Sequence alignment for CL0283

PF02900

MHPB_RHOGO/4-305----ALLCMSHSPLL.HHLD.....PPADVKAS.VEAA......................FDQARAFVHN..F.......
O32474_PSESP/6-262----AAGGTSHILMSP.........KGCEESAARVVNG......................IAELGRRLKE..A.......
MHPB_ECOLI/4-306----YLHCLSHSPLV.GYVD.....PAQEVLDE.VNGV......................IASARERIAA..F.......
Q8Y3G5_RALSO/3-283----PVLYLSHGSPMLAADP.....GPVGA......AL...........................AALGR..D.......
Q8PCD0_XANCP/6-275----GGIGTSHVPTIGVAYD...KGKQQDPLWKPLFDG......................YTPVANWLAE..Q.......
Q8L3U9_ORYSJ/2-267----DTFFLSHGTPTLSIDD.....TMPAQ......HF......................FRSWLPAAVA..G.......
Q9L3A6_9SPHN/6-273----AGVATSHVPAIGAAMD...LVKTAEPYWQPVFAG......................YDWSRRWIAQ..E.......
Q97KR6_CLOAB/3-255----SPMFICHGSPELILQD.....NQYTK......CL...........................QKLGS..E.......
MHPB_CUPNE/4-304----QLECLSHTPLH.GYVD.....PAPEVVAE.VERV......................QAAARDRVRA..F.......
Q973X7_SULTO/11-259----KGIFVSHGSPMILVEN.....DPWK.......DL......................LREWGKRLG...........
Q885Q5_PSESM/3-255----PSLFISHGSPTLALEP.....GESGP......AL...........................AQLAA..S.......
Q9AGL8_9MICC/152-424----SALFTSHVPAIGAAMD...LGKTEEPYWKKVFSG......................YEWTREWAKE..N.......
Q9ZHH5_9BURK/6-268----GGFMMPHDPLIPATPT.....APPAAQREICMHA......................YAIIVERLRA..L.......
Y1956_THETN/2-265----GCYLMPHPPIIVHEVG...RGEERKI..QKTIDS......................LENISQEIKQ..K.......
AMNA_PSESP/5-267----SAFLVPGSPLPHLRPD........VKSWESFKVA......................MQNVGEKLRA..S.......
MHPB_COMTE/12-315----AFLGMSHSPLL.GLNP.....VAADDQIA.IDKA......................IAAARAAVHE..F.......
MHPB_RHOSO/4-305----ALCAMSHSPLM.GRND.....PEQEVIDA.VDAA......................FDHARRFVAD..F.......
Q9CKS5_PASMU/6-280----LAAKITHVPSMYLSEQ....PGKHYGCRASAIEG......................HKEISRRCRD..L.......
Q8L178_9NOCA/6-280----GAYATSHTAMMIRKLQ.....PDNDVHAA.VHQA......................FAQVRAEIDR..L.......
Q9I004_PSEAE/3-256----PTLYISHGSPMLALEP.....GASGV......QL...........................RRLAT..E.......
Q8GFC1_PHOLU/6-280----LAAKITHVPSMYLSEL....PGKHHGCRQGAIDG......................HKEISRRCRE..M.......
Q89G83_BRAJA/5-264----PTLFLSHGGGPWPFME.....DRRVQYARTAEEF...........................GRLPQ..L.......
Q97WR5_SULSO/8-261----IGLFISHGSPTILIDE.....NKWK.......DL......................LRRVGKEIEE..KY......
Q96U38_NEUCS/5-267----PVYFFSHGGPDVQYNT.....KHPVY......PV......................LQAIGKEIIQ..K.......
Q93A27_9PROT/6-281----LAAKITHVPSMYLSEF....PGPNQGCREAAING......................HKEIDRRCRE..L.......
Q8L3D8_9MICO/4-305----SLVAMSHTPLL.HRVE.....VDPQVRAE.VDGA......................FEAVRAFVAE..V.......
Y1420_CLOAB/5-268----GFYLLPHPPIVVPEVG...RGEEKKI..ENTTKS......................FEAIAKDIAG..K.......
Q8EFR0_SHEON/10-264----PVLFVPHGGGPLPLLN.....DANHHQLR...DF......................LSSVGGQIPM..........
O34137_PSEPS/5-267----SAFLVPGSPLPQLRAD........VPGWHNFQQA......................MRQAGAALKE..S.......
DIOXL_SCHPO/12-282----PALYLAHGSPFLMLPQ.....SSDDEVFSNDSKL...........................GGLHY..QFLEQLGP
DIOXL_ARATH/6-254----QTFFLSHGSPTLSIDD.....SLEAR......QF......................FKSWTQKVLP..Q.......
MHPB2_PSEPU/4-306----YLHCLSHTPLI.GHFD.....PNQDVLDE.VAEV......................VRAARARIEA..F.......
Q9HJ55_THEAC/12-268----AMVYAPNTPTLIGDLG.....VKHTETERALNEI...........................GRSCA..D.......
O82834_PSEPA/6-325----LGMWTSHGPTLSTTPEQWTLRVSADLKRKHPFRGEEYSFEELVSCAAARSWRRPVPFPSASDARPG..AKVPSPTW
PCYB_PSEPA/6-274----TGITSSHIPALGAAIQ...TGTSDNDYWGPVFKG......................YQPIRDWIKQPGN.......
Q8F0B5_LEPIN/4-257----PVLFLGHGSPMNLITT.....SDFTQ......NL...........................ETFGS..T.......
Q88LR0_PSEPK/12-264----PSLFISHGSPMLALQP.....GASGP......AL...........................SGLAN..A.......
Q8TTF1_METAC/6-254----PVLFVGHGSPMNAIEE.....NEFTE......SW...........................REISE..K.......
Q9A485_CAUCR/5-256----PVLFVGHGSPMNAIED.....NAWRR......DW...........................ARLGR..E.......
O24680_PSEPS/8-288----SGFLAPHPPHMLYAENPPQNEPRSNGGWEQLRWA......................YERARASVEA..L.......
O69791_9NOCA/4-306----ALVCTSHSPLL.EFNN.....PPPEVRTE.VDRA......................FAQARQFIEE..Y.......
Q8RNX9_COMTE/6-282----ASVFTSHVPAIGAAMD...MGKTQEAYWAPLFKG......................YDFSRQWMKD..N.......
Q9HWQ7_PSEAE/6-281----LAAKITHVPSLYLSEL....PGPRHGCRQPAIDG......................HREIGRRCRE..L.......
Q8P4P1_XANCP/5-261----PSLYISHGSPMTALRP.....GELGT......QL...........................AALAQ..G.......
Q8VRI3_9SPHN/6-262----GVFATSHVLFGS.........PDGDAQALRVVEG......................MNEIGRRVRL..L.......
Q8FDI2_ECOL6/16-271----PALFLGHGSPMNVLED.....NLYTR......SW...........................QTLGM..T.......
Q54224_STRGR/2-251----PALYLSHGAPPLADDP.....VWPG.......QL...........................AAWSA..E.......

PF01875

YJX8_YEAST/5-334PATHAGSWYSNRAQELSQQL-----HTYLIKSTLKGPIHN...ARIIIC.......PHAGYRYCGPTMAY--SYASLDLN
Y403_METJA/6-285YPAVAGLFYPSHPDELIDMI-----EQCYLHKFGPKSMPVHGTYEKP....IGLLCPHAGYVYSGPIQAH--SYYELSKR
Y890_AQUAE/5-265EPAVAGTFYPKDKEELNKLM-----D..LLCGFEP........KEKIKP..KAILVPHAGYIYSGKTACE--VYKRIEI.
Y1336_AQUAE/104-372EPSHAGQAYPENPQELKNFI-----EETVNKNSEKFK......ARGILV.......PHMDLRVASGVYGS--VYSAIKE.
Y2310_ARCFU/3-258HPRVAGSFYPANPESLLAML-----R...EYTYPAK....D..ESVIA.....CVSPHAGYVYSGRTAGK--VHSLLPD.
Y924_THET8/60-325PMRLAGLSYPEGEREARAFL-----EAFRASYPGEGEE.....ARVLLM.......PHLEPSRVPEVYGA--ALAALEKT
Y1626_PYRHO/4-288YPAVAGQFYPEGDALIEMLS-----S..FFKDLGE.....EGTKRTITA....GVAPHAGYVFSGFTASR--TYKAIYE.
YAY4_SCHPO/7-308EATHAGSWYLDDTELLTKQL-----KSFIKNPTPETG......KRFVIS.......PHAGYMYSGKVASQ--GFQQLDF.
Y066_SULSO/4-281LPAVAGSFYESDPKKLKMQI-----EWSFRHNIGPRDIPKQ.SYEKKKRDNLFFIVPHAGYIYSGPVAAH--SYYYLAS.
Y045_METTH/4-277RPAVAGAFYERDPAALRRRI-----EWCFEHELGPGTLPAVGSMRRIKG....VIAPHAGYMYSGPVAAH--AYHELVS.
TG253_CAEEL/60-344SASHAGSWYNANQRDLDRQL-----T.KWLDNAGPR....IGTARALIS.......PHAGYSYCGETAAY--AFKQVVS.

PF02900

MHPB_RHOGO/4-305......DPDVIVNFGPDHYNGFFYDL-MPPFCIGYKA................KGSGD........YD.........SFA
O32474_PSESP/6-262......RPDVLVIITSDHMFNINLSM-QPRFVVGIADS..............YTPMGD........MD.........IPR
MHPB_ECOLI/4-306......SPELVVLFAPDHYNGFFYDV-MPPFCLGVGA................TAIGD........FG.........SAA
Q8Y3G5_RALSO/3-283..VAALSPRAIVVVSPHWMT....RR-P.A..VTARPQ..............QEAWHD........FG..GFPPQLYALE
Q8PCD0_XANCP/6-275......QPDVLVFFYNDHCTTFFFDL-YPTFALGVGER..............FPIADE...............GAGLRDL
Q8L3U9_ORYSJ/2-267..AQ..PPRAILIVSGHWET....AT-PTV..NVVRGN..............NDTIHD........FEGYGFPKSMFQLE
Q9L3A6_9SPHN/6-273......KPDVVILVYNDHASAFDMKI-IPTFAIGCGER..............YKPADE...............GWGPRPV
Q97KR6_CLOAB/3-255..I...KPRAIVVFTAHFEK....ET-TTI..CFRDEA..............YKTIHD........FY..GFKDELYAVD
MHPB_CUPNE/4-304......DPELVVVFAPDHFNGFFYDV-MPPFCIGAAA................TAIGD........FK.........SLA
Q973X7_SULTO/11-259......KFDSVIIISPHFFS....WS-G.TFLVETQPK..............LECIQD........YY..GFPDELYKFC
Q885Q5_PSESM/3-255..LP..RPRAIVMVSAHWES....HE-L.I..VNGNPQ..............PETWHD........FG..GFAAELFAMQ
Q9AGL8_9MICC/152-424......LPDVVILVYNDHATAFDSSI-IPTFVLGTGAE..............YPVADE...............GYGPRPV
Q9ZHH5_9BURK/6-268......QVDTVVVIADDHYT.....L-NGPYCIPMAM................IGIGDIEGPYEPWLG.........IPR
Y1956_THETN/2-265......RPDTVIVITPHGYV....FK-DAVSITTLPSL..............EGDLSQ........FG.......AREVK
AMNA_PSESP/5-267......KPDVVLIYSTQWFAVLDEIW-LTRQRSLDIHV..............DENWHE........FG.........ELP
MHPB_COMTE/12-315......APELIVLLGPDHYNGFFNEL-MPPFCIGSQA................TAVGD........YL.........SPA
MHPB_RHOSO/4-305......APDLIVIFAPDHYNGVFYDL-LPPFCIGAAA................QSVGD........YG.........TEA
Q9CKS5_PASMU/6-280......GVDTIIVFDTHWLV......-NSAYHVNCCSH..............FEGVYT........SN..ELPHFIRDIT
Q8L178_9NOCA/6-280......SPDVLVVVSSEHLTSFSYDS-FPQICVGIGEI..............ATGWGD........GG.........VAS
Q9I004_PSEAE/3-256..LP..RPKAILVVSAHWES....DD-L.R..VTGAAV..............PDIWHD........FY..GFPPPLYAVR
Q8GFC1_PHOLU/6-280......GVDTIIVFDTHWLV......-NSAYHINCADH..............FSGIYT........SN..ELPHFIRDMS
Q89G83_BRAJA/5-264..LP.ERPKAVLVITGHWEA....DA-F.T..VSTSAH..............PPMVYD........YY..GFPEHTYRLK
Q97WR5_SULSO/8-261......KPETIIVSSPHFVS....WT-E.TFYIESSEK..............LECIQD........YY..DFPDETYKYC
Q96U38_NEUCS/5-267..V...KPKAVVVFSAHWQA....TP-SEIHLNNGDGP..............TDLIYD........FY..GFPDHFYKAT
Q93A27_9PROT/6-281......GVDTIVVFDVHWQV......-NSEYHINCGPR..............FEGVYT........SN..ELPHFIKNLP
Q8L3D8_9MICO/4-305......DPELVITIGPDHYNGFFYDT-MPPFCLGLGA................YGLGD........YG.........TAS
Y1420_CLOAB/5-268......APNTIIIVTPHGTM....FQ-DYIALAYEDEI..............SGSFKD........FR.......APNVS
Q8EFR0_SHEON/10-264.......PKAILLITAHWEE....AQ-V.T..LSSHPH..............PGMLFD........YY..GFPPEAYKLS
O34137_PSEPS/5-267......RPDVVLIYSTQWFAVLDEIW-LTRRHSEDIHV..............DENWHE........FG.........ELP
DIOXL_SCHPO/12-282FLLEKFRPKGIIVFSAHYES....RG-S.VEVYSRDDE..............NPLFYD........YY..GFPDYLYQIK
DIOXL_ARATH/6-254......KPKSILVISAHWDT.....K-FPS..VNTVLR..............NNTIHD........FS..GFPDPMYKLK
MHPB2_PSEPU/4-306......NPELVVLFAPDHYNGFFYDV-MPPFCLGMEA................EAIGD........FG.........SLA
Q9HJ55_THEAC/12-268......RIDTVIVVSPHFIT....SG-GFG..IVASER..............PKQLYD........FY..GFPDSFYLVK
O82834_PSEPA/6-325PTFAAAKIDVAVIMGNDQRELFLEDV-TPAITVYLGETIWDQPATPEQAARMPPGIHE........AEWGIARPSAGTIP
PCYB_PSEPA/6-274......MPDVVILVYNDHASAFDMNI-IPTFAIGCAET..............FKPADE...............GWGPRPV
Q8F0B5_LEPIN/4-257..LS..EIKNILVISAHWKT....RG-T.Y..VTVADP..............PEQIYD........FY..GFPQELYEVK
Q88LR0_PSEPK/12-264..LP..RPKAIVVVSAHWES....RE-L.L..VTGSAQ..............PETWHD........FY..GFPPALYAVQ
Q8TTF1_METAC/6-254..IS..RPKAILAISAHYER....ED-S.S..VTSNEK..............PKTIHD........FY..GFPKELYDQK
Q9A485_CAUCR/5-256..LP..RPKAILMVSAHWET....RG-ASA..VSAAAA..............PETIHD........FF..GFPQALFDVC
O24680_PSEPS/8-288......KPDVLLVHSPHWITSVGHHF-IGVPELSGRSV..............DPIFPN........LF.........RFD
O69791_9NOCA/4-306......DPDLVVSFAPDHYNGFFYKL-MPSFCIGFEA................SGVGD........FG.........SSA
Q8RNX9_COMTE/6-282......KPDVIFLVYNDHATAFSLDC-IPTFAIGTAAE..............FQPADE...............GWGPRPV
Q9HWQ7_PSEAE/6-281......GVDTIVVFDTHWLV......-NAGYHINCAPH..............FEGLYT........SN..ELPHFIANME
Q8P4P1_XANCP/5-261..LP..RPRAIVVASAHWLA....RR-P.L..VGAASK..............PVTIHD........FG..GFPPPLYEIE
Q8VRI3_9SPHN/6-262......RPDLLIVIGSDHLFNITTRL-QPPFTVGVSDT..............FTPLGD........MD.........IEQ
Q8FDI2_ECOL6/16-271..LP..RPQAIVVVSAHWFT....RG-TG...VTAMEM..............PPTIHD........FG..GFPQALYDTH
Q54224_STRGR/2-251..LP..RPTAILMVSAHWEE....AP-L.A..LGAVRT..............LPLVYD........FW..GFPEHYYRVQ

PF01875

YJX8_YEAST/5-334...R--NVKRIFILGPSHHI----YFKNQILVSAFSEL--------------ETPLGN----------------------
Y403_METJA/6-285VDAL--EETTVVILGPNHTG----LG.SGVSVMD.GIW--------------RTPLGD----------------------
Y890_AQUAE/5-265...P--..EKVVLLGPNHTG----LG.KPISVYSGDAW--------------ETPYGV----------------------
Y1336_AQUAE/104-372...N--EYDTVVLLGVSHYF----HE.TPFSVLP.LDL--------------RTPLGD----------------------
Y2310_ARCFU/3-258...A--..ETFVIVGPNHTG----YG.LPVAVST.DTW--------------LTPLGE----------------------
Y924_THET8/60-325...P--PPERIYLVGVAHRP----LK.EKAAALP.VPF--------------QTPFGP----------------------
Y1626_PYRHO/4-288..DG--LPEVFVIFGPNHTG----LG.SPIALYPEGEW--------------ITPMGS----------------------
YAY4_SCHPO/7-308...S--KIQRVFVFGPSHHI----FT.RKCLVSRASIC--------------STPLGD----------------------
Y066_SULSO/4-281..EG--KPDVVIILGPNHTG----LG.SYVSAWPKGEW--------------ETPLGS----------------------
Y045_METTH/4-277..DG--IPGTLVIICPNHTG----MG.SGVSLMQQGAW--------------ETPLGT----------------------
TG253_CAEEL/60-344...S--AVERVFILGPSHVV----AL.NGCAITTCSKY--------------RTPLGD----------------------

PF02900

MHPB_RHOGO/4-305GELNVPEAMAEDLAQFVMD------QGLDIAI.........SRQMEVDHGAVQPMEIIYGD.VA......SKPLIPVFVN
O32474_PSESP/6-262DLVPGSREVGRAIALQADE------DGFDLCQ.........AEEYSLDHGIMIPILFMGMK.........EIPVVPVIVN
MHPB_ECOLI/4-306GELPVPVELAEACAHAVMK------SGIDLAV.........SYCMQVDHGFAQPLEFLLGG.LD......KVPVLPVFIN
Q8Y3G5_RALSO/3-283YAPPGAPVLAERIRTLIDG------NIVPGLEEQASTVL..DPRQPLDHGAWIPLMLMLP........EATIPVVQVSLM
Q8PCD0_XANCP/6-275PPIRGDVKLQAHIAECLVN------DEFDLTV.........FQDKPIDHGCAAPLPLLWPH.VP....DWPGTVVPIAIN
Q8L3U9_ORYSJ/2-267YPAPGAPDVAKKAKELLEQ------AGFGP......VKE..DHGRGLDHGAWVPLMFMYP........EANVPVCQLSLQ
Q9L3A6_9SPHN/6-273PDVEGHADLAWHIAQSLIL------DEFDMTI.........INEMDVDHGLTVPMSLMFGQ.PE....QWPCKVIPLAVN
Q97KR6_CLOAB/3-255YPAIGSKGVAKDISNLLNK------RNID.......NVF..DEKRGLDHGTWSILKLMFP........KADVPVVQISVN
MHPB_CUPNE/4-304GKLPVPADLALSLAESVMA------ADIDVAL.........SHRMQVDHGCADALAALTGS.LH......RYPVIPVFIN
Q973X7_SULTO/11-259YSADNDVDLANKIVEEGQK------EGLP.......IKQ..DNKWGLDHGAWIPLMYMYP........E.GVKAVTISI.
Q885Q5_PSESM/3-255YPAPGLPELTRTIVELLTA------NGLP.......ARI..DSRRPFDHGVWVPLSLMYP........QADIPVVQVSLP
Q9AGL8_9MICC/152-424PDVKGYPELAAHIAQSVIQ------DDFDLTL.........VNEMVVDHGLTVPLSLVYGD.VE....EWPVRVIPLAVN
Q9ZHH5_9BURK/6-268AQIENNRPLAHHIMQYGLE------YGIDWAV.........SKSLVLDHSATVPIHYAVRP.VK......GMRAIPVYLN
Y1956_THETN/2-265FKFENDLDLAREIMEETKK------RNIPIAEVSEELIKKYVLPKKLDHGTIVPLYFVTK..........HYPDFKLIHM
AMNA_PSESP/5-267YDIYSDVDLANACIESCRA------AGVN.......ARGADYESFPIDTGTIVACNALKV..........GTSDLPVVVA
MHPB_COMTE/12-315GPLNVAGELAIALADHLMD------RHFDIAV.........SRRMLVDHGFSQALQFLWGDEMD......TPPVIPIFMN
MHPB_RHOSO/4-305GPLDVDRDAAYAVARDVLD------SGIDVAF.........SERMHVDHGFAQALQLLVGS.IT......AVPTVPIFIN
Q9CKS5_PASMU/6-280FNYEGNPELGHMIVKHAVA------KGVR.......AQAHEIDSLKLEYGTLVPMRYMNE...........DKAFKVISI
Q8L178_9NOCA/6-280AEVPLAGAFAAQLLSEGVA------AGFDLAF.........SANPKIDHAFMAPLTLIRPE..M......DIPVVPVFQN
Q9I004_PSEAE/3-256YPAKGEPALAQRTIELLQA------AGLP.......AQA..DPQRPFDHGTWVPLSLMYP........QADIPVLQLSLP
Q8GFC1_PHOLU/6-280YEYDGNPELGQMIAEEARN------VGVR.......AQAHEIPSLKLEYGTLVPMRYMNS...........DRHFKVVSV
Q89G83_BRAJA/5-264YPAPGKPELAAEVKALLAH------AGLD.......CRE..DANQGFDHGTFVPLGLMYP........NADMPIVLLSLK
Q97WR5_SULSO/8-261YNALNDTELVEEIVKNAEG------K..........VVK..DDKWGLDHGAWIPLFYMFP........EYKPKVVTISI.
Q96U38_NEUCS/5-267FPATGSPQLAAKIQQLLTK------ADI........QSK..GLKRGLDHGVFSGFNVAFP...PNTDQAITVPLVQVSLF
Q93A27_9PROT/6-281FSYPGNPGLGHLIADVANE------MGVK.......SRAHSDTTLELEYGTLVPMRYMNG...........DQHYKVVSV
Q8L3D8_9MICO/4-305GALDVPADIAEDLARHVQG------EDIDLTI.........SRAMGVDHGAVQPLEVIFGQ.ID......TVPTIPVFVN
Y1420_CLOAB/5-268MELKINKELTSKIYELAYG------ERIPSVMATNDILKKYNTSVFLDHGCMVPLYFINK..........YYKEYKIVHI
Q8EFR0_SHEON/10-264YPAPGNPELAEKIASLLKA------SGIA.......VKL..DNQRAFDHGTFVPLKLMYP........EANIPVVQMSLV
O34137_PSEPS/5-267YSLFSDVDLANACVEACRS------QGVP.......ARGADYKAYPIDTGTIVACTAMGI..........GTEALPLVVA
DIOXL_SCHPO/12-282FHSKGSKRIADQIISALKE------YQIPA......KTV..SGDRGLDHGVFVPFKIMFP.......DGLNIPLIEVSMH
DIOXL_ARATH/6-254YEAPGAIELGKRVKELLMK------EGGM.......KRVDEDTKRGLDHGAWVPLMLMYP........EADIPICQLSVQ
MHPB2_PSEPU/4-306GTLSVPKDVAEACAESVLT------SGIDLAV.........SYRMQVDHGFAQPLDFLLGG.LD......KYPVLPVFVN
Q9HJ55_THEAC/12-268YDPPGNPEMGEMLIRELLK------QGIP.......AGN..ATSWGLDHGAWSPLRLMFP........DADKRVLPVSIS
O82834_PSEPA/6-325ASPSSACMCAKRWCRRLRS------GGLQDTA.........RARRPLVERRAHSLGFIYRQIIR....DQVVPNLPIIIN
PCYB_PSEPA/6-274PDVKGHPDLAWHIAQSLIL------DEFDMTI.........MNQMDVDHGCTVPLSMIFGE.PE....EWPCKVIPFPVN
Q8F0B5_LEPIN/4-257YRPSGSTELAQQIQKLVKT------VDV.........WA..TKDWGLDHGSWGVLYFLFR........KANFPVIQLSID
Q88LR0_PSEPK/12-264YPAPGEPGLAGQVSERLKA------AGLP.......ARL..DMQRPFDHGAWVPLSLMYP........DARIPVVQVSLP
Q8TTF1_METAC/6-254YDCSGSKELITKVKDLAQE------VDF.............DSRWGIDHGVWCVLSKMYP........NADIPVVELSIN
Q9A485_CAUCR/5-256YPAPGDPALAARVADLLAP------DTVVQ...........HPTRGLDHGAWGVLAPMYP........DADIPVVQLSLD
O24680_PSEPS/8-288YSMKIDVDLAEACYEEGRN------VGLE.......TKMMRNPRFRVDYGTITTLHMIRP........QWDIPVVSISAN
O69791_9NOCA/4-306GRLDVPSALAEQMAQSVLD------QGVDIAV.........SLEMEVDHGAVQPLEILLGG.IA......TKPVIPIFVN
Q8RNX9_COMTE/6-282PKVVGHPDLASHIAQSVIQ------QDFDLTI.........VNKMDVDHGLTVPLSLMCGE.QDPKTGSWPCPVIPFAVN
Q9HWQ7_PSEAE/6-281YGFPGNPELGRILAEGCNA------LGVE.......TLAHDATTLGPEYGTLVPMRYMNQ...........DRHFKVVSV
Q8P4P1_XANCP/5-261YPAPGAPALAQQVTRLLEL------AGLH.......PHQ..DPQRGLDHGIWVPLRMLYP........QADIPVVPLSIQ
Q8VRI3_9SPHN/6-262RPFAGNRAFAESLCARA.A------DRFDLAQ.........GEELRPDHGVMVPLMFIDP........DGRIPVVPIYVN
Q8FDI2_ECOL6/16-271YPAPGSPALAQHLVELLAP------VPVALD..........KEAWGFDHGSWGVLIKMYP........DADIPMVQLSID
Q54224_STRGR/2-251YAAPGAPALADSVRKLLAA------PGTP.......VQD..IPDRGLDHGAYVPLVEMYP........DADIPVLQMSLP

PF01875

YJX8_YEAST/5-334--LKVDTDLCKTLIQKEYPENGKKLFKPMD-----------HDTDMAEHSLEMQLPMLVETLKWREISLDTVKVFPMMVS
Y403_METJA/6-285--VKCDEEFVEELWRKCEI......VDLDE-----------TAH.LNEHSIEVQLPFLKHLELLNI...AKFKIVPICMM
Y890_AQUAE/5-265--VEIDGELREKILKY.PY......ANPDE-----------YAH.LYEHSLEVQLPFLQRYARR......EFKILPIVVT
Y1336_AQUAE/104-372--LKVDIERVEELQKMFDY......DLSHD-----------VLAYKNEHSIEFQTIFLKYLFPE.......VKVIPAIVS
Y2310_ARCFU/3-258--VEVDTEFVEAMPK..II......TAPDE-----------IAH.RYEHSLEVQVPFLQYLHDD.......FKIVPICLG
Y924_THET8/60-325--ALPDLPALQALDALLPF......ELFNT-----------PLAFREEHSLELPLFFLKGRFPEA.......RVLPLLVA
Y1626_PYRHO/4-288--IKVDSKFAKEIVKRSGI......ADLDD-----------LAH.KYEHSIEVQLPFIQYIAEKAG...VEVKIVPITLG
YAY4_SCHPO/7-308--LKVDEDLCQKLVASDNS......FDSMT-----------LDVDESEHSLEMQFPLLAFHLLKQGC.LGKVKIVPIMIG
Y066_SULSO/4-281--VKVDEEVLMQLVMESEV......IDLEE-----------KSH.LYEHSIEVQLPFLQYFFDDN......FKIVPIVIM
Y045_METTH/4-277--VEIDSELAEAIVRESGI......IDLDE-----------TAH.LAEHSCEVHVPFIQYFTDN.......FRIVPVTMW
TG253_CAEEL/60-344--LIVDHKINEELRATRHF......DLMDR-----------RDE.ESEHSIEMQLPFIAKVMGS.....KRYTIVPVLVG

PF02900

MHPB_RHOGO/4-305SVARP.FVKVARVRKFGEAVGAYFKNS...DKKVLFIGSGGLSHDPPVPQIATADEAQRKMLTD.GRNPTPQARAARQQR
O32474_PSESP/6-262INTDP.IPSARRCVALAESIRQAIEKRTPDGCRVAVVGAGGLSHWLCVPRHG............................
MHPB_ECOLI/4-306GVATP.LPGFQRTRMLGEAIGRFTSTL...NKRVLFLGSGGLSHQPPVPELAKADAHMRDRLLGSGKDLPASERELRQQR
Q8Y3G5_RALSO/3-283P.....GLSPACQMAMGRTLAPLR......DEGVLIIGSGSFTHNLRALMRGAGMAQHGVPVEP................
Q8PCD0_XANCP/6-275VLQYP.LPTARRCYRLGQALRRAIESYPED.LKVVVVGTGGLSHQIHGERTG............................
Q8L3U9_ORYSJ/2-267T.....GRDGAYHYDLGRALAPLR......DDGVLILGSGNATHNLSCMA.PVAEGT....PVP................
Q9L3A6_9SPHN/6-273VVTYP.PPSGNRCWLLGEAIARAVESFPED.LNVQVWGTGGMSHQLQGPRAG............................
Q97KR6_CLOAB/3-255P.....YLPIDKQYNIGRAIRELS......DKDVLVIGSGATVHNLKTLKWNNST......PDI................
MHPB_CUPNE/4-304SVAPP.MATLRRARLLGDAVGRFLSRA...GKRVLVVGSGGISHEPPVPELAGASEEVAERLIA.GRN.PSPESAARQAR
Q973X7_SULTO/11-259T.....DLSAEIHYKLGEVIGRVVG.....DRNVLIIGTGSPTHRLELMYLN.........AKP................
Q885Q5_PSESM/3-255S.....RQGPALQTQVGRALAGLR......EQGVLVIGSGSITHNLYDLDWSAAPDR....VEP................
Q9AGL8_9MICC/152-424VVQYP.VPSGRRCYELGRALRRALDKWDGEPLKVQIWGTGGMSHQLQGPRAG............................
Q9ZHH5_9BURK/6-268TGIEP.FITSWRAHEIGRVIGDAVANW.QGDERVAIYGTGGLSHWPGMAEMG............................
Y1956_THETN/2-265S.Y.G.FLPFEKLYEFGVAIKDAINK...SDRRVVFIASGDLSHKLTPNSPNGYTP........................
AMNA_PSESP/5-267S.....NNLYDDQAATERLAALAVACISEKGKRIAVIGVGGLSGSVFTTAIDPAEDRVVKA...................
MHPB_COMTE/12-315AVAQPGIARMARCKALGEGVGSFLDQL...PLRTLLIGSGGLSHEPPVPTLAHPDPAVRERITV.RSTPTEQERELKTER
MHPB_RHOSO/4-305SVAEP.LGPVSRVRLLGEAVGRAAAKL...DKRVLFVGSGGLSHDPPVPQFATAPEEVRERLID.GRNPSAAERDAREQR
Q9CKS5_PASMU/6-280AAFCT.SHSFEDSRKLGEAVLDAIKE.Y..DGIVAVLASGSLSHYFIPDHLAKDGMNSYTRE..................
Q8L178_9NOCA/6-280ANTEP.LPPLWRSAQLGELLRDVITRR.PAAETVVVLGTGGLSHWVGTPEMG............................
Q9I004_PSEAE/3-256S.....RLGPALQSRVGQALRQLR......GEGVLLIGSGSITHNLGELDWRAGPEA....IAP................
Q8GFC1_PHOLU/6-280SAFCT.VHAFEDSRRLGEAILKAIEK.Y..DGTVAVLASGSLSHRFIDDQRAEEGMNSYTRE..................
Q89G83_BRAJA/5-264S.....SYDAAEHIKAGQAIAALR......DEGILIVGSGLTYHNMRGFNRPESK........P................
Q97WR5_SULSO/8-261T.....DNSPESHYEIGEKIRKAVEKL...GRKAVFLATGSPTHRLDLFYFK.........ITP................
Q96U38_NEUCS/5-267K.....SEDPDAHYRLGQAVEELR......DEGVVIICTGMTVHNLRDMQFTWGDPR....PLP................
Q93A27_9PROT/6-281SGWCD.WHDLHESGRFGLAVRKAIEERH..HGTVAVFASGSLSHHFADNGRSPDFMHKVYDP..................
Q8L3D8_9MICO/4-305GVAAP.FVPMRRIRALGESIGRWAAGR...PERILVIASGGLSHDPPVPQRATATPAVSAALLA.GRNPPPQARAAREQR
Y1420_CLOAB/5-268T.Y.A.ALSDIELYRFGMNVTKAVEE...LNENAVFIASGDLSHRLREDGPYGYNP........................
Q8EFR0_SHEON/10-264Q.....HLDPRAHIAIGEALASLR......QQGVLIVGSGMSFHNMRAFFSSDPK......VLP................
O34137_PSEPS/5-267S.....NNLYYNGEATENIGAIAAKAALDQGKRVAVIGVGGLSGSVFTSQIDPLDDHIVKP...................
DIOXL_SCHPO/12-282T......LDPMQLYKVGQALQSLR......KE.YLIVSGGLNIHTFEDLSAFNEDT........................
DIOXL_ARATH/6-254S.....NQNGSYHYNMGKALASLK......DEGVLIIGSGSATHNLRKLDFNITDGS....PVP................
MHPB2_PSEPU/4-306CVAPP.LPTFERVRLLGDAIGRFTRGL...NKRVLFLGSGGLSHQPPVPELAKVDARMADRLMGSGRNLPPEERDARTQR
Q9HJ55_THEAC/12-268P.....ALGADSHLKLGMAIRKVSS.....EHDAMLLVTGSIIHRLDL................................
O82834_PSEPA/6-325TFFPPNQPTARRCFELGRAVGKAIRSW.KEDLPVAVFGSGGMSHFV..................................
PCYB_PSEPA/6-274VVTYP.PPSGKRCFALGDSIRAAVESFPED.LNVHVWGTGGMSHQLQGPRAG............................
Q8F0B5_LEPIN/4-257A.....NCNPEKQYEIGKELRPLR......EEGTLILGSGNIVHNLHKADFYNLNAT....PTD................
Q88LR0_PSEPK/12-264S.....HMGPALQLKVGQALAGLR......AEDVLLIGSGSITHNLGELDWHAGPDV....IEP................
Q8TTF1_METAC/6-254R.....KLSMQQHYDLARKLYKLR......EEGILIFCTGNVVHNLMLARMSG..T.....PYK................
Q9A485_CAUCR/5-256R.....DRSDRWHYEAGRRLAPLR......DEGVLIIGSGDIVHNLRAIDFRRPE......TLP................
O24680_PSEPS/8-288NTPYY.LSMEEGLTEMDLLGKATLEAVRKSGKRAVLLASNTLSHWHFNQEPEPPEDMTKEHPES................
O69791_9NOCA/4-306SVAAP.FAPMKRIRLLGEAVGTFLKNF...DGNVLLLGSGGLSHDPPVPRLEAATGEQRKMLLG.CNHPTAAARAVRQQR
Q8RNX9_COMTE/6-282VVQYP.VPTGQRCFNLGRAIRKAVESYDQD.INVHIWGTGGMSHQLQGARAG............................
Q9HWQ7_PSEAE/6-281SALCT.VHYLNDSARLGWAMRKAVEEHY..DGTVAFLASGSLSHRFAQNGQAPDFSDRIWSP..................
Q8P4P1_XANCP/5-261P.....ELGPAHQFAVGRALAPLR......AEGVLVIGSGSITHNLHDLHQGYSAER....EAP................
Q8VRI3_9SPHN/6-262ANMTP.PPTAARAAQLGDIVAEAVGLDLPSHLRVVVVATGGLSHWINIPGHG............................
Q8FDI2_ECOL6/16-271S.....SKPAAWHFEMGRKLAALR......DEGIMLVASGNVVHNLRTVKWHGDSS.....PYP................
Q54224_STRGR/2-251T......LDPRRLMDIGRKLAPLR......DEGVLIVGSGFFTHNLAALRQGG........TPS................

PF01875

YJX8_YEAST/5-334------HNSVDVDRCIGNILSEYIKDPN--...NLFIVSSDFCHWGRRFQYTGYVGSKEELNDA--------IQEETEVE
Y403_METJA/6-285------FQDYETAVEVGYFIAKIAKELN--.RRIVVIASSDLTHYE..................--------........
Y890_AQUAE/5-265------FVEYEVAKDFGRFLGEVLKEED--...ALIVISSDMSHYV..................--------........
Y1336_AQUAE/104-372------YGDTKSLKEIAHKITKVLEDSQ--..NPLIISSVDFSHVGRKFG..............--------........
Y2310_ARCFU/3-258------MQDEETAMEVAEEILTAERETG--.RKVVVIASSDMHHYL..................--------........
Y924_THET8/60-325------RRSPE....LGEALKVVLRDFP--...GLLVLAVDLSHVGPRFG..............--------........
Y1626_PYRHO/4-288------IQDEEVSRSLGRSIFEASTSLG--.RDTIIIASTDFMHYGSFYGYV............--------........
YAY4_SCHPO/7-308------ALTSTTMMAAAKFLSQYIKDES--...NSFVISSDFCHWGRRFGYTLYLNDTNQL...--------.....EDA
Y066_SULSO/4-281------MQTPEIAEFLADAIYKVIQKYS--DKDIVVLASSDMNHYD..................--------........
Y045_METTH/4-277------MQGHETAADVGHAVASAIRETG--.RDAAVIASTDFTHYS..................--------........
TG253_CAEEL/60-344------SLPGSRQQTYGNIFAHYMEDPR--...NLFVISSDFCHWGERFSFSPY..........--------........

PF02900

MHPB_RHOGO/4-305VIDTAVKFAADEADIMDLNPEWDRGFLDVCAS....G...RIEDFDRYTADDMDAVAGHS.SHEVRNWVAAYSALR.ACG
O32474_PSESP/6-262................EVSEKFDHMVMDELVR....G...NAEKLVAMGNEAIIDQGGNA.GVEILTWIMAAVASE....
MHPB_ECOLI/4-306VISAAEKFVEDQRTLHPLNPIWDNQFMTLLEQ....G...RIQELDAVSNEELSAIAGKS.THEIKTWVAAFAAIS.AFG
Q8Y3G5_RALSO/3-283.................WVEAFREWMVEAMTEGIRTG...DFATFCDYRARAPHAAHAHPTDEHLMPLYVALGAAMGQPE
Q8PCD0_XANCP/6-275................FNNTEWDMEFLDRFQH....A...PET.LTDLTHTDYVRLGGAE.SVEQIMWLAMRGAMGGP..
Q8L3U9_ORYSJ/2-267................QWAAEFDGWLQEALLA....GG..RHDDVKQYEEKAPNGKMAHPSPDHFLPLHVALGAAGE...
Q9L3A6_9SPHN/6-273................LINKEWDNRFLDLMSD....D...DGEALRAISHIEYLRETGSE.GIEMVMWLIMRGALGKK..
Q97KR6_CLOAB/3-255.................WAVEFDDWIINKVKN....K...DLESLFNYRKLAPNAKIAVPREEHIVPLFIALGSGNL...
MHPB_CUPNE/4-304TVAAAKSFVAGDSHLHPLNPEWDRAFLSLLAS....G...ELTAVDGMTNDAITRDGGKS.AHEIRTWVAAFGALA.AYG
Q973X7_SULTO/11-259.................RQTKFDQILIQKLKD....G...DFTSLFKLEG..TKEWEIASPEGMLRPLFVVLGAVKP...
Q885Q5_PSESM/3-255.................WAAEFRDWIIDKLQS....N...DEAALHHYRTQAPHAVRAHPSDEHLLPLYFARGAGGA...
Q9AGL8_9MICC/152-424................LINEEWDNAFLDHLIA....D...PVG.LTEWQHMEYVDEAGSE.GIELVDWLIARGAMDDQFG
Q9ZHH5_9BURK/6-268................AINEGWDRKIMKLVAQ....G...DVESLIALSDEEILRDGGNG.GIEIKNWICAMGALG....
Y1956_THETN/2-265.................KGEVFDKTLLQLLSE....M...KVEEVIRMDKDLIEEA...A.ECGFRSVCVMLGVLDG...
AMNA_PSESP/5-267.................VEDDCNKNILSLMES....G...NIQALREALKSYSKEAR..A.EMGFKHFHWLLGALDG...
MHPB_COMTE/12-315VKAAGLALAHGDSWMKPLNPEWDLQWMDAMAS....G...QLDGLCAMNEASIGAMAGNS.AHESKTWLVARSALP.ANT
MHPB_RHOSO/4-305VITAGRDFAAGTAAIQPLNPEWDRHLLDVLAS....G...DLEQIDAWTNDWFVEQAGHS.SHEVRTWIAAYAAMS.AAG
Q9CKS5_PASMU/6-280.................FERQIDLHVVDMWRK....G...NFKDFCKMLPEYAEFCR..G.EGNMHDTVMLLGMLGW...
Q8L178_9NOCA/6-280................QINSAFDERFLQHVRA....G...DLGAILAMKTADVLAEAGNG.APEICNWVTAMAAASSQEG
Q9I004_PSEAE/3-256.................WAREFRDWMVEKLQA....D...DEAALHDYRRQAPWAARNHPSDEHLLPLFFARGAGGG...
Q8GFC1_PHOLU/6-280.................FDEQMDHRVVQLWKE....G...KFKEFCKMLPEYADYCY..G.EGNMHDTVMLLGLLGW...
Q89G83_BRAJA/5-264.................VSYDFEAYLNEAISAPDAAR...RNAMLVDWEN.APSARLAHPREDHLLPLMVAAGAAGN...
Q97WR5_SULSO/8-261.................KPTKFDAILMDLIKS....G...EFEKILKISELYPKEYQTAMPEGNLNTLHMLLGYIKP...
Q96U38_NEUCS/5-267.................YAVSFDDALKEAVEG....DAEGRLDRMREVVKRG.DARQAHPWMDHLMPIYVAAGAAGK...
Q93A27_9PROT/6-281.................FLEQVDQRVVDLWKS....G...DWKTFVGMLPMYADKCW..G.EGGMHDTAMLLGLLGW...
Q8L3D8_9MICO/4-305VADTAHAFAAGTATILDLNPEWDAQFLRVCRE....G...EVAAFDDYDTDEMAATAGNS.SHEVRSWVTAFSALS.AVG
Y1420_CLOAB/5-268.................AGEKFDKELLNNLKD....G...NVEGVFSIDKDTVYNA...G.ECGRRSVAVLLGTLEG...
Q8EFR0_SHEON/10-264.................RSQEFDDWLTQVLTLA.PHH...AKSQLIEWQS.APEARFSHPREEHLLPLHVCFGAASS...
O34137_PSEPS/5-267.................EEDEWNRQILSLLES....G...NLPALKEQIPHYVKAAR..V.DMGFKHFNWVLGAIGG...
DIOXL_SCHPO/12-282.................AADGYKEFQLDILKAIETDKQNDRLNKLLGLQ.LHPYFRKAHPREEHFVPLYVAAGLGSS...
DIOXL_ARATH/6-254.................WALEFDHWLRDSLLQ....G...RYGDVNEWEEKAPNAKMAHPWPEHLYPLHVVMGAAGG...
MHPB2_PSEPU/4-306VVVAAERFVENQNTLHPLNPKWDRYFLDVVEQ....D...LLSQLDDLSNAHLSELAGKS.THEVKAWVAAFSALS.AHG
Q9HJ55_THEAC/12-268.................YSKGTGEMPEEALKYLELAAKYMVAGSWEAIWNISHDLFIAASPEGGEYPSRVLAGSASN...
O82834_PSEPA/6-325.................IDEDFDRMFFEALRN....R...DAETLCAIEDKHLQSG.....TSELKTWIAAAGALFDT..
PCYB_PSEPA/6-274................LINKEFDLNFIDKLIS....D...PEE.LSKMPHIQYLRESGSE.GVELVMWLIMRGALPEK..
Q8F0B5_LEPIN/4-257.................WAIEFDEYMRQALES....R...NDKTILDFQNKGEIAKLAAPSTEHLEPIFYVLGAMKP...
Q88LR0_PSEPK/12-264.................WALAFRDWVVDRLQE....D...DQAALMDYRHQAPFAVRNHPSDEHLLPLFFALGAGSK...
Q8TTF1_METAC/6-254.................WASSFDEKVKKYVTA....R...DDLKLVNYELLGEDALLSVNSAEHYIPLIYALGATDR...
Q9A485_CAUCR/5-256.................WAERFNDTAKQLILA....G...DHDPLIDWRTLGPDAEASINSAEHYLPLLYVLGAQTP...
O24680_PSEPS/8-288................LAGYQWDMRMIDLMRR....G...QMQEVFRLLPQFIEESF..A.EVKSGAFTWMHAAMQY...
O69791_9NOCA/4-306VIDTAKAFTRGEAGIMDLAPEWDRQLLDILAS....G...ELERLDAWTAKEMAATAGNS.AHEVRTWVAAHNALKAAAG
Q8RNX9_COMTE/6-282................LINKEWDNQFLDLLVE....N...PHG.LAQMPHIDYVREAGSE.GIELVMWLIARGAMSDVDG
Q9HWQ7_PSEAE/6-281.................FLEVLDHEVVQMWQE....G...RWAEFCGMLPEYASKGH..G.EGFMHDTAMLLGALGW...
Q8P4P1_XANCP/5-261.................YVRPFIDWTERRLAD....D...DVPALLDYRRQAPHAARAHPTDEHLLPLYVAMGAAGG...
Q8VRI3_9SPHN/6-262................EVNAEFDRRVIAAFQS....G...DMRWLRAIDTETLLKNAGNG.GLEIVNWVMAAATLP....
Q8FDI2_ECOL6/16-271.................WATSFNEYVKANLTW....QGPVEQHPLVNYLDHE.GGALSNPTPEHYLPLLYVLGAWDG...
Q54224_STRGR/2-251.................WSAEFDDWGRAALDG....G...DIDTLLDFRHAAPAGTLAHPRTEHFAPLFVTLGAADA...

PF01875

YJX8_YEAST/5-334MLTARSKLSHHQVPIWQSIEIMDRYAMKTLSDTPNGE---RYDAWKQYLEITGNT.-----ICGEKPISVILSALSKIRD
Y403_METJA/6-285...........PQEIASKK...DAIVIKDILEM....---NEKELYEDVVNYNIS.-----MCGYGPVIAMLKAMKTLGA
Y890_AQUAE/5-265...........PAEEARKK...DEILISAMERL....---NTEELYFKAVQYNIT.-----MCGVVPAVVGIESAKVLGA
Y1336_AQUAE/104-372..........DPHSYDPSPR..DREYINLLAELK...---NEEAFNLLQSDNNRTR-----IDGQFTNFVFLEILKNLG.
Y2310_ARCFU/3-258...........PDEECRRL...DSIVIDAILSM....---DVKKYYETIYRLQAS.-----VCGYGCIAVAMYYSKAKG.
Y924_THET8/60-325.......DTPLTRTLAEEARRRDLGFLERLAEG....---.EPEAALAFLGANPTR-----IDGVEVVASLLPLLRERK.
Y1626_PYRHO/4-288P......FRGRPEELPNMVRDWDMRIIRRILDF....---DLDGMFSEIREMNHT.-----MCGPGGVGAGIIYSRLMKA
YAY4_SCHPO/7-308VLKYKRRGGPTSPKIYESISNLDHIGMKIIETK....---SSDDFSEYLKTTQNT.-----ICGRYPIELIMKSMECANF
Y066_SULSO/4-281...........PHEITMKK...DEEAIEKIQQL....---DYRGLYEVVEGKDVT.-----LCGYGPIMVSLILAKKLG.
Y045_METTH/4-277...........PQDIAEAT...DRRIIDRITAM....---DDTGMYGVISELNAT.-----MCGYGPVAATIIASRILGA
TG253_CAEEL/60-344.......DRHSSIPIYEQITNMDKQGMSAIETL....---NPAAFNDYLKKTQNT.-----ICGRNPILIMLQAAEHFRI

PF02900

MHPB_RHOGO/4-305...........EYEIAYEFYRPIKEYI..SGFA
O32474_PSESP/6-262...........ASSGEKVFYEAMTQWF..TGIG
MHPB_ECOLI/4-306...........NWRSEGRYYRPIPEWI..AGFG
Q8Y3G5_RALSO/3-283QATPGGVQA..RHVVDTVTYGALAMDS..FRFD
Q8PCD0_XANCP/6-275............IRKLHQNYYLMTTTAMTVVLY
Q8L3U9_ORYSJ/2-267.....DAKA..ELIHHSWYNATLSHAS..YRFT
Q9L3A6_9SPHN/6-273.............VRPLHRHYHVPASN..TAVG
Q97KR6_CLOAB/3-255.....KENP..EVLCRIYEYGSLSYIC..IKF.
MHPB_CUPNE/4-304...........PYRASLDFYRAIPEWI..AGFA
Q973X7_SULTO/11-259......KKA..EIIGYEVPYGGVSMLA..VEFY
Q885Q5_PSESM/3-255........F..SIAYQGFTMGALGMDI..YRFD
Q9AGL8_9MICC/152-424GE.........S.PEVNHRFYHVPASN..TAVG
Q9ZHH5_9BURK/6-268...........ACRGEVIAYEPVAEWV..CGCG
Y1956_THETN/2-265........Y..EVNAKVLSHEGPFGVG..YGVA
AMNA_PSESP/5-267........H..FKGATVHHYGALYGSG..AAVV
MHPB_COMTE/12-315...........RLSCPVRAYRAIPSLI..AGYG
MHPB_RHOSO/4-305...........KYRVTSTFYREIHEWI..AGFG
Q9CKS5_PASMU/6-280..DKYDKPV..EILTDLFPSSGTGQIN..AVFP
Q8L178_9NOCA/6-280WGVSEPERTARGPRGVVLAYESVPDWA..TGIA
Q9I004_PSEAE/3-256.......GM..RVEHSGFTLGSLGMDI..YRFD
Q8GFC1_PHOLU/6-280..DKYDGKV..EFLTELFASSGTGQVN..AVFP
Q89G83_BRAJA/5-264.......DV..GHRVFVDEVASVAMAS..YMFG
Q97WR5_SULSO/8-261......KKA..EILGYDTPWPGVSMLA..ASFY
Q96U38_NEUCS/5-267.......DK..GVQTWTLHEGSFAWA......Q
Q93A27_9PROT/6-281..DRYRAPV..EIVTPYFGSSGTGQIN..AIFP
Q8L3D8_9MICO/4-305...........DYAVELEYYRKIREFI..AGFG
Y1420_CLOAB/5-268........K..KFKGEILSYEGTFGVG..YGVM
Q8EFR0_SHEON/10-264.......ES..PKAI...QAFSGVLLN..TAIS
O34137_PSEPS/5-267........E..FRSAKVYHYGAIYGSG..AAVV
DIOXL_SCHPO/12-282.............GKSKVVCDLYGAVS..AFFG
DIOXL_ARATH/6-254.....DAKA..EQIHTSW..............Q
MHPB2_PSEPU/4-306...........AYTATDRYYRPIPEWI..AGFG
Q9HJ55_THEAC/12-268.....RMRG..RIMAQELEFNAVSLTT..ILFS
O82834_PSEPA/6-325...........DLKGDVVGYEPCYRSE..AGTG
PCYB_PSEPA/6-274.............VRDLYTFYHIPASN..TALG
Q8F0B5_LEPIN/4-257.....EEKV..KFIHHSFQNRTVSMRS..FTSV
Q88LR0_PSEPK/12-264........F..GVVHQGFTLGALGMDI..YRFD
Q8TTF1_METAC/6-254.....NESV..SFFCEEIVLASVSMRC..ILFE
Q9A485_CAUCR/5-256.....GEPV..SFFTDDV.FAAISMTG..VQVG
O24680_PSEPS/8-288........P..ELAAELHGYGTVIGTG..NAVM
O69791_9NOCA/4-306...........QYTVTSEYYRPIPEYI..AGFA
Q8RNX9_COMTE/6-282PA.........PLPKVAHRFYHVPASN..TAVG
Q9HWQ7_PSEAE/6-281..SAYDGKA..EVVTPYFGSSGTGQIN..AVFP
Q8P4P1_XANCP/5-261....DRLGA..QRIDAGIDQGLIGMDI..YRFD
Q8VRI3_9SPHN/6-262...........GRRAEKIYYEPMPQWM..TGMG
Q8FDI2_ECOL6/16-271.....QEPI..TIPVDGIEMGSLSMLS..VQIG
Q54224_STRGR/2-251..TGDLATQ..RSIIDGFWMGLAKRSV.....Q

PF01875

YJX8_YEAST/5-334AGPSGIKFQWPNYSQSSHVTSIDDSSVSYASGY
Y403_METJA/6-285.....EKAKLLAYATSGDITGDYSAVVGYASAI
Y890_AQUAE/5-265.....TKGIVVDYSNSGDTTGDYSQVVAYLGMI
Y1336_AQUAE/104-372....VKEGKLLDYDVYHEAP..TDSKVSYAGMV
Y2310_ARCFU/3-258.....ARAELVDYSTSGDVA.DRSQVVGYAGIV
Y924_THET8/60-325.......GKVLAHRLDLEAP..TLSAVGAGTLV
Y1626_PYRHO/4-288.....KEAELLHYTTSFEVSRSPDAIVGYASII
YAY4_SCHPO/7-308S....ERFKFISYAQSSHVELVTDSSVSYATAT
Y066_SULSO/4-281.....KKAYILKHATSGDTSGPKDSVVGYLAAR
Y045_METTH/4-277.....TECDLLRYATSGDVTGDRSSVVGYAHLS
TG253_CAEEL/60-344SNNHTHEFRFLHYTQSNKVRSSVDSSVSYASGV

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window