTV.........FQDKPID
Q8L3U9_ORYSJ/2-267--V..NVVRGNNDTIH-DFEGYGFPKSMFQLEYPAPGAPDVAKKAKELLEQ------AGFGP..V......KEDHGRGLD
Y1956_THETN/2-265--VSITTLPSLEGDLS-QFG.......AREVKFKFENDLDLAREIMEETKK------RNIPIAEVSEELIKKYVLPKKLD
Q9CKS5_PASMU/6-280--AYHVNCCSHFEGVY-TSN..ELPHFIRDITFNYEGNPELGHMIVKHAVA------KGVR...AQ....AHEIDSLKLE
Y1420_CLOAB/5-268--IALAYEDEISGSFK-DFR.......APNVSMELKINKELTSKIYELAYG------ERIPSVMATNDILKKYNTSVFLD
Q9HWQ7_PSEAE/6-281--GYHINCAPHFEGLY-TSN..ELPHFIANMEYGFPGNPELGRILAEGCNA------LGVE...TL....AHDATTLGPE
A0AWP0_ARTS2/153-424--TFVLGTGAEYPVAD-EGY.......GPRPVPDVKGYPELAAHIAQSVIQ------DDFDLTL.........VNEMVVD
C5CXA1_VARPS/7-280--EYHINCGPKFGGTY-TSN..ELPHFIKNMPYAYPGNPALGHLIADVANE------MGVKSRAH.......SDTTLELE
D0IZN4_COMT2/7-282--TFAIGTAAEFQPAD-E.......GWGPRPVPKVVGHPDLASHIAQSVIQ------QDFDLTI.........VNKMDVD
G2IQQ3_9SPHN/8-273--TFAIGCAETFKPAD-E.......GWGPRPVPDVKGHPDLAWHIAQSLIL------DEFDMTI.........MNQMDVD
Q7N7W4_PHOLL/7-279--AYHINCADHFSGIY-TSN..ELPHFIRDMSYEYDGNPELGQMIAEEARN------VGVRAQAH.......EIPSLKLE

PF01875

YJX8_YEAST/5-334NVKRIFILGPSHHIYFKNQILVSAFSELETPLGNLKVDTDLCKTLIQKEYPENGKKLFKPM-----------DHDTDMAE
Y403_METJA/6-285EETTVVILGPNHTGLG.SGVSVMD.GIWRTPLGDVKCDEEFVEELWRKCEI......VDLD-----------ETAH.LNE
Y890_AQUAE/5-265..EKVVLLGPNHTGLG.KPISVYSGDAWETPYGVVEIDGELREKILKY.PY......ANPD-----------EYAH.LYE
Y1336_AQUAE/104-372EYDTVVLLGVSHYFHE.TPFSVLP.LDLRTPLGDLKVDIERVEELQKMFDY......DLSH-----------DVLAYKNE
Y2310_ARCFU/3-258..ETFVIVGPNHTGYG.LPVAVST.DTWLTPLGEVEVDTEFVEAMPK..II......TAPD-----------EIAH.RYE
Y924_THET8/60-325PPERIYLVGVAHRPLK.EKAAALP.VPFQTPFGPALPDLPALQALDALLPF......ELFN-----------TPLAFREE
YAY4_SCHPO/7-308KIQRVFVFGPSHHIFT.RKCLVSRASICSTPLGDLKVDEDLCQKLVASDNS......FDSM-----------TLDVDESE
Y066_SULSO/4-281KPDVVIILGPNHTGLG.SYVSAWPKGEWETPLGSVKVDEEVLMQLVMESEV......IDLE-----------EKSH.LYE
Y045_METTH/4-277IPGTLVIICPNHTGMG.SGVSLMQQGAWETPLGTVEIDSELAEAIVRESGI......IDLD-----------ETAH.LAE
TG253_CAEEL/60-344AVERVFILGPSHVVAL.NGCAITTCSKYRTPLGDLIVDHKINEELRATRHF......DLMD-----------RRDE.ESE

PF02900

DIOXL_SCHPO/24-294HGVFVPFKIMFP......DGLNIPLIEVSMHT.....LDPMQLYKVGQALQSLR.......KEYLIVSGGLNIHTFEDLS
MHPB_ECOLI/4-306HGFAQPLEFLLGG....LD..KVPVLPVFINGVATPLPGFQRTRMLGEAIGRFTSTL...NKRVLFLGSGGLSHQPPVPE
Q8Y3G5_RALSO/3-283HGAWIPLMLMLP.......EATIPVVQVSLMP....GLSPACQMAMGRTLAPLR......DEGVLIIGSGSFTHNLRALM
Q8PCD0_XANCP/6-275HGCAAPLPLLWPH....VPDWPGTVVPIAINVLQYPLPTARRCYRLGQALRRAIESYPED.LKVVVVGTGGLSHQIHGER
Q8L3U9_ORYSJ/2-267HGAWVPLMFMYP.......EANVPVCQLSLQT....GRDGAYHYDLGRALAPLR......DDGVLILGSGNATHNLSCMA
Y1956_THETN/2-265HGTIVPLYFVTK.........HYPDFKLIHMS.Y.GFLPFEKLYEFGVAIKDAINK...SDRRVVFIASGDLSHKLTPNS
Q9CKS5_PASMU/6-280YGTLVPMRYMNE..........DKAFKVISIAAFCTSHSFEDSRKLGEAVLDAIKE...YDGIVAVLASGSLSHYFIPDH
Y1420_CLOAB/5-268HGCMVPLYFINK.........YYKEYKIVHIT.Y.AALSDIELYRFGMNVTKAVEE...LNENAVFIASGDLSHRLREDG
Q9HWQ7_PSEAE/6-281YGTLVPMRYMNQ..........DRHFKVVSVSALCTVHYLNDSARLGWAMRKAVEEH..YDGTVAFLASGSLSHRFAQNG
A0AWP0_ARTS2/153-424HGLTVPLSLVYGD....VEEWPVRVIPLAVNVVQYPVPSGRRCYELGRALRRALDKWDGEPLNVQIWGTGGMSHQLQGPR
C5CXA1_VARPS/7-280YGTLVPMRYMNA.......DQHYKVISISG...WCDWHDLTESGRFGLAVRRAIEER..YEGTVAVFASGSLSHHFADNG
D0IZN4_COMT2/7-282HGLTVPLSLMCGEQDPKTGSWPCPVIPFAVNVVQYPVPTGQRCFNLGRAIRKAVESYD.QDINVHIWGTGGMSHQLQGAR
G2IQQ3_9SPHN/8-273HGCTVPLSMIFGE....PEEWPCKVIPFPVNVVTYPPPSGKRCFALGDSIRAAVESFP.EDLNVHVWGTGGMSHQLQGPR
Q7N7W4_PHOLL/7-279YGTLVPMRYMNS..........DRHFKVISVSAFCTVHAFEDSRRLGEAILTAIEKY...DGTVAVFASGSLSHRFIDDQ

PF01875

YJX8_YEAST/5-334HSLEMQLPMLVE----TLKWREISLDTVKVFPMMVSHNSVDVDRCIGNILSEYIKDP--N...NLFIVSSDFCHWGRRFQ
Y403_METJA/6-285HSIEVQLPFLKH----LELLNI...AKFKIVPICMMFQDYETAVEVGYFIAKIAKEL--N.RRIVVIASSDLTHYE....
Y890_AQUAE/5-265HSLEVQLPFLQR----YARR......EFKILPIVVTFVEYEVAKDFGRFLGEVLKEE--D...ALIVISSDMSHYV....
Y1336_AQUAE/104-372HSIEFQTIFLKY----LFPE.......VKVIPAIVSYGDTKSLKEIAHKITKVLEDS--Q..NPLIISSVDFSHVGRKFG
Y2310_ARCFU/3-258HSLEVQVPFLQY----LHDD.......FKIVPICLGMQDEETAMEVAEEILTAERET--G.RKVVVIASSDMHHYL....
Y924_THET8/60-325HSLELPLFFLKG----RFPEA.......RVLPLLVARRSPE....LGEALKVVLRDF--P...GLLVLAVDLSHVGPRFG
YAY4_SCHPO/7-308HSLEMQFPLLAF----HLLKQGC.LGKVKIVPIMIGALTSTTMMAAAKFLSQYIKDE--S...NSFVISSDFCHWGRRFG
Y066_SULSO/4-281HSIEVQLPFLQY----FFDDN......FKIVPIVIMMQTPEIAEFLADAIYKVIQKY--SDKDIVVLASSDMNHYD....
Y045_METTH/4-277HSCEVHVPFIQY----FTDN.......FRIVPVTMWMQGHETAADVGHAVASAIRET--G.RDAAVIASTDFTHYS....
TG253_CAEEL/60-344HSIEMQLPFIAK----VMGS.....KRYTIVPVLVGSLPGSRQQTYGNIFAHYMEDP--R...NLFVISSDFCHWGERFS

PF02900

DIOXL_SCHPO/24-294AFNEDT.........................................AADGYKEFQLDILKAIETDKQND.RLNKLLGLQ
MHPB_ECOLI/4-306LAKADAHMRDRLLGSGKDLPASERELRQQRVISAAEKFVEDQRTLHPLNPIWDNQFMTLLEQ.......G.RIQELDAVS
Q8Y3G5_RALSO/3-283RGAGMAQHG................................VPVEP.WVEAFREWMVEAMTEGI...RTG.DFATFCDYR
Q8PCD0_XANCP/6-275TG............................................FNNTEWDMEFLDRFQH.......A.PET.LTDLT
Q8L3U9_ORYSJ/2-267.PVAEGT....................................PVPQWAAEFDGWLQEALLA.......GGRHDDVKQYE
Y1956_THETN/2-265PNGYTP.........................................KGEVFDKTLLQLLSE.......M.KVEEVIRMD
Q9CKS5_PASMU/6-280LAKDGMNS..................................YTRE.FERQIDLHVVDMWRK.......G.NFKDFCKML
Y1420_CLOAB/5-268PYGYNP.........................................AGEKFDKELLNNLKD.......G.NVEGVFSID
Q9HWQ7_PSEAE/6-281QAPDFSDR..................................IWSP.FLEVLDHEVVQMWQE.......G.RWAEFCGML
A0AWP0_ARTS2/153-424AG...........................................L.INEEWDNAFLDHLIA.......D.PVG.LTEWQ
C5CXA1_VARPS/7-280RAPEFMHK..................................VYDP.FLEQVDRRVVELWEA.......G.DWKTFVGML
D0IZN4_COMT2/7-282AG...........................................L.INKEWDNQFLDLLIE.......N.PHG.LAQMP
G2IQQ3_9SPHN/8-273AG...........................................L.INKEFDLNFIDKLIS.......D.PEE.LSKMP
Q7N7W4_PHOLL/7-279RAEEGMNS..................................YTRE.FDEQMDHRVVQLWKE.......G.KFKEFCKML

PF01875

YJX8_YEAST/5-334YTGYVG--------SKEELNDAIQEETEVEMLTARSKLSHHQVPIWQSIEIMDRYAMKTLSDTPN----GERYDAWKQYL
Y403_METJA/6-285......--------...........................PQEIASKK...DAIVIKDILEM..----..NEKELYEDV
Y890_AQUAE/5-265......--------...........................PAEEARKK...DEILISAMERL..----..NTEELYFKA
Y1336_AQUAE/104-372......--------..........................DPHSYDPSPR..DREYINLLAELK.----..NEEAFNLLQ
Y2310_ARCFU/3-258......--------...........................PDEECRRL...DSIVIDAILSM..----..DVKKYYETI
Y924_THET8/60-325......--------.......................DTPLTRTLAEEARRRDLGFLERLAEG..----...EPEAALAF
YAY4_SCHPO/7-308YTLYLN--------DTNQL........EDAVLKYKRRGGPTSPKIYESISNLDHIGMKIIETK..----..SSDDFSEYL
Y066_SULSO/4-281......--------...........................PHEITMKK...DEEAIEKIQQL..----..DYRGLYEVV
Y045_METTH/4-277......--------...........................PQDIAEAT...DRRIIDRITAM..----..DDTGMYGVI
TG253_CAEEL/60-344FSPY..--------.......................DRHSSIPIYEQITNMDKQGMSAIETL..----..NPAAFNDYL

PF02900

DIOXL_SCHPO/24-294.LHPYF-RKAHPREEHFVPLYVAAGLGSS..............GKSKVVCDLYGAVS..AFFG---
MHPB_ECOLI/4-306NEELSA-IAGKS.THEIKTWVAAFAAIS.A.........FGNWRSEGRYYRPIPEWI..AGFG---
Q8Y3G5_RALSO/3-283ARAPHA-AHAHPTDEHLMPLYVALGAAMGQPEQATPGGVQARHVVDTVTYGALAMDS..FRFD---
Q8PCD0_XANCP/6-275HTDYVR-LGGAE.SVEQIMWLAMRGAMGG...........P.IRKLHQNYYLMTTTAMTVVLY---
Q8L3U9_ORYSJ/2-267EKAPNG-KMAHPSPDHFLPLHVALGAAGED........AKAELIHHSWYNATLSHAS..YRFT---
Y1956_THETN/2-265KDLIEE-A...A.ECGFRSVCVMLGVLDG...........YEVNAKVLSHEGPFGVG..YGVA---
Q9CKS5_PASMU/6-280PEYAEF-CR..G.EGNMHDTVMLLGMLGWDKY.....DKPVEILTDLFPSSGTGQIN..AVFP---
Y1420_CLOAB/5-268KDTVYN-A...G.ECGRRSVAVLLGTLEG...........KKFKGEILSYEGTFGVG..YGVM---
Q9HWQ7_PSEAE/6-281PEYASK-GH..G.EGFMHDTAMLLGALGWSAY.....DGKAEVVTPYFGSSGTGQIN..AVFP---
A0AWP0_ARTS2/153-424HMEYVD-EAGSE.GIELVDWLIARGAMDDQ........FGGESPEVNHRFYHVPASN..TAVG---
C5CXA1_VARPS/7-280PMYADK-CW..G.EGDMHDTAMLLGLLGWDRY.....AAPVEVVTPYFGSSGTGQIN..AIF.---
D0IZN4_COMT2/7-282HIDYVR-EAGSE.GIELVMWLIARGAMSDVD.......GPAPLPKVAHRFYHVPASN..TAVG---
G2IQQ3_9SPHN/8-273HIQYLR-ESGSE.GIELVMWLIMRGALPE.............KVRDLYTFYHIPASN..TAL.---
Q7N7W4_PHOLL/7-279PEYADY-CY..G.EGNMHDTVMLLGLLGWDKY.....DGKVEFLTELFASSGTGQVN..AVF.---

PF01875

YJX8_YEAST/5-334EITGNT.ICGEKPISVILSALSKIRDAGPS-------GIKFQWPNYSQSSHVTSIDDSSVSYASGY
Y403_METJA/6-285VNYNIS.MCGYGPVIAMLKAMKTLGA....-------.EKAKLLAYATSGDITGDYSAVVGYASAI
Y890_AQUAE/5-265VQYNIT.MCGVVPAVVGIESAKVLGA....-------.TKGIVVDYSNSGDTTGDYSQVVAYLGMI
Y1336_AQUAE/104-372SDNNRTRIDGQFTNFVFLEILKNLG.....-------VKEGKLLDYDVYHEAP..TDSKVSYAGMV
Y2310_ARCFU/3-258YRLQAS.VCGYGCIAVAMYYSKAKG.....-------.ARAELVDYSTSGDVA.DRSQVVGYAGIV
Y924_THET8/60-325LGANPTRIDGVEVVASLLPLLRERK.....-------...GKVLAHRLDLEAP..TLSAVGAGTLV
YAY4_SCHPO/7-308KTTQNT.ICGRYPIELIMKSMECANFS...-------.ERFKFISYAQSSHVELVTDSSVSYATAT
Y066_SULSO/4-281EGKDVT.LCGYGPIMVSLILAKKLG.....-------.KKAYILKHATSGDTSGPKDSVVGYLAAR
Y045_METTH/4-277SELNAT.MCGYGPVAATIIASRILGA....-------.TECDLLRYATSGDVTGDRSSVVGYAHLS
TG253_CAEEL/60-344KKTQNT.ICGRNPILIMLQAAEHFRISNNH-------THEFRFLHYTQSNKVRSSVDSSVSYASGV

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window