Sequence alignment for CL0286

PF03074

GSH1_YEAST/253-647------------IYMDSMGFGMGCSCLQVTF------------------------------QAPNINKA--RYLYDALVN
GSH1_HUMAN/236-610------------IYMDAMGFGMGNCCLQVTF------------------------------QACSISEA--RYLYDQLAT
GSH1_ONCVO/243-613------------IYMDHMGFGMGCCCLQVTF------------------------------QAVNIDEA--RWLYDQLTP
GSH1_MOUSE/236-610------------IYMDAMGFGMGNCCLQVTF------------------------------QACSISEA--RYLYDQLAT
GSH1_RAT/236-610------------IYMDAMGFGMGNCCLQVTF------------------------------QACSISEA--RYLYDQLAT
GSH1_SCHPO/299-657------------IYMDSMGFGMGCCCLQITF------------------------------QAKSCDEA--RLLYDQLTP
O77252_TRYCR/321-672------------IYMDCMAFGMGCNCLQVTM------------------------------QLENETQA--RHVYDQLGV
Q26820_9TRYP/306-657------------IYMDCMAFGMGCNCLQLTM------------------------------QLPNEAQA--RHIYDQLGI
GSH1_CAEEL/241-614------------IYMDHMGFGMGCCCLQVTF------------------------------QAVNVDEA--RWLYDQLTP
P90557_LEITA/314-665------------IYMDCMAFGMGNSGLQVTM------------------------------QLDNIQEA--RHVYDQLAI

PF04107

CAAL_HALSA/15-298---------------------------------------------------------------LGVEEE--FFVVDEHGV
CAAL_PSEAE/12-290---------------------------------------------------------------FGIEEE--FFLLDASDL
Q9RD01_STRCO/37-342---------------------------------------------------------------LGVEVE--WLVHELRAP
Y2307_ARCFU/12-285---------------------------------------------------------------DENFNP--VPISDEILK
P74515_SYNY3/5-287---------------------------------------------------------------KGLEVE--IYTGKKTGE
CAAL_ECOLI/14-292---------------------------------------------------------------LGIELE--MQVVNPPGY
GSHA_MYCTU/46-355---------------------------------------------------------------VGLEME--AHCFDPADP
Q9RH09_ZYMMB/53-361---------------------------------------------------------------PSYEEK--GGICDLLQG
CAAL_STRCO/4-283---------------------------------------------------------------VGVEEE--LLLVDPATG
CAAL_MYCBO/20-297---------------------------------------------------------------LGVEWE--FALVDSQTR
Q9A2Z2_CAUCR/50-358---------------------------------------------------------------VPYEGD--KGVHALLTG
Q9JMV4_BRAJP/24-335---------------------------------------------------------------VPYEGA--RGIGALLEG

PF00120

GLNA_HALVD/117-366---------------------------------------------------------------SGDPRG--.VLKRAIER
GLNA_SYNP2/104-382---------------------------------------------------------------SRDPRS--.IAQKAVDY
GLNA_AZOC5/103-379---------------------------------------------------------------GRDPRG--.IAKKAMAY
Q9Y9Z7_AERPE/97-368---------------------------------------------------------------PRDPRL--.AAETAEKI
GLNA_NOSS1/103-383---------------------------------------------------------------NRCPRV--.IAQKAIDY
GLNA_SHIFL/102-379---------------------------------------------------------------DRDPRS--.IAKRAEDY
GLNA_BACCE/105-354---------------------------------------------------------------EGDPRN--.NLKRVLKE
E7QAF9_YEASB/107-352---------------------------------------------------------------KFNHRH--.EAAKLFAA
O86055_HERSE/104-381---------------------------------------------------------------DRDPRS--.IAKRAEAY
O33342_MYCTU/121-374---------------------------------------------------------------AVSPRS--.ILRRQLDR
Q9HYP0_PSEAE/75-331---------------------------------------------------------------GLSTRG--.LLKQVVAR
GLNA_METJA/115-365---------------------------------------------------------------EGDPRS--.RLKAILEE
GLNA_XENLA/110-359---------------------------------------------------------------ETNLRH--.TCKKIMEM
Q97VQ9_SULSO/102-347---------------------------------------------------------------NYDPRS--.ILIKTIEK
Q977Z8_THEVO/122-372---------------------------------------------------------------PGDPRY--.VLEKLLEK
GLNA1_MYCTU/105-387---------------------------------------------------------------SRDPRN--.IARKAENY
GLNA_AGABI/105-350---------------------------------------------------------------RTNHRH--.HAKKVFDE
GLNA_PYRAB/96-339---------------------------------------------------------------GADPRG--.VLKRVIEK
GLNA_METTH/107-353---------------------------------------------------------------EGDPRY--.VLKRALDK
GLNA_LACLA/106-356---------------------------------------------------------------AGDPRG--.VLKRNLKS
Q9KZC7_STRCO/124-376---------------------------------------------------------------PACGRT--.VLRRIVAG
Q9A3S2_CAUCR/129-384---------------------------------------------------------------EEAPRQ--.VLRRVLAL
GLNA_CLOSA/105-353---------------------------------------------------------------EGDPRH--.VLKRANAD
O85177_AMYMD/104-383---------------------------------------------------------------SRDPRN--.IARKAEQY
Q98A06_RHILO/120-375---------------------------------------------------------------PVDTRN--.VLKTQVAS
Q9I3F1_PSEAE/117-372---------------------------------------------------------------VADPRH--.LLVRTIDA
GLNA_THEMA/102-350---------------------------------------------------------------EGDPRY--.RLRRMMEK
GLNA3_RHILP/97-349---------------------------------------------------------------EQAPRV--.VLKRLVAE
GLNA_AZOBR/103-379---------------------------------------------------------------ARCPRG--.IAKAAEKY
Q9AEL4_CORGT/87-338---------------------------------------------------------------FSDPRQ--.VLRRQVQL
GLNA_SULSO/104-381---------------------------------------------------------------ERDPRF--.IAEEAEKY
GLNA2_DROME/116-365---------------------------------------------------------------DTNKRK--.TCLEVANK
GLNA_AZOVI/100-377---------------------------------------------------------------DRDPRA--.IARRAEEY
GLNA_ARCFU/116-402---------------------------------------------------------------DCDPRG--YVAKRYEDM
GLNA2_FRAAL/84-326---------------------------------------------------------------PTNTRA--.AALGVAER
Q9K665_BACHD/115-365---------------------------------------------------------------EGDPRN--.ILKKTVER
Q9SC91_MEDTR/118-374---------------------------------------------------------------EYCPR.--.EALRRVSK
Q986Q4_RHILO/115-369---------------------------------------------------------------LGDPRR--.ALARILDR
Q9I6J3_PSEAE/114-370---------------------------------------------------------------ELSPRN--.ILKRVLKM
GLNA_HAEIN/106-383---------------------------------------------------------------DRDPRS--.IAIRAENY
O88070_STRCO/130-380---------------------------------------------------------------LAAPRQ--.ILRRQLER
Q9AMT8_BRAJP/106-360---------------------------------------------------------------NICPRG--.VLRKVLRR
GLNA_HELPJ/111-388---------------------------------------------------------------EKCPRS--.IAKKALKH
GLNA1_DROME/147-395---------------------------------------------------------------ASNKRA--.AFQAAIDL
O31044_SYNPW/104-383---------------------------------------------------------------DRCPRA--.LAQRALAY
Q97FR9_CLOAB/167-449---------------------------------------------------------------LSRQAI--.RVLRCLGN
Q98CH5_RHILO/124-382---------------------------------------------------------------SSDPRL--.ALARQVDI
GLNA_COLGL/109-354---------------------------------------------------------------KYNYRH--.ECAKLMEA
GLNA_STAAW/107-356---------------------------------------------------------------EGDPRA--.NLKRVLKE
GLNA_LACDE/107-356---------------------------------------------------------------EGDPRN--.NLKKVIAE
Q9C213_NEUCS/546-806---------------------------------------------------------------ALCPRS--.QLQKAVDL
Q9U307_CAEEL/115-364---------------------------------------------------------------ATNYRQ--.RCKEVMEK
P95692_STRAG/106-359---------------------------------------------------------------CRRFHV--.KFQRNMKR
GLNA1_STRFL/101-378---------------------------------------------------------------SRDPRN--.IAKKAEAY
PUUA_ECOLI/133-390---------------------------------------------------------------DVEPRN--.VLNRLWQQ
Q9FAR9_SHEVI/102-379---------------------------------------------------------------NRDPRS--.IAKKAEEY
GLNA_METMP/110-357---------------------------------------------------------------EGDPRG--.CLKRVLAK
Q98H15_RHILO/126-382---------------------------------------------------------------PHSPRA--.ILKKQVKR
GLNA1_ALNGL/103-351---------------------------------------------------------------PTNKRH--.GAAKIFSH
Q9RX64_DEIRA/111-359---------------------------------------------------------------EGDPRR--.VLRAQVER
Q27747_PARLI/109-358---------------------------------------------------------------ETNYRK--.TCDEIMTR
GLNA_SULAC/107-383---------------------------------------------------------------ERDPRG--.IAEEAEKY
Q9RDW7_LACRH/107-356---------------------------------------------------------------GGDPRN--.NLIRVVNE
Q9A6W3_CAUCR/103-379---------------------------------------------------------------NRDPRS--.IAKAALNY
Q9SCP3_ARATH/507-763---------------------------------------------------------------GYCPR.--.ETLRRVAK
P95529_PSEPU/135-401---------------------------------------------------------------ALSPRA--.ILKKALVE
Q9RDS6_STRCO/104-363---------------------------------------------------------------FADPRY--.VLKRALAR
Q9A3R4_CAUCR/118-375---------------------------------------------------------------DLDPRH--.VLQRVLDR
GLNA_THIFE/104-378---------------------------------------------------------------ERDPRS--.VAKRAEIY
GLNA1_RHILV/103-379---------------------------------------------------------------NRDRRG--.TAKKAEAY
Q9HT65_PSEAE/105-353---------------------------------------------------------------PACPRS--.LLRAEVER
GLNA2_STRVR/89-333---------------------------------------------------------------ASNTRA--.ALAEVAER
Q98EM0_RHILO/120-375---------------------------------------------------------------MASPRH--.VLRAVLDL
GLNA_HALSA/115-364---------------------------------------------------------------AGGPRQ--.VLKNVLAR
Q53045_RHORU/103-379---------------------------------------------------------------ERCPRS--.IAKKALSY
GLNA_METCA/102-379---------------------------------------------------------------ERDPRS--.IAKRAEAY
Q9I275_PSEAE/120-376---------------------------------------------------------------FADPRE--.VLRQVVAR
GLNA2_MYCTU/106-357---------------------------------------------------------------WADPRH--.VLRRQLTK
Q988Z8_RHILO/141-397---------------------------------------------------------------EFTPRN--.VLKRVLAA
Q97W07_SULSO/106-349---------------------------------------------------------------PYCSRS--.ILNKAIEK
Q44249_ACISP/140-407---------------------------------------------------------------PLCPRG--.IMKKAVKS
LGSN_HUMAN/181-427---------------------------------------------------------------LTSPRY--.IAKRQLSH
GLNA2_HORVU/165-413---------------------------------------------------------------PTNKRH--.MAAQIFSD
O07752_MYCTU/111-358---------------------------------------------------------------PACSRG--.TLSRIEAA
Q9ZF05_9CYAN/195-477---------------------------------------------------------------MNKAAT--.RVLKLLGE
GLNA_NEIGO/105-382---------------------------------------------------------------DRDPRS--.IARRAEAY
GLNA2_STRHY/85-330---------------------------------------------------------------PSNTRA--.LLRPVAER
Q9HT51_PSEAE/117-373---------------------------------------------------------------AGDPRH--.VLQRVIHS
GLNA_AQUAE/105-379---------------------------------------------------------------GRDTRY--.IAQKAEQY
Q9PCD9_XYLFA/137-414---------------------------------------------------------------VRDPRG--.IAKRAEIY
GLNA_RHOCA/103-378---------------------------------------------------------------SRDPR.--.IALKAEAY
Q97S86_STRPN/106-358---------------------------------------------------------------AGDPRG--.NLKRALRH
O96463_SKECO/151-401---------------------------------------------------------------PTNTRA--.IAAKAFEG
GLNA1_FRAAL/104-383---------------------------------------------------------------SRDPRN--.IAKKAETY
Q79VE3_CORGL/105-386---------------------------------------------------------------SRDPRN--.VARKAEQY

PF12224

Q311H8_DESDG/19-291---------------------------------------------------------------TMRRVG--FELE.FT..
Q2HBV5_CHAGB/10-268---------------------------------------------------------------PGLRFG--VEIE.LVLR
Q67LG7_SYMTH/9-197---------------------------------------------------------------EELRFG--VEIE.FV..
A6G6Z1_9DELT/9-197---------------------------------------------------------------RSLRFG--VEIE.FV..
Q5LF69_BACFN/74-277---------------------------------------------------------------FNRCFG--VEIE.AY..
A6KZ00_BACV8/75-278---------------------------------------------------------------FRRKFG--VEIE.AY..
A7ALF5_9PORP/71-272---------------------------------------------------------------FNRKFG--IEIE.AY..
A5D072_PELTS/13-222---------------------------------------------------------------ENRTFG--VEIE.FF..
O86176_DICNO/4-232---------------------------------------------------------------KEIHYG--IEIE.TV..
Q1DBA6_MYXXD/2-223---------------------------------------------------------------KTLRFG--IEIE.TV..
B8I7I6_CLOCE/4-236---------------------------------------------------------------KNQRFG--IEIE.LT..
Q24NQ7_DESHY/4-240---------------------------------------------------------------KEQRFG--IEIE.MT..
A7VE77_9CLOT/4-240---------------------------------------------------------------KEQKFG--IEIE.MT..
A5N406_CLOK5/4-240---------------------------------------------------------------KSQRFG--IEVE.LT..
Q252G7_DESHY/4-240---------------------------------------------------------------QAQDFG--IEIE.MT..
A3DFX9_CLOTH/2-240---------------------------------------------------------------LTTRFG--IEVE.LT..
B0K6R6_THEPX/2-240---------------------------------------------------------------LSAKFG--IEIE.FT..
A3DG69_CLOTH/7-247---------------------------------------------------------------LKARFG--IEIE.MT..
A7B449_RUMGN/13-255---------------------------------------------------------------KKQTIG--VEVE.MN..
A5KNA4_9FIRM/6-244---------------------------------------------------------------QDQYFG--TEIE.MT..
A7VHZ7_9CLOT/7-244---------------------------------------------------------------KDQYFG--TEIE.MT..
A6P0C2_9FIRM/7-247---------------------------------------------------------------KDQCFG--VEVE.LT..
A6NU92_9FIRM/5-246---------------------------------------------------------------KDQCFG--VEVE.FT..
A7VEY9_9CLOT/228-465---------------------------------------------------------------KKRRFG--CEIE.FT..
Q2LU27_SYNAS/194-396---------------------------------------------------------------PIYSFG--VEFEGFVRS
A6NXI0_9FIRM/22-218---------------------------------------------------------------GPRFFG--VELE.I...
A6RSA1_BOTFB/8-281---------------------------------------------------------------TDFTFG--VEFE.FGVR
A6RWE1_BOTFB/15-325---------------------------------------------------------------DIPSFG--VEFE.FLIA
A6S997_BOTFB/48-350---------------------------------------------------------------PRLTFG--VELE.IAVG
A7EWG5_SCLS1/49-355---------------------------------------------------------------PRLTFG--VEFE.MAIC
A6RWC8_BOTFB/15-290---------------------------------------------------------------TRLTFG--IELE.YLLA
A6F4K8_9ALTE/17-284---------------------------------------------------------------KERRVG--VEIE.LS..
A1U270_MARAV/19-286---------------------------------------------------------------QERKVG--VEIE.LS..
A3J9P7_9ALTE/19-286---------------------------------------------------------------AERRVG--VEIE.LS..
Q1N2M0_9GAMM/21-286---------------------------------------------------------------KPRRVG--IEIE.LA..
Q21GI0_SACD2/15-285---------------------------------------------------------------KPRCVG--VEVE.FA..
A1SY20_PSYIN/16-290---------------------------------------------------------------ETRKVG--FELE.FS..
A6Q4S5_NITSB/14-275---------------------------------------------------------------DIRKAG--FEIE.YT..
Q1NPF7_9DELT/17-289---------------------------------------------------------------RPRQVG--IEIE.MA..
Q1QYE1_CHRSD/31-310---------------------------------------------------------------RQRRVG--VEIE.FA..
Q0A4Z7_ALHEH/26-298---------------------------------------------------------------RPRRVG--FELE.FA..
A6GSC5_9BURK/17-282---------------------------------------------------------------DVRCAG--FELE.FA..
Q2SFT5_HAHCH/19-280---------------------------------------------------------------EVRLVG--FELE.FT..
A4A8R3_9GAMM/16-277---------------------------------------------------------------KPRRAG--FELE.FS..
A3WME7_9GAMM/21-284---------------------------------------------------------------QLRTIG--FEIE.FS..
Q5QYT8_IDILO/18-278---------------------------------------------------------------EDRRVG--FELE.FS..
A6FM81_9RHOB/18-271---------------------------------------------------------------TPRRVG--VEIE.LG..
A6DW96_9RHOB/16-269---------------------------------------------------------------DPRLVG--VEIE.LG..
A3TW22_9RHOB/18-271---------------------------------------------------------------DPRLTG--VEIE.FS..
A3K2K5_9RHOB/17-270---------------------------------------------------------------VERKTG--VEVE.FS..
Q0FIK0_9RHOB/23-278---------------------------------------------------------------EPRRVG--VEVE.FS..
Q0AQY0_MARMM/8-327---------------------------------------------------------------RPWKQG--FEIE.LMA.
Q2L5I9_CLOPF/180-403---------------------------------------------------------------NKSTFG--VELE.FV..

PF04262

GSH1_PSEAE/6-381-------------------SRRLALLGAAAN------------------------------LPLLTECL--HGIERECLR
Q9RDU4_PSESP/6-381-------------------AGRLSLLSGTDE------------------------------LTLLLRGG--RGIEREALR
GSH1_ECOLI/6-381-------------------SQALAWL..EKH------------------------------PQALKGIQ--RGLERETLR
GSH1_CLOAB/6-390-------------------PEMIRLFSDEYR------------------------------SSMLSEGN--FGVERESQR
GSH1_BUCAI/6-382-------------------SKKIAWL..KKN------------------------------PKMLKGIF--RGIERETLR
GSHAB_PASMU/1-337-------------------MKIQHIIHENQL------------------------------GLLFQQGS--FGLEKESQR
GSH1_VIBCH/5-379-------------------AERLQTV..ANK------------------------------PEVFQKFS--RGLERESLR

PF14395

B7DSA7_9BACL/212-472---------------------------------------------------------------PSVTLG--ADVEIMLRN
C0ZEZ5_BREBN/171-428---------------------------------------------------------------TLQSLG--ADPEFALRK
B0TB99_HELMI/204-455---------------------------------------------------------------TDVTLG--ADPEFMFKH
C6CUQ2_PAESJ/144-402---------------------------------------------------------------APLLIG--ADPEFVLIR
D3E8P9_GEOS4/163-421---------------------------------------------------------------SSLLMG--MDPEFVLMK
Q0AXS0_SYNWW/193-453---------------------------------------------------------------TEVKLG--ADPEFMMLN
B0TBC1_HELMI/214-474---------------------------------------------------------------SSVTIG--SDPEFMLSL
B0TET0_HELMI/208-468---------------------------------------------------------------DDFTLG--CDVEFMLRQ

PF09899

A3HSI4_9BACT/278-1112AEPAETTFEFENEVTRIVEKPRVTKPYSDEQ------------------------------WQKILDVG--DKVDADLEA
Q1B9K6_MYCSS/283-1101TEPCESTLDFANLVTRVHEDPRVTLPYTETA------------------------------WDAVCALG--ARVDDRLTK
Q4ZYW4_PSEU2/275-1090VEPCETEFSHEMSVERIWEAPRVTKPYTEAQ------------------------------WQDIQALG--RQIDADLLR
A0L4M6_MAGSM/274-1111TDKCETTFHYKNTVVRIHEDPRVTKPYSSSQ------------------------------WSDILTLG--EDVDKLLKK
Q2W952_MAGSA/302-1132VEMCEVSFEHHMGVARVLETPRVTKPYSEDQ------------------------------WQAVLELG--DLVDEKLRQ
Q11VA3_CYTH3/275-1141TSKCETTFSFSNVVTRIHEDPRVTKPYSEEE------------------------------WTAINALG--MMVDYEYQK
A2VKS3_MYCTU/329-1149TDVCDTVLEFSNTVTRVHEDPRVTLPYTDES------------------------------WKTICEVG--QRVDERLAA
A0NMX9_9RHOB/275-1105ASKAEVDFSFDMKVARVAEHPRITKPFSDDA------------------------------WAALNQLG--AKVDRILSQ
A4XQ07_PSEMY/275-1095LDECEVTFEHLMSVERVWEAPRVTKPYSEAQ------------------------------WQAIQALG--RRIDDDLSK
A9W7N2_METEP/297-1111AEPAKVEFAYEMTISRVAEAPRITKPFSDEV------------------------------WTSMDALG--ERIDADLAE
Q47BP1_DECAR/275-1115LDECETEFSHHMQVTRIWEAPRVTKPYTDEQ------------------------------WIEIEGLG--HQIDDTLGK
Q2SNA7_HAHCH/275-1090VDEAEVEFSFFNQVTRIKEDPRVTRPFTERE------------------------------WEDIDALG--QYIDETLTR
Q31N62_SYNE7/1-727MGSAA........................KH------------------------------WTAIAALG--DRVEAALQA
A8LRF2_DINSH/275-1107ASAANVEFNFDMQVTRTAEHPRITKPFSDTA------------------------------WEALNDLG--RKVDAKLDA
Q1MBT5_RHIL3/277-1103FGEAETEFAFDMKVSRVAEHPRITKPFSDES------------------------------WEELNELG--EKVDRILEA
Q89QZ5_BRAJA/275-1084AGFAEVEFAFDMSVKRIREAPRITKPFSDES------------------------------WARLNDLG--EQVDGDLAS
Q1YG30_MOBAS/275-1127VSFAEVEFDFEMTVDRISERPRVSYPFSEES------------------------------WQALDELG--ETVDRELVE
A3VDN8_9RHOB/278-1112AGTPQVDFAFDMQVKRVSEHPRITKPFSDEA------------------------------WERLNKLG--QQVDASLEK
A6C0B7_9PLAN/274-1115VEKCEVTFHHEMSISRVHEDPRITKPYTDEV------------------------------WERIDSVG--QQVDKALEA
A3XIL1_LEEBM/275-1116SDPAETEFEFDNSVTRIFESPRVTKPYTEAQ------------------------------WNAIYELG--FEVEKELQA
A3PN00_RHOS1/275-1102ASYAEVDFAFDMKVTRVAEHPRITKPFSDES------------------------------WQRLDALG--HRVDAALRA
A1U538_MARAV/275-1097VEDCEVEFEHQMSVQRIWEAPRVTKPYTEEQ------------------------------WQRIVDLG--HEVDERLTE
A1VL54_POLNA/295-1117TDKAEVTFFHEMTITRIHEDPRVTKPYKEED------------------------------WQKIDLLG--QQVDADLKR
Q21G23_SACD2/275-1112TDKCEVEFDFLNTVARIHEDPRVTKPYTEQQ------------------------------WQEVLALG--KFVDSKLEA
A6GT43_9BURK/286-1103LDECEVEFEHEMSVQRVYESPRTSKPYTEEQ------------------------------WKGIEALG--FEVDKALDA
Q7UKP5_RHOBA/275-1113HEPCEVEFEHEMTVTRVHEDPRVTKPYAEST------------------------------WQDILQAG--RAIDEQLES
A4TX61_9PROT/275-1111VEACTVGFDHRMEVIRVLETPRVTKPYSDEQ------------------------------WQAVLALG--QQVDQRLHA
B0SXH9_CAUSK/275-1086VGPARVEFEFEMSVTRLIEPVRITKPFEDDR------------------------------WAALDALG--EAVDKDLAA
Q2RR87_RHORT/275-1085VEPCETAFDFAMSITRVHETPRVTKPYSDEQ------------------------------WRAIDALG--RRIDTVLGK
A1K5W6_AZOSB/275-1124LDKCEVAFEHAMKVTRIWEAPRVTKPYTEAQ------------------------------WSEIERLG--HAIDAELAE
Q1ND53_9SPHN/280-1118AEPAEVDFRFEMSVSRIAEAVRITKPFTDTR------------------------------WDAVMALG--EQVDADLER
Q218C6_RHOPB/275-1085AGFANVDFNFEMSVKRIREVPRITKPFSDAA------------------------------WARLDQVG--EQVDADLKA
A5VFM9_SPHWW/295-1120LEPAHVDFHFDMDVQRIAEAVRITKPFTDAR------------------------------WEALDALG--EAVDADLVA
Q98HG6_RHILO/275-1114ASFANVEFGFDMRVDRIAEHPRITKPFSDES------------------------------WQALDALG--NKVDAALGE
C0AE57_9BACT/275-1117LDECEVEFAHEMHVSRIQESPRVTQPCTEEQ------------------------------WAAIDRLG--HQIDADLER
B0UHH5_METS4/274-1075ADPAEVDFHFEMNVMRVAEAPRVTRPFSDEA------------------------------WGAMDALG--DRIDRDLAA
C1DJA3_AZOVD/275-1116VDDCECEFSHDMRIERIWEAPRVTRPYSEEQ------------------------------WRAILDLG--HRVDADLLR
A3YWY7_9SYNE/14-726AEPMV...........VTESIR..HASADAG------------------------------WMAVTA..--AEAERRLSA
A6VTZ0_MARMS/275-1113VDECECEFSYSNIVTRIHEDPRVTKPYAEGE------------------------------WDTIKALG--FAVDKQLED
Q07VI7_RHOP5/275-1098VDPAEVTFAFEMKVTRIDEKPRVTLPFSDEA------------------------------WTALDRLG--EKVDADLAA

PF03136

PAFA_CORGL/10-445RRIMGIETEYGLTFV.DGDSKKL......................................RPDEIARR..MFRPIV.EK
Q7UWL2_RHOBA/26-608RRLMGMETEFATVVEPRDGSLSSSVTAREVY..............................AGLRDAIC..RHLPAVEGL
A6G895_9DELT/3-562DRLLGLETEYAIRYSPAHPADPRRPDHESVY..............................DLFIEVLD..ERVATSDGA
Q7WZ91_9ACTO/5-426RRIFGLENEYGITCT.FKGQRRL......................................SPDEVARY..LFRKVV.SW
PAFA_KINRD/3-425RRIFGLETEFGVTCA.FEGQRKL......................................SPDEVARY..LFRKVV.SW
A3TL35_9MICO/3-425RRIFGIENEYGITAS.SEGQRTL......................................TPDEVARY..LFRKVV.AW
PAFA_MYCS2/3-424RRIMGIETEFGVTCT.FHGHRRL......................................SPDEVARY..LFRRVV.SW
PAFA_ARTS2/3-425KRIFGIETEFGISYS.SPDSRPL......................................APEEVARY..LFRKVV.SW
PAFA_CORDI/11-437RRITGVETEYGITCVGDNSRRRL......................................GADEAARY..MFRPVV.EE
PAFA_CORJK/6-436RRIMGLETEYGIANM.QDSSRRL......................................GPDEIARK..LFAPVV.EK
PAFA_BIFLO/27-456CRIFGVETEYGVAVT..GAERPV......................................DAGQVAMT..MFQPIV.SR
A3EPC1_9BACT/3-425RRIFGLESEYGFVFQ.NKSQKAY......................................PPERALEF..LFQGIL.MN
Q828J1_STRAW/4-459RRVMGIETEYGISVPGHPNANAMLTSSQIVNAYAAA...........MHRARRARWDFEEENPLRDARG..FDLARE.AA
A8LH56_FRASN/73-531RRIMGTETEYGVSVPGQPNTNQMLASSLVVNSYANRA..........ATGGSRARWDFEEESPLRDARG..FELPREPVV
Q47NY8_THEFY/10-466RRIMGIETEYGISVPGNPGANAMVTSTQVVNAYLTAS..........AARARRARWDFEEENPLRDARG..FDLARE.AA
A0LU48_ACIC1/2-458HRVMGIETEYGISVPHQPNANAMAASSQVVNAYAPIG..........APAQRQARWDFEEENPLRDARG..FEVARE.AA
A1SK11_NOCSJ/4-459RRVMGAEVEYGIAVQGQPLANPMVASSQVVNAYASA...........TLKARRARWDFEEESPLRDARG..FDMSRQ.VA
A6W968_KINRD/4-497RRVTGIETEYGISVPGDPGANPMLLSAQVVNAYAAPATGSMRSSLAGAGGGSRARWDYEDEAPLRDARG..FELDRA.RA
Q5YUX0_NOCFA/2-457QRIIGIEVEYGISTPTEPSANPILTSTQAVLAYAAAE.........GVPRARRTRWDYEVESPLRDARG..FDLSR..MN
A4FBX9_SACEN/2-456RRIMGTEVEYGIVVPGDSSANPVLTSTHIVLAYAAAA.........DIPRARRARWDYEVESPLRDARG..FDLGAA.AQ
A1R6Q5_ARTAT/19-506MRVMGSETEYGIHAPSAPGANATMMSARIIQAYATVTR.......QRAAGGAETRWDYTDEEPLHDARG..WTVDRA.VA
Q8NQD9_CORGL/2-460ARFMGSETEYGISTPSAPFLSPIVTSTHAVVAYSTAR..........GFGEHRVRWDYAQESPLRDTRG..FDLRRY.HQ
Q8FTE4_COREF/2-463ERFIGSETEYGIATPGHTHVSPIVTSTHAVVSYASAR..........GFGEHRVRWDFSEESPLRDSRG..FDLRRY.HQ
Q6NH93_CORDI/2-457SRFVGTETEYGIATPSNTMLSPIVTSTHAVVAFSLG...........ERCASQARWDFSEESPLRDLRG..FDLRRY.RT
Q4JVP6_CORJK/4-450PHIIGSETEYGIVAVNDPSASPIHTSTQAVVAYAEHS.........GQGVNRRTRWDYENESPLRDIRG..FDLRRY.RR
A7BC88_9ACTO/4-485ERIIGTETEYGVYRPGDAWANPIALSTTVVTTYGEISRE.....GTPAQGAGVVRWDYTGEDPLNDLRG..MRMSRA.AA
Q8G3G5_BIFLO/4-488KRVMGTETEYAVSLNTPDRYNPVQLSFDVVNGAAD.............SHSKSIRWDYRQEDPVNDARG..TRLERA.AA
A7A4U7_BIFAD/16-491RRVMGTETEYAVSAPGQGRYNPVQLSFDVVGAASD.............ASRSHIRWDYRQEDPVNDARG..TRLERA.AA
A3EPC5_9BACT/10-458AGIVGTEVEYGLSWANRTPEDPERLSAELIGHVPE.............ACHAPVLWDYENEDPRHDARG..FLVEGD.RE
A3ETM5_9BACT/5-463SVVMGIETEYGIVRNDLKESDPVIESMELVRSYQ...............SADLTGWLYQGEDPSLDARG..FRVDNL.AQ
A3ETM1_9BACT/26-469KTVVGLETEYGALLSGASQG.................................MRDLFRQEEMFQKVRDHIFHVQRKGLI

PF00217

KTRC_SCHMA/141-382---------------------------------------------------------------NTYG.N--LVVSTRVRL
Q7PYN5_ANOGA/203-445---------------------------------------------------------------DPEG.Q--YVVSTRVRC
Q4AED1_9ANNE/113-361---------------------------------------------------------------LLDA.K--YVKSCRVRT
Q4AED2_9ANNE/113-360---------------------------------------------------------------VLDE.N--YVRSCRVRT
KCRB_HUMAN/120-367---------------------------------------------------------------DLDP.N--YVLSSRVRT
Q1Q1E9_9BACT/18-252---------------------------------------------------------------GPES.D--IVISSRIRL
KARG_LIMPO/114-356---------------------------------------------------------------DPGG.Q--FIISTRVRC
A3DGD2_CLOTH/9-244---------------------------------------------------------------GPES.D--VVMSTRVRI
Q9VST4_DROME/143-385---------------------------------------------------------------DPDG.H--FIVSTRVRC
Q4AEC5_9ANNE/149-396---------------------------------------------------------------NFDE.K--YVVSSRVRT
Q9NKV5_OCTVU/106-347---------------------------------------------------------------DPSG.S--LIVSTRVRV
Y120_BACSK/19-255---------------------------------------------------------------GSDA.D--IVLSSRIRL
KARG_LIOJA/108-349---------------------------------------------------------------DPSG.D--WIVSTRVRV
A6QBA0_SULNB/100-342---------------------------------------------------------------DPEG.K--FILSTRIRV
Q8MWR8_9BIVA/125-367---------------------------------------------------------------DPTG.Q--FVVSTRVRM
A3ZT72_9PLAN/20-254---------------------------------------------------------------GPQS.D--IVISSRIRL
A7XZJ5_GLYDO/114-356---------------------------------------------------------------DPKN.E--YVLSTRVRC
Q6XLN0_HETGL/163-406---------------------------------------------------------------DPDG.K--YILSTRIRC
Q4AEC8_RIFPA/122-369---------------------------------------------------------------VFDE.K--YVVSSRVRT
Q177S3_AEDAE/202-445---------------------------------------------------------------DPEN.E--FIISTRVRC
A6XH18_9METZ/115-362---------------------------------------------------------------NLDP.N--YVLSSHIKT
A6CSY9_9BACI/19-254---------------------------------------------------------------GPNS.D--IVLSTRIRL
KCRF_STRPU/908-1155---------------------------------------------------------------DLDP.E--FVLSCRVRT
Q5TP29_ANOGA/189-444---------------------------------------------------------------DTSG.K--YITGCVIEC
Y282_PELTS/19-256---------------------------------------------------------------GPES.E--IIISSRVRV
Y860_HALOH/19-252---------------------------------------------------------------GPER.D--IVLSSRIRL
Q2B1J8_9BACI/19-255---------------------------------------------------------------GPDS.D--IVLSSRIRL
Q1HBJ2_BRABE/114-362---------------------------------------------------------------EFDE.K--YVFSSRVRT
KARG_HALMK/111-353---------------------------------------------------------------DPSG.E--YIVSTRVRV
A6XH11_9METZ/115-365---------------------------------------------------------------PP....--DI.SIRMRT
Y102_BACHD/19-254---------------------------------------------------------------GPDS.D--IVLSSRIRL
Q6F4H6_HEDDI/131-378---------------------------------------------------------------VFDE.K--YVKSCRIRC
A6XH14_CLAPR/119-361---------------------------------------------------------------QDEA.D--MIISTRIRV
Q760P7_ANABR/106-348---------------------------------------------------------------DPSG.E--MIISTRVRV
A4F2K7_9CUCU/128-370---------------------------------------------------------------DPTG.D--FIISTRVRC
A6F800_9GAMM/114-356---------------------------------------------------------------DPTN.K--YIVSTRIRV
Y077_GEOTN/19-255---------------------------------------------------------------GPDS.D--IVLSSRIRL
KCRS_RAT/154-401---------------------------------------------------------------QFDE.R--YVLSSRVRT
KARG2_CAEEL/117-359---------------------------------------------------------------DPEG.K--FIVSTRIRC
Q6BDZ3_9BILA/120-367---------------------------------------------------------------VLDS.N--YVLSSRVRT
Q67ER6_CHAVR/889-1136---------------------------------------------------------------DLDP.D--FVLSSRVRT
O45011_CAEEL/156-398---------------------------------------------------------------DPKG.K--YIKSTRIRC
Q6BDZ2_POLMI/114-361---------------------------------------------------------------KLDE.K--YVLSSRVRT
Q6RSH2_TETAR/120-367---------------------------------------------------------------NLDP.N--YVLSSRVRT
Q8T6T7_URECA/107-354---------------------------------------------------------------QFDE.K--YVKSCRIRT
KCRF_STRPU/161-408---------------------------------------------------------------DFDP.K--YVLSCRVRT
A7RNR3_NEMVE/152-399---------------------------------------------------------------KFDE.K--YVLSSRVRT
A7S6V8_NEMVE/867-1114---------------------------------------------------------------DLDA.N--FVLSCRVRT
Q7T1J2_CHAAC/120-367---------------------------------------------------------------DLDP.A--YVLSSRVRT
A6XH13_9METZ/149-396---------------------------------------------------------------LFDD.K--YMLSSRVRT
Q67ER6_CHAVR/504-751---------------------------------------------------------------DLDE.K--YVLSSRVRT
Y092_OCEIH/19-255---------------------------------------------------------------GPDK.D--IVMSSRIRL
Q4AED0_SIPCU/113-355---------------------------------------------------------------DPEG.K--YVISTRVRV
A0D308_PARTE/131-376---------------------------------------------------------------DPAL.E--KV.SMRARV
Y701_CHLPN/18-250---------------------------------------------------------------PQAN.K--VWPVTTFSL
Y194_CLOK5/10-245---------------------------------------------------------------NHNY.G--LVISSRIRL
Q7UMV3_RHOBA/22-257---------------------------------------------------------------GPES.D--IVISSRIRL
Q6APG0_DESPS/133-375---------------------------------------------------------------DPEG.R--YIRSSRVRV
Q9NKV6_9MOLL/108-349---------------------------------------------------------------DPEG.K--LIASTRVRV
Y070_BACP2/19-254---------------------------------------------------------------GPES.D--IVLSSRIRL
Q3A9N0_CARHZ/16-253---------------------------------------------------------------GTDA.D--IVVSSRIRL
KCRF_STRPU/534-781---------------------------------------------------------------NLDP.K--YVLSCRVRT
Q5L768_CHLAB/18-250---------------------------------------------------------------PPTN.K--TWPITTFSL
Q760P6_CRAGI/107-349---------------------------------------------------------------DATG.E--FIVSTRVRV
A7RGZ5_NEMVE/118-356---------------------------------------------------------------DPDN.R--FIRSTRIRV
A1HTJ5_9FIRM/19-255---------------------------------------------------------------GPDG.D--IVLSSRIRL
B1YGS1_EXIS2/18-248---------------------------------------------------------------APYD.D--IVVSTRIRL
Y110_BACA2/19-254---------------------------------------------------------------GPES.D--IVLSSRIRL
Y2442_CLOPE/7-240---------------------------------------------------------------PLDN.S--IVIASKVKI
Q4W3A2_SUBDO/130-379---------------------------------------------------------------PSTK.S--KIISTRIRV
Y3134_SYMTH/19-256---------------------------------------------------------------GPHA.D--IVLSSRIRL
Q9BKE8_CIOIN/114-361---------------------------------------------------------------NMDP.K--YVLSSRVRT
Y2328_THETN/3-239---------------------------------------------------------------QYDK.D--VVLSSRIRL
A6M9J4_LOCMI/114-356---------------------------------------------------------------NPNG.E--YVISTRVRC
Y2368_SYNWW/20-257---------------------------------------------------------------ASQS.D--IVISSRVRL
A8MLV0_ALKOO/9-245---------------------------------------------------------------GPES.D--IAISSRIRM
B8G1T2_DESHD/17-252---------------------------------------------------------------NPDT.P--VVLSSRIRL
Q73L28_TREDE/13-247---------------------------------------------------------------GPDT.D--VVLYSRCDI
Q4MIA1_BACCE/19-254---------------------------------------------------------------GPDS.D--IVLSSRIRL
Q4AEC6_9ANNE/106-353---------------------------------------------------------------KMDE.K--YVKSCRIRT
A5I7N7_CLOBH/9-243---------------------------------------------------------------LLND.N--MVLSSRIRL
Q67E02_GLOPY/117-364---------------------------------------------------------------DLDP.N--YVLSSRVRT
Y3260_BACLD/19-254---------------------------------------------------------------GPES.D--IVLSSRIRL
Y3190_CLOAB/9-244---------------------------------------------------------------LKDN.D--IVITTRIRL
A7YVI5_TOXCA/157-399---------------------------------------------------------------DPKN.K--YIVSTRIRC
Y161_MOOTA/16-253---------------------------------------------------------------GPQA.D--IVISSRIRL
A6XH19_9METZ/153-400---------------------------------------------------------------VFDD.K--YVLSSRVRT
Y046_CHLMU/17-249---------------------------------------------------------------FKAE.T--FRPISTLSL
Y1086_CLONN/9-244---------------------------------------------------------------NASE.D--IVLSSRIRL
Q9XZF5_CHAVR/108-356---------------------------------------------------------------NFDS.K--YVLSSRVRT
KLOM_EISFO/108-355---------------------------------------------------------------QFDP.K--YVKSARIRT
Q67ER6_CHAVR/136-383---------------------------------------------------------------NLDS.N--YVLSSRVRT
Q38EV2_TRYB2/136-378---------------------------------------------------------------DPEG.K--YVISTRVRC
A7RQU9_NEMVE/116-364---------------------------------------------------------------ALDP.K--YVLSSRVRT
Y2634_CLOTE/8-241---------------------------------------------------------------SLDNSD--IVLSSRIRL
Q14TA8_9CNID/153-400---------------------------------------------------------------AFDP.K--YVLSSRVRT
Q296Q2_DROPS/207-449---------------------------------------------------------------DPER.K--YIISARIRI
A7S6V8_NEMVE/487-734---------------------------------------------------------------DLDE.K--YVLSCRVRT
A0DI85_PARTE/130-381---------------------------------------------------------------DPKL.E--KV.SMRARV
Q291M9_DROPS/185-440---------------------------------------------------------------DDES.I--LVTRCIVEA
A3IET5_9BACI/18-253---------------------------------------------------------------DDYS.D--IVISTRIRL
Q9BLC7_APLKU/109-351---------------------------------------------------------------DPSG.N--VIVSTRVRV
KARG_STIJA/110-358---------------------------------------------------------------VLDP.A--YVISSRVRT
KCRM_TORMA/120-367---------------------------------------------------------------DLDP.N--YVLSSRVRT
A6XH09_9METZ/111-359---------------------------------------------------------------QFDP.N--YVISSRVRT
Y179_DESRM/19-256---------------------------------------------------------------GPEN.D--VIISSRVRL
Q8N0P4_9BIVA/478-719---------------------------------------------------------------DPEG.K--MVVSTRIRV
A7S6L6_NEMVE/110-357---------------------------------------------------------------KFDE.N--FVLSCRVRA
A7RER2_NEMVE/138-389---------------------------------------------------------------DSAK.A--KIISTRIRV
Q4AEC7_RIFPA/105-352---------------------------------------------------------------DLDG.K--YVRSCRIRT
Q75ZZ3_LAMJA/120-367---------------------------------------------------------------DLDP.N--YVLSSRVRT
Q17MS1_AEDAE/186-440---------------------------------------------------------------DTSG.K--FITGVVIEC
A6TWL7_ALKMQ/9-245---------------------------------------------------------------GPES.D--IVVSSRIRI
Q1DA50_MYXXD/88-329---------------------------------------------------------------DPTG.E--FILSTRVRV
Y164_STAEQ/16-244---------------------------------------------------------------SEET.P--VIISSRIRL

PF03074

GSH1_YEAST/253-647FAPI------------------------------------MLAFSA-AAP-AFK-----------------GWLADQDVR
GSH1_HUMAN/236-610ICPI------------------------------------VMALSA-ASP-FYR-----------------GYVSDIDCR
GSH1_ONCVO/243-613ITPV------------------------------------LLALSA-ATP-VFR-----------------SRLADVDSR
GSH1_MOUSE/236-610ICPI------------------------------------VMALSA-ASP-FYR-----------------GYVSDIDCR
GSH1_RAT/236-610ICPI------------------------------------VMALSA-ASP-FYR-----------------GYVSDIDCR
GSH1_SCHPO/299-657ITPL------------------------------------MLALSA-GTP-AFR-----------------GYLADQDCR
O77252_TRYCR/321-672LCPL------------------------------------FLAMSS-STP-FQK-----------------GILCDSDVR
Q26820_9TRYP/306-657LCPL------------------------------------FLALSS-ATP-FQK-----------------GILCESDVR
GSH1_CAEEL/241-614ITPI------------------------------------LLALSA-ATP-IFR-----------------GKLSNVDSR
P90557_LEITA/314-665LCPV------------------------------------FLALSS-ATP-FQK-----------------GLLCDTDVR

PF04107

CAAL_HALSA/15-298PTA.------------------------------------..G--S-DEL-VYE-----------------GEPPEP..I
CAAL_PSEAE/12-290DIVR------------------------------------...--S-APA-GFV-----------------AACRDT..L
Q9RD01_STRCO/37-342RLP.------------------------------------..V--S-PER-LQA-----------------VYTALRAVP
Y2307_ARCFU/12-285KIG.------------------------------------...--.-GRT-VNE-----------------AKLGRV...
P74515_SYNY3/5-287IVG.------------------------------------...--.-..L-SDR-----------------IVRDLS...
CAAL_ECOLI/14-292DLS.------------------------------------.QD--S-SML-IDA-----------------VKNKIT...
GSHA_MYCTU/46-355FRR.------------------------------------PSW--E-EIT-E..-----------------VLEWLSPLP
Q9RH09_ZYMMB/53-361FTR.------------------------------------FGW--Q-PIY-END-----------------KIIGLS..G
CAAL_STRCO/4-283EPR.------------------------------------.AL--S-AAV-LAR-----------------AFLDDS..E
CAAL_MYCBO/20-297DLS.------------------------------------...--N-EAT-AVI-----------------AEIGEN...
Q9A2Z2_CAUCR/50-358LQR.------------------------------------FGW--T-PVM-EGP-----------------TIIGLE..R
Q9JMV4_BRAJP/24-335MKLL------------------------------------LGW--E-PIM-EKG-----------------NIIGLYDVT

PF00120

GLNA_HALVD/117-366AEE.------------------------------------LGYD..-VNV-APE-----------------PEFFLFEE.
GLNA_SYNP2/104-382LAA.------------------------------------SGIGDT-AYF-GPE-----------------AEFFVFDD.
GLNA_AZOC5/103-379LQS.------------------------------------TGIGDT-VFF-GPE-----------------AEFFIFDD.
Q9Y9Z7_AERPE/97-368MSS.------------------------------------MGYR..-VKA-GAE-----------------IEFFIFDKI
GLNA_NOSS1/103-383LVS.------------------------------------TGIGDT-AFF-GPE-----------------AEFFIFDS.
GLNA_SHIFL/102-379LRS.------------------------------------TGIADT-VLF-GPE-----------------PEFFLFDD.
GLNA_BACCE/105-354MEA.------------------------------------LGFS.D-FNL-GPE-----------------PEFFLFKV.
E7QAF9_YEASB/107-352HK..------------------------------------.DEE..-IWF-GLE-----------------QEYTLFDMY
O86055_HERSE/104-381LKS.------------------------------------SGLGDT-AYF-GPE-----------------PEFFIFDG.
O33342_MYCTU/121-374LKA.------------------------------------RGLV..-ADV-ATE-----------------LEFIVFD..
Q9HYP0_PSEAE/75-331YAA.------------------------------------HGLQ..-PVV-ATE-----------------LEFFVFAP.
GLNA_METJA/115-365LKK.------------------------------------EMNG.E-YFV-GPE-----------------PEFFLLKR.
GLNA_XENLA/110-359VN..------------------------------------.DHR..-PWF-GME-----------------QEYTLLG.I
Q97VQ9_SULSO/102-347AK..------------------------------------EQYDFD-FKS-AFE-----------------IEFYLTKD.
Q977Z8_THEVO/122-372VHK.------------------------------------EGN..E-FFV-GPE-----------------FEFFLFKR.
GLNA1_MYCTU/105-387LIS.------------------------------------TGIADT-AYF-GAE-----------------AEFYIFDS.
GLNA_AGABI/105-350AK..------------------------------------.EHE..-PWF-GLE-----------------QEYTLFD.A
GLNA_PYRAB/96-339LAE.------------------------------------MGI..K-AYI-GPE-----------------PEFYLFKK.
GLNA_METTH/107-353YAH.------------------------------------LGY..E-YNV-GPE-----------------PEFFILDQ.
GLNA_LACLA/106-356MEK.------------------------------------LGFK.S-FNL-GPE-----------------PEFFLFKL.
Q9KZC7_STRCO/124-376AAER------------------------------------HGIT..-FRA-AVE-----------------VEWVVGRG.
Q9A3S2_CAUCR/129-384YAD.------------------------------------KGWH..-PIV-APE-----------------IEFYLVDR.
GLNA_CLOSA/105-353AKE.------------------------------------LGYT.M-N.V-GPE-----------------CEFFLFET.
O85177_AMYMD/104-383IAE.------------------------------------YGVADN-VYF-GPE-----------------AEFYIFDS.
Q98A06_RHILO/120-375LAE.------------------------------------RDWT..-LNT-GLE-----------------PEFLLLRR.
Q9I3F1_PSEAE/117-372LKS.------------------------------------EGYH..-PVM-AAE-----------------LEFYLLDR.
GLNA_THEMA/102-350AEQ.------------------------------------LGY..T-PYA-GPE-----------------MEFFILPI.
GLNA3_RHILP/97-349AAK.------------------------------------EGLR..-VKT-GVE-----------------PEFFLIS..
GLNA_AZOBR/103-379MAS.------------------------------------AGIADT-AYF-GPE-----------------AEFFVFDD.
Q9AEL4_CORGT/87-338AAD.------------------------------------EGLT..-CMI-SPE-----------------IEFYLVQS.
GLNA_SULSO/104-381QTE.------------------------------------QGY..T-SYY-GPE-----------------LEFFMFDK.
GLNA2_DROME/116-365CA..------------------------------------.AEE..-PWF-GIE-----------------QEYTFLD.F
GLNA_AZOVI/100-377LKS.------------------------------------TGIGDT-AFF-GPE-----------------PEFFIFDE.
GLNA_ARCFU/116-402LKS.------------------------------------EGMS..-AIF-GPE-----------------IEFFLFEG.
GLNA2_FRAAL/84-326YA..------------------------------------.DMS..-PMF-GIE-----------------QEYTFFK..
Q9K665_BACHD/115-365AKE.------------------------------------KGYS.I-S.V-GPE-----------------LEFFLFET.
Q9SC91_MEDTR/118-374ILK.------------------------------------DEFDLA-MNA-GFE-----------------NEFFLLKS.
Q986Q4_RHILO/115-369YKA.------------------------------------LGLT..-PVA-ATE-----------------LEFYLVD..
Q9I6J3_PSEAE/114-370YAD.------------------------------------KGWR..-PIV-APE-----------------MEFYLTKR.
GLNA_HAEIN/106-383MRS.------------------------------------TGIADQ-AFF-GPE-----------------PEFFLFDD.
O88070_STRCO/130-380LAG.------------------------------------HGYT..-AQV-GTE-----------------LEFIVFR..
Q9AMT8_BRAJP/106-360AAD.------------------------------------HGYD..-CTA-GFE-----------------FEFILFKE.
GLNA_HELPJ/111-388LRD.------------------------------------LGLGDV-AYF-GAE-----------------NEFFIFDS.
GLNA1_DROME/147-395IS..------------------------------------.DQE..-PWF-GIE-----------------QEYTLLD.V
O31044_SYNPW/104-383LSG.------------------------------------SGLADK-AFF-GPE-----------------PEFFLFDD.
Q97FR9_CLOAB/167-449TTS.------------------------------------QKVF..-PNV-GPE-----------------QEYFIVDKK
Q98CH5_RHILO/124-382LAA.------------------------------------KGLY..-PAG-AFE-----------------LEFFLLAN.
GLNA_COLGL/109-354HA..------------------------------------.AHE..-PWF-GLE-----------------QEYTLLD.L
GLNA_STAAW/107-356MED.------------------------------------LGFT.D-FNL-GPE-----------------PEFFLFKL.
GLNA_LACDE/107-356MEE.------------------------------------MGFS.D-FEI-GFE-----------------AEFFLFKE.
Q9C213_NEUCS/546-806GAQ.------------------------------------NGLT..-FLL-GFE-----------------IEFLLLERV
Q9U307_CAEEL/115-364AA..------------------------------------.DQH..-PWF-GME-----------------QEYTLLD.I
P95692_STRAG/106-359MNR.------------------------------------VGYN.S-FNF-RTR-----------------PDFLLFKL.
GLNA1_STRFL/101-378LAS.------------------------------------TGIADT-AYF-GPE-----------------AEFYVFDN.
PUUA_ECOLI/133-390LRQ.------------------------------------RGLF..-PVV-AVE-----------------LEFYLLDR.
Q9FAR9_SHEVI/102-379LRS.------------------------------------TGIADT-VLL-GPE-----------------PEFFLFDD.
GLNA_METMP/110-357FDE.------------------------------------ELGG.E-FFV-GPE-----------------PEFFILKE.
Q98H15_RHILO/126-382LSE.------------------------------------RGYI..-GYF-ASE-----------------LEFYLFN..
GLNA1_ALNGL/103-351PEV.------------------------------------VAEV..-PWY-GIE-----------------QEYTLLQKD
Q9RX64_DEIRA/111-359AQA.------------------------------------LGLE.M-Y.V-GTE-----------------PEFFLFER.
Q27747_PARLI/109-358AA..------------------------------------.DTE..-PWF-GIE-----------------QEYTLLG.S
GLNA_SULAC/107-383QSE.------------------------------------QGYV..-SYF-GPE-----------------LEFFVFDK.
Q9RDW7_LACRH/107-356MKD.------------------------------------AGFT.A-FNI-GPE-----------------PEFFLFKL.
Q9A6W3_CAUCR/103-379LKS.------------------------------------AGVGDT-VYF-GPE-----------------AEFFIFDD.
Q9SCP3_ARATH/507-763VLK.------------------------------------DEFDLV-MNA-GFE-----------------NEFYLLKN.
P95529_PSEPU/135-401MQD.------------------------------------LGY..D-YQA-GLE-----------------VEWYLTRI.
Q9RDS6_STRCO/104-363TSD.------------------------------------LGFT..-FYT-HPE-----------------IEFFLLKD.
Q9A3R4_CAUCR/118-375YAA.------------------------------------DGLT..-PVA-ACE-----------------LEYYLVDL.
GLNA_THIFE/104-378LKS.------------------------------------TGIADT-SFF-GP.-----------------.EFFVFDS.
GLNA1_RHILV/103-379LKA.------------------------------------SGIGDT-VFV-GRE-----------------AEFFVFDD.
Q9HT65_PSEAE/105-353YRD.------------------------------------SGLQ..-VIA-AFE-----------------HEFSLLG..
GLNA2_STRVR/89-333FA..------------------------------------.AQE..-PIF-GIE-----------------QEYTFFQ..
Q98EM0_RHILO/120-375YRQ.------------------------------------RGWR..-AVV-APE-----------------VEFYLTAP.
GLNA_HALSA/115-364ADD.------------------------------------MGYS.V-S.I-GPE-----------------PEFFLFEK.
Q53045_RHORU/103-379LAS.------------------------------------TGIGDT-SYF-GPE-----------------AEFFVFDD.
GLNA_METCA/102-379MKS.------------------------------------TGIADT-ALF-GPE-----------------NEFFIFDD.
Q9I275_PSEAE/120-376FTE.------------------------------------MELT..-IVA-AFE-----------------LEFYLID..
GLNA2_MYCTU/106-357AGE.------------------------------------LGFS..-CYV-HPE-----------------IEFFLLKP.
Q988Z8_RHILO/141-397YDK.------------------------------------LGLR..-PVV-APE-----------------IEFYLVRK.
Q97W07_SULSO/106-349LKE.------------------------------------AGYT..-LQV-SFE-----------------PTFYLLNS.
Q44249_ACISP/140-407LSD.------------------------------------EGY..L-FKC-GIE-----------------LEWYLTKI.
LGSN_HUMAN/181-427LQA.------------------------------------SGFS..-LLS-AFI-----------------YDFCIFGV.
GLNA2_HORVU/165-413PKV.------------------------------------TSQV..-PWF-GIE-----------------QEYTLMQRD
O07752_MYCTU/111-358LAD.------------------------------------AGID..-AVI-GHE-----------------VEFLLVDA.
Q9ZF05_9CYAN/195-477KDI.------------------------------------APVN..-SSC-GAE-----------------QEYFLVDAN
GLNA_NEIGO/105-382LKS.------------------------------------SGIGDT-AYF-GPE-----------------PEFFVFDG.
GLNA2_STRHY/85-330FA..------------------------------------.GQE..-PIF-GIE-----------------QEYTFLK..
Q9HT51_PSEAE/117-373LQA.------------------------------------EGFH..-PVM-AVE-----------------LEFYLLDR.
GLNA_AQUAE/105-379LKQ.------------------------------------TGIGDT-AYF-GPE-----------------AEFFIFDS.
Q9PCD9_XYLFA/137-414LNS.------------------------------------LGIADQ-AFF-GPE-----------------PEFFIFDS.
GLNA_RHOCA/103-378LKA.------------------------------------SGIGDV-AYF-GPE-----------------AEFFIFDD.
Q97S86_STRPN/106-358MEE.------------------------------------VGFK.S-FNL-GPE-----------------PEFFLFKL.
O96463_SKECO/151-401KE..------------------------------------.DEE..-VWF-GLE-----------------QEFTPLQ..
GLNA1_FRAAL/104-383LRG.------------------------------------TSIADT-AYF-GPE-----------------AEFYIFDD.
Q79VE3_CORGL/105-386LAS.------------------------------------TGIADT-CNF-GAE-----------------AEFYLFDS.

PF12224

Q311H8_DESDG/19-291....------------------------------------.GVELE-DVA-QDV-----------------AALY-----
Q2HBV5_CHAGB/10-268SRHQ------------------------------------KHTTFI-SLA-AEI-----------------CQRL-----
Q67LG7_SYMTH/9-197....------------------------------------.GGNPA-AVE-LL.-----------------....-----
A6G6Z1_9DELT/9-197....------------------------------------.GIAPE-AVE-RL.-----------------....-----
Q5LF69_BACFN/74-277....------------------------------------.NCPRQ-TLT-DAL-----------------REA.-----
A6KZ00_BACV8/75-278....------------------------------------.NCTCQ-RLV-REL-----------------TEA.-----
A7ALF5_9PORP/71-272....------------------------------------.NCSRE-RLA-REL-----------------REA.-----
A5D072_PELTS/13-222....------------------------------------.GTTAP-QVL-EAL-----------------RNA.-----
O86176_DICNO/4-232....------------------------------------.KRTRE-QIA-WAI-----------------HSVV-----
Q1DBA6_MYXXD/2-223....------------------------------------.GASRQ-KLA-HAI-----------------QSAV-----
B8I7I6_CLOCE/4-236....------------------------------------.GLSRK-EAG-QIL-----------------SEYF-----
Q24NQ7_DESHY/4-240....------------------------------------.GLSRQ-RAA-EVL-----------------AEYF-----
A7VE77_9CLOT/4-240....------------------------------------.GITRA-KAA-EVT-----------------AEYF-----
A5N406_CLOK5/4-240....------------------------------------.GVTRK-AAS-DIA-----------------AAYF-----
Q252G7_DESHY/4-240....------------------------------------.GLTRS-RAA-EVI-----------------AEYF-----
A3DFX9_CLOTH/2-240....------------------------------------.GITRK-QAA-KTA-----------------AAFL-----
B0K6R6_THEPX/2-240....------------------------------------.GITRE-RAA-RVA-----------------AEFL-----
A3DG69_CLOTH/7-247....------------------------------------.GVTRN-KAA-KVV-----------------AEVL-----
A7B449_RUMGN/13-255....------------------------------------.HIKRE-KAA-RIA-----------------ADFF-----
A5KNA4_9FIRM/6-244....------------------------------------.GITRQ-RAA-EKV-----------------AELF-----
A7VHZ7_9CLOT/7-244....------------------------------------.GISRY-DAA-VAI-----------------GRMF-----
A6P0C2_9FIRM/7-247....------------------------------------.GITRE-QAA-QAL-----------------ADYF-----
A6NU92_9FIRM/5-246....------------------------------------.GITRE-QAA-NAL-----------------AEYF-----
A7VEY9_9CLOT/228-465....------------------------------------.GISRD-TAA-RVV-----------------ARTL-----
Q2LU27_SYNAS/194-396SHGI------------------------------------EGLGRS-LTD-AGI-----------------STVS-----
A6NXI0_9FIRM/22-218....------------------------------------.DGAGE-RTS-NAL-----------------ALL.-----
A6RSA1_BOTFB/8-281..FK------------------------------------EELSPE-YTK-LGL-----------------AKIY-----
A6RWE1_BOTFB/15-325VLAK------------------------------------PSIENP-NPS-DPR-----------------TVYF-----
A6S997_BOTFB/48-350..TL------------------------------------RDICEN-PTP-KDL-----------------RRVY-----
A7EWG5_SCLS1/49-355..TL------------------------------------RNTCPN-PAP-EDS-----------------RRVY-----
A6RWC8_BOTFB/15-290..TV------------------------------------HPFHPA-PHP-KDP-----------------REKD-----
A6F4K8_9ALTE/17-284....------------------------------------.GLGYE-DLV-SLS-----------------AKLL-----
A1U270_MARAV/19-286....------------------------------------.GLTYE-ALV-QHA-----------------ARLL-----
A3J9P7_9ALTE/19-286....------------------------------------.GLSYE-ALV-HEV-----------------ANLL-----
Q1N2M0_9GAMM/21-286....------------------------------------.GLQPD-TIL-SII-----------------QSLF-----
Q21GI0_SACD2/15-285....------------------------------------.GVPPQ-DVL-AAI-----------------TSLY-----
A1SY20_PSYIN/16-290....------------------------------------.NIEIE-NIL-QIL-----------------QQGF-----
A6Q4S5_NITSB/14-275....------------------------------------.GLKPI-QTA-HII-----------------QDLF-----
Q1NPF7_9DELT/17-289....------------------------------------.GMDLA-TMA-RAV-----------------QAEF-----
Q1QYE1_CHRSD/31-310....------------------------------------.GIMPD-TAA-RLV-----------------AECF-----
Q0A4Z7_ALHEH/26-298....------------------------------------.GLSPE-GAA-AAI-----------------QEAF-----
A6GSC5_9BURK/17-282....------------------------------------.GLDLQ-TAA-NAV-----------------AQAV-----
Q2SFT5_HAHCH/19-280....------------------------------------.GLTLE-QTV-AAL-----------------KRSL-----
A4A8R3_9GAMM/16-277....------------------------------------.GLSLD-AAV-KAV-----------------QDIL-----
A3WME7_9GAMM/21-284....------------------------------------.GLSVQ-QTL-EVL-----------------QSHL-----
Q5QYT8_IDILO/18-278....------------------------------------.GLTLE-RTV-EVL-----------------QQQL-----
A6FM81_9RHOB/18-271....------------------------------------.GLSEA-EVA-GIC-----------------TDTL-----
A6DW96_9RHOB/16-269....------------------------------------.GLPES-RVA-DLC-----------------ASKL-----
A3TW22_9RHOB/18-271....------------------------------------.GLTAE-EAA-TLA-----------------ARTL-----
A3K2K5_9RHOB/17-270....------------------------------------.GLGEI-RVG-AIV-----------------ADFL-----
Q0FIK0_9RHOB/23-278....------------------------------------.GLTEE-KAA-RVL-----------------ADTL-----
Q0AQY0_MARMM/8-327...P------------------------------------QGLSRR-DLA-ERI-----------------AQRV-----
Q2L5I9_CLOPF/180-403....------------------------------------.GGDAN-AIA-REL-----------------YDLG-----

PF04262

GSH1_PSEAE/6-381VDSD------------------------------------GKLALT-PHP-RAL-----------------GSTLTHPQI
Q9RDU4_PSESP/6-381VDVQ------------------------------------GELALT-PHP-AAL-----------------GSALTHPTI
GSH1_ECOLI/6-381VNAD------------------------------------GTLATT-GHP-EAL-----------------GSALTHKWI
GSH1_CLOAB/6-390VNYS------------------------------------GDLALT-PHP-SVF-----------------GDKFENPRI
GSH1_BUCAI/6-382IQKN------------------------------------GHFSKT-IHP-YLI-----------------GSSLTHKWI
GSHAB_PASMU/1-337VTAD------------------------------------GAIVTT-PHP-AVF-----------------GNRRYHPYI
GSH1_VIBCH/5-379YTPE------------------------------------GALTQT-PHP-KAL-----------------GAALTHRWI

PF14395

B7DSA7_9BACL/212-472AQGK------------------------------------.MVLAS.KYF-PRK-----------------GRIG-----
C0ZEZ5_BREBN/171-428PTGE------------------------------------.MALAS.DFL-SIN-----------------GAVG-----
B0TB99_HELMI/204-455SRSG------------------------------------RLVPAN.RFF-QTD-----------------GPIG-----
C6CUQ2_PAESJ/144-402PDGK------------------------------------.IAPASRYLG-GVG-----------------GAAG-----
D3E8P9_GEOS4/163-421DNGD------------------------------------.IVFAS.EFM-ERG-----------------GSVG-----
Q0AXS0_SYNWW/193-453SKTG------------------------------------KMLSAS.EFF-PRD-----------------GVVG-----
B0TBC1_HELMI/214-474VPGR------------------------------------RMVPAS.RFF-PRT-----------------GTVG-----
B0TET0_HELMI/208-468TQTM------------------------------------RMLPAS.FFW-PME-----------------GPIG-----

PF09899

A3HSI4_9BACT/278-1112NDVK------------------------------------LTMGGE-PTF-VSV-----------------DNQDAPEWN
Q1B9K6_MYCSS/283-1101GDVR------------------------------------LTVGGE-PTF-VSV-----------------DNRTDPEWT
Q4ZYW4_PSEU2/275-1090DDVR------------------------------------LTMGGE-PTF-VSI-----------------DDRDGAEWN
A0L4M6_MAGSM/274-1111EDVR------------------------------------LTMGGE-PTF-VSV-----------------DDFESPQWT
Q2W952_MAGSA/302-1132GDVR------------------------------------LTQGGE-PTF-IST-----------------TDPDGEEWN
Q11VA3_CYTH3/275-1141GDVR------------------------------------MTMGGE-PTF-VSI-----------------DDMESAQWN
A2VKS3_MYCTU/329-1149ADVR------------------------------------LTVGGE-PTF-VSV-----------------DNQVAEEWR
A0NMX9_9RHOB/275-1105EDVR------------------------------------LTMGGE-PTF-VSI-----------------DDFEAAEWN
A4XQ07_PSEMY/275-1095HDVR------------------------------------LTMGGE-PTF-VAL-----------------DYPDDDEWN
A9W7N2_METEP/297-1111QDVR------------------------------------LTMGGE-PTF-VSV-----------------DDFESPEWN
Q47BP1_DECAR/275-1115LDVR------------------------------------LTQGGE-PTF-VAV-----------------DDPDGAEWN
Q2SNA7_HAHCH/275-1090NDVR------------------------------------LTMGGE-PTF-VSI-----------------DDMQSAQWN
Q31N62_SYNE7/1-727SGVE------------------------------------LWMGGE-PTF-VAA-----------------NQLEDLQWR
A8LRF2_DINSH/275-1107GDVR------------------------------------LTMGGE-PTF-VSI-----------------DDFESAEWN
Q1MBT5_RHIL3/277-1103EDVH------------------------------------LTMGGE-PTF-VSI-----------------DDFQSEEWN
Q89QZ5_BRAJA/275-1084ADVR------------------------------------LTMGGE-PTF-VSV-----------------DDLEAGEWN
Q1YG30_MOBAS/275-1127NDVR------------------------------------LTMGGE-PTF-VSI-----------------DEFESPEWN
A3VDN8_9RHOB/278-1112NDVR------------------------------------LTMGGE-PTF-VSI-----------------DDFESDEWN
A6C0B7_9PLAN/274-1115GDVR------------------------------------LTMGGE-PTF-VSI-----------------DDMDGDEWK
A3XIL1_LEEBM/275-1116GDVR------------------------------------LTMGGE-PTF-VSI-----------------DDMESDQWN
A3PN00_RHOS1/275-1102GDVR------------------------------------LTMGGE-PTF-VSI-----------------DDFESGEWN
A1U538_MARAV/275-1097LDVR------------------------------------LTQGGE-PTF-VAN-----------------HDRDEPEWN
A1VL54_POLNA/295-1117QDVR------------------------------------LTQGGE-PTF-VSI-----------------DDMDGAEWN
Q21G23_SACD2/275-1112GDVR------------------------------------LTMGGE-PTF-VSI-----------------DDMESAQWN
A6GT43_9BURK/286-1103LDVR------------------------------------LTMGGE-PTF-VAN-----------------TDRGAAEWN
Q7UKP5_RHOBA/275-1113ADVR------------------------------------LTMGGE-PTF-VSI-----------------DNMDDPQWN
A4TX61_9PROT/275-1111GDVR------------------------------------LTQGGE-PTF-VSA-----------------LDMEADEWN
B0SXH9_CAUSK/275-1086QDVR------------------------------------LTLGGE-PTF-CSI-----------------DDFEAAEWN
Q2RR87_RHORT/275-1085ADVR------------------------------------LTMGGE-PTF-VSI-----------------DDMDGPEWN
A1K5W6_AZOSB/275-1124HDVR------------------------------------LTQGGE-PTF-VSV-----------------DDPDGAEWN
Q1ND53_9SPHN/280-1118QDVR------------------------------------LTIGGE-PTF-VAQ-----------------DGGDAGEWN
Q218C6_RHOPB/275-1085DDVR------------------------------------LTMGGE-PTF-VSI-----------------DDLESPEWN
A5VFM9_SPHWW/295-1120QDVR------------------------------------LTTGGE-PTF-VAL-----------------DDPEAPEWN
Q98HG6_RHILO/275-1114GDVR------------------------------------LTMGGE-PTF-VSI-----------------DDFESAEWN
C0AE57_9BACT/275-1117DDIR------------------------------------LTMGGE-PTF-VSI-----------------DDPDGPEWN
B0UHH5_METS4/274-1075QDVR------------------------------------LTMGGE-PTF-VSV-----------------DDFQSPEWN
C1DJA3_AZOVD/275-1116GDVR------------------------------------LTMGGE-PTF-IAL-----------------DYPDDPEWN
A3YWY7_9SYNE/14-726KGIQ------------------------------------LTLGGE-PTV-VPV-----------------.EPEGAEWS
A6VTZ0_MARMS/275-1113GDVR------------------------------------LTMGGE-PTF-VSI-----------------DDMDSEQWN
Q07VI7_RHOP5/275-1098SDVR------------------------------------LTLGGE-PTF-VSI-----------------DDYQAEEWN

PF03136

PAFA_CORGL/10-445YSSS....................................NIFIPNGSRL-YLD...VGSH..........PEYATAECD
Q7UWL2_RHOBA/26-608DGGD....................................RRFLANGSAI-NLE.....THLAFRDGPGGLFEMATPEVY
A6G895_9DELT/3-562RKYSRR..................................QRFLENGGAI-YYEYLPKATHG.......GLIEASTPECR
Q7WZ91_9ACTO/5-426GRSS....................................NVFLGNGARL-YLD...VGSH..........PEYATPECD
PAFA_KINRD/3-425GRSS....................................NVFLKNGARL-YLD...VGSH..........PEYATPECD
A3TL35_9MICO/3-425GRSS....................................NVFLANGSRL-YLD...VGSH..........PEYATAECD
PAFA_MYCS2/3-424GRSS....................................NVFLRNGARL-YLD...VGSH..........PEYATAECD
PAFA_ARTS2/3-425GRSS....................................NVFLTNGSRL-YLD...VGSH..........PEYATAECD
PAFA_CORDI/11-437WGSS....................................NVFIPNGARL-YLD...VGSH..........PEYASAECD
PAFA_CORJK/6-436HRSS....................................NIYTENASRL-YLD...VGAH..........PEFATAECD
PAFA_BIFLO/27-456SRST....................................NTYLANGSRL-YLD...VGSH..........PEYATAEAR
A3EPC1_9BACT/3-425SWSR....................................DAFLPNGARI-YQD...TGSH..........PEYSTPECD
Q828J1_STRAW/4-459DSSQ.LTDEDI..........................GLANVILTNGARL-YVD....HAH..........PEYSAPEVT
A8LH56_FRASN/73-531DPGA.PANEDD.........................LGLANVILTNGARF-YVD....HAH..........PEFSTPEVT
Q47NY8_THEFY/10-466DPSQ.LTDEDL..........................GLANVILTNGARF-YVD....HAH..........PEYSAPEAT
A0LU48_ACIC1/2-458DPSQ.LTDEDL..........................GLANVILTNGARL-YVD....HAH..........PEYSTPEVT
A1SK11_NOCSJ/4-459DPSQ.LTDEDM..........................GLANVILTNGARL-YVD....HAH..........PEYSTPEVT
A6W968_KINRD/4-497HPSQ.LTDAPGRAAGTRRAAPN...ASDVVSAETEDPTMANVILTNGARF-YVD....HAH..........PEYSSPEVL
Q5YUX0_NOCFA/2-457GPAP.VIDADE.........................VGAANMILTNGARL-YVD....HAH..........PEYSAPEVT
A4FBX9_SACEN/2-456QPNG..SDSDD.........................LGAANVILTNGARL-YVD....HAH..........PEYSAPEVT
A1R6Q5_ARTAT/19-506DPSQ.LTDQPPVLDAEAVALAYGRQELELDGADESGSLLMNMVLGNGARL-YVD....HAH..........PEYSSPEVT
Q8NQD9_CORGL/2-460AP...VVDPHA.........................IGVANVFVPNGARF-YVD....HAH..........PEYSSPEVT
Q8FTE4_COREF/2-463AP...VVDPHA.........................IGVANVFITNGARF-YVD....HAH..........PEYSSPEVT
Q6NH93_CORDI/2-457VP...VVDPHA.........................LGVANSVLINGGRF-YVD....HAH..........PEYSSPETS
Q4JVP6_CORJK/4-450GSAP.VLDPNA.........................LGAANVITANGARF-YVD....HAH..........PEYSSPETT
A7BC88_9ACTO/4-485DPSL.LTDDPYHLAPSGGSERV....ARPTPEELALPAATTAVLTNGARL-YVD....HAH..........PEYSAPETI
Q8G3G5_BIFLO/4-488RPDM.LTDAPQ.........................LNITNVIAPNGGRV-YVD....HAH..........PEYSAPETT
A7A4U7_BIFAD/16-491HPDL.LTDAPQ.........................LNITNVIAPNGGRI-YVD....HAH..........PEYSAPETT
A3EPC5_9BACT/10-458NPDE.DDNR.............................SLNKPLYNGGRL-YVD....GAH..........PEYSGPECA
A3ETM5_9BACT/5-463DEEEKAFTRSDYKRF.................FSFHEMKSDRILSNGGRF-YND....HTH..........PEFSTPESS
A3ETM1_9BACT/26-469DQHQRAYDEP...........................PGNGGFLRNGGRL-YID....MGH..........VEYATPECH

PF00217

KTRC_SCHMA/141-382GRTV------------------------------------EGFGFG-PTL.TKE-----------------TRIELENKI
Q7PYN5_ANOGA/203-445ARSV------------------------------------EGMPFH-PRM.QED-----------------QYEEIYEKV
Q4AED1_9ANNE/113-361ARNL------------------------------------SGVALP-PCV.CRA-----------------ERRLVEQVF
Q4AED2_9ANNE/113-360ARNL------------------------------------KGACLP-PCI.SRA-----------------ERRLVEKVF
KCRB_HUMAN/120-367GRSI------------------------------------RGFCLP-PHC.SRG-----------------ERRAIEKLA
Q1Q1E9_9BACT/18-252ARNV------------------------------------AKYPFL-SRA.NVK-----------------QKKELEELI
KARG_LIMPO/114-356GRSL------------------------------------QGYPFN-PCL.TAE-----------------QYKEMEEKV
A3DGD2_CLOTH/9-244ARNF------------------------------------NGIPFP-SKM.KRE-----------------DGKLVIKKV
Q9VST4_DROME/143-385GRAV------------------------------------KGYPFN-PCL.TEA-----------------DYMELESKI
Q4AEC5_9ANNE/149-396GRSI------------------------------------RGLCLP-PAA.CRA-----------------ERREVERVI
Q9NKV5_OCTVU/106-347GRSH------------------------------------DSFGFP-PVL.KKE-----------------DRVKMEQVS
Y120_BACSK/19-255ARNM------------------------------------SAFTFP-MLS.SKE-----------------EAYAVAKHV
KARG_LIOJA/108-349GRSH------------------------------------ASFGFP-PTL.NKE-----------------QRVEMQRVT
A6QBA0_SULNB/100-342GRNV------------------------------------DNIPLG-PAI.TRE-----------------QRNQVESDV
Q8MWR8_9BIVA/125-367ARSH------------------------------------AGLPFP-PAG.KKE-----------------DFEKMEKLA
A3ZT72_9PLAN/20-254ARNI------------------------------------AEFPFI-RRC.TAT-----------------DRAAIDKAV
A7XZJ5_GLYDO/114-356GRSL------------------------------------QGYPFN-PCL.TEA-----------------QYKEMETKV
Q6XLN0_HETGL/163-406GRSL------------------------------------LGYPFN-PLL.MRD-----------------DYLVMQQKV
Q4AEC8_RIFPA/122-369GRNI------------------------------------RGLCLP-PAT.CRA-----------------ERREVERVL
Q177S3_AEDAE/202-445GRSI------------------------------------EGFPFN-PRL.KMA-----------------MYEEIMERI
A6XH18_9METZ/115-362KHNQ------------------------------------RGYSLP-PHC.NRA-----------------ERRAVEKIV
A6CSY9_9BACI/19-254ARNL------------------------------------NEYLFP-TLF.SAE-----------------EANKILEKV
KCRF_STRPU/908-1155GRCI------------------------------------RGLALP-PCC.TRA-----------------ERAEVEKIT
Q5TP29_ANOGA/189-444ARNL------------------------------------DAYEFP-LNL.GIA-----------------QLEQVERLI
Y282_PELTS/19-256ARNL------------------------------------AGIPFP-HLL.NKE-----------------NSEKVIHAV
Y860_HALOH/19-252ARNL------------------------------------DTIPYP-NRA.DKD-----------------SKEEVTKRV
Q2B1J8_9BACI/19-255ARNM------------------------------------NIYKFP-TLF.SNE-----------------EGQSIIEDI
Q1HBJ2_BRABE/114-362GRSI------------------------------------RGISLP-PHC.SRA-----------------ERRAVETIS
KARG_HALMK/111-353GRSH------------------------------------DSYGFP-PVL.TKQ-----------------ERLKMEEDT
A6XH11_9METZ/115-365GRNL------------------------------------NQFPLP-GSM.TKQ-----------------DRINLELEM
Y102_BACHD/19-254ARNL------------------------------------QSFRFP-LLA.TIE-----------------ESKQLVEHV
Q6F4H6_HEDDI/131-378GRSV------------------------------------RGVCLP-PAM.SRA-----------------ERRLVEKVV
A6XH14_CLAPR/119-361GRNL------------------------------------EGYPLG-PGV.SKE-----------------QRDDIMQKV
Q760P7_ANABR/106-348GRSH------------------------------------AGYLFC-PSV.TAE-----------------QRKEMEEKT
A4F2K7_9CUCU/128-370GRSL------------------------------------NGYPFN-PCL.KEN-----------------EYKRIETLL
A6F800_9GAMM/114-356GRNL------------------------------------ADMPLG-PAI.TKS-----------------QRNEVETRA
Y077_GEOTN/19-255ARNI------------------------------------VDFRFP-TLF.SSE-----------------EAMQIVALF
KCRS_RAT/154-401GRSI------------------------------------RGLSLP-PAC.SRA-----------------ERREVENVA
KARG2_CAEEL/117-359GRSL------------------------------------QGYPFN-PCL.SET-----------------NYKMMETRM
Q6BDZ3_9BILA/120-367GRSI------------------------------------RGLSLP-PTC.NRA-----------------ERRMVESVV
Q67ER6_CHAVR/889-1136GRSI------------------------------------RPYPLP-PHC.NRE-----------------ERRAVEKVC
O45011_CAEEL/156-398GRSL------------------------------------KGYPFN-PCL.TQD-----------------NYLEMEGKV
Q6BDZ2_POLMI/114-361GRSI------------------------------------KDISLP-PHC.SRA-----------------ERRKVEEVA
Q6RSH2_TETAR/120-367GRCI------------------------------------RGYSLP-PHC.SRA-----------------ERRAVEKII
Q8T6T7_URECA/107-354GRGI------------------------------------RGLCYP-PSC.TRG-----------------ERREVERVI
KCRF_STRPU/161-408GRCI------------------------------------RGYGLP-PHC.TRA-----------------ERRDVEKVC
A7RNR3_NEMVE/152-399GRSI------------------------------------RGFSLP-PHC.TRA-----------------ERREVERIV
A7S6V8_NEMVE/867-1114GRSI------------------------------------RGLGLP-PHC.TRA-----------------ERREVEKIT
Q7T1J2_CHAAC/120-367GRSI------------------------------------KGFTLP-PHN.SRG-----------------ERRGIEKLS
A6XH13_9METZ/149-396GRSI------------------------------------RGFGLP-PHC.TRA-----------------ERREVEKIV
Q67ER6_CHAVR/504-751GRSI------------------------------------RGYCLP-PHC.TRG-----------------ERKAVETCV
Y092_OCEIH/19-255ARNF------------------------------------ANQTYP-ILA.KEE-----------------KLVEIQEFI
Q4AED0_SIPCU/113-355GRSV------------------------------------DGIPFP-PLI.NLQ-----------------QVKDCEQRL
A0D308_PARTE/131-376ARNV------------------------------------VGYNLP-SSM.DKD-----------------ERIKFENQM
Y701_CHLPN/18-250ARNL------------------------------------SVSKFL-PCL.SKE-----------------QKLEILQFI
Y194_CLOK5/10-245ARNL------------------------------------AKIPFS-HKL.NIE-----------------ESKKVIKNV
Q7UMV3_RHOBA/22-257ARNL------------------------------------AGFPFI-RKC.SPE-----------------DREKIERQV
Q6APG0_DESPS/133-375ARNL------------------------------------RGFPFT-NHL.KLE-----------------ERRRLEEKI
Q9NKV6_9MOLL/108-349GRSH------------------------------------DSFGFP-PVL.TKE-----------------DRVNMEKTS
Y070_BACP2/19-254ARNL------------------------------------EHVRFP-TQF.SQE-----------------EAQAVLQQF
Q3A9N0_CARHZ/16-253ARNL------------------------------------KDVPFP-HLM.DEE-----------------TAGFVTKEV
KCRF_STRPU/534-781GRSI------------------------------------IGYSLP-PHC.TVE-----------------ERAAVETIT
Q5L768_CHLAB/18-250SRNL------------------------------------SIAKFL-PCL.SRE-----------------KKQEILEVI
Q760P6_CRAGI/107-349GRSH------------------------------------EGYPFP-PVS.TDE-----------------QRKDMENKT
A7RGZ5_NEMVE/118-356GRNL------------------------------------KGYGLA-PSL.TKK-----------------ER......V
A1HTJ5_9FIRM/19-255ARNF------------------------------------EAVPFP-NRA.KGS-----------------QLAAIVDQM
B1YGS1_EXIS2/18-248ARNV------------------------------------AHYPFS-TRM.TED-----------------QANALINET
Y110_BACA2/19-254ARNF------------------------------------ENIKFP-ARY.TNE-----------------EASSIIQQF
Y2442_CLOPE/7-240LRNI------------------------------------KGIKFT-KLL.NEE-----------------EFNDLLSMV
Q4W3A2_SUBDO/130-379ARNL------------------------------------SFFPLN-PGG.SRA-----------------TREKIAEHM
Y3134_SYMTH/19-256ARNL------------------------------------DDLPFP-QRM.SEP-----------------DTERLLQAA
Q9BKE8_CIOIN/114-361GRSI------------------------------------RGLCLP-PHC.SRA-----------------ERRKVEQIS
Y2328_THETN/3-239ARNV------------------------------------KDIPFP-TVM.TEE-----------------QGKKVIELA
A6M9J4_LOCMI/114-356GRSM------------------------------------QGYPFN-LCL.TEA-----------------QYKKMEQKV
Y2368_SYNWW/20-257ARNL------------------------------------SDIAFP-HLL.NQE-----------------SGQKFMQLI
A8MLV0_ALKOO/9-245ARNI------------------------------------ESMPFP-NDL.NEA-----------------QSKNILEMV
B8G1T2_DESHD/17-252ARNL------------------------------------EGVPFP-LGL.SQE-----------------AAQDIEQKV
Q73L28_TREDE/13-247ARNI------------------------------------SGFLFP-NKI.NLS-----------------DSADVVSLV
Q4MIA1_BACCE/19-254ARNF------------------------------------KKYQFS-TMQ.NEE-----------------EAKQIQELF
Q4AEC6_9ANNE/106-353GRSI------------------------------------RGLCLP-PAI.SRA-----------------ERREVERTL
A5I7N7_CLOBH/9-243ARNV------------------------------------DKAPFP-NKI.DNK-----------------NGRDIIYRI
Q67E02_GLOPY/117-364GRSI------------------------------------RGLSLP-PNC.TRA-----------------ERRAVERIT
Y3260_BACLD/19-254ARNL------------------------------------DKVRFP-TLF.SNE-----------------EASAIIALF
Y3190_CLOAB/9-244ARNI------------------------------------KGIPFP-DKL.SDD-----------------EGRDVVKKI
A7YVI5_TOXCA/157-399GRSI------------------------------------AGYPFN-PLL.TQD-----------------DYLILQQKV
Y161_MOOTA/16-253ARNL------------------------------------KGLPFP-NLM.NSD-----------------QQARVVSQV
A6XH19_9METZ/153-400GRCI------------------------------------RGLSLP-PAC.TRA-----------------ERRAVESIA
Y046_CHLMU/17-249SRNL------------------------------------SVSKFV-PCL.SKE-----------------NKRDVLETI
Y1086_CLONN/9-244ARNL------------------------------------KGIPFP-NKL.TVD-----------------SAKDVVEKV
Q9XZF5_CHAVR/108-356GRSI------------------------------------KGISLP-PHC.TRA-----------------ECRRVEMIV
KLOM_EISFO/108-355GRSV------------------------------------KGFCLP-PSI.SRA-----------------ERREVERII
Q67ER6_CHAVR/136-383GRNI------------------------------------RGYSLP-PHN.NRA-----------------ERRDVEEIL
Q38EV2_TRYB2/136-378GRSL------------------------------------AGYPFN-PCL.TKE-----------------QYEEMESRV
A7RQU9_NEMVE/116-364GRSI------------------------------------RGFCLP-PHC.SRA-----------------ERRSVEKIS
Y2634_CLOTE/8-241ARNL------------------------------------SNFTYP-HKI.SIE-----------------EGRKIVETI
Q14TA8_9CNID/153-400GRSI------------------------------------RGLSLP-PAC.SRA-----------------ERREVERVV
Q296Q2_DROPS/207-449ARNI------------------------------------EGFPFF-PKL.TEK-----------------QFIEVEERV
A7S6V8_NEMVE/487-734GRSI------------------------------------RGLCLP-PWC.SRA-----------------ERREVEKIV
A0DI85_PARTE/130-381ARNV------------------------------------KGWNLP-PLM.SKE-----------------ERINFESKM
Q291M9_DROPS/185-440SRNL------------------------------------DQLELP-LNL.TIG-----------------QLEQAERLM
A3IET5_9BACI/18-253ARNL------------------------------------DGYRFP-LSF.SEN-----------------EALQVEQAV
Q9BLC7_APLKU/109-351GRSH------------------------------------DSYGFP-PVI.SKE-----------------DRVDMEKKT
KARG_STIJA/110-358GRNI------------------------------------RGMALS-PHV.CRS-----------------ERRAIEKMV
KCRM_TORMA/120-367GRSI------------------------------------KGIALP-PHC.SRG-----------------ERRLVEKLC
A6XH09_9METZ/111-359GRSI------------------------------------RGFRLP-PSC.NRG-----------------ERREIEEIL
Y179_DESRM/19-256ARNL------------------------------------MGYPFP-HVL.GHE-----------------NADKVLYAV
Q8N0P4_9BIVA/478-719ARSH------------------------------------AKYPFP-PAC.NSE-----------------DFENMQDDT
A7S6L6_NEMVE/110-357CRSI------------------------------------KGFRLS-PIN.SRK-----------------EKRGIEQIA
A7RER2_NEMVE/138-389ARNL------------------------------------SMFPLN-PGG.SKE-----------------SRLEIIDLM
Q4AEC7_RIFPA/105-352GRSL------------------------------------RGLCLP-PAI.SRA-----------------ERREVEATI
Q75ZZ3_LAMJA/120-367GRSI------------------------------------KGYTLP-PHC.SRG-----------------ERRAVERLA
Q17MS1_AEDAE/186-440ARNL------------------------------------DEFDFP-LNL.SIA-----------------QLEKAERIL
A6TWL7_ALKMQ/9-245ARNI------------------------------------KGIPFP-HRL.SED-----------------GADSVNQQV
Q1DA50_MYXXD/88-329GRNL------------------------------------ARYAFP-PAI.GAR-----------------DRAALEAEV
Y164_STAEQ/16-244ARNL------------------------------------ENHVHP-LMFPSEQ-----------------EGYRVINEV

PF03074

GSH1_YEAST/253-647WNVISGAVDDRTPKERGVAPLLPKYNKNGFGGIAKDVQDKVLEIPKSRYSSVDL-FLGGS--------KFFNRTY----N
GSH1_HUMAN/236-610WGVISASVDDRTREERGLEPL................KNNNYRISKSRYDSIDS-YLSKC--------G...EKY----N
GSH1_ONCVO/243-613WDVISASVDDRTAEERGLVPL................KNNKFVLEKSRYDTTDC-YIYPC--------S...ESY----N
GSH1_MOUSE/236-610WGVISASVDDRTREERGLEPL................KNNRFRISKSRYDSIDS-YLSKC--------G...EKY----N
GSH1_RAT/236-610WGVISASVDDRTREERGLEPL................KNNRFKISKSRYDSIDS-YLSKC--------G...EKY----N
GSH1_SCHPO/299-657WNVIAGAVDDRTEEEMKTVP.........................KSRYDSVDL-YISND--------KRNLPEY----N
O77252_TRYCR/321-672WLTIAASVDDRKREE...VP......................HIIKSRYDSFSV-FVSLT--------LPNLEEF----N
Q26820_9TRYP/306-657WLTITASVDDRKYEE...VP......................HIIKSRYDSISV-FVSSL--------TPNLEEF----N
GSH1_CAEEL/241-614WDIISASVDDRTPEERGLEPL................KNSKWVIDKSRYDSTDC-YIYPC--------S...VGY----N
P90557_LEITA/314-665WLTIAGAVDDRRLEE...VP......................YILKSRYDSISV-FISDR--------TENLEEF----N

PF04107

CAAL_HALSA/15-298AGRLDHELFKFVVETQTP.T----------------------------LNGVAE-APAAI--------R---EVR----A
CAAL_PSEAE/12-290GEHFAEEMFECQVEVASP.V----------------------------FSTLAE-AARFH--------G---QAR----Q
Q9RD01_STRCO/37-342LRSALTVEPGGQLELSSL.P----------------------------AASLTE-CVRSV--------S---ADL----E
Y2307_ARCFU/12-285..VIGKELQKHVIELKPARP----------------------------FESLSE-FEETM--------Q---EGV----E
P74515_SYNY3/5-287..GFVREPDSRNVEYTTP.P----------------------------LNSYDR-LLCGI--------L---QPR----R
CAAL_ECOLI/14-292AGEVKHDITESMLELATD.V----------------------------CRDINQ-AAGQF--------S---AMQ----K
GSHA_MYCTU/46-355GGSVVSVEPGGAVELSGP.P----------------------------ADGVLA-AIGAM--------T---RDQ----A
Q9RH09_ZYMMB/53-361DDGAISLEPAGQFELSGA.P----------------------------RSTIHE-SYDEI--------C---RHI----Q
CAAL_STRCO/4-283QDVFEKELHEQMLEFATH.P----------------------------QADMER-LHAEI--------V---RCR----E
CAAL_MYCBO/20-297.PRVHKELLRNTVEIVSG.I----------------------------CECTAE-AMQDL--------R---DTL----G
Q9A2Z2_CAUCR/50-358NGANVSLEPGGQFELSGA.P----------------------------LSTMHE-ICEET--------G---QHL----D
Q9JMV4_BRAJP/24-335GGGAISLEPGGQFELSGA.P----------------------------VENVHQ-TQSEL--------M---AHL----A

PF00120

GLNA_HALVD/117-366...DED...GRAT....TVT----------------------------ND....-.....--------.......----.
GLNA_SYNP2/104-382...VRF...DQTE..NKGFY----------------------------YVDSVE-GRWNS--------G...RKE----P
GLNA_AZOC5/103-379...VKF...KADP..YNTGF----------------------------KLDSIE-LPTNG--------D...TDY----E
Q9Y9Z7_AERPE/97-368..GVDV...LNPA..RGLGY----------------------------IVESRE-QP...--------.......----.
GLNA_NOSS1/103-383...ARF...AQNA..NEGYY----------------------------FLDSVE-GAWNS--------GK.EGTA----D
GLNA_SHIFL/102-379...IRF...GSSI..SGSHV----------------------------AIDDIE-GAWNS--------S...TQY----E
GLNA_BACCE/105-354...DEK...GNPT....LEL----------------------------ND....-.....--------.......----.
E7QAF9_YEASB/107-352..DDVY....GWP...KGGY----------------------------PAP...-.....--------.......----.
O86055_HERSE/104-381...VRW...GADM..SGSFV----------------------------KIDSEE-ASWST--------G...AKI----E
O33342_MYCTU/121-374...QPY...RQAWASGYRGL----------------------------T.....-.....--------.......----.
Q9HYP0_PSEAE/75-331...NTD...PNEPFQAPLGP----------------------------D.G...-.....--------.......----.
GLNA_METJA/115-365...DPH...NPHR....WVP----------------------------AD....-.....--------.......----.
GLNA_XENLA/110-359..NGHP...YGWP...ENGF----------------------------PGP...-.....--------.......----.
Q97VQ9_SULSO/102-347...KKP.............L----------------------------DD....-.....--------.......----.
Q977Z8_THEVO/122-372...DAN...GNPT....TEP----------------------------SD....-.....--------.......----.
GLNA1_MYCTU/105-387...VSF...DSRA..NGSFY----------------------------EVDAIS-GWWNT--------GAATEAD----G
GLNA_AGABI/105-350..DDQP...YGWP...KGGF----------------------------PGP...-.....--------.......----.
GLNA_PYRAB/96-339...N.....GSWE....LEI----------------------------PD....-.....--------.......----.
GLNA_METTH/107-353...DED...G..N....IIP----------------------------HD....-.....--------.......----.
GLNA_LACLA/106-356...NEN...DEPT....LEV----------------------------ND....-.....--------.......----.
Q9KZC7_STRCO/124-376.....D....AGG....DAF----------------------------VP....-.....--------.......----.
Q9A3S2_CAUCR/129-384...NTD...PDYPLKPPIGR----------------------------S.G...-.....--------.......----.
GLNA_CLOSA/105-353...DEN...GRAT....TNT----------------------------QD....-.....--------.......----.
O85177_AMYMD/104-383...IRF...DSAE..HASFH----------------------------EIDSVE-GWWNT--------G...ADE----V
Q98A06_RHILO/120-375...EPD...GKLS...PFDR----------------------------TD....-.....--------.......----.
Q9I3F1_PSEAE/117-372...ERD...ANGRPQPARDA----------------------------D.G...-.....--------.......----.
GLNA_THEMA/102-350...NEK...GEPV....PEF----------------------------LD....-.....--------.......----.
GLNA3_RHILP/97-349...ADG...SVIS....DQF----------------------------DT....-.....--------.......----.
GLNA_AZOBR/103-379...VKF...KVEM..NKVSY----------------------------EFDSEE-GPYTS--------D...KDY----E
Q9AEL4_CORGT/87-338...LRT...NGLP....PVP----------------------------TD....-.....--------.......----.
GLNA_SULSO/104-381...VKL...DVSAPQSGTGY----------------------------KIYARE-APW..--------.......----.
GLNA2_DROME/116-365..DGHP...LGWP...KNGF----------------------------PGP...-.....--------.......----.
GLNA_AZOVI/100-377...VKY...KSDI..SGSMF----------------------------KIFSEQ-AAWNT--------D...ADF----E
GLNA_ARCFU/116-402...VDF...TRLS.WDMWVS----------------------------PNGGAG-DSWGP--------PRIMPIS----S
GLNA2_FRAAL/84-326..DGRP...YGWP..EVG.Y----------------------------PAP...-.....--------.......----.
Q9K665_BACHD/115-365...DEY...GLPT....KQT----------------------------QD....-.....--------.......----.
Q9SC91_MEDTR/118-374...AIR...EGKE....EWI----------------------------QF....-.....--------.......----.
Q986Q4_RHILO/115-369.....P...QSQRPVGPVSP----------------------------VTG...-.....--------.......----.
Q9I6J3_PSEAE/114-370...SDD...PDYPLQAPVGR----------------------------S.G...-.....--------.......----.
GLNA_HAEIN/106-383...VRF...NVSM..NKASF----------------------------SIDDIE-AAWNT--------N...KKY----E
O88070_STRCO/130-380...DTY...EHAWDANYRGL----------------------------T.....-.....--------.......----.
Q9AMT8_BRAJP/106-360..NADT..IEEKP...FGEW----------------------------AP....-.....--------.......----.
GLNA_HELPJ/111-388...IKI...KDAS..NSQYY----------------------------EVDSEE-GEWNR--------DK..SFE----N
GLNA1_DROME/147-395..DGRP...FGWP...ENGF----------------------------PAP...-.....--------.......----.
O31044_SYNPW/104-383...VRY...NSSE..GGSFY----------------------------SVDTIE-ASWNS--------G...RLE----E
Q97FR9_CLOAB/167-449SYDEREDLIFTGR..TLFGA----------------------------PSP...-.....--------.......----.
Q98CH5_RHILO/124-382...ERD...ADGKVQPARAV----------------------------LDG...-.....--------.......----.
GLNA_COLGL/109-354..SNRP...FGWP...ANGF----------------------------PAP...-.....--------.......----.
GLNA_STAAW/107-356...DEK...GEPT....LEL----------------------------ND....-.....--------.......----.
GLNA_LACDE/107-356...GKN...GEET....TKV----------------------------SD....-.....--------.......----.
Q9C213_NEUCS/546-806EGADTSATLSLNSLNPFKHR----------------------------PAEASG-.....--------.......----.
Q9U307_CAEEL/115-364..DGHP...FGWP...KNGF----------------------------PGP...-.....--------.......----.
P95692_STRAG/106-359...MKC...NQHL....IDC----------------------------YC....-.....--------.......----.
GLNA1_STRFL/101-378...VRF...QTSA..NESFY----------------------------HIDSEA-GAWNT--------.....GA----V
PUUA_ECOLI/133-390...QRD...AEGYLQPPCAP----------------------------GTD...-.....--------.......----.
Q9FAR9_SHEVI/102-379...VKY...GADM..SGCFY----------------------------KVDAEE-AAWNS--------G...TSY----E
GLNA_METMP/110-357...DAC...G..S....WVP----------------------------AD....-.....--------.......----.
Q98H15_RHILO/126-382...ETY...DSARKKHWQGL----------------------------D.....-.....--------.......----.
GLNA1_ALNGL/103-351..VKWP...LGWP...VGGY----------------------------PGP...-.....--------.......----.
Q9RX64_DEIRA/111-359...GPN...GAAT....TVT----------------------------HD....-.....--------.......----.
Q27747_PARLI/109-358..DKWP...FGWP...KGGF----------------------------PGP...-.....--------.......----.
GLNA_SULAC/107-383...VEV...DASLPQSGTGY----------------------------KIHSRE-APW..--------.......----.
Q9RDW7_LACRH/107-356...DED...GNPT....THL----------------------------ND....-.....--------.......----.
Q9A6W3_CAUCR/103-379...VRW...STAP..HDTSY----------------------------SFDSTE-LPVNS--------N...KQY----A
Q9SCP3_ARATH/507-763...VVR...EGKE....EYM----------------------------PF....-.....--------.......----.
P95529_PSEPU/135-401...VDP...CLEP...ETLG----------------------------GPGTPA-A....--------.......----.
Q9RDS6_STRCO/104-363...KPV...DGSV....PTP----------------------------AD....-.....--------.......----.
Q9A3R4_CAUCR/118-375...QRG...PNGELLPAKSL----------------------------QTG...-.....--------.......----.
GLNA_THIFE/104-378...VTW...NIDM..SGCAY----------------------------KVDAEE-AAWNS--------G...KEY----E
GLNA1_RHILV/103-379...VKY...KADP..YNTGF----------------------------KLDSTE-LPSND--------D...TDY----E
Q9HT65_PSEAE/105-353....LP...GERP.......----------------------------......-.....--------.......----.
GLNA2_STRVR/89-333..DGYP...LGFP..KGG.F----------------------------PAP...-.....--------.......----.
Q98EM0_RHILO/120-375...NPD...PDRPLTAPVGA----------------------------N.G...-.....--------.......----.
GLNA_HALSA/115-364...DDD...GNAT....TTA----------------------------HD....-.....--------.......----.
Q53045_RHORU/103-379...VRF...DVSM..NRVMY----------------------------EVDSEE-GPYVT--------G...KIF----D
GLNA_METCA/102-379...VRW...GANM..SGSFY----------------------------KVDSEE-AGWNS--------E...KVY----E
Q9I275_PSEAE/120-376...QEN...VNGRPQPPRSP----------------------------ISG...-.....--------.......----.
GLNA2_MYCTU/106-357...GPE...DGSV....PVP----------------------------VD....-.....--------.......----.
Q988Z8_RHILO/141-397...NPD...PDYPLTPPVGR----------------------------S.G...-.....--------.......----.
Q97W07_SULSO/106-349................ALNP----------------------------AD....-.....--------.......----.
Q44249_ACISP/140-407...VDR...SLSP...ESLG----------------------------APGVQP-D....--------.......----.
LGSN_HUMAN/181-427..P..............EIL----------------------------NS....-.....--------.......----.
GLNA2_HORVU/165-413..VNWP...LGWP...VGGY----------------------------PGP...-.....--------.......----.
O07752_MYCTU/111-358.....D....GQR......L----------------------------PS....-.....--------.......----.
Q9ZF05_9CYAN/195-477FANARPDLLLAGR..TLFGR----------------------------PSA...-.....--------.......----.
GLNA_NEIGO/105-382...VEF...ETDM..HKTRY----------------------------EITSES-GAWAS--------G...LHM----D
GLNA2_STRHY/85-330..GDRP...LGFP..EGGGY----------------------------PAP...-.....--------.......----.
Q9HT51_PSEAE/117-373...ERD...SDGRPLPALQM----------------------------N.G...-.....--------.......----.
GLNA_AQUAE/105-379...VEF...GTAA..NYAFW----------------------------RVDSEE-GWWN.--------......R----E
Q9PCD9_XYLFA/137-414...VRF...ANDM..GHAFF----------------------------QIASEE-AAWNT--------G...AEF----E
GLNA_RHOCA/103-378...VRY...SVTP..AKVAY----------------------------QIDAEA-AAWNT--------D...AEV----E
Q97S86_STRPN/106-358...DEN...GDPT....LEV----------------------------ND....-.....--------.......----.
O96463_SKECO/151-401...PRP...THSP..RLAQE----------------------------PVSQ..-.....--------.......----.
GLNA1_FRAAL/104-383...VRY...DYNP..YGSMH----------------------------HVDSVE-AAWNT--------S...RKE----E
Q79VE3_CORGL/105-386...VRY...STEM..NSGFY----------------------------EVDTEE-GWWNR--------GKETNLD----G

PF12224

Q311H8_DESDG/19-291---------GG.AVSRR..............................SSFVYEI-.....--------.......----.
Q2HBV5_CHAGB/10-268---------KE.IQVPS..HIGN....................LLQKTGAAETY-.....--------.......----.
Q67LG7_SYMTH/9-197---------.............................................-.....--------.......----.
A6G6Z1_9DELT/9-197---------.............................................-.....--------.......----.
Q5LF69_BACFN/74-277---------GI.PVEIG..............................SRNAETN-.....--------.......----.
A6KZ00_BACV8/75-278---------GI.EVASE..............................RYNHDLR-.....--------.......----.
A7ALF5_9PORP/71-272---------GI.EVMVE..............................SYNHTTR-.....--------.......----.
A5D072_PELTS/13-222---------GI.DVQHE..............................RYNHSRR-.....--------.......----.
O86176_DICNO/4-232---------GG.TVRHV..GI........................PNSYDSWEV-.....--------.......----.
Q1DBA6_MYXXD/2-223---------GG.HVSG...............................DYRGWQV-.....--------.......----.
B8I7I6_CLOCE/4-236---------GT.QLAHN..G..........................GFYDSYSV-.....--------.......----.
Q24NQ7_DESHY/4-240---------GR.PDSYD..G..........................GGYNEYSV-.....--------.......----.
A7VE77_9CLOT/4-240---------GT.RVKYL..G..........................TYYDTYAA-.....--------.......----.
A5N406_CLOK5/4-240---------GT.SAVYD..G..........................TYYDTYSA-.....--------.......----.
Q252G7_DESHY/4-240---------GT.TKEYE..G..........................SFYDAYFA-.....--------.......----.
A3DFX9_CLOTH/2-240---------GG.RIESS..G..........................DYYDTQKV-.....--------.......----.
B0K6R6_THEPX/2-240---------QG.TYSEG..G..........................TYYDTKKV-.....--------.......----.
A3DG69_CLOTH/7-247---------RG.SIKRE..N..........................DYYDTYKV-.....--------.......----.
A7B449_RUMGN/13-255---------GTGRFEYT..AS........................RNGYYTWSA-.....--------.......----.
A5KNA4_9FIRM/6-244---------GT.RAVCD..G..........................GYYGVWSV-.....--------.......----.
A7VHZ7_9CLOT/7-244---------GT.EPYHI..R..........................S.YDSWCV-.....--------.......----.
A6P0C2_9FIRM/7-247---------GT.EPRRG..D..........................DYYDSWYV-.....--------.......----.
A6NU92_9FIRM/5-246---------GT.TPRHD..S..........................DFYDSWYV-.....--------.......----.
A7VEY9_9CLOT/228-465---------GT.QKIYK..G..........................GVYNEHHI-.....--------.......----.
Q2LU27_SYNAS/194-396---------LGYTHALM.....................................-.....--------.......----.
A6NXI0_9FIRM/22-218---------...........................................NI-.....--------.......----.
A6RSA1_BOTFB/8-281---------AL.IKETLVAETGLKHLTEAEIDQDSPDFFNPNKDPNKIYQADLF-.....--------.......----.
A6RWE1_BOTFB/15-325---------PS.TPEDN..APSYFQ...............IPVGKEDWANEWSI-YAHIK--------RSLASIG----L
A6S997_BOTFB/48-350---------GV.GRPAN..SAPLKHDPRP.......ANFGESSVAERIYRLEGR-LCVYE--------NIAQTLS----C
A7EWG5_SCLS1/49-355---------DV.ASALN..FSPLKFDPVLAQF..CEGTSTNMPPAEISYGDKGL-ISVWE--------NIVHTLK----C
A6RWC8_BOTFB/15-290---------GK.KLATI..EK........................ANYEIGKKL-EANGI--------SVATTLR----S
A6F4K8_9ALTE/17-284---------GG.TGKSV..............................ARYVSEV-.....--------.......----.
A1U270_MARAV/19-286---------GG.EPELT..............................SRYVTRL-.....--------.......----.
A3J9P7_9ALTE/19-286---------NG.APQPR..............................SRYVTAV-.....--------.......----.
Q1N2M0_9GAMM/21-286---------GG.QIEHR..............................HSFCYEI-.....--------.......----.
Q21GI0_SACD2/15-285---------GG.EIEEA..............................HMFEYRV-.....--------.......----.
A1SY20_PSYIN/16-290---------DF.EIKKK..............................NKFLYKL-.....--------.......----.
A6Q4S5_NITSB/14-275---------GG.TTEVI..............................DEYETRI-.....--------.......----.
Q1NPF7_9DELT/17-289---------GG.RVEYL..............................NPFLSRV-.....--------.......----.
Q1QYE1_CHRSD/31-310---------GG.DIVRQ..............................SPHRMSV-.....--------.......----.
Q0A4Z7_ALHEH/26-298---------GG.EVQSD..............................SRFVKRV-.....--------.......----.
A6GSC5_9BURK/17-282---------NG.EVIKD..............................TQAECKV-.....--------.......----.
Q2SFT5_HAHCH/19-280---------GA.QLISG..............................SAAEKKL-.....--------.......----.
A4A8R3_9GAMM/16-277---------GA.DPVEA..............................TAAECTL-.....--------.......----.
A3WME7_9GAMM/21-284---------KG.QVDHI..............................SLAERSI-.....--------.......----.
Q5QYT8_IDILO/18-278---------SG.KRVAV..............................SKAEQKV-.....--------.......----.
A6FM81_9RHOB/18-271---------GG.RAEQG..............................DGPFWTI-.....--------.......----.
A6DW96_9RHOB/16-269---------GG.TAQQV..............................DSHIWRV-.....--------.......----.
A3TW22_9RHOB/18-271---------GG.SPSRQ..............................DAHVWSV-.....--------.......----.
A3K2K5_9RHOB/17-270---------GG.TATEP..............................HFHELTV-.....--------.......----.
Q0FIK0_9RHOB/23-278---------GG.AASEE..............................KPGKWSV-.....--------.......----.
Q0AQY0_MARMM/8-327---------GG.RVKTVFYPQSEPSLVPGMPVFENLVLGYEALDAAGERVALCV-.....--------.......----.
Q2L5I9_CLOPF/180-403---------IV.SSPRR..LG........................YH.......-.....--------.......----.

PF04262

GSH1_PSEAE/6-381TTDYSEALLEFITPTETDVA-------------------DTLGDLERIHRFASS-KLDG.--------EYLWSPS----M
Q9RDU4_PSESP/6-381TTDYAEALLELITRPATDCA-------------------QALAELEELHRFVHS-RLEG.--------EYLWNLS----M
GSH1_ECOLI/6-381TTDFAEALLEFITPVDGDIE-------------------HMLTFMRDLHRYTAR-NMGD.--------ERMWPLS----M
GSH1_CLOAB/6-390TTDFSESQIEMITPPLKSAE-------------------EVYKALNDINNEVKN-ALKG.--------ELLWPLS----M
GSH1_BUCAI/6-382TTDFSENLLEFITPTSDNID-------------------YLLSFLTDLHSFTAS-KIKN.--------ERMWPFS----I
GSHAB_PASMU/1-337QTDFAESQLELITPPTKKLE-------------------DTFRWLSVIHEVVQR-SLPEE--------EYIFPLS----M
GSH1_VIBCH/5-379TTDFAESLLEFITPVSHEVD-------------------TLLAQMSDIHHFAQT-KLGD.--------EKLWPLS----M

PF14395

B7DSA7_9BACL/212-472---------CDDRSVNFDG.------------------------------------------------------------
C0ZEZ5_BREBN/171-428---------CDTTRYREELG------------------------------------------------------------
B0TB99_HELMI/204-455---------CDRRKA.....------------------------------------------------------------
C6CUQ2_PAESJ/144-402---------SDAMLIGRRL.------------------------------------------------------------
D3E8P9_GEOS4/163-421---------SDAVRLRGEV.------------------------------------------------------------
Q0AXS0_SYNWW/193-453---------CDNIRIPNRQ.------------------------------------------------------------
B0TBC1_HELMI/214-474---------CDNRRAFGAS.------------------------------------------------------------
B0TET0_HELMI/208-468---------CDNRSLENAN.------------------------------------------------------------

PF09899

A3HSI4_9BACT/278-1112SDADGEHKRSLSNTLFHKLKGEFG.TGALMQYGQGKWYPGEPLPRWKLACFWRK-DGIPM..WHND..ALMADLS....K
Q1B9K6_MYCSS/283-1101TAADGPHKRERASALAAGLKTVWA.PQGLVQRGQGKWYPGEPLPRWQIGLYWRA-DGAPL..WTDA..SLLADPWGA..E
Q4ZYW4_PSEU2/275-1090TAALGPRKRELSAELFQRMRGHYA.PLGIVHFGQGKWYPGEQLPRWSLNCFWRK-DGQPV..WRNN..ALIADET....R
A0L4M6_MAGSM/274-1111EAADGPHKRERAVDLLGRMRNHFA.PGGIYHFGQGKWYPGEPIPRWRYGCYWRT-DGEPI..WRDI..NLLGFPT....V
Q2W952_MAGSA/302-1132TSAVGPTKRAFADTLIRRLRDRFA.PGALIAYGQGKWYPGESLPRWAFSLIWRD-DDEVV..WRDP..RLIALEA....E
Q11VA3_CYTH3/275-1141TEADGVEKRILSHELLLRLRARFA.PAGMLHYGQGKWYPGEPLPRWQYGLFWRK-DGLPM..WKNT..SLLALEN....G
A2VKS3_MYCTU/329-1149TAADGPHKRERASDLAARLKAVWA.PQGLIHRGQGRWYPGEPLPRWQIALYWRT-DGRPL..WTND..ALLADPWGAPPA
A0NMX9_9RHOB/275-1105TDAVGPTKRQKADILIRRLRERFA.PGGFLHYGQGKWYPGETLPRWTFSLYWRR-DEKPI..WKDP..ALIAEEG....D
A4XQ07_PSEMY/275-1095TAALGPNKRRLAADLFHRLREHYA.PNALVHFGQGKWYPGEQLPRWSLNCFWRR-DGEPL..WHDP..KLLADEK....R
A9W7N2_METEP/297-1111VAAVGPTKRGLADQLIRRLRDRFA.PGGMLHYGQGKWYPGESLPRWAFALYWRK-DGVPI..WKNA..DLIAVED....G
Q47BP1_DECAR/275-1115TAALGPTKRIFAADIFHRLREKYA.PNGLMHFGQGKWYPGEQLPRWSLNCFWRK-DGEPI..WNAP..ELYANES....V
Q2SNA7_HAHCH/275-1090TDADGPEKRRLAFDLSLRLKKQYA.ENGFMHYGQGKWYPGEPLPRWQYALYWRK-DGEPL..WRGPQDALMHDAR.....
Q31N62_SYNE7/1-727TAALGAEKYQLGLSLLDRLVTAFQLPQPLLLEGTGKWYPGELAPRWALGAYWRR-DGQPL..WRGE..PLTVSTA....T
A8LRF2_DINSH/275-1107TAAVGPTKRALADTLIRRLRDRFA.PGGFLHYGQGKWYPGETLPRWTFSLYWRG-DGKPL..WTNA..DLIAREK....T
Q1MBT5_RHIL3/277-1103TAAVGPTKREKADVLIRKLQERFA.PGGFLHYGQGKWYPGESLPRWTFSLYWRR-DGKPV..WQNL..DLVAAEG....K
Q89QZ5_BRAJA/275-1084TEAVGPTKRALGDDLIRRLRTRFA.PGGLLHYGQGKWYPGESLPRWAFGLYWRK-DGVPI..WKNV..DLIAKIE....N
Q1YG30_MOBAS/275-1127ADATGPMKRGLADDLIRRLRDRFA.PDGFLHYGQGKWYPGETLPRWTFSLYWRK-DGVPV..WKNA..ELVARET....E
A3VDN8_9RHOB/278-1112TAAVGPQKRALADQLIRRLRDRFA.PGGFLHYGQGKWYPGESLPRWTFSLYWRR-DGKPV..WRDE..SLIAHEG....D
A6C0B7_9PLAN/274-1115TAAVGPTKRGLAGNLIELLRQRFA.PQGMIHYGQGKWYPGESLPRWALTCMWRT-DGQPI..WNDP..MLLAAPE....E
A3XIL1_LEEBM/275-1116TAADGPEKRKLSEGLSKRLLHKFG.QGGMFHHAQGKWYPGEPIPRWSIGLHWRK-DGIPI..WKDE..SLMASFN....E
A3PN00_RHOS1/275-1102TDAVGPTKRVLADRLIRRLRDRFA.PGGFLHYGQGKWYPGETLPRWTFSLYWRE-DGAPI..WRDG..ALVAGET....G
A1U538_MARAV/275-1097TEAMGPTKRKKAIELYHRMRDRYG.AGGLVHFGQGKWYPGEPLPRWSLNCFWRK-DGEPI..WQDE..RWLADER....T
A1VL54_POLNA/295-1117TLAHGDKKRELAGQLMHRLKNHFA.PGGMLHYGQGKWYPGEPLPRWALNIYWRI-DGQPM..WLDP..TLFSDEN....K
Q21G23_SACD2/275-1112TAALGEDKLRLAKTLLLKLRDHFA.PHGLLHYGQGKWYPGEEIPRWALGLFWRK-DNEPL..WADH..KLLARVD....K
A6GT43_9BURK/286-1103IDALGPTKREYGIKMLNKLAKYYG.KGGLYHFGQGKWYPGEQLPRWALSMYWLK-SGEAI..WKNP..KLLSHEQ....T
Q7UKP5_RHOBA/275-1113TDAVGEEKRVLSNVLLTRLRERWA.PGSLLHYGQGKWYPGESLPRWALTCLWRR-DGQPI..WQDD..QWIADEG....K
A4TX61_9PROT/275-1111TDAVGPTKRAYADQLIRRLRDRFA.PGAMITHGQGKWYPGESLPRWAYALTWRD-DEELV..WRNP..ALIGQEG....Q
B0SXH9_CAUSK/275-1086TDATGPTKRRLADDLIRRLRERFA.PGGLLHHGQGKWYPGEPLPRWAFALYWRA-DGQPI..WRDP..DAIGREP....E
Q2RR87_RHORT/275-1085TTAVGPDKERLATNLLHRLRQSYA.PAGLLLFGQGKWYPGEQLPRWAHHLFWRT-DGKAL..WRTP..RLLSDGL....S
A1K5W6_AZOSB/275-1124TTAMGPNKKRLASDLYDRLAAKYG.PQGLVHYGQGKWYPGEQLPRWSLNCFWRK-DGEPM..WTRR..DLIADES....R
Q1ND53_9SPHN/280-1118GDAVGPTKAAYADRLIRKLRSDFA.PGGLLHHGQGKWYPGESLPRWAYAVYWRQ-DGVPL..WRDE..SLIATDT....P
Q218C6_RHOPB/275-1085IAAVGPTKRVLGDDLLRRLRERFA.PGGLLHFGQGKWYPGESLPRWAFGLYWRK-DGVPV..WKNP..QLIAPVE....G
A5VFM9_SPHWW/295-1120GDAVGPTKAGYADRLIRRLRERFA.PGGLLHHGQGKWYPGESLPRWGYSVYWRT-DGVPV..WNDA..ALIAGEG....T
Q98HG6_RHILO/275-1114TAAVGPTKREKADALIRRLRERFA.PGGFLHYGQGKWYPGESLPRWTFSLYWRA-DGQPV..WSDP..SLIAREK....S
C0AE57_9BACT/275-1117FTAVSHPKRILSGQLIKRLRDKFA.PGALLHYGQGKWYPGEPLPRWALSAFWRK-DGVPV..WRDD..SLIADVS....R
B0UHH5_METS4/274-1075TAAVGPTKRALADQLIRRLRERFA.PGGLLHYGQGKWYPGESLPRWAFALYWRK-DGQPI..WRDE..ALIARVA....G
C1DJA3_AZOVD/275-1116TEAMGPNKRRLAADLFHRLRAHYA.PQGLAHFGQGKWYPGEQLPRWSLNCFWRK-DGEPV..WQDP..ALYADET....R
A3YWY7_9SYNE/14-726VAADGPTKLRYARRLAAELQRRVW.PGSTLMYCPGKRYDGEVNPRWALRLITGL-DGTPLVPWPQQ..APASSPA.....
A6VTZ0_MARMS/275-1113TGALGAEKLKLAKDLLIKMKQEFG.ANGLLHYGQGKWYPGEEVPRWALGCFWRT-DGEAL..WNDP..KYLARVD....K
Q07VI7_RHOP5/275-1098TAAVGPTKRQRADDLIRRLRERYA.PDGLLHYGQGKWYPGESLPRWSFALYWRK-DGKPI..WRNP..DLIARED....M

PF03136

PAFA_CORGL/10-445NLTQLINFEKAGDVIADRMAVDAEESLAKEDI.......AGQVYLFKNNVDSVG.NSYGC--------------------
Q7UWL2_RHOBA/26-608RPSDLVACQRAIDEIMRDASNEARWSDDQNV.........GRLRVLKNSCDAAG.HLYGC--------------------
A6G895_9DELT/3-562GPSQLLLYQRAQERLLTQALPEVTARLRRLGF.......HGELGLLKNCRDAEG.HIYGA--------------------
Q7WZ91_9ACTO/5-426NVVELVTHDKAGERIVEGLAVDAERRLREEGI.......AGDIYLFKNNTDSAG.NSYGC--------------------
PAFA_KINRD/3-425DVRQLVVHDRAGERTLEGLLTDAERRLEEEGI.......AGEVFLFKNNTDSAG.NSYGC--------------------
A3TL35_9MICO/3-425SLRQLVAHDKAGERVVEGLVADAEARLREDGV.......RGDIYVFKNNTDSAG.NSYGC--------------------
PAFA_MYCS2/3-424NLIQLVTHDRAGERVLEDLLIDAEQRLADEGI.......GGDIYLFKNNTDSAG.NSYGC--------------------
PAFA_ARTS2/3-425DLGQLIAHDRAGELILDDLVDEAQERLAAEGF.......NGTVYLFKNNTDSAG.NSYGS--------------------
PAFA_CORDI/11-437SLSQLIAYDRAGDKIVDQLAQRAETALATEGI.......GGRVYLFKNNLDSLG.NSYGC--------------------
PAFA_CORJK/6-436SLHQLIAYDRSGDLMFHELADRAEQAVG............GKVYLLKNNTDSLG.NSYGC--------------------
PAFA_BIFLO/27-456DPREALAQDLAGEHVMRNLALKAQRKLRESYG......AHATIHVFKNNVDSAG.HAFGC--------------------
A3EPC1_9BACT/3-425RVRDVVVHDKAGERILSRAVDFAFDHLHEEGV.......DGSLFVLKNNTDSAG.NSYGC--------------------
Q828J1_STRAW/4-459NPRDAVLWDKAGERIMAEAAERAAQLPGA...........QPIHLYKNNTDNKG.ASYGT--------------------
A8LH56_FRASN/73-531NPRDIVLWDKAGERVMAEAARRALTVPGT...........MPVHLYKNNTDNKG.VSYGC--------------------
Q47NY8_THEFY/10-466NPRDAVLWDKAGERIVADAARRASMLPSA...........EPIQLYKNNTDNKG.SSYGC--------------------
A0LU48_ACIC1/2-458NPRDAVLWDKAGERIMAEAARRAADLPMG...........WTIQLYKNNTDNKG.ASYGC--------------------
A1SK11_NOCSJ/4-459TPLDVVRWDKAGEQVMLDAARRAGQLPGG...........PQIVLYKNNTDNKG.ASYGA--------------------
A6W968_KINRD/4-497TPRDAVLWDRAGELILLEALRRVAATPGL...........TPVTIYKNNTDGKG.ASYGT--------------------
Q5YUX0_NOCFA/2-457DPLDAVIWDKAGERVMEAAARHASSVPGA...........PRLQLYKNNVDGKG.ASYGT--------------------
A4FBX9_SACEN/2-456NPMDAVVWDKAGERVMEEAAIRAASVPGT...........APMQLYKNNVDGKG.ASYGT--------------------
A1R6Q5_ARTAT/19-506NPRDAVAWDAAGDLVALATVRKVASDPSL...........PPINLYKNNTDNKS.VSYGS--------------------
Q8NQD9_CORGL/2-460NAWDAMVYDAAGDHILMQAVSDVASFTSQNRSVLDGHDPCPALKIYKNNVDGKG.ASYGS--------------------
Q8FTE4_COREF/2-463NAWDAMVYDAAGDHILMQAVADTAAFSSQGKSVLDGHDPCPPLKIYKNNVDGKG.ASYGA--------------------
Q6NH93_CORDI/2-457SAFQAMLYDAAGDVVMNRAVELVAENSQRKHSVLEHHDPCPPLKIYKNNVDGKG.ASYGS--------------------
Q4JVP6_CORJK/4-450TARDAVVWDKAGDIIMHRAAEAAE................PELKIYKNNVDGKG.ASYGS--------------------
A7BC88_9ACTO/4-485GARDALLWDRAGEVIAQRVMARLEELGE............EPIVLVKNNTDGKG.AAYGT--------------------
Q8G3G5_BIFLO/4-488DPFEAVRYDHAGDLIMQAATEHARKQTG............TPIALHRNNVDGKG.SCWGT--------------------
A7A4U7_BIFAD/16-491DPFEAVRYDRAGDLIMRAAAAKASETTG............RKIVLHRNNVDGKG.ASWGT--------------------
A3EPC5_9BACT/10-458SVRDVVRYEKAGDRMVGACQAALSGLHAGG..........PPLLVLKNNADGKG.NSWGY--------------------
A3ETM5_9BACT/5-463SIMELLHYDRAGLDILRLAKKERERLLGGD..........GLLSLYRNNTDYHG.HSYGC--------------------
A3ETM1_9BACT/26-469TLLDLVRADRGGDRLLQQAVDEMGLS..............GEISFIKNNIDHQTLATFGS--------------------

PF00217

KTRC_SCHMA/141-382STALHNL.....SGEYE.--------------------------------------------------------------
Q7PYN5_ANOGA/203-445REAVQDL.....PEELQ.--------------------------------------------------------------
Q4AED1_9ANNE/113-361TSALNNL.....GGDLK.--------------------------------------------------------------
Q4AED2_9ANNE/113-360TEALNSL.....DGDLK.--------------------------------------------------------------
KCRB_HUMAN/120-367VEALSSL.....DGDLA.--------------------------------------------------------------
Q1Q1E9_9BACT/18-252RTKIIDA.....DVAPA.--------------------------------------------------------------
KARG_LIMPO/114-356SSTLSSM.....EDELK.--------------------------------------------------------------
A3DGD2_CLOTH/9-244KEAIFGR....SSVANN.--------------------------------------------------------------
Q9VST4_DROME/143-385CGAVTSL.....TGEYK.--------------------------------------------------------------
Q4AEC5_9ANNE/149-396TDALAGL.....SDEFS.--------------------------------------------------------------
Q9NKV5_OCTVU/106-347VEALKSL.....TGELA.--------------------------------------------------------------
Y120_BACSK/19-255KDALGGTQ...GEALGK.--------------------------------------------------------------
KARG_LIOJA/108-349QGALEGL.....TGELK.--------------------------------------------------------------
A6QBA0_SULNB/100-342VKALHRL.....EGDLA.--------------------------------------------------------------
Q8MWR8_9BIVA/125-367CDGLSTL.....TGNLA.--------------------------------------------------------------
A3ZT72_9PLAN/20-254RDRLAEV.....PQLTD.--------------------------------------------------------------
A7XZJ5_GLYDO/114-356KSQLATF.....EGELK.--------------------------------------------------------------
Q6XLN0_HETGL/163-406RMALENLE...DDPEIG.--------------------------------------------------------------
Q4AEC8_RIFPA/122-369SNSLAGL.....SGLFE.--------------------------------------------------------------
Q177S3_AEDAE/202-445KTVLTGL....EEDDLK.--------------------------------------------------------------
A6XH18_9METZ/115-362VDGLDTL.....QGEFK.--------------------------------------------------------------
A6CSY9_9BACI/19-254QGCIGEE....SGEHGN.--------------------------------------------------------------
KCRF_STRPU/908-1155TEALSTL.....SGPLK.--------------------------------------------------------------
Q5TP29_ANOGA/189-444TARVLSMDFVHATGETEL--------------------------------------------------------------
Y282_PELTS/19-256RLAISNKE..ASELLGG.--------------------------------------------------------------
Y860_HALOH/19-252LDATSK......QGKIK.--------------------------------------------------------------
Q2B1J8_9BACI/19-255RKISTEKP...FKGLGG.--------------------------------------------------------------
Q1HBJ2_BRABE/114-362LDALSHL.....TGEFA.--------------------------------------------------------------
KARG_HALMK/111-353KAAFEKF.....SGELA.--------------------------------------------------------------
A6XH11_9METZ/115-365GGTFKKLI...SNPKYG.--------------------------------------------------------------
Y102_BACHD/19-254KHHLAES....SYHTNR.--------------------------------------------------------------
Q6F4H6_HEDDI/131-378SNALGGL.....KEDLA.--------------------------------------------------------------
A6XH14_CLAPR/119-361VDACNTF.....TGDLK.--------------------------------------------------------------
Q760P7_ANABR/106-348IKALKKL.....KGDLG.--------------------------------------------------------------
A4F2K7_9CUCU/128-370SNCLKEL.....TDDLK.--------------------------------------------------------------
A6F800_9GAMM/114-356AAALANM.....SGELL.--------------------------------------------------------------
Y077_GEOTN/19-255ERTFAYRS...YGGAGR.--------------------------------------------------------------
KCRS_RAT/154-401ITALGGL.....KGDLA.--------------------------------------------------------------
KARG2_CAEEL/117-359KEIFNSI....TDPELK.--------------------------------------------------------------
Q6BDZ3_9BILA/120-367VDALSGL.....KGDLR.--------------------------------------------------------------
Q67ER6_CHAVR/889-1136TKALEGL.....SGPLK.--------------------------------------------------------------
O45011_CAEEL/156-398KKAFSEY....SDKELK.--------------------------------------------------------------
Q6BDZ2_POLMI/114-361CKALDKL.....TGELK.--------------------------------------------------------------
Q6RSH2_TETAR/120-367TEGLQGL.....QGEFK.--------------------------------------------------------------
Q8T6T7_URECA/107-354TTALAGL.....SGDLS.--------------------------------------------------------------
KCRF_STRPU/161-408KDALATL.....DGPLK.--------------------------------------------------------------
A7RNR3_NEMVE/152-399NDALDGL.....GGDLN.--------------------------------------------------------------
A7S6V8_NEMVE/867-1114VDALATL.....DGPLK.--------------------------------------------------------------
Q7T1J2_CHAAC/120-367VEALTSL.....DGEFK.--------------------------------------------------------------
A6XH13_9METZ/149-396SSALDNL.....GGELK.--------------------------------------------------------------
Q67ER6_CHAVR/504-751TEALNSL.....DGEYK.--------------------------------------------------------------
Y092_OCEIH/19-255RDEYANKS...FQTYKD.--------------------------------------------------------------
Q4AED0_SIPCU/113-355VSALKTF.....QGDLS.--------------------------------------------------------------
A0D308_PARTE/131-376VTVFE.......NFGIP.--------------------------------------------------------------
Y701_CHLPN/18-250TSHFNHI.....EGFGE.--------------------------------------------------------------
Y194_CLOK5/10-245ENAFYTF....SNTEEK.--------------------------------------------------------------
Q7UMV3_RHOBA/22-257RSRLENL.....PDWDE.--------------------------------------------------------------
Q6APG0_DESPS/133-375VAALSVL.....ADDLR.--------------------------------------------------------------
Q9NKV6_9MOLL/108-349LEALNTL.....EGDLK.--------------------------------------------------------------
Y070_BACP2/19-254EQKFASQE...VKDIGN.--------------------------------------------------------------
Q3A9N0_CARHZ/16-253EKAVTSRG..FKQKFGK.--------------------------------------------------------------
KCRF_STRPU/534-781IGALDKF.....DGDLQ.--------------------------------------------------------------
Q5L768_CHLAB/18-250ASHFNHI.....EGFDE.--------------------------------------------------------------
Q760P6_CRAGI/107-349IAALNTL.....EGELK.--------------------------------------------------------------
A7RGZ5_NEMVE/118-356VGVLTSL.....TGDLA.--------------------------------------------------------------
A1HTJ5_9FIRM/19-255RKSVNDLT...NLDGHR.--------------------------------------------------------------
B1YGS1_EXIS2/18-248ERQLSGL....K....G.--------------------------------------------------------------
Y110_BACA2/19-254EDHFSGKE...LPDIGQ.--------------------------------------------------------------
Y2442_CLOPE/7-240LGRLKEI.....DILDK.--------------------------------------------------------------
Q4W3A2_SUBDO/130-379DKVFAKL.....PDDLK.--------------------------------------------------------------
Y3134_SYMTH/19-256EAGVREIN..LVGFPSR.--------------------------------------------------------------
Q9BKE8_CIOIN/114-361CEALAKL.....DGDLK.--------------------------------------------------------------
Y2328_THETN/3-239RKAILGS....NTILSTQ--------------------------------------------------------------
A6M9J4_LOCMI/114-356STTLSGL.....EGELK.--------------------------------------------------------------
Y2368_SYNWW/20-257YEAWQKSE...FKELKQ.--------------------------------------------------------------
A8MLV0_ALKOO/9-245HHTITNA....NSSFKKE--------------------------------------------------------------
B8G1T2_DESHD/17-252SAELEAL....TIDQDK.--------------------------------------------------------------
Q73L28_TREDE/13-247FSFFCSL.....GDSSY.--------------------------------------------------------------
Q4MIA1_BACCE/19-254KKEFINKT...VEPFGE.--------------------------------------------------------------
Q4AEC6_9ANNE/106-353VDALAGL.....KGDLS.--------------------------------------------------------------
A5I7N7_CLOBH/9-243ENEFYKE.....VGKDT.--------------------------------------------------------------
Q67E02_GLOPY/117-364VDALNGL.....DGEFK.--------------------------------------------------------------
Y3260_BACLD/19-254EEQFTGYE...VPGIGK.--------------------------------------------------------------
Y3190_CLOAB/9-244KDTLIVS....NDGKEN.--------------------------------------------------------------
A7YVI5_TOXCA/157-399KNALMSQ....HDDELV.--------------------------------------------------------------
Y161_MOOTA/16-253SRAIQAPM..VFQAVGE.--------------------------------------------------------------
A6XH19_9METZ/153-400TKALGSL.....TGEFS.--------------------------------------------------------------
Y046_CHLMU/17-249AKEFSNI.....EG.EE.--------------------------------------------------------------
Y1086_CLONN/9-244ENAIFTI....PDLKDN.--------------------------------------------------------------
Q9XZF5_CHAVR/108-356TDALNSL.....DGEFK.--------------------------------------------------------------
KLOM_EISFO/108-355VDALAGL.....EGDLA.--------------------------------------------------------------
Q67ER6_CHAVR/136-383LNALNNL.....DGPFK.--------------------------------------------------------------
Q38EV2_TRYB2/136-378REQLSTM.....TDDLQ.--------------------------------------------------------------
A7RQU9_NEMVE/116-364VDALAKL.....DGEFK.--------------------------------------------------------------
Y2634_CLOTE/8-241EKVLQ.......NEESK.--------------------------------------------------------------
Q14TA8_9CNID/153-400VDALGNL.....EGSLK.--------------------------------------------------------------
Q296Q2_DROPS/207-449RAATETM.....DGEHI.--------------------------------------------------------------
A7S6V8_NEMVE/487-734TSALAEL.....DGPLA.--------------------------------------------------------------
A0DI85_PARTE/130-381VQAFE.......NFGIK.--------------------------------------------------------------
Q291M9_DROPS/185-440MGKIFTTSFADAIGETES--------------------------------------------------------------
A3IET5_9BACI/18-253THAVSDS....PTLQND.--------------------------------------------------------------
Q9BLC7_APLKU/109-351VAALAKL.....DGELK.--------------------------------------------------------------
KARG_STIJA/110-358SEALNSL.....AADLK.--------------------------------------------------------------
KCRM_TORMA/120-367IEGLATL.....TGEFQ.--------------------------------------------------------------
A6XH09_9METZ/111-359KKALDSL.....PGDLK.--------------------------------------------------------------
Y179_DESRM/19-256QSAVAQKS..LQEAVGN.--------------------------------------------------------------
Q8N0P4_9BIVA/478-719VAALNTL.....TGELA.--------------------------------------------------------------
A7S6L6_NEMVE/110-357KNALGTM.....QGEFE.--------------------------------------------------------------
A7RER2_NEMVE/138-389AKVYDSL.....GDDLA.--------------------------------------------------------------
Q4AEC7_RIFPA/105-352ASALEGL.....GGDLA.--------------------------------------------------------------
Q75ZZ3_LAMJA/120-367IEALSKL.....DGDLK.--------------------------------------------------------------
Q17MS1_AEDAE/186-440TSKILSMAFATAIGEEEL--------------------------------------------------------------
A6TWL7_ALKMQ/9-245YKALMEGD...HTLKNQ.--------------------------------------------------------------
Q1DA50_MYXXD/88-329VQVLSGL.....RGHLA.--------------------------------------------------------------
Y164_STAEQ/16-244QDALSN............--------------------------------------------------------------

PF03074

GSH1_YEAST/253-647DTN----------------------------------------------------------------VPINEKVL-----
GSH1_HUMAN/236-610DID----------------------------------------------------------------LTIDKEIY-----
GSH1_ONCVO/243-613DIP----------------------------------------------------------------LQYDDKIY-----
GSH1_MOUSE/236-610DID----------------------------------------------------------------LTIDKEIY-----
GSH1_RAT/236-610DID----------------------------------------------------------------LTIDTEIY-----
GSH1_SCHPO/299-657DVP----------------------------------------------------------------VVINQDCY-----
O77252_TRYCR/321-672DEE----------------------------------------------------------------FVINNNYL-----
Q26820_9TRYP/306-657DEV----------------------------------------------------------------LRINDSYY-----
GSH1_CAEEL/241-614DIP----------------------------------------------------------------LQYDETIY-----
P90557_LEITA/314-665DID----------------------------------------------------------------VPINHSYC-----

PF04107

CAAL_HALSA/15-298ALV----------------------------------------------------------------AYASEHGL-----
CAAL_PSEAE/12-290RLA----------------------------------------------------------------HLAMDFGL-----
Q9RD01_STRCO/37-342AVR----------------------------------------------------------------AVLREDGL-----
Y2307_ARCFU/12-285ELL----------------------------------------------------------------SVMD..GY-----
P74515_SYNY3/5-287QLR----------------------------------------------------------------HYLSQLGE-----
CAAL_ECOLI/14-292VVL----------------------------------------------------------------QAATDHHL-----
GSHA_MYCTU/46-355VLR----------------------------------------------------------------SALANAGL-----
Q9RH09_ZYMMB/53-361QTQ----------------------------------------------------------------EVGDELGL-----
CAAL_STRCO/4-283EAG----------------------------------------------------------------RHAGGIGC-----
CAAL_MYCBO/20-297PAR----------------------------------------------------------------QIVRDRGM-----
Q9A2Z2_CAUCR/50-358EVK----------------------------------------------------------------TVADELGL-----
Q9JMV4_BRAJP/24-335QVR----------------------------------------------------------------EIAAPLGI-----

PF00120

GLNA_HALVD/117-366...----------------------------------------------------------------.......A-----
GLNA_SYNP2/104-382GGN----------------------------------------------------------------LAHKPGYK-----
GLNA_AZOC5/103-379GGN----------------------------------------------------------------LGHRIKTK-----
Q9Y9Z7_AERPE/97-368GGQ----------------------------------------------------------------DGIFGQVK-----
GLNA_NOSS1/103-383KPN----------------------------------------------------------------LAYKPRFK-----
GLNA_SHIFL/102-379GGN----------------------------------------------------------------KGHRPAVK-----
GLNA_BACCE/105-354...----------------------------------------------------------------.......N-----
E7QAF9_YEASB/107-352...----------------------------------------------------------------...QGPYY-----
O86055_HERSE/104-381GGN----------------------------------------------------------------SGHRPTVK-----
O33342_MYCTU/121-374...----------------------------------------------------------------...PASDY-----
Q9HYP0_PSEAE/75-331...----------------------------------------------------------------...RRELG-----
GLNA_METJA/115-365...----------------------------------------------------------------.......D-----
GLNA_XENLA/110-359...----------------------------------------------------------------...QGPYY-----
Q97VQ9_SULSO/102-347...----------------------------------------------------------------........-----
Q977Z8_THEVO/122-372...----------------------------------------------------------------.......Y-----
GLNA1_MYCTU/105-387SPN----------------------------------------------------------------RGYKVRHK-----
GLNA_AGABI/105-350...----------------------------------------------------------------...QGPYY-----
GLNA_PYRAB/96-339...----------------------------------------------------------------.......V-----
GLNA_METTH/107-353...----------------------------------------------------------------.......C-----
GLNA_LACLA/106-356...----------------------------------------------------------------.......K-----
Q9KZC7_STRCO/124-376...----------------------------------------------------------------.....AVS-----
Q9A3S2_CAUCR/129-384...----------------------------------------------------------------...RPETG-----
GLNA_CLOSA/105-353...----------------------------------------------------------------.......K-----
O85177_AMYMD/104-383GGN----------------------------------------------------------------QGYKTKFK-----
Q98A06_RHILO/120-375...----------------------------------------------------------------.....TLT-----
Q9I3F1_PSEAE/117-372...----------------------------------------------------------------...GRPRA-----
GLNA_THEMA/102-350...----------------------------------------------------------------.......H-----
GLNA3_RHILP/97-349...----------------------------------------------------------------......AE-----
GLNA_AZOBR/103-379DGN----------------------------------------------------------------LGHRPGVK-----
Q9AEL4_CORGT/87-338...----------------------------------------------------------------.......N-----
GLNA_SULSO/104-381SDS----------------------------------------------------------------GTFVIRFK-----
GLNA2_DROME/116-365...----------------------------------------------------------------...QGPYY-----
GLNA_AZOVI/100-377GGN----------------------------------------------------------------KGHRPGVK-----
GLNA_ARCFU/116-402ELE----------------------------------------------------------------SGYMIRPK-----
GLNA2_FRAAL/84-326...----------------------------------------------------------------...QGPYY-----
Q9K665_BACHD/115-365...----------------------------------------------------------------.......I-----
Q9SC91_MEDTR/118-374...----------------------------------------------------------------...D...S-----
Q986Q4_RHILO/115-369...----------------------------------------------------------------...RRLDS-----
Q9I6J3_PSEAE/114-370...----------------------------------------------------------------...RQETG-----
GLNA_HAEIN/106-383EGN----------------------------------------------------------------NAYRPLKK-----
O88070_STRCO/130-380...----------------------------------------------------------------...PANQY-----
Q9AMT8_BRAJP/106-360...----------------------------------------------------------------......LT-----
GLNA_HELPJ/111-388GVN----------------------------------------------------------------FGHRPGKQ-----
GLNA1_DROME/147-395...----------------------------------------------------------------...QGPYY-----
O31044_SYNPW/104-383GGN----------------------------------------------------------------LGYKIQLK-----
Q97FR9_CLOAB/167-449...----------------------------------------------------------------...KGQEL-----
Q98CH5_RHILO/124-382...----------------------------------------------------------------...RVSGK-----
GLNA_COLGL/109-354...----------------------------------------------------------------...QGPYY-----
GLNA_STAAW/107-356...----------------------------------------------------------------.......D-----
GLNA_LACDE/107-356...----------------------------------------------------------------.......H-----
Q9C213_NEUCS/546-806...----------------------------------------------------------------RFSTLVTD-----
Q9U307_CAEEL/115-364...----------------------------------------------------------------...QGPYY-----
P95692_STRAG/106-359...----------------------------------------------------------------...P...R-----
GLNA1_STRFL/101-378ENN----------------------------------------------------------------RGYKVRYK-----
PUUA_ECOLI/133-390...----------------------------------------------------------------...DRNTQ-----
Q9FAR9_SHEVI/102-379GGN----------------------------------------------------------------KGHRPSVK-----
GLNA_METMP/110-357...----------------------------------------------------------------.......D-----
Q98H15_RHILO/126-382...----------------------------------------------------------------...TASPY-----
GLNA1_ALNGL/103-351...----------------------------------------------------------------...QGPYY-----
Q9RX64_DEIRA/111-359...----------------------------------------------------------------.......R-----
Q27747_PARLI/109-358...----------------------------------------------------------------...QGPYY-----
GLNA_SULAC/107-383SKN----------------------------------------------------------------GGYVIRYK-----
Q9RDW7_LACRH/107-356...----------------------------------------------------------------.......R-----
Q9A6W3_CAUCR/103-379EGN----------------------------------------------------------------MGHRPGPK-----
Q9SCP3_ARATH/507-763...----------------------------------------------------------------...D...F-----
P95529_PSEPU/135-401.PP----------------------------------------------------------------KVMP..VA-----
Q9RDS6_STRCO/104-363...----------------------------------------------------------------.......N-----
Q9A3R4_CAUCR/118-375...----------------------------------------------------------------...LRPTG-----
GLNA_THIFE/104-378SGN----------------------------------------------------------------MGHRLGVK-----
GLNA1_RHILV/103-379TGN----------------------------------------------------------------LGHRPRVK-----
Q9HT65_PSEAE/105-353...----------------------------------------------------------------........-----
GLNA2_STRVR/89-333...----------------------------------------------------------------...QGGYY-----
Q98EM0_RHILO/120-375...----------------------------------------------------------------...RAEGV-----
GLNA_HALSA/115-364...----------------------------------------------------------------.......Q-----
Q53045_RHORU/103-379EGN----------------------------------------------------------------YGHRPPIK-----
GLNA_METCA/102-379DGN----------------------------------------------------------------IGHRPGVK-----
Q9I275_PSEAE/120-376...----------------------------------------------------------------...KRPQS-----
GLNA2_MYCTU/106-357...----------------------------------------------------------------.......N-----
Q988Z8_RHILO/141-397...----------------------------------------------------------------...RAIGG-----
Q97W07_SULSO/106-349...----------------------------------------------------------------.......Y-----
Q44249_ACISP/140-407.AI----------------------------------------------------------------QVQP..VA-----
LGSN_HUMAN/181-427...----------------------------------------------------------------.......K-----
GLNA2_HORVU/165-413...----------------------------------------------------------------...QGPYY-----
O07752_MYCTU/111-358...----------------------------------------------------------------......TL-----
Q9ZF05_9CYAN/195-477...----------------------------------------------------------------...KGQQF-----
GLNA_NEIGO/105-382GQN----------------------------------------------------------------TGHRPAVK-----
GLNA2_STRHY/85-330...----------------------------------------------------------------...QADYY-----
Q9HT51_PSEAE/117-373...----------------------------------------------------------------...QRPRA-----
GLNA_AQUAE/105-379VPS----------------------------------------------------------------SGYKIPHK-----
Q9PCD9_XYLFA/137-414GGN----------------------------------------------------------------GGYRPAVK-----
GLNA_RHOCA/103-378MGN----------------------------------------------------------------LAHRAGHK-----
Q97S86_STRPN/106-358...----------------------------------------------------------------.......K-----
O96463_SKECO/151-401...----------------------------------------------------------------.PRSGPYY-----
GLNA1_FRAAL/104-383GGN----------------------------------------------------------------LGYKPRFK-----
Q79VE3_CORGL/105-386TPN----------------------------------------------------------------LGAKNRVK-----

PF12224

Q311H8_DESDG/19-291...----------------------------------------------------------------...SGTRF.....
Q2HBV5_CHAGB/10-268...----------------------------------------------------------------.............
Q67LG7_SYMTH/9-197...----------------------------------------------------------------.............
A6G6Z1_9DELT/9-197...----------------------------------------------------------------.............
Q5LF69_BACFN/74-277...----------------------------------------------------------------.............
A6KZ00_BACV8/75-278...----------------------------------------------------------------.............
A7ALF5_9PORP/71-272...----------------------------------------------------------------.............
A5D072_PELTS/13-222...----------------------------------------------------------------.............
O86176_DICNO/4-232...----------------------------------------------------------------...EDLRG.....
Q1DBA6_MYXXD/2-223...----------------------------------------------------------------...TDTQG.....
B8I7I6_CLOCE/4-236...----------------------------------------------------------------...LDSQC.....
Q24NQ7_DESHY/4-240...----------------------------------------------------------------...LDNQS.....
A7VE77_9CLOT/4-240...----------------------------------------------------------------...IDTEG.....
A5N406_CLOK5/4-240...----------------------------------------------------------------...IDSQG.....
Q252G7_DESHY/4-240...----------------------------------------------------------------...RDTSG.....
A3DFX9_CLOTH/2-240...----------------------------------------------------------------...IAPDG.....
B0K6R6_THEPX/2-240...----------------------------------------------------------------...KTPDG.....
A3DG69_CLOTH/7-247...----------------------------------------------------------------...TAADG.....
A7B449_RUMGN/13-255...----------------------------------------------------------------...WDADG.....
A5KNA4_9FIRM/6-244...----------------------------------------------------------------...TDQEG.....
A7VHZ7_9CLOT/7-244...----------------------------------------------------------------...KDSDG.....
A6P0C2_9FIRM/7-247...----------------------------------------------------------------...RDGEG.....
A6NU92_9FIRM/5-246...----------------------------------------------------------------...KDTKG.....
A7VEY9_9CLOT/228-465...----------------------------------------------------------------...IDRMS.....
Q2LU27_SYNAS/194-396...----------------------------------------------------------------.............
A6NXI0_9FIRM/22-218...----------------------------------------------------------------...ANQDG.....
A6RSA1_BOTFB/8-281...----------------------------------------------------------------.............
A6RWE1_BOTFB/15-325PTE----------------------------------------------------------------PRKANSNF.....
A6S997_BOTFB/48-350AGF----------------------------------------------------------------PAIHMEDAEYQKT
A7EWG5_SCLS1/49-355AGF----------------------------------------------------------------RAAHVEAPGCRER
A6RWC8_BOTFB/15-290NAS----------------------------------------------------------------ISPSDEEL.....
A6F4K8_9ALTE/17-284...----------------------------------------------------------------....ETEL.....
A1U270_MARAV/19-286...----------------------------------------------------------------....DTDA.....
A3J9P7_9ALTE/19-286...----------------------------------------------------------------....DTPL.....
Q1N2M0_9GAMM/21-286...----------------------------------------------------------------...TDSRS.....
Q21GI0_SACD2/15-285...----------------------------------------------------------------...TGTSL.....
A1SY20_PSYIN/16-290...----------------------------------------------------------------....NSKY.....
A6Q4S5_NITSB/14-275...----------------------------------------------------------------...KETQF.....
Q1NPF7_9DELT/17-289...----------------------------------------------------------------...CVPEF.....
Q1QYE1_CHRSD/31-310...----------------------------------------------------------------...EGTPW.....
Q0A4Z7_ALHEH/26-298...----------------------------------------------------------------...AGTAW.....
A6GSC5_9BURK/17-282...----------------------------------------------------------------...RHPQF.....
Q2SFT5_HAHCH/19-280...----------------------------------------------------------------...QVESL.....
A4A8R3_9GAMM/16-277...----------------------------------------------------------------...RAEGL.....
A3WME7_9GAMM/21-284...----------------------------------------------------------------...QHEQL.....
Q5QYT8_IDILO/18-278...----------------------------------------------------------------...EVDEL.....
A6FM81_9RHOB/18-271...----------------------------------------------------------------...RDSRI.....
A6DW96_9RHOB/16-269...----------------------------------------------------------------...ENSQI.....
A3TW22_9RHOB/18-271...----------------------------------------------------------------...PDSEL.....
A3K2K5_9RHOB/17-270...----------------------------------------------------------------...EDTEL.....
Q0FIK0_9RHOB/23-278...----------------------------------------------------------------...TGTGL.....
Q0AQY0_MARMM/8-327...----------------------------------------------------------------...DDLTLRDGLN
Q2L5I9_CLOPF/180-403...----------------------------------------------------------------...SRSEP.....

PF04262

GSH1_PSEAE/6-381PCE----------------------------------------------------------------LPDEESIP-----
Q9RDU4_PSESP/6-381PGR----------------------------------------------------------------LPVDEQIP-----
GSH1_ECOLI/6-381PCY----------------------------------------------------------------IAEGQDIE-----
GSH1_CLOAB/6-390PPR----------------------------------------------------------------LPKEEDIP-----
GSH1_BUCAI/6-382PYC----------------------------------------------------------------FNDQTNIQ-----
GSHAB_PASMU/1-337PAG----------------------------------------------------------------LPAEEQIR-----
GSH1_VIBCH/5-379PCY----------------------------------------------------------------VGSEEGIV-----

PF14395

B7DSA7_9BACL/212-472--------------------------------------------------------------------------------
C0ZEZ5_BREBN/171-428--------------------------------------------------------------------------------
B0TB99_HELMI/204-455--------------------------------------------------------------------------------
C6CUQ2_PAESJ/144-402--------------------------------------------------------------------------------
D3E8P9_GEOS4/163-421--------------------------------------------------------------------------------
Q0AXS0_SYNWW/193-453--------------------------------------------------------------------------------
B0TBC1_HELMI/214-474--------------------------------------------------------------------------------
B0TET0_HELMI/208-468--------------------------------------------------------------------------------

PF09899

A3HSI4_9BACT/278-1112DYK....HSAKDAEAFMTELTTHLNVDQKNITPLYEDPIYFIWQESKIPVNVDP.KDFDLK......SPLERQKLAQLLT
Q1B9K6_MYCSS/283-1101THT....VDDDAARRLLAAVAAGLGLPGTQVRPAFEDPLSRLAAAARRPAGEPVAPDDDLA....DDTARARADLLARLD
Q4ZYW4_PSEU2/275-1090DYG....ATGELAGRFLASVAERLKLPARFVFPAYEDNFYYLWREGALPVNVTA.EDSRLG......DELERARLRKVFA
A0L4M6_MAGSM/274-1111DYG....YGADEAEAFMGELARRLGHLGKFVSPAYEDPFYYVWAEAKLPVNLDP.FKFNLK......DGIERQKMAQVLQ
Q2W952_MAGSA/302-1132DNS....PTHEQARDFSQALCRHLGVDADFAMPAWEDPAYYLLREQALPINVDP.IDSKLE......NPEERARLATVFK
Q11VA3_CYTH3/275-1141KKK....YTHIDAEAFITELTKTLAVPASDISALHEDIFYFLWTEGKIPVNIDP.MSFTLK......DPIERRTLTQLLD
A2VKS3_MYCTU/329-1149DP.....VDDDAAYRVLAGIADGLGLPISQVRPAYEDPLSRLAAAVRMPAGDPVESGDDLGCDTNPDTPTGRAALLARLD
A0NMX9_9RHOB/275-1105DTK....AGAEQAEALLQEIATKLEIDPDYVVPAYEDPAVWLVKEANLPENVTP.KNSKLE......DAEARHRIARVFD
A4XQ07_PSEMY/275-1095GYG....ASADTAARFLAALAARLDVDAGNVFPAYEDWFYYLWRERKLPDNVTP.DDPRLS......DPLERERLRKVFD
A9W7N2_METEP/297-1111PKT....ATITDAERLIGTLAERLEL.ARFVFPAYEDADYWRIRESELPVNVTT.AEPQTG......SPETDARFRRVFG
Q47BP1_DECAR/275-1115NYG....ATSEHAERFLKRVAERLGMTGDYVFPAFEDAYYYMWRERRLPGNVDP.FDSRVD......DPLERARLMKVFT
Q2SNA7_HAHCH/275-1090.........PDDARALMAAFCQEIGLSDSAVQPCYEDPFYYMWRHGQLPAGDDLHGDH.........EELARRTLAQVMQ
Q31N62_SYNE7/1-727TAA....IATDAAQQFVQTLQQVLQL......PVVEPWIVPAESAVVLP...............................
A8LRF2_DINSH/275-1107DAT....PGPEAAESLLSGIAAALGVPEDNVTPAYEDPAEWLVREAQLPENVSP.ENSKLK......DPEERHRIARVFE
Q1MBT5_RHIL3/277-1103DTG....VTAEDAEKLLTAIAKELAIKSDMVQPAYEDPADWIIKEGNLPENVDP.ANSKLK......DPEERNRIARVFA
Q89QZ5_BRAJA/275-1084PRP....ARAKDAEAFMEGAALRLGLDPGYIMPAYEDTALWLQKEAELPVNVDP.TDSKLS......DPEARARIARVFE
Q1YG30_MOBAS/275-1127ARP....VGPEEAERLSRKVAEAIGVSPDYAAPAYEDSAYWLAREAQLPENVEP.TDSKLE......DPEERARLATVFS
A3VDN8_9RHOB/278-1112DTG....AGAPEAEKLLDGIAARLGLDGKFTHAVYEDPAEWMLKEGKLPPNVTP.EDSKLK......DPEERSRFARVFE
A6C0B7_9PLAN/274-1115NYE....HDIEHAQLFATTLAKRLGLNPEYVATAYEDAMYYMWKERRLAVNADV.LNSDLV......DEEERIRLARVFE
A3XIL1_LEEBM/275-1116EYD....LPEGVTKTFLQELALNLGIRLEYITPAYEDVFYFMWEEGRLPVDVDP.LKGDDV......ATSVRNRLNKVLE
A3PN00_RHOS1/275-1102QGG....VGPAEAERLMQGIAAELGLEPDLVVPAYEDPGEWLLKEANLPENVTP.ENSELK......DPEERLRMARVFE
A1U538_MARAV/275-1097EGK....ASPEDAHRFLAALAKELGVDEKHLFPGFEDAFYYLWRERRLPVNLDP.FDAKLD......NALERKQLQQIFS
A1VL54_POLNA/295-1117NDG....YGYEDAERFAAELVKSLGLPAFSQIPAYEDVVQQAHLEQGLPVNLDP.LQVDLK......ASEQRRRLARLLE
Q21G23_SACD2/275-1112DYG....HGLTTSTKFARKLAAKLGLEKDFAQPAYEDGLHYLLEERSLPNNIDKLCNSVMR......NDLSRKRLVHLLE
A6GT43_9BURK/286-1103DGK....AGNATAKQFIEGLCSRLGLHPRYVMPGFEDAWYYMWRERKLPVNVDP.FDSRLD......DPLERKRLNKVFT
Q7UKP5_RHOBA/275-1113DYG....HTHRDAERFVKSLARELNVSARMTFPVHEDVFHYLWRENRLPIDVDP.TDPKLE......DPNERAMMMRTFN
A4TX61_9PROT/275-1111ADN....PSVAMSETFAVQLAEKLGVDDQFIHPAYEDAAYYLMREQDLPINVTP.DDARLA......DSEERARLARVFR
B0SXH9_CAUSK/275-1086PGSGGKPTGAPQASRFAALFAEALGLDPGCVITALEDPLHWIGKEGALPTNFDD.EGLPVD......DPEARARLLRVFD
Q2RR87_RHORT/275-1085DHG....HDTRSARAFVERLTTRLGLDNKVILEAYEDPWHFLAQERQLPANVDA.LDNHLE......DRQSRDRLARVFE
A1K5W6_AZOSB/275-1124PGG....ATDIIAGRFLRGIADRLGLDAQYVFPAYEDVFYYLWRERRLPANVDP.FDSRLD......DPLERERLMKVYS
Q1ND53_9SPHN/280-1118PEGARQ.TTAEDARTFLAALAGNMGFSADYTHPVYEDPAVWMVKEGDLPINTDP.QDPAIA......DPEARARMVKTFE
Q218C6_RHOPB/275-1085KRP....VKIEEAQRFAVDTAKRLGVHSDYILPAFEDPAHWLQKEAGLPPNVDP.SDSKLA......DPEERARMARVFD
A5VFM9_SPHWW/295-1120DGAGAT.VGAEQAEAFLSAMAEGLGVGAAMVAPAYEDPVDWSVKEAQLPANVDP.SDPKID......DPEARARMVKAFE
Q98HG6_RHILO/275-1114SAD....VGPKQAESLLTAIAGELGIDKAMVSEAYEDPAEWLLKEGKLPENVDP.SNSKLE......DPEERSRMARVFE
C0AE57_9BACT/275-1117DYG....YGAREARELALRIARAAGLNPAHLLPAYEDVFYYTWKERRLPSNVAA.GDSRLK......DKQERERIARIFQ
B0UHH5_METS4/274-1075PQD....TGIEHAEAFGKALAKALGLGP.YLQPTFEDPVYWERKEAELPINTTP.LQPRVG......DAEFQERMARIYR
C1DJA3_AZOVD/275-1116HYG....ADAQLGARFLDILCGYLGISGEHFFPAYEDWLYYLWRERRLPENVTP.EDARLA......DPLERERLRRVFR
A3YWY7_9SYNE/14-726DQAAPLPLPAKRAEDFLHGIGKALGHEVH........PL....R...LKDPLDP..SSKIW...................
A6VTZ0_MARMS/275-1113DYK....HTIKDAQAFGELLCEKLALDKQYLQSTYEDTLYYLWMEQSLPADADP.TKADLK......DDLERRRLAKLLS
Q07VI7_RHOP5/275-1098STP....ATIEQAEQLVCCIAERLGLEADYVVPAFEDPAHWLMQEAKLPPNVDP.SDSKLE......DPESRARMAKVFD

PF03136

PAFA_CORGL/10-445--------------------------------------------------------------------------------
Q7UWL2_RHOBA/26-608--------------------------------------------------------------------------------
A6G895_9DELT/3-562--------------------------------------------------------------------------------
Q7WZ91_9ACTO/5-426--------------------------------------------------------------------------------
PAFA_KINRD/3-425--------------------------------------------------------------------------------
A3TL35_9MICO/3-425--------------------------------------------------------------------------------
PAFA_MYCS2/3-424--------------------------------------------------------------------------------
PAFA_ARTS2/3-425--------------------------------------------------------------------------------
PAFA_CORDI/11-437--------------------------------------------------------------------------------
PAFA_CORJK/6-436--------------------------------------------------------------------------------
PAFA_BIFLO/27-456--------------------------------------------------------------------------------
A3EPC1_9BACT/3-425--------------------------------------------------------------------------------
Q828J1_STRAW/4-459--------------------------------------------------------------------------------
A8LH56_FRASN/73-531--------------------------------------------------------------------------------
Q47NY8_THEFY/10-466--------------------------------------------------------------------------------
A0LU48_ACIC1/2-458--------------------------------------------------------------------------------
A1SK11_NOCSJ/4-459--------------------------------------------------------------------------------
A6W968_KINRD/4-497--------------------------------------------------------------------------------
Q5YUX0_NOCFA/2-457--------------------------------------------------------------------------------
A4FBX9_SACEN/2-456--------------------------------------------------------------------------------
A1R6Q5_ARTAT/19-506--------------------------------------------------------------------------------
Q8NQD9_CORGL/2-460--------------------------------------------------------------------------------
Q8FTE4_COREF/2-463--------------------------------------------------------------------------------
Q6NH93_CORDI/2-457--------------------------------------------------------------------------------
Q4JVP6_CORJK/4-450--------------------------------------------------------------------------------
A7BC88_9ACTO/4-485--------------------------------------------------------------------------------
Q8G3G5_BIFLO/4-488--------------------------------------------------------------------------------
A7A4U7_BIFAD/16-491--------------------------------------------------------------------------------
A3EPC5_9BACT/10-458--------------------------------------------------------------------------------
A3ETM5_9BACT/5-463--------------------------------------------------------------------------------
A3ETM1_9BACT/26-469--------------------------------------------------------------------------------

PF00217

KTRC_SCHMA/141-382--------------------------------------------------------------------------------
Q7PYN5_ANOGA/203-445--------------------------------------------------------------------------------
Q4AED1_9ANNE/113-361--------------------------------------------------------------------------------
Q4AED2_9ANNE/113-360--------------------------------------------------------------------------------
KCRB_HUMAN/120-367--------------------------------------------------------------------------------
Q1Q1E9_9BACT/18-252--------------------------------------------------------------------------------
KARG_LIMPO/114-356--------------------------------------------------------------------------------
A3DGD2_CLOTH/9-244--------------------------------------------------------------------------------
Q9VST4_DROME/143-385--------------------------------------------------------------------------------
Q4AEC5_9ANNE/149-396--------------------------------------------------------------------------------
Q9NKV5_OCTVU/106-347--------------------------------------------------------------------------------
Y120_BACSK/19-255--------------------------------------------------------------------------------
KARG_LIOJA/108-349--------------------------------------------------------------------------------
A6QBA0_SULNB/100-342--------------------------------------------------------------------------------
Q8MWR8_9BIVA/125-367--------------------------------------------------------------------------------
A3ZT72_9PLAN/20-254--------------------------------------------------------------------------------
A7XZJ5_GLYDO/114-356--------------------------------------------------------------------------------
Q6XLN0_HETGL/163-406--------------------------------------------------------------------------------
Q4AEC8_RIFPA/122-369--------------------------------------------------------------------------------
Q177S3_AEDAE/202-445--------------------------------------------------------------------------------
A6XH18_9METZ/115-362--------------------------------------------------------------------------------
A6CSY9_9BACI/19-254--------------------------------------------------------------------------------
KCRF_STRPU/908-1155--------------------------------------------------------------------------------
Q5TP29_ANOGA/189-444--------------------------------------------------------------------------------
Y282_PELTS/19-256--------------------------------------------------------------------------------
Y860_HALOH/19-252--------------------------------------------------------------------------------
Q2B1J8_9BACI/19-255--------------------------------------------------------------------------------
Q1HBJ2_BRABE/114-362--------------------------------------------------------------------------------
KARG_HALMK/111-353--------------------------------------------------------------------------------
A6XH11_9METZ/115-365--------------------------------------------------------------------------------
Y102_BACHD/19-254--------------------------------------------------------------------------------
Q6F4H6_HEDDI/131-378--------------------------------------------------------------------------------
A6XH14_CLAPR/119-361--------------------------------------------------------------------------------
Q760P7_ANABR/106-348--------------------------------------------------------------------------------
A4F2K7_9CUCU/128-370--------------------------------------------------------------------------------
A6F800_9GAMM/114-356--------------------------------------------------------------------------------
Y077_GEOTN/19-255--------------------------------------------------------------------------------
KCRS_RAT/154-401--------------------------------------------------------------------------------
KARG2_CAEEL/117-359--------------------------------------------------------------------------------
Q6BDZ3_9BILA/120-367--------------------------------------------------------------------------------
Q67ER6_CHAVR/889-1136--------------------------------------------------------------------------------
O45011_CAEEL/156-398--------------------------------------------------------------------------------
Q6BDZ2_POLMI/114-361--------------------------------------------------------------------------------
Q6RSH2_TETAR/120-367--------------------------------------------------------------------------------
Q8T6T7_URECA/107-354--------------------------------------------------------------------------------
KCRF_STRPU/161-408--------------------------------------------------------------------------------
A7RNR3_NEMVE/152-399--------------------------------------------------------------------------------
A7S6V8_NEMVE/867-1114--------------------------------------------------------------------------------
Q7T1J2_CHAAC/120-367--------------------------------------------------------------------------------
A6XH13_9METZ/149-396--------------------------------------------------------------------------------
Q67ER6_CHAVR/504-751--------------------------------------------------------------------------------
Y092_OCEIH/19-255--------------------------------------------------------------------------------
Q4AED0_SIPCU/113-355--------------------------------------------------------------------------------
A0D308_PARTE/131-376--------------------------------------------------------------------------------
Y701_CHLPN/18-250--------------------------------------------------------------------------------
Y194_CLOK5/10-245--------------------------------------------------------------------------------
Q7UMV3_RHOBA/22-257--------------------------------------------------------------------------------
Q6APG0_DESPS/133-375--------------------------------------------------------------------------------
Q9NKV6_9MOLL/108-349--------------------------------------------------------------------------------
Y070_BACP2/19-254--------------------------------------------------------------------------------
Q3A9N0_CARHZ/16-253--------------------------------------------------------------------------------
KCRF_STRPU/534-781--------------------------------------------------------------------------------
Q5L768_CHLAB/18-250--------------------------------------------------------------------------------
Q760P6_CRAGI/107-349--------------------------------------------------------------------------------
A7RGZ5_NEMVE/118-356--------------------------------------------------------------------------------
A1HTJ5_9FIRM/19-255--------------------------------------------------------------------------------
B1YGS1_EXIS2/18-248--------------------------------------------------------------------------------
Y110_BACA2/19-254--------------------------------------------------------------------------------
Y2442_CLOPE/7-240--------------------------------------------------------------------------------
Q4W3A2_SUBDO/130-379--------------------------------------------------------------------------------
Y3134_SYMTH/19-256--------------------------------------------------------------------------------
Q9BKE8_CIOIN/114-361--------------------------------------------------------------------------------
Y2328_THETN/3-239--------------------------------------------------------------------------------
A6M9J4_LOCMI/114-356--------------------------------------------------------------------------------
Y2368_SYNWW/20-257--------------------------------------------------------------------------------
A8MLV0_ALKOO/9-245--------------------------------------------------------------------------------
B8G1T2_DESHD/17-252--------------------------------------------------------------------------------
Q73L28_TREDE/13-247--------------------------------------------------------------------------------
Q4MIA1_BACCE/19-254--------------------------------------------------------------------------------
Q4AEC6_9ANNE/106-353--------------------------------------------------------------------------------
A5I7N7_CLOBH/9-243--------------------------------------------------------------------------------
Q67E02_GLOPY/117-364--------------------------------------------------------------------------------
Y3260_BACLD/19-254--------------------------------------------------------------------------------
Y3190_CLOAB/9-244--------------------------------------------------------------------------------
A7YVI5_TOXCA/157-399--------------------------------------------------------------------------------
Y161_MOOTA/16-253--------------------------------------------------------------------------------
A6XH19_9METZ/153-400--------------------------------------------------------------------------------
Y046_CHLMU/17-249--------------------------------------------------------------------------------
Y1086_CLONN/9-244--------------------------------------------------------------------------------
Q9XZF5_CHAVR/108-356--------------------------------------------------------------------------------
KLOM_EISFO/108-355--------------------------------------------------------------------------------
Q67ER6_CHAVR/136-383--------------------------------------------------------------------------------
Q38EV2_TRYB2/136-378--------------------------------------------------------------------------------
A7RQU9_NEMVE/116-364--------------------------------------------------------------------------------
Y2634_CLOTE/8-241--------------------------------------------------------------------------------
Q14TA8_9CNID/153-400--------------------------------------------------------------------------------
Q296Q2_DROPS/207-449--------------------------------------------------------------------------------
A7S6V8_NEMVE/487-734--------------------------------------------------------------------------------
A0DI85_PARTE/130-381--------------------------------------------------------------------------------
Q291M9_DROPS/185-440--------------------------------------------------------------------------------
A3IET5_9BACI/18-253--------------------------------------------------------------------------------
Q9BLC7_APLKU/109-351--------------------------------------------------------------------------------
KARG_STIJA/110-358--------------------------------------------------------------------------------
KCRM_TORMA/120-367--------------------------------------------------------------------------------
A6XH09_9METZ/111-359--------------------------------------------------------------------------------
Y179_DESRM/19-256--------------------------------------------------------------------------------
Q8N0P4_9BIVA/478-719--------------------------------------------------------------------------------
A7S6L6_NEMVE/110-357--------------------------------------------------------------------------------
A7RER2_NEMVE/138-389--------------------------------------------------------------------------------
Q4AEC7_RIFPA/105-352--------------------------------------------------------------------------------
Q75ZZ3_LAMJA/120-367--------------------------------------------------------------------------------
Q17MS1_AEDAE/186-440--------------------------------------------------------------------------------
A6TWL7_ALKMQ/9-245--------------------------------------------------------------------------------
Q1DA50_MYXXD/88-329--------------------------------------------------------------------------------
Y164_STAEQ/16-244--------------------------------------------------------------------------------

PF03074

GSH1_YEAST/253-647-------GRLL---------------------------------------------------------------------
GSH1_HUMAN/236-610-------EQLL---------------------------------------------------------------------
GSH1_ONCVO/243-613-------KQLI---------------------------------------------------------------------
GSH1_MOUSE/236-610-------EQLL---------------------------------------------------------------------
GSH1_RAT/236-610-------EQLL---------------------------------------------------------------------
GSH1_SCHPO/299-657-------DKLI---------------------------------------------------------------------
O77252_TRYCR/321-672-------EVLK---------------------------------------------------------------------
Q26820_9TRYP/306-657-------NLLT---------------------------------------------------------------------
GSH1_CAEEL/241-614-------KQLI---------------------------------------------------------------------
P90557_LEITA/314-665-------ELLK---------------------------------------------------------------------

PF04107

CAAL_HALSA/15-298-------RIAG---------------------------------------------------------------------
CAAL_PSEAE/12-290-------RSLC---------------------------------------------------------------------
Q9RD01_STRCO/37-342-------ALVG---------------------------------------------------------------------
Y2307_ARCFU/12-285-------KLLG---------------------------------------------------------------------
P74515_SYNY3/5-287-------DYTL---------------------------------------------------------------------
CAAL_ECOLI/14-292-------EICG---------------------------------------------------------------------
GSHA_MYCTU/46-355-------GLVF---------------------------------------------------------------------
Q9RH09_ZYMMB/53-361-------GFLG---------------------------------------------------------------------
CAAL_STRCO/4-283-------AVAA---------------------------------------------------------------------
CAAL_MYCBO/20-297-------ELFC---------------------------------------------------------------------
Q9A2Z2_CAUCR/50-358-------GFTG---------------------------------------------------------------------
Q9JMV4_BRAJP/24-335-------GFLG---------------------------------------------------------------------

PF00120

GLNA_HALVD/117-366-------GGYF---------------------------------------------------------------------
GLNA_SYNP2/104-382-------QGYF---------------------------------------------------------------------
GLNA_AZOC5/103-379-------GGYF---------------------------------------------------------------------
Q9Y9Z7_AERPE/97-368-------KSYH---------------------------------------------------------------------
GLNA_NOSS1/103-383-------EGYF---------------------------------------------------------------------
GLNA_SHIFL/102-379-------GGYF---------------------------------------------------------------------
GLNA_BACCE/105-354-------GGYF---------------------------------------------------------------------
E7QAF9_YEASB/107-352-------CGVG---------------------------------------------------------------------
O86055_HERSE/104-381-------GGYF---------------------------------------------------------------------
O33342_MYCTU/121-374-------NIDY---------------------------------------------------------------------
Q9HYP0_PSEAE/75-331-------YSAF---------------------------------------------------------------------
GLNA_METJA/115-365-------GGYF---------------------------------------------------------------------
GLNA_XENLA/110-359-------CGVG---------------------------------------------------------------------
Q97VQ9_SULSO/102-347-------ARCF---------------------------------------------------------------------
Q977Z8_THEVO/122-372-------GGYF---------------------------------------------------------------------
GLNA1_MYCTU/105-387-------GGYF---------------------------------------------------------------------
GLNA_AGABI/105-350-------CGAG---------------------------------------------------------------------
GLNA_PYRAB/96-339-------GGYF---------------------------------------------------------------------
GLNA_METTH/107-353-------GAYF---------------------------------------------------------------------
GLNA_LACLA/106-356-------GGYF---------------------------------------------------------------------
Q9KZC7_STRCO/124-376-------GPAY---------------------------------------------------------------------
Q9A3S2_CAUCR/129-384-------RQGY---------------------------------------------------------------------
GLNA_CLOSA/105-353-------AGYF---------------------------------------------------------------------
O85177_AMYMD/104-383-------GGYF---------------------------------------------------------------------
Q98A06_RHILO/120-375-------KPAY---------------------------------------------------------------------
Q9I3F1_PSEAE/117-372-------TQVY---------------------------------------------------------------------
GLNA_THEMA/102-350-------GGYF---------------------------------------------------------------------
GLNA3_RHILP/97-349-------KPCY---------------------------------------------------------------------
GLNA_AZOBR/103-379-------GGYF---------------------------------------------------------------------
Q9AEL4_CORGT/87-338-------GGYF---------------------------------------------------------------------
GLNA_SULSO/104-381-------EGYY---------------------------------------------------------------------
GLNA2_DROME/116-365-------CGVG---------------------------------------------------------------------
GLNA_AZOVI/100-377-------GGYF---------------------------------------------------------------------
GLNA_ARCFU/116-402-------EGYF---------------------------------------------------------------------
GLNA2_FRAAL/84-326-------CGVG---------------------------------------------------------------------
Q9K665_BACHD/115-365-------GGYF---------------------------------------------------------------------
Q9SC91_MEDTR/118-374-------TPYC---------------------------------------------------------------------
Q986Q4_RHILO/115-369-------DAAL---------------------------------------------------------------------
Q9I6J3_PSEAE/114-370-------RQSF---------------------------------------------------------------------
GLNA_HAEIN/106-383-------GGYC---------------------------------------------------------------------
O88070_STRCO/130-380-------NVDY---------------------------------------------------------------------
Q9AMT8_BRAJP/106-360-------RGPF---------------------------------------------------------------------
GLNA_HELPJ/111-388-------GGYM---------------------------------------------------------------------
GLNA1_DROME/147-395-------CGVG---------------------------------------------------------------------
O31044_SYNPW/104-383-------EGYF---------------------------------------------------------------------
Q97FR9_CLOAB/167-449-------DDHY---------------------------------------------------------------------
Q98CH5_RHILO/124-382-------TEVY---------------------------------------------------------------------
GLNA_COLGL/109-354-------CGVG---------------------------------------------------------------------
GLNA_STAAW/107-356-------GGYF---------------------------------------------------------------------
GLNA_LACDE/107-356-------SSYF---------------------------------------------------------------------
Q9C213_NEUCS/546-806-------GHAW---------------------------------------------------------------------
Q9U307_CAEEL/115-364-------CGVG---------------------------------------------------------------------
P95692_STRAG/106-359-------RPTL---------------------------------------------------------------------
GLNA1_STRFL/101-378-------GGYF---------------------------------------------------------------------
PUUA_ECOLI/133-390-------SQVY---------------------------------------------------------------------
Q9FAR9_SHEVI/102-379-------GGYF---------------------------------------------------------------------
GLNA_METMP/110-357-------AGYF---------------------------------------------------------------------
Q98H15_RHILO/126-382-------IGDY---------------------------------------------------------------------
GLNA1_ALNGL/103-351-------CGIG---------------------------------------------------------------------
Q9RX64_DEIRA/111-359-------AGYF---------------------------------------------------------------------
Q27747_PARLI/109-358-------CGVG---------------------------------------------------------------------
GLNA_SULAC/107-383-------EGYY---------------------------------------------------------------------
Q9RDW7_LACRH/107-356-------GSYF---------------------------------------------------------------------
Q9A6W3_CAUCR/103-379-------GGYF---------------------------------------------------------------------
Q9SCP3_ARATH/507-763-------GPYC---------------------------------------------------------------------
P95529_PSEPU/135-401-------KGYS---------------------------------------------------------------------
Q9RDS6_STRCO/104-363-------SGYF---------------------------------------------------------------------
Q9A3R4_CAUCR/118-375-------IQVY---------------------------------------------------------------------
GLNA_THIFE/104-378-------GGYF---------------------------------------------------------------------
GLNA1_RHILV/103-379-------GGYF---------------------------------------------------------------------
Q9HT65_PSEAE/105-353-------AAAF---------------------------------------------------------------------
GLNA2_STRVR/89-333-------CGVG---------------------------------------------------------------------
Q98EM0_RHILO/120-375-------QHPY---------------------------------------------------------------------
GLNA_HALSA/115-364-------GGYF---------------------------------------------------------------------
Q53045_RHORU/103-379-------GGYF---------------------------------------------------------------------
GLNA_METCA/102-379-------GGYF---------------------------------------------------------------------
Q9I275_PSEAE/120-376-------VQVY---------------------------------------------------------------------
GLNA2_MYCTU/106-357-------AGYF---------------------------------------------------------------------
Q988Z8_RHILO/141-397-------GAGY---------------------------------------------------------------------
Q97W07_SULSO/106-349-------SKAF---------------------------------------------------------------------
Q44249_ACISP/140-407-------QGYS---------------------------------------------------------------------
LGSN_HUMAN/181-427-------IISF---------------------------------------------------------------------
GLNA2_HORVU/165-413-------CAVG---------------------------------------------------------------------
O07752_MYCTU/111-358-------WAQY---------------------------------------------------------------------
Q9ZF05_9CYAN/195-477-------DDHY---------------------------------------------------------------------
GLNA_NEIGO/105-382-------GGYA---------------------------------------------------------------------
GLNA2_STRHY/85-330-------CGVG---------------------------------------------------------------------
Q9HT51_PSEAE/117-373-------TQVY---------------------------------------------------------------------
GLNA_AQUAE/105-379-------RGYF---------------------------------------------------------------------
Q9PCD9_XYLFA/137-414-------GGYF---------------------------------------------------------------------
GLNA_RHOCA/103-378-------GGYF---------------------------------------------------------------------
Q97S86_STRPN/106-358-------GGYF---------------------------------------------------------------------
O96463_SKECO/151-401-------SSAG---------------------------------------------------------------------
GLNA1_FRAAL/104-383-------GGYF---------------------------------------------------------------------
Q79VE3_CORGL/105-386-------GGYF---------------------------------------------------------------------

PF12224

Q311H8_DESDG/19-291.......GDFT---------------------------------------------------------------------
Q2HBV5_CHAGB/10-268.......QEWT---------------------------------------------------------------------
Q67LG7_SYMTH/9-197.......PGWV---------------------------------------------------------------------
A6G6Z1_9DELT/9-197.......DGWS---------------------------------------------------------------------
Q5LF69_BACFN/74-277.......SNWK---------------------------------------------------------------------
A6KZ00_BACV8/75-278.......PHWK---------------------------------------------------------------------
A7ALF5_9PORP/71-272.......PHWK---------------------------------------------------------------------
A5D072_PELTS/13-222.......PHWK---------------------------------------------------------------------
O86176_DICNO/4-232.......CVWK---------------------------------------------------------------------
Q1DBA6_MYXXD/2-223.......RIWR---------------------------------------------------------------------
B8I7I6_CLOCE/4-236.......RRWK---------------------------------------------------------------------
Q24NQ7_DESHY/4-240.......RRWK---------------------------------------------------------------------
A7VE77_9CLOT/4-240.......RQWK---------------------------------------------------------------------
A5N406_CLOK5/4-240.......RKWK---------------------------------------------------------------------
Q252G7_DESHY/4-240.......RKWK---------------------------------------------------------------------
A3DFX9_CLOTH/2-240.......RIWK---------------------------------------------------------------------
B0K6R6_THEPX/2-240.......RVWR---------------------------------------------------------------------
A3DG69_CLOTH/7-247.......RVWK---------------------------------------------------------------------
A7B449_RUMGN/13-255.......REWK---------------------------------------------------------------------
A5KNA4_9FIRM/6-244.......KKWK---------------------------------------------------------------------
A7VHZ7_9CLOT/7-244.......KTWK---------------------------------------------------------------------
A6P0C2_9FIRM/7-247.......KEWR---------------------------------------------------------------------
A6NU92_9FIRM/5-246.......KEWK---------------------------------------------------------------------
A7VEY9_9CLOT/228-465.......RTWK---------------------------------------------------------------------
Q2LU27_SYNAS/194-396.......NEWK---------------------------------------------------------------------
A6NXI0_9FIRM/22-218.......DFAY---------------------------------------------------------------------
A6RSA1_BOTFB/8-281.......NTWA---------------------------------------------------------------------
A6RWE1_BOTFB/15-325.......AMWE---------------------------------------------------------------------
A6S997_BOTFB/48-350GYTNEMTSKWI---------------------------------------------------------------------
A7EWG5_SCLS1/49-355GYTPWMADKWM---------------------------------------------------------------------
A6RWC8_BOTFB/15-290......RTKWH---------------------------------------------------------------------
A6F4K8_9ALTE/17-284.......GDFT---------------------------------------------------------------------
A1U270_MARAV/19-286.......GAFT---------------------------------------------------------------------
A3J9P7_9ALTE/19-286.......GEFV---------------------------------------------------------------------
Q1N2M0_9GAMM/21-286.......GKFK---------------------------------------------------------------------
Q21GI0_SACD2/15-285.......GSFK---------------------------------------------------------------------
A1SY20_PSYIN/16-290.......GEFT---------------------------------------------------------------------
A6Q4S5_NITSB/14-275.......GNFS---------------------------------------------------------------------
Q1NPF7_9DELT/17-289.......DDFV---------------------------------------------------------------------
Q1QYE1_CHRSD/31-310.......GKFT---------------------------------------------------------------------
Q0A4Z7_ALHEH/26-298.......GTFK---------------------------------------------------------------------
A6GSC5_9BURK/17-282.......GDFK---------------------------------------------------------------------
Q2SFT5_HAHCH/19-280.......GKFS---------------------------------------------------------------------
A4A8R3_9GAMM/16-277.......GDFK---------------------------------------------------------------------
A3WME7_9GAMM/21-284.......GTFH---------------------------------------------------------------------
Q5QYT8_IDILO/18-278.......GSFT---------------------------------------------------------------------
A6FM81_9RHOB/18-271.......GTLE---------------------------------------------------------------------
A6DW96_9RHOB/16-269.......GQID---------------------------------------------------------------------
A3TW22_9RHOB/18-271.......GRLD---------------------------------------------------------------------
A3K2K5_9RHOB/17-270.......GDIR---------------------------------------------------------------------
Q0FIK0_9RHOB/23-278.......GDFE---------------------------------------------------------------------
Q0AQY0_MARMM/8-327PLAAPLPGWMR---------------------------------------------------------------------
Q2L5I9_CLOPF/180-403.......GKWK---------------------------------------------------------------------

PF04262

GSH1_PSEAE/6-381-------IARY---------------------------------------------------------------------
Q9RDU4_PSESP/6-381-------IAWY---------------------------------------------------------------------
GSH1_ECOLI/6-381-------LAQY---------------------------------------------------------------------
GSH1_CLOAB/6-390-------VAQF---------------------------------------------------------------------
GSH1_BUCAI/6-382-------IAQY---------------------------------------------------------------------
GSHAB_PASMU/1-337-------VAQL---------------------------------------------------------------------
GSH1_VIBCH/5-379-------LAQY---------------------------------------------------------------------

PF14395

B7DSA7_9BACL/212-472-------.RRL---------------------------------------------------------------------
C0ZEZ5_BREBN/171-428-------LHQH---------------------------------------------------------------------
B0TB99_HELMI/204-455-------....---------------------------------------------------------------------
C6CUQ2_PAESJ/144-402-------..MY---------------------------------------------------------------------
D3E8P9_GEOS4/163-421-------..IY---------------------------------------------------------------------
Q0AXS0_SYNWW/193-453-------..QR---------------------------------------------------------------------
B0TBC1_HELMI/214-474-------.DDL---------------------------------------------------------------------
B0TET0_HELMI/208-468-------.KIF---------------------------------------------------------------------

PF09899

A3HSI4_9BACT/278-1112EGLDKPIGFSV---------------------------------------------------------------------
Q1B9K6_MYCSS/283-1101TSVTEPAAFVL---------------------------------------------------------------------
Q4ZYW4_PSEU2/275-1090QGLDKMIGQVL---------------------------------------------------------------------
A0L4M6_MAGSM/274-1111HGLQNPVGYVL---------------------------------------------------------------------
Q2W952_MAGSA/302-1132RGLGTPTGYVL---------------------------------------------------------------------
Q11VA3_CYTH3/275-1141KGLETPAGFVL---------------------------------------------------------------------
A2VKS3_MYCTU/329-1149EAITSPAAYVL---------------------------------------------------------------------
A0NMX9_9RHOB/275-1105RGLTEPAGHVL---------------------------------------------------------------------
A4XQ07_PSEMY/275-1095QGLDAVVGHVL---------------------------------------------------------------------
A9W7N2_METEP/297-1111RGLDKPVGYVL---------------------------------------------------------------------
Q47BP1_DECAR/275-1115QGMTYTVGHVL---------------------------------------------------------------------
Q2SNA7_HAHCH/275-1090MGLNQAVGYCL---------------------------------------------------------------------
Q31N62_SYNE7/1-727.........LL---------------------------------------------------------------------
A8LRF2_DINSH/275-1107RGLTEPSGYVL---------------------------------------------------------------------
Q1MBT5_RHIL3/277-1103RGLTVATGYIL---------------------------------------------------------------------
Q89QZ5_BRAJA/275-1084QGLNTPRGFVL---------------------------------------------------------------------
Q1YG30_MOBAS/275-1127RGLSKPTGYVL---------------------------------------------------------------------
A3VDN8_9RHOB/278-1112RGLDQPVGYVL---------------------------------------------------------------------
A6C0B7_9PLAN/274-1115RGLGAPVGCML---------------------------------------------------------------------
A3XIL1_LEEBM/275-1116QGLDKKIGHVM---------------------------------------------------------------------
A3PN00_RHOS1/275-1102RGLTEPSGFVL---------------------------------------------------------------------
A1U538_MARAV/275-1097RGLDEPVGYVL---------------------------------------------------------------------
A1VL54_POLNA/295-1117TGLGQVVGYVL---------------------------------------------------------------------
Q21G23_SACD2/275-1112KGIDKPTGFVL---------------------------------------------------------------------
A6GT43_9BURK/286-1103QGLTEEVGYCL---------------------------------------------------------------------
Q7UKP5_RHOBA/275-1113AGLGSPVGYVL---------------------------------------------------------------------
A4TX61_9PROT/275-1111HGLGNPVGHVL---------------------------------------------------------------------
B0SXH9_CAUSK/275-1086DGLTRPRGYVL---------------------------------------------------------------------
Q2RR87_RHORT/275-1085RGLDKLVGYVL---------------------------------------------------------------------
A1K5W6_AZOSB/275-1124QGLTKIAGHVL---------------------------------------------------------------------
Q1ND53_9SPHN/280-1118RGLDKPVGYVL---------------------------------------------------------------------
Q218C6_RHOPB/275-1085QGLNVPKGYVL---------------------------------------------------------------------
A5VFM9_SPHWW/295-1120RGLGSPVGYVL---------------------------------------------------------------------
Q98HG6_RHILO/275-1114RGLTKPSGYVL---------------------------------------------------------------------
C0AE57_9BACT/275-1117KELGEVVGYAL---------------------------------------------------------------------
B0UHH5_METS4/274-1075RGLTEPVGYVL---------------------------------------------------------------------
C1DJA3_AZOVD/275-1116QGLEHAVGHVL---------------------------------------------------------------------
A3YWY7_9SYNE/14-726...AVPLSHST---------------------------------------------------------------------
A6VTZ0_MARMS/275-1113RGLSTTTGFVL---------------------------------------------------------------------
Q07VI7_RHOP5/275-1098RGLGRPSGYVL---------------------------------------------------------------------

PF03136

PAFA_CORGL/10-445-------HENY.....................................................................
Q7UWL2_RHOBA/26-608-------QENYETDVASGFGLLVYRLAICFVWALQIICVLMSFPIVVAIVFASLIQHSVRQARSIVYRRGGRFDTQLNTT
A6G895_9DELT/3-562-------QENYEAEVAQGAQLWLYRLALAAWLPVVFVTGVPTLAVVFALVGLILALAVIGL................VLG
Q7WZ91_9ACTO/5-426-------HENY.....................................................................
PAFA_KINRD/3-425-------HENY.....................................................................
A3TL35_9MICO/3-425-------HENF.....................................................................
PAFA_MYCS2/3-424-------HENY.....................................................................
PAFA_ARTS2/3-425-------HENY.....................................................................
PAFA_CORDI/11-437-------HENY.....................................................................
PAFA_CORJK/6-436-------HENY.....................................................................
PAFA_BIFLO/27-456-------HENY.....................................................................
A3EPC1_9BACT/3-425-------HENY.....................................................................
Q828J1_STRAW/4-459-------HENY.....................................................................
A8LH56_FRASN/73-531-------HENY.....................................................................
Q47NY8_THEFY/10-466-------HENY.....................................................................
A0LU48_ACIC1/2-458-------HENY.....................................................................
A1SK11_NOCSJ/4-459-------HENY.....................................................................
A6W968_KINRD/4-497-------HENY.....................................................................
Q5YUX0_NOCFA/2-457-------HENY.....................................................................
A4FBX9_SACEN/2-456-------HENY.....................................................................
A1R6Q5_ARTAT/19-506-------HENY.....................................................................
Q8NQD9_CORGL/2-460-------HENY.....................................................................
Q8FTE4_COREF/2-463-------HENY.....................................................................
Q6NH93_CORDI/2-457-------HENY.....................................................................
Q4JVP6_CORJK/4-450-------HENY.....................................................................
A7BC88_9ACTO/4-485-------HENY.....................................................................
Q8G3G5_BIFLO/4-488-------HENY.....................................................................
A7A4U7_BIFAD/16-491-------HENY.....................................................................
A3EPC5_9BACT/10-458-------HENY.....................................................................
A3ETM5_9BACT/5-463-------HENY.....................................................................
A3ETM1_9BACT/26-469-------HENY.....................................................................

PF00217

KTRC_SCHMA/141-382-------GTYY---------------------------------------------------------------------
Q7PYN5_ANOGA/203-445-------GELH---------------------------------------------------------------------
Q4AED1_9ANNE/113-361-------GQYY---------------------------------------------------------------------
Q4AED2_9ANNE/113-360-------GQYY---------------------------------------------------------------------
KCRB_HUMAN/120-367-------GRYY---------------------------------------------------------------------
Q1Q1E9_9BACT/18-252-------LSYI---------------------------------------------------------------------
KARG_LIMPO/114-356-------GTYY---------------------------------------------------------------------
A3DGD2_CLOTH/9-244-------FRFI---------------------------------------------------------------------
Q9VST4_DROME/143-385-------GKYM---------------------------------------------------------------------
Q4AEC5_9ANNE/149-396-------GKYY---------------------------------------------------------------------
Q9NKV5_OCTVU/106-347-------GNYY---------------------------------------------------------------------
Y120_BACSK/19-255-------AEML---------------------------------------------------------------------
KARG_LIOJA/108-349-------GKYY---------------------------------------------------------------------
A6QBA0_SULNB/100-342-------GKYY---------------------------------------------------------------------
Q8MWR8_9BIVA/125-367-------GTYY---------------------------------------------------------------------
A3ZT72_9PLAN/20-254-------LAYM---------------------------------------------------------------------
A7XZJ5_GLYDO/114-356-------GTYY---------------------------------------------------------------------
Q6XLN0_HETGL/163-406-------GTYY---------------------------------------------------------------------
Q4AEC8_RIFPA/122-369-------GTYY---------------------------------------------------------------------
Q177S3_AEDAE/202-445-------GEFH---------------------------------------------------------------------
A6XH18_9METZ/115-362-------GKYY---------------------------------------------------------------------
A6CSY9_9BACI/19-254-------LEFL---------------------------------------------------------------------
KCRF_STRPU/908-1155-------GKYY---------------------------------------------------------------------
Q5TP29_ANOGA/189-444-------GTYY---------------------------------------------------------------------
Y282_PELTS/19-256-------LELS---------------------------------------------------------------------
Y860_HALOH/19-252-------LHYI---------------------------------------------------------------------
Q2B1J8_9BACI/19-255-------LELL---------------------------------------------------------------------
Q1HBJ2_BRABE/114-362-------GKYY---------------------------------------------------------------------
KARG_HALMK/111-353-------GKYF---------------------------------------------------------------------
A6XH11_9METZ/115-365-------GQYY---------------------------------------------------------------------
Y102_BACHD/19-254-------FELL---------------------------------------------------------------------
Q6F4H6_HEDDI/131-378-------GKYF---------------------------------------------------------------------
A6XH14_CLAPR/119-361-------GTFY---------------------------------------------------------------------
Q760P7_ANABR/106-348-------GKYY---------------------------------------------------------------------
A4F2K7_9CUCU/128-370-------GTYY---------------------------------------------------------------------
A6F800_9GAMM/114-356-------GNYY---------------------------------------------------------------------
Y077_GEOTN/19-255-------FELL---------------------------------------------------------------------
KCRS_RAT/154-401-------GRYY---------------------------------------------------------------------
KARG2_CAEEL/117-359-------GTYY---------------------------------------------------------------------
Q6BDZ3_9BILA/120-367-------GKYY---------------------------------------------------------------------
Q67ER6_CHAVR/889-1136-------GKYY---------------------------------------------------------------------
O45011_CAEEL/156-398-------GKYY---------------------------------------------------------------------
Q6BDZ2_POLMI/114-361-------GKYY---------------------------------------------------------------------
Q6RSH2_TETAR/120-367-------GKYY---------------------------------------------------------------------
Q8T6T7_URECA/107-354-------GTYY---------------------------------------------------------------------
KCRF_STRPU/161-408-------GTYY---------------------------------------------------------------------
A7RNR3_NEMVE/152-399-------GKYY---------------------------------------------------------------------
A7S6V8_NEMVE/867-1114-------GKYY---------------------------------------------------------------------
Q7T1J2_CHAAC/120-367-------GKYY---------------------------------------------------------------------
A6XH13_9METZ/149-396-------GVYY---------------------------------------------------------------------
Q67ER6_CHAVR/504-751-------GKYY---------------------------------------------------------------------
Y092_OCEIH/19-255-------LQYV---------------------------------------------------------------------
Q4AED0_SIPCU/113-355-------GQYY---------------------------------------------------------------------
A0D308_PARTE/131-376-------GNYY---------------------------------------------------------------------
Y701_CHLPN/18-250-------FIVL---------------------------------------------------------------------
Y194_CLOK5/10-245-------FKSN---------------------------------------------------------------------
Q7UMV3_RHOBA/22-257-------IPYV---------------------------------------------------------------------
Q6APG0_DESPS/133-375-------GEYH---------------------------------------------------------------------
Q9NKV6_9MOLL/108-349-------GTYF---------------------------------------------------------------------
Y070_BACP2/19-254-------FVLI---------------------------------------------------------------------
Q3A9N0_CARHZ/16-253-------TEFF---------------------------------------------------------------------
KCRF_STRPU/534-781-------GKYY---------------------------------------------------------------------
Q5L768_CHLAB/18-250-------FLVL---------------------------------------------------------------------
Q760P6_CRAGI/107-349-------GKYY---------------------------------------------------------------------
A7RGZ5_NEMVE/118-356-------GKYY---------------------------------------------------------------------
A1HTJ5_9FIRM/19-255-------YLFI---------------------------------------------------------------------
B1YGS1_EXIS2/18-248-------FQFG---------------------------------------------------------------------
Y110_BACA2/19-254-------FHLI---------------------------------------------------------------------
Y2442_CLOPE/7-240-------CYVV---------------------------------------------------------------------
Q4W3A2_SUBDO/130-379-------GDFF---------------------------------------------------------------------
Y3134_SYMTH/19-256-------VELY---------------------------------------------------------------------
Q9BKE8_CIOIN/114-361-------GKYY---------------------------------------------------------------------
Y2328_THETN/3-239-------FTEY---------------------------------------------------------------------
A6M9J4_LOCMI/114-356-------GQFY---------------------------------------------------------------------
Y2368_SYNWW/20-257-------MELV---------------------------------------------------------------------
A8MLV0_ALKOO/9-245-------FELI---------------------------------------------------------------------
B8G1T2_DESHD/17-252-------LTYY---------------------------------------------------------------------
Q73L28_TREDE/13-247-------FKKL---------------------------------------------------------------------
Q4MIA1_BACCE/19-254-------FELL---------------------------------------------------------------------
Q4AEC6_9ANNE/106-353-------GKYY---------------------------------------------------------------------
A5I7N7_CLOBH/9-243-------FKTI---------------------------------------------------------------------
Q67E02_GLOPY/117-364-------GKYY---------------------------------------------------------------------
Y3260_BACLD/19-254-------FELV---------------------------------------------------------------------
Y3190_CLOAB/9-244-------FTCI---------------------------------------------------------------------
A7YVI5_TOXCA/157-399-------GTYY---------------------------------------------------------------------
Y161_MOOTA/16-253-------LKLQ---------------------------------------------------------------------
A6XH19_9METZ/153-400-------GKYY---------------------------------------------------------------------
Y046_CHLMU/17-249-------FFVL---------------------------------------------------------------------
Y1086_CLONN/9-244-------LKSN---------------------------------------------------------------------
Q9XZF5_CHAVR/108-356-------GKYY---------------------------------------------------------------------
KLOM_EISFO/108-355-------GVYY---------------------------------------------------------------------
Q67ER6_CHAVR/136-383-------GTYY---------------------------------------------------------------------
Q38EV2_TRYB2/136-378-------GTYY---------------------------------------------------------------------
A7RQU9_NEMVE/116-364-------GKYY---------------------------------------------------------------------
Y2634_CLOTE/8-241-------YKVY---------------------------------------------------------------------
Q14TA8_9CNID/153-400-------GKYY---------------------------------------------------------------------
Q296Q2_DROPS/207-449-------GSYL---------------------------------------------------------------------
A7S6V8_NEMVE/487-734-------GKYY---------------------------------------------------------------------
A0DI85_PARTE/130-381-------GKYH---------------------------------------------------------------------
Q291M9_DROPS/185-440-------GNYY---------------------------------------------------------------------
A3IET5_9BACI/18-253-------YAYF---------------------------------------------------------------------
Q9BLC7_APLKU/109-351-------GTYH---------------------------------------------------------------------
KARG_STIJA/110-358-------GKYY---------------------------------------------------------------------
KCRM_TORMA/120-367-------GKYY---------------------------------------------------------------------
A6XH09_9METZ/111-359-------GKYY---------------------------------------------------------------------
Y179_DESRM/19-256-------LELS---------------------------------------------------------------------
Q8N0P4_9BIVA/478-719-------GTYF---------------------------------------------------------------------
A7S6L6_NEMVE/110-357-------GRYY---------------------------------------------------------------------
A7RER2_NEMVE/138-389-------GNLY---------------------------------------------------------------------
Q4AEC7_RIFPA/105-352-------GKYY---------------------------------------------------------------------
Q75ZZ3_LAMJA/120-367-------GTYY---------------------------------------------------------------------
Q17MS1_AEDAE/186-440-------GTYY---------------------------------------------------------------------
A6TWL7_ALKMQ/9-245-------LMLL---------------------------------------------------------------------
Q1DA50_MYXXD/88-329-------GKYH---------------------------------------------------------------------
Y164_STAEQ/16-244-------LTLN---------------------------------------------------------------------

PF03074

GSH1_YEAST/253-647------------------------------------------------ENDKAP-LDYDLAKHFAHLYIRDPVSTFEE--
GSH1_HUMAN/236-610------------------------------------------------QEG...-IDHLLAQHVAHLFIRDPLTLFEE--
GSH1_ONCVO/243-613------------------------------------------------DGG...-IDDLLAQHIAHMFIRDPLQVFRE--
GSH1_MOUSE/236-610------------------------------------------------EEG...-IDHLLAQHVAHLFIRDPLTLFEE--
GSH1_RAT/236-610------------------------------------------------EEG...-IDHLLAQHVAHLFIRDPLTLFEE--
GSH1_SCHPO/299-657------------------------------------------------KDC...-IDERLAKHMAHIFSRDPLVIFSD--
O77252_TRYCR/321-672------------------------------------------------DAG...-VDTRLAKHVAHLFIRDPLVVYDQ--
Q26820_9TRYP/306-657------------------------------------------------REG...-VDSRLATHIAHLFIRDPLVIYDQ--
GSH1_CAEEL/241-614------------------------------------------------DGN...-IDEPLAKHIAHMFIRDPHQVFRE--
P90557_LEITA/314-665------------------------------------------------DSG...-VDVRLATHIAHLFIRDPLVIYDK--

PF04107

CAAL_HALSA/15-298------------------------------------------------AGL-------------------HPGARWRE--
CAAL_PSEAE/12-290------------------------------------------------VGT-------------------HPFADWRR--
Q9RD01_STRCO/37-342------------------------------------------------LGH-------------------DP.WHPPR--
Y2307_ARCFU/12-285------------------------------------------------LGM-------------------HP.LLRLE--
P74515_SYNY3/5-287------------------------------------------------IPG-------------------SCLALGGT--
CAAL_ECOLI/14-292------------------------------------------------GGT-------------------HPFQKWQR--
GSHA_MYCTU/46-355------------------------------------------------LGA-------------------DP..LRSP--
Q9RH09_ZYMMB/53-361------------------------------------------------LGL-------------------WPDKKRSD--
CAAL_STRCO/4-283------------------------------------------------LAT-------------------SP......--
CAAL_MYCBO/20-297------------------------------------------------AGT-------------------HPFARWSA--
Q9A2Z2_CAUCR/50-358------------------------------------------------LGF-------------------SPKWTRGQ--
Q9JMV4_BRAJP/24-335------------------------------------------------LGM-------------------TPSWSRAD--

PF00120

GLNA_HALVD/117-366------------------------------------------------DLA--------------------P..KD.L--
GLNA_SYNP2/104-382------------------------------------------------PVP--------------------P..TD.T--
GLNA_AZOC5/103-379------------------------------------------------PVP--------------------P..LD.S--
Q9Y9Z7_AERPE/97-368------------------------------------------------MPE--------------------P..PD.S--
GLNA_NOSS1/103-383------------------------------------------------PVS--------------------P..TD.S--
GLNA_SHIFL/102-379------------------------------------------------PVP--------------------P..VD.S--
GLNA_BACCE/105-354------------------------------------------------DLA--------------------P..MD.L--
E7QAF9_YEASB/107-352------------------------------------------------AGK--------------------V.....Y--
O86055_HERSE/104-381------------------------------------------------PVP--------------------P..VD.S--
O33342_MYCTU/121-374------------------------------------------------AIL--------------------A..SS.R--
Q9HYP0_PSEAE/75-331------------------------------------------------SVS--------------------S..NN.G--
GLNA_METJA/115-365------------------------------------------------DVE--------------------P..LD.D--
GLNA_XENLA/110-359------------------------------------------------ADK--------------------V.....Y--
Q97VQ9_SULSO/102-347------------------------------------------------DPS--------------------A...F.Y--
Q977Z8_THEVO/122-372------------------------------------------------DNT--------------------P..LD.S--
GLNA1_MYCTU/105-387------------------------------------------------PVA--------------------P..ND.Q--
GLNA_AGABI/105-350------------------------------------------------TGK--------------------V.....F--
GLNA_PYRAB/96-339------------------------------------------------DIL--------------------T..LD.K--
GLNA_METTH/107-353------------------------------------------------DVE--------------------P..VD.Q--
GLNA_LACLA/106-356------------------------------------------------DLA--------------------P..TD.L--
Q9KZC7_STRCO/124-376------------------------------------------------GAA--------------------R..QV.E--
Q9A3S2_CAUCR/129-384------------------------------------------------SIS--------------------A..VN.E--
GLNA_CLOSA/105-353------------------------------------------------DLA--------------------P..TD.L--
O85177_AMYMD/104-383------------------------------------------------PVP--------------------P..VD.H--
Q98A06_RHILO/120-375------------------------------------------------DYR--------------------G..LM.R--
Q9I3F1_PSEAE/117-372------------------------------------------------GLR--------------------E..LE.Q--
GLNA_THEMA/102-350------------------------------------------------DLL--------------------P..LS.K--
GLNA3_RHILP/97-349------------------------------------------------DQQ--------------------A..VM.R--
GLNA_AZOBR/103-379------------------------------------------------PVA--------------------P..VD.S--
Q9AEL4_CORGT/87-338------------------------------------------------DQA--------------------T..FN.E--
GLNA_SULSO/104-381------------------------------------------------PAP--------------------P..VD.Q--
GLNA2_DROME/116-365------------------------------------------------ANK--------------------V.....Y--
GLNA_AZOVI/100-377------------------------------------------------PVP--------------------P..VD.H--
GLNA_ARCFU/116-402------------------------------------------------RPP--------------------P..ED.T--
GLNA2_FRAAL/84-326------------------------------------------------GSK--------------------M.....P--
Q9K665_BACHD/115-365------------------------------------------------EPS--------------------P..KD.N--
Q9SC91_MEDTR/118-374------------------------------------------------SSS--------------------A..FD.V--
Q986Q4_RHILO/115-369------------------------------------------------SID--------------------E..ID.D--
Q9I6J3_PSEAE/114-370------------------------------------------------SID--------------------A..AN.E--
GLNA_HAEIN/106-383------------------------------------------------AVA--------------------P..ID.S--
O88070_STRCO/130-380------------------------------------------------SVL--------------------G..TG.R--
Q9AMT8_BRAJP/106-360------------------------------------------------GYS--------------------IARSI.A--
GLNA_HELPJ/111-388------------------------------------------------PVP--------------------P..TD.T--
GLNA1_DROME/147-395------------------------------------------------ADR--------------------V.....Y--
O31044_SYNPW/104-383------------------------------------------------PVA--------------------P..ND.T--
Q97FR9_CLOAB/167-449------------------------------------------------FGV--------------------L.K.E.R--
Q98CH5_RHILO/124-382------------------------------------------------SVD--------------------H..LH.G--
GLNA_COLGL/109-354------------------------------------------------TGK--------------------V.....V--
GLNA_STAAW/107-356------------------------------------------------DLA--------------------P..TD.L--
GLNA_LACDE/107-356------------------------------------------------DMA--------------------S..ED.E--
Q9C213_NEUCS/546-806------------------------------------------------SVS--------------------RYFADPK--
Q9U307_CAEEL/115-364------------------------------------------------ANK--------------------V.....Y--
P95692_STRAG/106-359------------------------------------------------TLA--------------------P..TD.L--
GLNA1_STRFL/101-378------------------------------------------------PAP--------------------P..VD.H--
PUUA_ECOLI/133-390------------------------------------------------SVD--------------------N..LN.H--
Q9FAR9_SHEVI/102-379------------------------------------------------PVA--------------------P..VD.S--
GLNA_METMP/110-357------------------------------------------------DLE--------------------P..LD.G--
Q98H15_RHILO/126-382------------------------------------------------QIG--------------------I..TT.K--
GLNA1_ALNGL/103-351------------------------------------------------ADK--------------------A.....W--
Q9RX64_DEIRA/111-359------------------------------------------------DLA--------------------P..ID.R--
Q27747_PARLI/109-358------------------------------------------------ANK--------------------V.....Y--
GLNA_SULAC/107-383------------------------------------------------PAS--------------------P..VD.Q--
Q9RDW7_LACRH/107-356------------------------------------------------DFA--------------------P..LD.M--
Q9A6W3_CAUCR/103-379------------------------------------------------PVN--------------------P..VD.S--
Q9SCP3_ARATH/507-763------------------------------------------------ATS--------------------S..FD.A--
P95529_PSEPU/135-401------------------------------------------------YLL--------------------ENHLD.E--
Q9RDS6_STRCO/104-363------------------------------------------------DHT--------------------P..QN.I--
Q9A3R4_CAUCR/118-375------------------------------------------------GLP--------------------E..LE.A--
GLNA_THIFE/104-378------------------------------------------------PVP--------------------P..VD.S--
GLNA1_RHILV/103-379------------------------------------------------PVP--------------------P..VD.S--
Q9HT65_PSEAE/105-353------------------------------------------------SLQ--------------------A..QR.A--
GLNA2_STRVR/89-333------------------------------------------------ADE--------------------I.....F--
Q98EM0_RHILO/120-375------------------------------------------------DMV--------------------A..LE.E--
GLNA_HALSA/115-364------------------------------------------------DLA--------------------P..KD.L--
Q53045_RHORU/103-379------------------------------------------------PVP--------------------P..VD.S--
GLNA_METCA/102-379------------------------------------------------PVP--------------------P..VD.S--
Q9I275_PSEAE/120-376------------------------------------------------SID--------------------D..LD.E--
GLNA2_MYCTU/106-357------------------------------------------------DQA--------------------V..HD.S--
Q988Z8_RHILO/141-397------------------------------------------------SIA--------------------G..VN.E--
Q97W07_SULSO/106-349------------------------------------------------SLE--------------------G..LL.E--
Q44249_ACISP/140-407------------------------------------------------YLL--------------------EYHLD.Q--
LGSN_HUMAN/181-427------------------------------------------------PAL--------------------TFLNN.H--
GLNA2_HORVU/165-413------------------------------------------------SDK--------------------S.....F--
O07752_MYCTU/111-358------------------------------------------------GVA--------------------G..VL.E--
Q9ZF05_9CYAN/195-477------------------------------------------------FGA--------------------I.P.E.R--
GLNA_NEIGO/105-382------------------------------------------------PVA--------------------P..ID.C--
GLNA2_STRHY/85-330------------------------------------------------ADA--------------------I.....F--
Q9HT51_PSEAE/117-373------------------------------------------------GVY--------------------E..LE.Q--
GLNA_AQUAE/105-379------------------------------------------------PAP--------------------P..VD.K--
Q9PCD9_XYLFA/137-414------------------------------------------------PVP--------------------P..TD.S--
GLNA_RHOCA/103-378------------------------------------------------PVN--------------------P..VD.E--
Q97S86_STRPN/106-358------------------------------------------------DLA--------------------P..TD.L--
O96463_SKECO/151-401------------------------------------------------PEN--------------------S.....F--
GLNA1_FRAAL/104-383------------------------------------------------PVP--------------------P..TD.H--
Q79VE3_CORGL/105-386------------------------------------------------PVA--------------------P..YD.Q--

PF12224

Q311H8_DESDG/19-291------------------------------------------------LEV--------------------------D--
Q2HBV5_CHAGB/10-268------------------------------------------------IIQ--------------------------D--
Q67LG7_SYMTH/9-197------------------------------------------------MAF--------------------------D--
A6G6Z1_9DELT/9-197------------------------------------------------VDP--------------------------R--
Q5LF69_BACFN/74-277------------------------------------------------LTT--------------------------D--
A6KZ00_BACV8/75-278------------------------------------------------LVT--------------------------D--
A7ALF5_9PORP/71-272------------------------------------------------LVT--------------------------D--
A5D072_PELTS/13-222------------------------------------------------LVY--------------------------D--
O86176_DICNO/4-232------------------------------------------------VVG--------------------------D--
Q1DBA6_MYXXD/2-223------------------------------------------------VVS--------------------------D--
B8I7I6_CLOCE/4-236------------------------------------------------IVS--------------------------D--
Q24NQ7_DESHY/4-240------------------------------------------------IMS--------------------------D--
A7VE77_9CLOT/4-240------------------------------------------------FMS--------------------------D--
A5N406_CLOK5/4-240------------------------------------------------FMS--------------------------D--
Q252G7_DESHY/4-240------------------------------------------------VMS--------------------------D--
A3DFX9_CLOTH/2-240------------------------------------------------FMS--------------------------D--
B0K6R6_THEPX/2-240------------------------------------------------FMY--------------------------D--
A3DG69_CLOTH/7-247------------------------------------------------LMY--------------------------D--
A7B449_RUMGN/13-255------------------------------------------------FQR--------------------------D--
A5KNA4_9FIRM/6-244------------------------------------------------FMY--------------------------D--
A7VHZ7_9CLOT/7-244------------------------------------------------FSR--------------------------D--
A6P0C2_9FIRM/7-247------------------------------------------------LMS--------------------------D--
A6NU92_9FIRM/5-246------------------------------------------------FMF--------------------------D--
A7VEY9_9CLOT/228-465------------------------------------------------IVR--------------------------D--
Q2LU27_SYNAS/194-396------------------------------------------------IVP--------------------------D--
A6NXI0_9FIRM/22-218------------------------------------------------IKH--------------------------D--
A6RSA1_BOTFB/8-281------------------------------------------------LGS--------------------------D--
A6RWE1_BOTFB/15-325------------------------------------------------VTA--------------------------D--
A6S997_BOTFB/48-350------------------------------------------------IGT--------------------------D--
A7EWG5_SCLS1/49-355------------------------------------------------VGT--------------------------D--
A6RWC8_BOTFB/15-290------------------------------------------------LKS--------------------------D--
A6F4K8_9ALTE/17-284------------------------------------------------IEL--------------------------D--
A1U270_MARAV/19-286------------------------------------------------IEL--------------------------D--
A3J9P7_9ALTE/19-286------------------------------------------------IEL--------------------------D--
Q1N2M0_9GAMM/21-286------------------------------------------------LEL--------------------------D--
Q21GI0_SACD2/15-285------------------------------------------------LEL--------------------------D--
A1SY20_PSYIN/16-290------------------------------------------------LEL--------------------------D--
A6Q4S5_NITSB/14-275------------------------------------------------IYL--------------------------D--
Q1NPF7_9DELT/17-289------------------------------------------------IEL--------------------------D--
Q1QYE1_CHRSD/31-310------------------------------------------------IEL--------------------------D--
Q0A4Z7_ALHEH/26-298------------------------------------------------VEV--------------------------D--
A6GSC5_9BURK/17-282------------------------------------------------IEL--------------------------D--
Q2SFT5_HAHCH/19-280------------------------------------------------VEV--------------------------D--
A4A8R3_9GAMM/16-277------------------------------------------------VEI--------------------------D--
A3WME7_9GAMM/21-284------------------------------------------------IEL--------------------------D--
Q5QYT8_IDILO/18-278------------------------------------------------VEI--------------------------D--
A6FM81_9RHOB/18-271------------------------------------------------VYL--------------------------D--
A6DW96_9RHOB/16-269------------------------------------------------IYL--------------------------D--
A3TW22_9RHOB/18-271------------------------------------------------IYL--------------------------D--
A3K2K5_9RHOB/17-270------------------------------------------------VEL--------------------------D--
Q0FIK0_9RHOB/23-278------------------------------------------------CYL--------------------------D--
Q0AQY0_MARMM/8-327------------------------------------------------ILS--------------------------D--
Q2L5I9_CLOPF/180-403------------------------------------------------LER--------------------------D--

PF04262

GSH1_PSEAE/6-381------------------------------------------------GSS--------------------------M--
Q9RDU4_PSESP/6-381------------------------------------------------GPS--------------------------N--
GSH1_ECOLI/6-381------------------------------------------------GTS--------------------------N--
GSH1_CLOAB/6-390------------------------------------------------PDT--------------------------E--
GSH1_BUCAI/6-382------------------------------------------------GKS--------------------------N--
GSHAB_PASMU/1-337------------------------------------------------DNP--------------------------E--
GSH1_VIBCH/5-379------------------------------------------------GSS--------------------------N--

PF14395

B7DSA7_9BACL/212-472------------------------------------------------PLM--------------------------E--
C0ZEZ5_BREBN/171-428------------------------------------------------PVA--------------------------E--
B0TB99_HELMI/204-455------------------------------------------------.IA--------------------------E--
C6CUQ2_PAESJ/144-402------------------------------------------------PVA--------------------------E--
D3E8P9_GEOS4/163-421------------------------------------------------PIA--------------------------E--
Q0AXS0_SYNWW/193-453------------------------------------------------PVA--------------------------E--
B0TBC1_HELMI/214-474------------------------------------------------PLA--------------------------E--
B0TET0_HELMI/208-468------------------------------------------------PLA--------------------------E--

PF09899

A3HSI4_9BACT/278-1112------------------------------------------------PLEWEY.VEDR......WQSCYWKFR.RND--
Q1B9K6_MYCSS/283-1101------------------------------------------------PLHRRD.DDSA......WASADWRLR.RGR--
Q4ZYW4_PSEU2/275-1090------------------------------------------------PLARNA.DGDS......WQSGRWYLR.DEH--
A0L4M6_MAGSM/274-1111------------------------------------------------PMAWNA.YDQR......WDSCKWSFR.REH--
Q2W952_MAGSA/302-1132------------------------------------------------PLQPWQ.AKDKFR....WITGPWPTR.DGK--
Q11VA3_CYTH3/275-1141------------------------------------------------PLEWSH.SKNS......WKSGKWRMK.REE--
A2VKS3_MYCTU/329-1149------------------------------------------------PLHRRD.DGQG......WASANWRLR.RGR--
A0NMX9_9RHOB/275-1105------------------------------------------------PIQRWQ.SKASGHR...WRSERWKLR.RDA--
A4XQ07_PSEMY/275-1095------------------------------------------------PLARQV.VGEG......WQSGRWFLR.DEH--
A9W7N2_METEP/297-1111------------------------------------------------PLANLA.AGEGRV....WISETWKFR.RGG--
Q47BP1_DECAR/275-1115------------------------------------------------PIMKNV.WNE.......WQTGPWFLR.AER--
Q2SNA7_HAHCH/275-1090------------------------------------------------PIGLNQ.VTGV......WRTCLWRFL.QGA--
Q31N62_SYNE7/1-727------------------------------------------------PIRRAD.QPA.......WATCAWIAPESAN--
A8LRF2_DINSH/275-1107------------------------------------------------PVQRWQ.AKAGAG....WRSERWSLR.RGK--
Q1MBT5_RHIL3/277-1103------------------------------------------------PVQAWN.AKAAESRV..WVSEKWRTR.RGK--
Q89QZ5_BRAJA/275-1084------------------------------------------------PVQRWN.APPR......WRSERWTLR.RNH--
Q1YG30_MOBAS/275-1127------------------------------------------------PVQAWQ.GRGERALR..WQSERWTTR.RGH--
A3VDN8_9RHOB/278-1112------------------------------------------------PIQRWQ.TKATGAR...WLSEVWKTR.RGK--
A6C0B7_9PLAN/274-1115------------------------------------------------PLMHQW.WNAKPR....WMSGTWPVR.SEQ--
A3XIL1_LEEBM/275-1116------------------------------------------------PLANIQ.GK........WVTSPWRFR.RNH--
A3PN00_RHOS1/275-1102------------------------------------------------PVQRWQ.AQAPRPR...WRSERWRLR.RRH--
A1U538_MARAV/275-1097------------------------------------------------PLRVSE.KEKA......WETGPWFLR.SER--
A1VL54_POLNA/295-1117------------------------------------------------PLKPKD.LDPNIALGTAWRTSPWPLK.RDH--
Q21G23_SACD2/275-1112------------------------------------------------PLAKDL.ANN.......WISSKWPMR.RER--
A6GT43_9BURK/286-1103------------------------------------------------PIQSTK.GQ........WRTGQWFLR.DER--
Q7UKP5_RHOBA/275-1113------------------------------------------------PVRRAW.WQARPG....WISGRWPVR.SER--
A4TX61_9PROT/275-1111------------------------------------------------PLQPWQ.AKDGNR....WISGAWPTR.DGR--
B0SXH9_CAUSK/275-1086------------------------------------------------PIRRWRTGQDSG.....WMTQAWSLR.RGR--
Q2RR87_RHORT/275-1085------------------------------------------------PVQRQTPPKGAAA....WKSEVWRFR.QEH--
A1K5W6_AZOSB/275-1124------------------------------------------------PIARNP.ANDA......WQTGPWFLR.SER--
Q1ND53_9SPHN/280-1118------------------------------------------------PVQRWQ.SQAATPR...WQSEIWQLR.RGK--
Q218C6_RHOPB/275-1085------------------------------------------------PIQRWN.AEADR.....WRSERWKFR.RGN--
A5VFM9_SPHWW/295-1120------------------------------------------------PIQRWN.ARQAATPGR.WRSERWSLR.RGK--
Q98HG6_RHILO/275-1114------------------------------------------------PVQRWN.SQASGPR...WRSEKWKTR.RGR--
C0AE57_9BACT/275-1117------------------------------------------------PIKRIS.EDAGGGHAG.WMSGPWFLRDDDT--
B0UHH5_METS4/274-1075------------------------------------------------PLASVQ.AGAGRV....WVSEKWQTR.RGA--
C1DJA3_AZOVD/275-1116------------------------------------------------PLMRSL.DGSH......WLTGAWFLR.DEY--
A3YWY7_9SYNE/14-726------------------------------------------------PTEEEP.DLPEG.....WQAARWPLA.KPL--
A6VTZ0_MARMS/275-1113------------------------------------------------PLEFDT.VNNR......WNSSLWPMR.SDV--
Q07VI7_RHOP5/275-1098------------------------------------------------PIQRWN.AAPAR.....WKSERWRFR.RER--

PF03136

PAFA_CORGL/10-445................................................LVG--------------------------R--
Q7UWL2_RHOBA/26-608DQDNDLQWHDHPDTSDSEETFVALPSWFQWLSIACLRMLHLPLVLSLRVIG--------------------------T--
A6G895_9DELT/3-562GLLSWIFPRLEPAFDRLHAMFATVFALVERGGAGIGIVGTFVGMAGFALIV--------------------------R--
Q7WZ91_9ACTO/5-426................................................CVG--------------------------R--
PAFA_KINRD/3-425................................................LVS--------------------------R--
A3TL35_9MICO/3-425................................................LVG--------------------------R--
PAFA_MYCS2/3-424................................................LIV--------------------------R--
PAFA_ARTS2/3-425................................................LIP--------------------------R--
PAFA_CORDI/11-437................................................LVS--------------------------R--
PAFA_CORJK/6-436................................................LVS--------------------------R--
PAFA_BIFLO/27-456................................................LVR--------------------------R--
A3EPC1_9BACT/3-425................................................LID--------------------------R--
Q828J1_STRAW/4-459................................................LMK--------------------------R--
A8LH56_FRASN/73-531................................................LMA--------------------------R--
Q47NY8_THEFY/10-466................................................LMR--------------------------R--
A0LU48_ACIC1/2-458................................................LMN--------------------------R--
A1SK11_NOCSJ/4-459................................................LMR--------------------------R--
A6W968_KINRD/4-497................................................LMN--------------------------R--
Q5YUX0_NOCFA/2-457................................................LMN--------------------------R--
A4FBX9_SACEN/2-456................................................LMA--------------------------R--
A1R6Q5_ARTAT/19-506................................................LMP--------------------------R--
Q8NQD9_CORGL/2-460................................................LYS--------------------------R--
Q8FTE4_COREF/2-463................................................RYR--------------------------R--
Q6NH93_CORDI/2-457................................................LYN--------------------------R--
Q4JVP6_CORJK/4-450................................................LYP--------------------------R--
A7BC88_9ACTO/4-485................................................QMP--------------------------R--
Q8G3G5_BIFLO/4-488................................................MMA--------------------------R--
A7A4U7_BIFAD/16-491................................................MML--------------------------R--
A3EPC5_9BACT/10-458................................................LLP--------------------------R--
A3ETM5_9BACT/5-463................................................LLP--------------------------R--
A3ETM1_9BACT/26-469................................................LVS--------------------------R--

PF00217

KTRC_SCHMA/141-382------------------------------------------------PLT--------------------------G..
Q7PYN5_ANOGA/203-445------------------------------------------------LLA--------------------------A..
Q4AED1_9ANNE/113-361------------------------------------------------PLT--------------------------K..
Q4AED2_9ANNE/113-360------------------------------------------------PLQ--------------------------S..
KCRB_HUMAN/120-367------------------------------------------------ALK--------------------------S..
Q1Q1E9_9BACT/18-252------------------------------------------------NLS--------------------------E..
KARG_LIMPO/114-356------------------------------------------------PLT--------------------------G..
A3DGD2_CLOTH/9-244------------------------------------------------DIH--------------------------E..
Q9VST4_DROME/143-385------------------------------------------------PLT--------------------------G..
Q4AEC5_9ANNE/149-396------------------------------------------------ALK--------------------------S..
Q9NKV5_OCTVU/106-347------------------------------------------------PLS--------------------------T..
Y120_BACSK/19-255------------------------------------------------AME--------------------------D..
KARG_LIOJA/108-349------------------------------------------------PLE--------------------------G..
A6QBA0_SULNB/100-342------------------------------------------------PLL--------------------------G..
Q8MWR8_9BIVA/125-367------------------------------------------------PLR--------------------------G..
A3ZT72_9PLAN/20-254------------------------------------------------RVD--------------------------E..
A7XZJ5_GLYDO/114-356------------------------------------------------PLD--------------------------G..
Q6XLN0_HETGL/163-406------------------------------------------------PLE--------------------------G..
Q4AEC8_RIFPA/122-369------------------------------------------------SLV--------------------------T..
Q177S3_AEDAE/202-445------------------------------------------------PLE--------------------------T..
A6XH18_9METZ/115-362------------------------------------------------PLS--------------------------S..
A6CSY9_9BACI/19-254------------------------------------------------KMS--------------------------E..
KCRF_STRPU/908-1155------------------------------------------------PLT--------------------------G..
Q5TP29_ANOGA/189-444------------------------------------------------SMN--------------------------E..
Y282_PELTS/19-256------------------------------------------------SLG--------------------------E..
Y860_HALOH/19-252------------------------------------------------KMD--------------------------D..
Q2B1J8_9BACI/19-255------------------------------------------------EMG--------------------------S..
Q1HBJ2_BRABE/114-362------------------------------------------------PLS--------------------------G..
KARG_HALMK/111-353------------------------------------------------PLE--------------------------G..
A6XH11_9METZ/115-365------------------------------------------------SLT--------------------------PGH
Y102_BACHD/19-254------------------------------------------------CMD--------------------------D..
Q6F4H6_HEDDI/131-378------------------------------------------------PLT--------------------------T..
A6XH14_CLAPR/119-361------------------------------------------------PLE--------------------------G..
Q760P7_ANABR/106-348------------------------------------------------SLE--------------------------K..
A4F2K7_9CUCU/128-370------------------------------------------------PLE--------------------------N..
A6F800_9GAMM/114-356------------------------------------------------TLS--------------------------D..
Y077_GEOTN/19-255------------------------------------------------KMS--------------------------E..
KCRS_RAT/154-401------------------------------------------------KLS--------------------------E..
KARG2_CAEEL/117-359------------------------------------------------PLT--------------------------G..
Q6BDZ3_9BILA/120-367------------------------------------------------PLS--------------------------K..
Q67ER6_CHAVR/889-1136------------------------------------------------PLG--------------------------G..
O45011_CAEEL/156-398------------------------------------------------PLD--------------------------G..
Q6BDZ2_POLMI/114-361------------------------------------------------PLA--------------------------G..
Q6RSH2_TETAR/120-367------------------------------------------------PLG--------------------------K..
Q8T6T7_URECA/107-354------------------------------------------------PLS--------------------------K..
KCRF_STRPU/161-408------------------------------------------------PLT--------------------------G..
A7RNR3_NEMVE/152-399------------------------------------------------PLN--------------------------G..
A7S6V8_NEMVE/867-1114------------------------------------------------PLS--------------------------K..
Q7T1J2_CHAAC/120-367------------------------------------------------PLK--------------------------S..
A6XH13_9METZ/149-396------------------------------------------------PLN--------------------------R..
Q67ER6_CHAVR/504-751------------------------------------------------PLG--------------------------D..
Y092_OCEIH/19-255------------------------------------------------PLT--------------------------D..
Q4AED0_SIPCU/113-355------------------------------------------------SLE--------------------------G..
A0D308_PARTE/131-376------------------------------------------------SLT--------------------------PGH
Y701_CHLPN/18-250------------------------------------------------PLK--------------------------D..
Y194_CLOK5/10-245------------------------------------------------YLW--------------------------D..
Q7UMV3_RHOBA/22-257------------------------------------------------DIA--------------------------T..
Q6APG0_DESPS/133-375------------------------------------------------SFE--------------------------L..
Q9NKV6_9MOLL/108-349------------------------------------------------PLQ--------------------------G..
Y070_BACP2/19-254------------------------------------------------RMN--------------------------E..
Q3A9N0_CARHZ/16-253------------------------------------------------KLV--------------------------T..
KCRF_STRPU/534-781------------------------------------------------PLE--------------------------G..
Q5L768_CHLAB/18-250------------------------------------------------PLK--------------------------D..
Q760P6_CRAGI/107-349------------------------------------------------SLE--------------------------T..
A7RGZ5_NEMVE/118-356------------------------------------------------PLT--------------------------G..
A1HTJ5_9FIRM/19-255------------------------------------------------EME--------------------------K..
B1YGS1_EXIS2/18-248------------------------------------------------RVD--------------------------Q..
Y110_BACA2/19-254------------------------------------------------RMS--------------------------E..
Y2442_CLOPE/7-240------------------------------------------------KLK--------------------------DGE
Q4W3A2_SUBDO/130-379------------------------------------------------RHT--------------------------T..
Y3134_SYMTH/19-256------------------------------------------------RLA--------------------------D..
Q9BKE8_CIOIN/114-361------------------------------------------------PLK--------------------------G..
Y2328_THETN/3-239------------------------------------------------EMK--------------------------K..
A6M9J4_LOCMI/114-356------------------------------------------------PLT--------------------------G..
Y2368_SYNWW/20-257------------------------------------------------TFE--------------------------N..
A8MLV0_ALKOO/9-245------------------------------------------------EMN--------------------------R..
B8G1T2_DESHD/17-252------------------------------------------------SMK--------------------------D..
Q73L28_TREDE/13-247------------------------------------------------KLR--------------------------A..
Q4MIA1_BACCE/19-254------------------------------------------------KMN--------------------------E..
Q4AEC6_9ANNE/106-353------------------------------------------------PLL--------------------------K..
A5I7N7_CLOBH/9-243------------------------------------------------YLW--------------------------N..
Q67E02_GLOPY/117-364------------------------------------------------PLS--------------------------G..
Y3260_BACLD/19-254------------------------------------------------KMD--------------------------Q..
Y3190_CLOAB/9-244------------------------------------------------DLW--------------------------K..
A7YVI5_TOXCA/157-399------------------------------------------------PLE--------------------------G..
Y161_MOOTA/16-253------------------------------------------------PLR--------------------------E..
A6XH19_9METZ/153-400------------------------------------------------PLD--------------------------G..
Y046_CHLMU/17-249------------------------------------------------PLK--------------------------D..
Y1086_CLONN/9-244------------------------------------------------HLW--------------------------E..
Q9XZF5_CHAVR/108-356------------------------------------------------PLS--------------------------K..
KLOM_EISFO/108-355------------------------------------------------PLK--------------------------K..
Q67ER6_CHAVR/136-383------------------------------------------------ALK--------------------------D..
Q38EV2_TRYB2/136-378------------------------------------------------PLS--------------------------G..
A7RQU9_NEMVE/116-364------------------------------------------------PLN--------------------------K..
Y2634_CLOTE/8-241------------------------------------------------RLW--------------------------E..
Q14TA8_9CNID/153-400------------------------------------------------PLA--------------------------K..
Q296Q2_DROPS/207-449------------------------------------------------TLS--------------------------D..
A7S6V8_NEMVE/487-734------------------------------------------------SLM--------------------------T..
A0DI85_PARTE/130-381------------------------------------------------SLT--------------------------PGH
Q291M9_DROPS/185-440------------------------------------------------TLT--------------------------E..
A3IET5_9BACI/18-253------------------------------------------------AIN--------------------------D..
Q9BLC7_APLKU/109-351------------------------------------------------PLT--------------------------G..
KARG_STIJA/110-358------------------------------------------------SLM--------------------------K..
KCRM_TORMA/120-367------------------------------------------------PLS--------------------------T..
A6XH09_9METZ/111-359------------------------------------------------PLK--------------------------E..
Y179_DESRM/19-256------------------------------------------------RMT--------------------------E..
Q8N0P4_9BIVA/478-719------------------------------------------------PLA--------------------------K..
A7S6L6_NEMVE/110-357------------------------------------------------ALS--------------------------S..
A7RER2_NEMVE/138-389------------------------------------------------RHT--------------------------T..
Q4AEC7_RIFPA/105-352------------------------------------------------PLS--------------------------G..
Q75ZZ3_LAMJA/120-367------------------------------------------------DLK--------------------------T..
Q17MS1_AEDAE/186-440------------------------------------------------TMN--------------------------E..
A6TWL7_ALKMQ/9-245------------------------------------------------KMN--------------------------D..
Q1DA50_MYXXD/88-329------------------------------------------------PLA--------------------------S..
Y164_STAEQ/16-244------------------------------------------------RLD--------------------------T..

PF03074

GSH1_YEAST/253-647---LLNQDNKTSSNHF------ENIQSTNWQTL-----------------------------------------------
GSH1_HUMAN/236-610---KIHLDDANESDHF------ENIQSTNWQTM-----------------------------------------------
GSH1_ONCVO/243-613---RIEQDDTKSTEHF------ETVQSSNWMNM-----------------------------------------------
GSH1_MOUSE/236-610---KIHLDDANESDHF------ENIQSTNWQTM-----------------------------------------------
GSH1_RAT/236-610---KIHLDDANESDHF------ENIQSTNWQTM-----------------------------------------------
GSH1_SCHPO/299-657---SILQDNSVSNAHF------ENLNSTNWQSM-----------------------------------------------
O77252_TRYCR/321-672---MIDIDDTTHTEHF------ENIQSTNWQSV-----------------------------------------------
Q26820_9TRYP/306-657---MIDIDDHTHVDHF------ENIQSTNWQTV-----------------------------------------------
GSH1_CAEEL/241-614---RIEQDDEKSSEHF------ETIQSSNWMNM-----------------------------------------------
P90557_LEITA/314-665---MIDIDDVTHTEHF------DNIQSTNWQTM-----------------------------------------------

PF04107

CAAL_HALSA/15-298---HEHAEKPRYRSQL------DRIQY....P.-----------------------------------------------
CAAL_PSEAE/12-290---ARSNPAAHFARLF------EDQGR....V.-----------------------------------------------
Q9RD01_STRCO/37-342---RYLRQP.RYDAME------SCLDR..TGPG-----------------------------------------------
Y2307_ARCFU/12-285---DAKVWNHRDRRIY------QAYDR..LFNI-----------------------------------------------
P74515_SYNY3/5-287---DTFYRSDPQNPYH------TYIEQ....TY-----------------------------------------------
CAAL_ECOLI/14-292---QEVCDNERYQRTL------ENFGY....L.-----------------------------------------------
GSHA_MYCTU/46-355---VRVNPGARYRAME------QFFAASHSGVP-----------------------------------------------
Q9RH09_ZYMMB/53-361---LPLMPKGRYKIMT------EYMPK..VGKL-----------------------------------------------
CAAL_STRCO/4-283---LPVTPSIGVNRRY------EWMAEQ.YGVV-----------------------------------------------
CAAL_MYCBO/20-297---QKLTDAPRYAELI------KRTQW....W.-----------------------------------------------
Q9A2Z2_CAUCR/50-358---VPIMPKGRYVIMR------NYMPK..VGNL-----------------------------------------------
Q9JMV4_BRAJP/24-335---IPVMPKGRYKIMT------NYMPK..VGQY-----------------------------------------------

PF00120

GLNA_HALVD/117-366---ASDVRRDIIYGL.------ESMGF.DIEAS-----------------------------------------------
GLNA_SYNP2/104-382---LQDMRTEMLLTM.------AKCGV.PIEKH-----------------------------------------------
GLNA_AZOC5/103-379---AQDMRSEMLASM.------AKMGA.KVEKH-----------------------------------------------
Q9Y9Z7_AERPE/97-368---LLDYRLMLTETL.------QRFKV.DVAVS-----------------------------------------------
GLNA_NOSS1/103-383---FQDIRTEMLLTM.------AKLGV.PIEKH-----------------------------------------------
GLNA_SHIFL/102-379---AQDIRSEMCLVM.------EQMGL.VVEAH-----------------------------------------------
GLNA_BACCE/105-354---GENCRRDIVLEL.------EEMGF.EIEAS-----------------------------------------------
E7QAF9_YEASB/107-352---ARDMIEAHYRAC.------LYAGL.EISGI-----------------------------------------------
O86055_HERSE/104-381---FQDMRSEMSLII.------ESLGI.PVEVH-----------------------------------------------
O33342_MYCTU/121-374---MEPLLRDIRLGM.------AGAGL.RFEAV-----------------------------------------------
Q9HYP0_PSEAE/75-331---LRPFFEDVYRCM.------DALGL.VRDTF-----------------------------------------------
GLNA_METJA/115-365---APDIRRDIVLAL.------ENLGF.HVEAS-----------------------------------------------
GLNA_XENLA/110-359---GRDVVESHYKAC.------LYAGI.KICGT-----------------------------------------------
Q97VQ9_SULSO/102-347---NNQIIPEIAKTL.------RQINI.EPIRI-----------------------------------------------
Q977Z8_THEVO/122-372---ASDIRQQIVREL.------YELGY.QPEAA-----------------------------------------------
GLNA1_MYCTU/105-387---YVDLRDKMLTNL.------INSGF.ILEKG-----------------------------------------------
GLNA_AGABI/105-350---ARDLIEAHYRAC.------LYAGI.NISGI-----------------------------------------------
GLNA_PYRAB/96-339---AKDIKREIAEYM.------PSFGL.VPEVL-----------------------------------------------
GLNA_METTH/107-353---GTDFRRKLVMDL.------EALNF.DVEVS-----------------------------------------------
GLNA_LACLA/106-356---AGNTRREIVNVL.------TDLGF.EVEAS-----------------------------------------------
Q9KZC7_STRCO/124-376---LSDCAADLLAAL.------AAQGV.DVEQF-----------------------------------------------
Q9A3S2_CAUCR/129-384---FDALFEDMYEYS.------ERQGL.EIDTL-----------------------------------------------
GLNA_CLOSA/105-353---GENARRDMTLAL.------EEMGF.EIEAS-----------------------------------------------
O85177_AMYMD/104-383---FADLRDDIVRNL.------QGSGF.EIERA-----------------------------------------------
Q98A06_RHILO/120-375---GRNVLERVTECL.------QAVGI.DVYQI-----------------------------------------------
Q9I3F1_PSEAE/117-372---IEPFLADLYAAC.------KAQGL.PARTA-----------------------------------------------
GLNA_THEMA/102-350---VEEIRRDIAIAL.------EKMGI.TVEAT-----------------------------------------------
GLNA3_RHILP/97-349---RYDVIAEICDYM.------LELGW.KPYQN-----------------------------------------------
GLNA_AZOBR/103-379---GSDLRAEMLSVL.------AEMGV.PVEKH-----------------------------------------------
Q9AEL4_CORGT/87-338---APNFRRNAMVAL.------EELGI.PVEFS-----------------------------------------------
GLNA_SULSO/104-381---LMDVRVEIVDTL.------VKYFGYTIEAT-----------------------------------------------
GLNA2_DROME/116-365---ARDIVDAHYRAC.------LYAGI.KVSGT-----------------------------------------------
GLNA_AZOVI/100-377---DHEIRTAMCNAL.------EEMGL.KVEVH-----------------------------------------------
GLNA_ARCFU/116-402---TVEYRNELVYYL.------EQLGI.DIEYH-----------------------------------------------
GLNA2_FRAAL/84-326---GRQIVERHTQAC.------LDAGL.AIEGT-----------------------------------------------
Q9K665_BACHD/115-365---GEKVRLEIYRTL.------KAMGF.TIEAS-----------------------------------------------
Q9SC91_MEDTR/118-374---ASPILREVTSAL.------HSMGI.PVEQL-----------------------------------------------
Q986Q4_RHILO/115-369---FEAFIHDVYEAC.------RAQGI.PVDTA-----------------------------------------------
Q9I6J3_PSEAE/114-370---FDPLFEDMYDWC.------EAQGL.DLDTL-----------------------------------------------
GLNA_HAEIN/106-383---AHDIRSEMCLIL.------EEMGL.VIEAH-----------------------------------------------
O88070_STRCO/130-380---VEPLLRRIRNEM.------AGAGL.TVESA-----------------------------------------------
Q9AMT8_BRAJP/106-360---QHELFGEILALC.------EKARI.PLSGL-----------------------------------------------
GLNA_HELPJ/111-388---MMDIRTEIVKVL.------NQVGL.ETFVV-----------------------------------------------
GLNA1_DROME/147-395---ARDLVEAHVVAC.------LYAGI.DFAGT-----------------------------------------------
O31044_SYNPW/104-383---AQDIRSEMLLMM.------AQLGI.PIEKH-----------------------------------------------
Q97FR9_CLOAB/167-449---VSAFMKDVDKEL.------WALGI.TAKTK-----------------------------------------------
Q98CH5_RHILO/124-382---MEPLFSDIYAAA.------KAQGI.PAETV-----------------------------------------------
GLNA_COLGL/109-354---QRDIVDAHYKAC.------LYSGV.KISGT-----------------------------------------------
GLNA_STAAW/107-356---GENCRRDIVLEL.------EDMGF.DIEAS-----------------------------------------------
GLNA_LACDE/107-356---GAKCRREIVETL.------EKLGF.RVEAA-----------------------------------------------
Q9C213_NEUCS/546-806---VANLLRDIVHAL.------DSMGI.YVEQI-----------------------------------------------
Q9U307_CAEEL/115-364---GRDIVEAHYRAC.------LYAGI.QISGT-----------------------------------------------
P95692_STRAG/106-359---ANNNRREIVSLN.------TNWAL.KLKLV-----------------------------------------------
GLNA1_STRFL/101-378---FADLRAEISLEL.------DKNGL.QVERQ-----------------------------------------------
PUUA_ECOLI/133-390---FADVLNDIDELA.------QLQLI.PADGA-----------------------------------------------
Q9FAR9_SHEVI/102-379---SQDIRSAMCLVL.------EEMGQ.VVEAH-----------------------------------------------
GLNA_METMP/110-357---GCDIRRKIVFAL.------ENLGF.HVEAS-----------------------------------------------
Q98H15_RHILO/126-382---EEGVMRRLRNEM.------EAAGI.PIENS-----------------------------------------------
GLNA1_ALNGL/103-351---GRDIVDAHYKAC.------LYAGI.NISGI-----------------------------------------------
Q9RX64_DEIRA/111-359---GERIRREIASRL.------VEMGF.EIEAS-----------------------------------------------
Q27747_PARLI/109-358---GRDIVESHYRAC.------LYAGV.KIAGS-----------------------------------------------
GLNA_SULAC/107-383---LMDIRLEIISTLV------DYFGF.TIEAA-----------------------------------------------
Q9RDW7_LACRH/107-356---GENCRRDIVLEL.------EKMGF.EVEAS-----------------------------------------------
Q9A6W3_CAUCR/103-379---CQDLRGEMLAVM.------GELGM.KPEKH-----------------------------------------------
Q9SCP3_ARATH/507-763---ASPIFHDIVPAL.------ESLNI.EVEQF-----------------------------------------------
P95529_PSEPU/135-401---VEPIMAEVRQHL.------LALGM.PLRSI-----------------------------------------------
Q9RDS6_STRCO/104-363---GMDFRRQAITML.------ESMGI.SVEFS-----------------------------------------------
Q9A3R4_CAUCR/118-375---HAPFLRELWDVA.------DTLGV.PLEGA-----------------------------------------------
GLNA_THIFE/104-378---AQDLRSAMCLAM.------EEMGL.KVEVH-----------------------------------------------
GLNA1_RHILV/103-379---AQDMRSEMLTVL.------SEMGV.VVEKH-----------------------------------------------
Q9HT65_PSEAE/105-353---AGQFPGWLVSAL.------AQAGT.EPEMF-----------------------------------------------
GLNA2_STRVR/89-333---GRDVVEAHLDNC.------LKAGL.AISGI-----------------------------------------------
Q98EM0_RHILO/120-375---FEPVIRRVYDYA.------AAAGL.PLDTL-----------------------------------------------
GLNA_HALSA/115-364---ASDIRREIIFTL.------EAMGF.EIEAS-----------------------------------------------
Q53045_RHORU/103-379---AQDLRAEMLSTM.------AEIGM.PVEKH-----------------------------------------------
GLNA_METCA/102-379---FQDLRSAMCNTL.------EDMGM.VVEVH-----------------------------------------------
Q9I275_PSEAE/120-376---YVECLQDIIDGA.------RAQGI.PADAI-----------------------------------------------
GLNA2_MYCTU/106-357---ALNFRRHAIDAL.------EFMGI.SVEFS-----------------------------------------------
Q988Z8_RHILO/141-397---FDELIDDIYHFS.------ESQGL.EIDTL-----------------------------------------------
Q97W07_SULSO/106-349---QQNFLKLLIKYL.------EEIDI.KVETI-----------------------------------------------
Q44249_ACISP/140-407---VDDIMSKVRKGL.------LELNL.PLRSI-----------------------------------------------
LGSN_HUMAN/181-427---DQPFMQELVDGL.------YHTGA.NVESF-----------------------------------------------
GLNA2_HORVU/165-413---GRDISDAHYKAC.------LYAGI.EISGT-----------------------------------------------
O07752_MYCTU/111-358---HEAFVRDVNAAA.------TAAGI.AIEQF-----------------------------------------------
Q9ZF05_9CYAN/195-477---VQVFMQDVEERL.------YRLGI.PAKTR-----------------------------------------------
GLNA_NEIGO/105-382---GQDLRSAMVNIL.------EGLGI.EVEVH-----------------------------------------------
GLNA2_STRHY/85-330---GREIVEKHLDLC.------LAAGL.GLSGI-----------------------------------------------
Q9HT51_PSEAE/117-373---LQPFLDDLYAAC.------EAQGL.PARTA-----------------------------------------------
GLNA_AQUAE/105-379---MMQLRNEMVSIM.------SDLGI.IVELH-----------------------------------------------
Q9PCD9_XYLFA/137-414---LHDLRAEMVKTL.------EQVGI.ETEVH-----------------------------------------------
GLNA_RHOCA/103-378---AQDLRGEMLSTM.------KRMGM.KVDKH-----------------------------------------------
Q97S86_STRPN/106-358---ADNTRREIVNVL.------TKMGF.EVEAS-----------------------------------------------
O96463_SKECO/151-401---GRAVTDAMYRCC.------LYAGL.EISGT-----------------------------------------------
GLNA1_FRAAL/104-383---FTDLRSEMTRVL.------YETGI.TVEMQ-----------------------------------------------
Q79VE3_CORGL/105-386---TVDVRDDMVRNL.------AASGF.ALERF-----------------------------------------------

PF12224

Q311H8_DESDG/19-291---ASQLKSEKYKEFL------ADLGVRLEPDTARSL.------------------------------------------
Q2HBV5_CHAGB/10-268---STLPSNEAENKF.------................------------------------------------------
Q67LG7_SYMTH/9-197---ELQVDDTGEDS..------................------------------------------------------
A6G6Z1_9DELT/9-197---ERMRALDGSYG..------................------------------------------------------
Q5LF69_BACFN/74-277---GSLEGSH......------................------------------------------------------
A6KZ00_BACV8/75-278---SSLNGND......------................------------------------------------------
A7ALF5_9PORP/71-272---SSISGND......------................------------------------------------------
A5D072_PELTS/13-222---SSVNNVGTGLATG------................------------------------------------------
O86176_DICNO/4-232---ASLTSVPAHL...------................------------------------------------------
Q1DBA6_MYXXD/2-223---ASLSGGEYSG...------................------------------------------------------
B8I7I6_CLOCE/4-236---ASIKEECKVGRPD------PT..............------------------------------------------
Q24NQ7_DESHY/4-240---GSIVPERREGRHV------VEADK...........------------------------------------------
A7VE77_9CLOT/4-240---GSITAQKKSNGRK------INAGR...........------------------------------------------
A5N406_CLOK5/4-240---ASITPERKSGRQT------VSASA...........------------------------------------------
Q252G7_DESHY/4-240---GSLDCQRKEGRRK------VSADR...........------------------------------------------
A3DFX9_CLOTH/2-240---GSIRTQKKENGRI------AAAGR...........------------------------------------------
B0K6R6_THEPX/2-240---GSINCQRKEGRRK------VAAGR...........------------------------------------------
A3DG69_CLOTH/7-247---GSIYTQKKVNDEK------VAATK...........------------------------------------------
A7B449_RUMGN/13-255---VSIAGPDEE....------................------------------------------------------
A5KNA4_9FIRM/6-244---GSIYTERRERGRM------VRAGS...........------------------------------------------
A7VHZ7_9CLOT/7-244---SSIDCERLANGTV------IDADG...........------------------------------------------
A6P0C2_9FIRM/7-247---SSIRGEHKVGARY------TSTSDP..........------------------------------------------
A6NU92_9FIRM/5-246---GSIKTEQRTENGY------EPVNNF..........------------------------------------------
A7VEY9_9CLOT/228-465---ASIKPSVTADRQN------PKLDH...........------------------------------------------
Q2LU27_SYNAS/194-396---SSVNGLAGYS...------................------------------------------------------
A6NXI0_9FIRM/22-218---GSLND........------................------------------------------------------
A6RSA1_BOTFB/8-281---STVHFEVEEKADS------SSMF............------------------------------------------
A6RWE1_BOTFB/15-325---GSIKGPAPPSRRN------KKAYADWQ........------------------------------------------
A6S997_BOTFB/48-350---ISIDLPDESIYDY------H...............------------------------------------------
A7EWG5_SCLS1/49-355---FSISCPDDTIYDY------H...............------------------------------------------
A6RWC8_BOTFB/15-290---SSVAPRVRIHPDY------REF.............------------------------------------------
A6F4K8_9ALTE/17-284---SDPIKDLDLADER------LPESVRELGGHAMS..------------------------------------------
A1U270_MARAV/19-286---SDPIKDLDLADER------LPESIRELGNHAMD..------------------------------------------
A3J9P7_9ALTE/19-286---SDSIKDLDLTGAD------VPESLREIGGQAMD..------------------------------------------
Q1N2M0_9GAMM/21-286---AQMLQKIDLNFDP------EFQAITDQAMKW....------------------------------------------
Q21GI0_SACD2/15-285---SSQLQALGEALSR------SEREPINETIEAFGL.------------------------------------------
A1SY20_PSYIN/16-290---FELLTKQKLKNSL------KDFFKQVSIDIDENSI------------------------------------------
A6Q4S5_NITSB/14-275---SVYLRKTSNHYLF------KDFDLFKELIY.....------------------------------------------
Q1NPF7_9DELT/17-289---ARVLQDRRYREHL------RTLGIELEAEDSETL.------------------------------------------
Q1QYE1_CHRSD/31-310---SKYVHPDATVMQA------NGMTPGKAPSAGREWR------------------------------------------
Q0A4Z7_ALHEH/26-298---ARVLKERSYRALL------SQMGFNLDDRTLDSL.------------------------------------------
A6GSC5_9BURK/17-282---WSFAKNMARKRLE------EQGASEDAVLEL....------------------------------------------
Q2SFT5_HAHCH/19-280---WDYFKRQAALQQD------EEGDEWVQLLG.....------------------------------------------
A4A8R3_9GAMM/16-277---WAFLKRVSREYAA------DEEQYWVEPLN.....------------------------------------------
A3WME7_9GAMM/21-284---WSYLKRIAREQPT------SGTAEHIWLEEL....------------------------------------------
Q5QYT8_IDILO/18-278---WDYLKRKAKAEGG------DNSAWVRELG......------------------------------------------
A6FM81_9RHOB/18-271---IFLRKATQSK...------....LRDLAL......------------------------------------------
A6DW96_9RHOB/16-269---IFLRNAEHSK...------....LRDLAL......------------------------------------------
A3TW22_9RHOB/18-271---TALRHARDTP...------....IKRLGL......------------------------------------------
A3K2K5_9RHOB/17-270---ISLRKKDIP....------....LLEQGL......------------------------------------------
Q0FIK0_9RHOB/23-278---SAPLNKMDRDG..------....IGKSLR......------------------------------------------
Q0AQY0_MARMM/8-327---DARLLALVTEHCD------PDADLANVLAPVAALF------------------------------------------
Q2L5I9_CLOPF/180-403---GSVSDGDA.....------................------------------------------------------

PF04262

GSH1_PSEAE/6-381---IGRLKYVYRKGLA------LRYGKTMQCIAGI---------------------------------------------
Q9RDU4_PSESP/6-381---PGMLRHVYRRGLA------LRYGKRMQCIAGI---------------------------------------------
GSH1_ECOLI/6-381---TGRFKTLYREGLK------NRYGALMQTISGV---------------------------------------------
GSH1_CLOAB/6-390---DGRQKQIYRNGLA------LRYGKKMQMISGI---------------------------------------------
GSH1_BUCAI/6-382---IGKMKTTYRIGLK------NRYGDLINTISGI---------------------------------------------
GSHAB_PASMU/1-337---....DVAYREYLV------KIYGKNKQMVSGI---------------------------------------------
GSH1_VIBCH/5-379---TGKMKTLYREGLK------RRYGSLMQIISGV---------------------------------------------

PF14395

B7DSA7_9BACL/212-472---LRPAPDSSPDGLV------LNLRALMQE-------------------------------------------------
C0ZEZ5_BREBN/171-428---LRPAPSEDPDQLF------THIYDNLAL-------------------------------------------------
B0TB99_HELMI/204-455---IRPAPKTAARELT------QAIGALLAG-------------------------------------------------
C6CUQ2_PAESJ/144-402---LRPEPAEDPAGLT------AHIRRLLLR-------------------------------------------------
D3E8P9_GEOS4/163-421---LRPSPKANPKELL------LEMQKALRE-------------------------------------------------
Q0AXS0_SYNWW/193-453---LRPKPEFSPLDLV------ENIKQALNT-------------------------------------------------
B0TBC1_HELMI/214-474---VRPAPAENAVEAL------RQLRNVLNE-------------------------------------------------
B0TET0_HELMI/208-468---IRPDPSNDPDAII------ASLERIMQV-------------------------------------------------

PF09899

A3HSI4_9BACT/278-1112---LFLVPGNSPAGLR------LPLDSIEHTPTEEEPI.LPERDLFADVDAL............................
Q1B9K6_MYCSS/283-1101---IVLLDGDSPAGLR------LPLDAISWQPPRP....GYPADPLARRGAL......................ASVADA
Q4ZYW4_PSEU2/275-1090---CRLVPGDSALGYR------LPLASQPWVKAAEYPF.IHPTDHNQDFPEL..........................AD
A0L4M6_MAGSM/274-1111---LFLIPGNSAIGLR------LPLESLFYQSPAERPL.TPEQDLFDTLGRL.................PKYKQLAKQAE
Q2W952_MAGSA/302-1132---LLTIPGDSPLGLR------LPLESLPWIPADAYPY.HSERDPFEPRGPMPP............ARRQRAQTEQVPGS
Q11VA3_CYTH3/275-1141---IFLIPGNSPIGLR------LPLDALSKIAAEYEPY.EIERSLFETIPYL........QNDYTNTVRSRYGSIVEHED
A2VKS3_MYCTU/329-1149---IVLLEGDSPAGLR------LPLDSISWRPPRA....SFDADPVAVRSTL.........................PAE
A0NMX9_9RHOB/275-1105---LFLVPGDSPVGYR------LPLESLPYVPPARYPY.TNIADPTVPRDPLPEF............PAGQRADRKQNVA
A4XQ07_PSEMY/275-1095---CRLLPGDSPLGYR------LPLDSLPWVSQADYPY.INPVDPSQALPPL........PSPAQIQRQLRGVWRGASAG
A9W7N2_METEP/297-1111---AYLNPGDSPLGFR------LPLGSLPYVPPDSYPY.YHPQDPLEARGDLP................VEPGGPRDAPL
Q47BP1_DECAR/275-1115---CYLFPGDSAMGYR------LPVDSQPWTAQSDYPY.VNVPDAETATDPL........ASYAALRSRVTGEVGAREPQ
Q2SNA7_HAHCH/275-1090---LYLSPGNSPLGFR------LPLASLSSHELSDEYE.VYERDPFAPLPQE............................
Q31N62_SYNE7/1-727---LVPLEGETPLGLR------LPLQQLGDIDLPYEPDDSTDLDSWQPGPAI............................
A8LRF2_DINSH/275-1107---LFLTPGDSPVGYR------LPLGSLPHVPAASYPY.TYPADPFAEQAPLPE......PDLVAREAERLRDRRERAPA
Q1MBT5_RHIL3/277-1103---IFLVPGDSPIGYR------LPLGTLPYVPPARYPY.IHPADPTIPREPLPDV..............FVPAGRAMPEA
Q89QZ5_BRAJA/275-1084---LFLTPGDSPLGLR------LPIGSLGYVPPNQYPY.IIERDPMEARGKLPVF...................TLAARP
Q1YG30_MOBAS/275-1127---LFLAPGDSALGYR------LPLGAIPHLESKDYPY.IHPADPMQPFPPLP.......PQNRTQYGRVEMQSQRDDTA
A3VDN8_9RHOB/278-1112---LFLIPGDSPAGFR------LPLGALPHVPPAQYPY.HYVTDPSIEVGDLPDY.....HEELEKRAPETDRSRAQPVS
A6C0B7_9PLAN/274-1115---LFLIPGDSPMGLR------LPLDSLPAPQPGEYA..PTPVVPFEATSDL........PEYDQLRQQSAYHQTAQHVT
A3XIL1_LEEBM/275-1116---LFLIPGNSPVGLR------LPLNSLIEEPDVPTQP.IADPDLFDKRKPF................GPYGEALEKRKA
A3PN00_RHOS1/275-1102---LFLVPGDSPVGYR------LPLGALPHIPASRYPY.INPTDPTVERGPLPP.........AGEAQIVPLQTPEAAVA
A1U538_MARAV/275-1097---CYLIPGGSPMGHR------LPLDSQPWVEEADYPW.IHEQDPFAPRGPL....................PVSEQIRQ
A1VL54_POLNA/295-1117---LYLTEGDSPMGLR------LPLNALPWVLPEEKEP.EFDVDPFAPRTAL..................DAGQKEKRAA
Q21G23_SACD2/275-1112---IVLIPGDSPMGLR------LPLGSLPLEEEKEL...DVKPDPFEQRQSL...........APHSELLQGAEKIQPQV
A6GT43_9BURK/286-1103---MYLIPGDSPMGYR------LPLDSQPWVAKKDFPY.TIPADPFAPPAPS.......................RVALQ
Q7UKP5_RHOBA/275-1113---VYLIPGDSPIGLR------LPLDRLPVASASEAPFYTAPMDPTAPHGPLPP......PEMPRGNEQDPRGNRRVDSS
A4TX61_9PROT/275-1111---IVTIPGDSPLGFR------LPLDSLPHIEPEDYPF.HAERDPFEPRGNLPP......RQRAPQPARQHSMTSRAAAE
B0SXH9_CAUSK/275-1086---MFLVPGDSPVGFR------LPLGDLPKLSAEDYPS.IVERDPFEPREPLPDY.................EALRKPPA
Q2RR87_RHORT/275-1085---CYLIPGDSALGLR------LPLASLPWLAPEEYPF.LVEEDPFAPRPPL..........................AD
A1K5W6_AZOSB/275-1124---CYLIPGDSPLGYR------LPLDSQPWATPGDYPW.IHQPDPFERFKPL........PTHAAIRQQFGPASGFAILR
Q1ND53_9SPHN/280-1118---LFAVPGDSALGYR------LPLGSLPHVPESDYPY.IHPRDTSEPRGPLADA.....RAQVSEAASREEAQRVQRVA
Q218C6_RHOPB/275-1085---LFLTPGDSPLGLR------LPISSLPHIPEDEFPY.TVEQDPLEPRDPL...................SEAGEASAE
A5VFM9_SPHWW/295-1120---LFAVAGDSALGYR------LPLGSLPHVPAADYPY.LHPRDTTEPREPMPDF.................YRQRIEAV
Q98HG6_RHILO/275-1114---LFLVPGDSPVGYR------LPLGTLPYVPPAQFPY.IVPVDPSLPRGPLPAREAILPTPAPAELEGADEMARRQQAA
C0AE57_9BACT/275-1117---LWLIPGDSPMGLR------LPLDSIPWVAPKDYPH.QWPRDLSQPLPAL........PREFPLGIGRQRFVSGANAP
B0UHH5_METS4/274-1075---LYLAAGDSPVGFR------LPLNSLISLPPEEFPY.YAPQDPLEARGPLP...........................
C1DJA3_AZOVD/275-1116---CRLTPGDSPLGWR------LPLDSLPWARDMDQPY.VHAPDPNQSFPPL........PSRQQILRQLRGTPPARPAA
A3YWY7_9SYNE/14-726---RELLPASGPAGLR------LPLQHFP...................................................
A6VTZ0_MARMS/275-1113---ITLIPGDSPMGYR------LPLNSLPAQAEEDR...IPERDPFDPRQPL....................ANKKDNAV
Q07VI7_RHOP5/275-1098---LLLAPGDSPVGYR------LPLGGLPWVAPVAYPY.IVQADPVEPKEALPD...............PEALQQRFVRS

PF03136

PAFA_CORGL/10-445---SMPL.KALGKRLM------PFLITRQLICG-----------------------------------------------
Q7UWL2_RHOBA/26-608---HIAF.RTQRRHLT------GLLVSRVAIMG-----------------------------------------------
A6G895_9DELT/3-562---AFAF.RRVRRDML------AFLISRPVLTG-----------------------------------------------
Q7WZ91_9ACTO/5-426---HGEF.GRLADVLI------PFLVTRQVVCG-----------------------------------------------
PAFA_KINRD/3-425---HGEF.GKLSDVLI------PFLVSRQLIVG-----------------------------------------------
A3TL35_9MICO/3-425---AGDF.QVFSDALL------PFLISRQIICG-----------------------------------------------
PAFA_MYCS2/3-424---AGEF.SRISDVLL------PFLVTRQLICG-----------------------------------------------
PAFA_ARTS2/3-425---RGEF.SRLAEILI------PFLVTRQLIAG-----------------------------------------------
PAFA_CORDI/11-437---DVVL.KTLGRQLL------PFLITRQLICG-----------------------------------------------
PAFA_CORJK/6-436---DIPL.KGLSKQLL------PFLVTRQLICG-----------------------------------------------
PAFA_BIFLO/27-456---FVPL.ETIEHQLL------PFLITRQLYTG-----------------------------------------------
A3EPC1_9BACT/3-425---NVTF.WRLSRTLI------PFFVTRQIFAG-----------------------------------------------
Q828J1_STRAW/4-459---ETPF.SDIVRHLT------PFFVSRQVVTG-----------------------------------------------
A8LH56_FRASN/73-531---ATPF.GEIVRHLT------PFFVSRQVICG-----------------------------------------------
Q47NY8_THEFY/10-466---STPF.SEIVQHLI------PFFVSRQVVCG-----------------------------------------------
A0LU48_ACIC1/2-458---STPF.ADIVRHLI------PFFVTRQVFCG-----------------------------------------------
A1SK11_NOCSJ/4-459---STPF.GDIVRHLT------PFFVSRQVICG-----------------------------------------------
A6W968_KINRD/4-497---STAF.GDVVRHLT------PFFVSRQVFTG-----------------------------------------------
Q5YUX0_NOCFA/2-457---DTPF.NQIIVGLT------PFFVSRQVICG-----------------------------------------------
A4FBX9_SACEN/2-456---STPF.TSVITGLT------PFFASRQVVCG-----------------------------------------------
A1R6Q5_ARTAT/19-506---SVPF.GDIIRGLT------PFFVSRQVICG-----------------------------------------------
Q8NQD9_CORGL/2-460---ETDF.DVLAQALI------PFFVCRQVIIG-----------------------------------------------
Q8FTE4_COREF/2-463---DIDF.DVIAQALI------PFFVTRQVIIG-----------------------------------------------
Q6NH93_CORDI/2-457---ETPF.EEISSGLT------PFFITRQVIIG-----------------------------------------------
Q4JVP6_CORJK/4-450---DLDV.EDVQAALI------PHFVTRQVFCG-----------------------------------------------
A7BC88_9ACTO/4-485---ITDL.DAIVRGLT------PFMVTRPVICG-----------------------------------------------
Q8G3G5_BIFLO/4-488---AVPF.DLVTRLMT------LHFVTRQIYAG-----------------------------------------------
A7A4U7_BIFAD/16-491---SVPF.DLVTRLMT------THFVSRQIFIG-----------------------------------------------
A3EPC5_9BACT/10-458---SLPF.DTLARKIS------SHLVTRVLFCG-----------------------------------------------
A3ETM5_9BACT/5-463---DIPF.DRIVQVCV------PFLVARTILLG-----------------------------------------------
A3ETM1_9BACT/26-469---DFPFTERGMEPLV------AFLVTRQIVTG-----------------------------------------------

PF00217

KTRC_SCHMA/141-382...MSEEDRIKLVNDH......FLFRN..DDNV-----------------------------------------------
Q7PYN5_ANOGA/203-445...LDAGQKEELTEGH......YLFKE..CDRF-----------------------------------------------
Q4AED1_9ANNE/113-361...LTKEQEESLRNDH......FLFQK.PISHI-----------------------------------------------
Q4AED2_9ANNE/113-360...LTKEQEQRLREDH......FLFQK.PDSHI-----------------------------------------------
KCRB_HUMAN/120-367...MTEAEQQQLIDDH......FLFDK.PVSPL-----------------------------------------------
Q1Q1E9_9BACT/18-252...LSSVDRLFLVERH......LISRE......-----------------------------------------------
KARG_LIMPO/114-356...MSKATQQQLIDDH......FLFKE..GDRF-----------------------------------------------
A3DGD2_CLOTH/9-244...LTPIQRQVLVEKH......LISPD......-----------------------------------------------
Q9VST4_DROME/143-385...MDKCIQEQLIEDH......YLFKE..GDRF-----------------------------------------------
Q4AEC5_9ANNE/149-396...LTDKEQQQLIDDH......FLFQK.PTGAL-----------------------------------------------
Q9NKV5_OCTVU/106-347...MTPDVQKQLTDDH......FLFND..SDRF-----------------------------------------------
Y120_BACSK/19-255...MRTNDKRMLVEKH......LISPH......-----------------------------------------------
KARG_LIOJA/108-349...MTPDVQKQLTEDH......FLFND..SDRF-----------------------------------------------
A6QBA0_SULNB/100-342...MSKEVQDALIQDH......FLFKE..GDRF-----------------------------------------------
Q8MWR8_9BIVA/125-367...MDKATQNKMIEDH......FLFRA..DDSV-----------------------------------------------
A3ZT72_9PLAN/20-254...LSDVDRHFLAERQ......LISRE......-----------------------------------------------
A7XZJ5_GLYDO/114-356...MDKSTQQQLIDDH......FLFKE..GDRF-----------------------------------------------
Q6XLN0_HETGL/163-406...MTKETQKQLIADH......FLFKE..GDRF-----------------------------------------------
Q4AEC8_RIFPA/122-369...MNPTDMQQLIDDH......FLFQK.PTGAL-----------------------------------------------
Q177S3_AEDAE/202-445...MSDELKQQLIDDH......YLFKE..GDRF-----------------------------------------------
A6XH18_9METZ/115-362...MSEKEQDQLIEDH......FLFDK.PVSPL-----------------------------------------------
A6CSY9_9BACI/19-254...MQPLQKRVLMEKH......LVSPN......-----------------------------------------------
KCRF_STRPU/908-1155...MTDEEQEKLIEDH......FLFDK.PVSPL-----------------------------------------------
Q5TP29_ANOGA/189-444..ILENPSEIRTILATNGLLIPLLDHTDPYQTA-----------------------------------------------
Y282_PELTS/19-256...LSPLERQILVDKH......LISPD......-----------------------------------------------
Y860_HALOH/19-252...LPEVEREVLVEKH......LISPA......-----------------------------------------------
Q2B1J8_9BACI/19-255...LQPLQKRVLVEKH......LISPN......-----------------------------------------------
Q1HBJ2_BRABE/114-362...MTDAEQEQLIADH......FLFDK.PVSPL-----------------------------------------------
KARG_HALMK/111-353...MSKEDQKQMTEDH......FLFKD..DDRF-----------------------------------------------
A6XH11_9METZ/115-365PSFIENDQYLKLVEDH......LMFKDMSSDTY-----------------------------------------------
Y102_BACHD/19-254...MKPNVKRVLVEKH......LISPH......-----------------------------------------------
Q6F4H6_HEDDI/131-378...MNDKDMEALIEDH......FLFEK.PTGAL-----------------------------------------------
A6XH14_CLAPR/119-361...MDKATQDQLIADH......FLFKE..GDRF-----------------------------------------------
Q760P7_ANABR/106-348...MTKEEETQLVEDH......FLFKN..DDRM-----------------------------------------------
A4F2K7_9CUCU/128-370...MSPADQQKLINDH......FLFKE..GDRF-----------------------------------------------
A6F800_9GAMM/114-356...IPETVKTQLVNDH......FLFKA..GDRF-----------------------------------------------
Y077_GEOTN/19-255...LQPIEKRVLVEKH......LISPH......-----------------------------------------------
KCRS_RAT/154-401...MTEQDQQRLIDDH......FLFDK.PVSPL-----------------------------------------------
KARG2_CAEEL/117-359...MDEETKKKLIADH......FLFKE..GDRF-----------------------------------------------
Q6BDZ3_9BILA/120-367...MTDEEQQQLIDDH......FLFDK.PVSPL-----------------------------------------------
Q67ER6_CHAVR/889-1136...MTEAEQEQLINDH......FLFDK.PVSPL-----------------------------------------------
O45011_CAEEL/156-398...MGKDTQKQLIADH......FLFKE..GDRH-----------------------------------------------
Q6BDZ2_POLMI/114-361...MTDQQQEQLIADH......FLFDK.PVSPL-----------------------------------------------
Q6RSH2_TETAR/120-367...MTDAEQQQLIDDH......FLFDK.PVSPL-----------------------------------------------
Q8T6T7_URECA/107-354...MTPEQENQLIADH......FLFQK.PTGHL-----------------------------------------------
KCRF_STRPU/161-408...MTEEMQDKLIADH......FLFDK.PVSPL-----------------------------------------------
A7RNR3_NEMVE/152-399...MSDAQQQQLIDDH......FLFDK.PVSPL-----------------------------------------------
A7S6V8_NEMVE/867-1114...MTDAEQEQLINDH......FLFDK.PVSPL-----------------------------------------------
Q7T1J2_CHAAC/120-367...MTDAEQDQLINDH......FLFDK.PVSPL-----------------------------------------------
A6XH13_9METZ/149-396...MSDQEQEQLINDH......FLFDK.PVSPL-----------------------------------------------
Q67ER6_CHAVR/504-751...MTNEEQEQLINDH......FLFDK.PVSPL-----------------------------------------------
Y092_OCEIH/19-255...LSPVEKSVLVEKH......LISPH......-----------------------------------------------
Q4AED0_SIPCU/113-355...MDEATKNKLIDDH......FLFGD.PPNKI-----------------------------------------------
A0D308_PARTE/131-376KNFISDQKADELRKRH......FLFIDMTSDNH-----------------------------------------------
Y701_CHLPN/18-250...TPLWQKEFLLEHF......LLPYD......-----------------------------------------------
Y194_CLOK5/10-245...KNDNEKNIYLEKH......LISKN......-----------------------------------------------
Q7UMV3_RHOBA/22-257...LSEVDRQFLVERQ......LISRE......-----------------------------------------------
Q6APG0_DESPS/133-375...LGAEKMAALRAEK......LIFSK..GDRF-----------------------------------------------
Q9NKV6_9MOLL/108-349...MSKEIQSKLTEDH......FLFND..SDRF-----------------------------------------------
Y070_BACP2/19-254...TQPLAKRVLVEKH......LISPN......-----------------------------------------------
Q3A9N0_CARHZ/16-253...LAPIERQVLVEKH......LISPD......-----------------------------------------------
KCRF_STRPU/534-781...MSDETQTQLIDDH......FLFDK.PVSPL-----------------------------------------------
Q5L768_CHLAB/18-250...APAWQKEFLIEHF......LFPYD......-----------------------------------------------
Q760P6_CRAGI/107-349...MTPEENQQLIDDH......FMFKN..DDKM-----------------------------------------------
A7RGZ5_NEMVE/118-356...MDEVTREQLVNDH......FLFKK..GDRF-----------------------------------------------
A1HTJ5_9FIRM/19-255...LSPLERYVLVEKH......IISPN......-----------------------------------------------
B1YGS1_EXIS2/18-248...VDALTRTALVEKH......LISPA......-----------------------------------------------
Y110_BACA2/19-254...AQPLEKRVLMEKH......LISPN......-----------------------------------------------
Y2442_CLOPE/7-240EKIIDYYKENFGLIKY......FENKD......-----------------------------------------------
Q4W3A2_SUBDO/130-379...MSDQQRQQLIDDH......FLFRG..KDKM-----------------------------------------------
Y3134_SYMTH/19-256...TTPLDRQILVEKH......LISPQ......-----------------------------------------------
Q9BKE8_CIOIN/114-361...MSEEHQDQLINDH......FLFDK.PVSPL-----------------------------------------------
Y2328_THETN/3-239...LTPLDRQALVEKH......LISPD......-----------------------------------------------
A6M9J4_LOCMI/114-356...MSKEVQQKLIDDH......FLFKE..GDRF-----------------------------------------------
Y2368_SYNWW/20-257...LSALDRKILVEKH......LISPN......-----------------------------------------------
A8MLV0_ALKOO/9-245...QDKIERLNYIEKH......LISPA......-----------------------------------------------
B8G1T2_DESHD/17-252...LTPIEQYVLIEKH......LISPA......-----------------------------------------------
Q73L28_TREDE/13-247...MDPLSIKLLEERG......IILPD......-----------------------------------------------
Q4MIA1_BACCE/19-254...LTPLQRRVLVEKH......LISPN......-----------------------------------------------
Q4AEC6_9ANNE/106-353...MTPEEEKQLIEDH......FLFQK.PTGHL-----------------------------------------------
A5I7N7_CLOBH/9-243...LEKKEINSLLEKH......IISFN......-----------------------------------------------
Q67E02_GLOPY/117-364...MTEEEQDKLIEDH......FLFDK.PVSPL-----------------------------------------------
Y3260_BACLD/19-254...VQPLEKRVLVEKH......LISPH......-----------------------------------------------
Y3190_CLOAB/9-244...NDNNCNAEYLEKH......LISKK......-----------------------------------------------
A7YVI5_TOXCA/157-399...MSKEVQNQLIQDH......FLFKD..GDRH-----------------------------------------------
Y161_MOOTA/16-253...LAPVERQILVEKH......LISPD......-----------------------------------------------
A6XH19_9METZ/153-400...MTDQEQEQLIEDH......FLFDK.PVSPL-----------------------------------------------
Y046_CHLMU/17-249...LPIWQRECLLEHY......LCPYD......-----------------------------------------------
Y1086_CLONN/9-244...NDNETNKMYLEKH......LISRG......-----------------------------------------------
Q9XZF5_CHAVR/108-356...MTDKEQEQLIEDH......FLFDK.PVSPL-----------------------------------------------
KLOM_EISFO/108-355...MTPEQEKQLIADH......FLFQK.PTGHL-----------------------------------------------
Q67ER6_CHAVR/136-383...MTEEQQQKLIDDH......FLFDK.PVSPL-----------------------------------------------
Q38EV2_TRYB2/136-378...MTKETQQQLIDDH......FLFKE..GDRF-----------------------------------------------
A7RQU9_NEMVE/116-364...MTDEEQEQLINDH......FLFDK.PVSPL-----------------------------------------------
Y2634_CLOTE/8-241...MDPLDRVTYLEKY......LISSK......-----------------------------------------------
Q14TA8_9CNID/153-400...MTEAEQDQLINDH......FLFDK.PVSPL-----------------------------------------------
Q296Q2_DROPS/207-449...IDAETQQEMVKRH......IMFHR..GDAY-----------------------------------------------
A7S6V8_NEMVE/487-734...MTEAEQDQLIDDH......FLFDK.PVSPL-----------------------------------------------
A0DI85_PARTE/130-381KNQITQEQADELIKRH......FLFNDMTTDNH-----------------------------------------------
Q291M9_DROPS/185-440..LLEPDSEVTLMLSSLGLMISLLDTKDLVQAA-----------------------------------------------
A3IET5_9BACI/18-253...LTPLQRQILVEKH......LISPQ......-----------------------------------------------
Q9BLC7_APLKU/109-351...MSKETQTQLTEDH......FLFNN..SDRF-----------------------------------------------
KARG_STIJA/110-358...MDEKTQQQLIDDH......FLFDR.PVSRH-----------------------------------------------
KCRM_TORMA/120-367...MSDAEQQQLIDDH......FLFDK.PISPL-----------------------------------------------
A6XH09_9METZ/111-359...MTNEEQEQLINDH......FLFDK.PVSPL-----------------------------------------------
Y179_DESRM/19-256...LSSIERQILVEKH......LISPD......-----------------------------------------------
Q8N0P4_9BIVA/478-719...MDEATQKQLVADH......FLFRD..DDDV-----------------------------------------------
A7S6L6_NEMVE/110-357...MTPQDYHHLSLEH......VLSDA.TKHPL-----------------------------------------------
A7RER2_NEMVE/138-389...MTDEERQKLVDDH......FLFRG..KDKM-----------------------------------------------
Q4AEC7_RIFPA/105-352...MKPEDEKRLIEDH......FLFQK.PTGHL-----------------------------------------------
Q75ZZ3_LAMJA/120-367...MSDKDQQQLIDDH......FLFDK.PVSPL-----------------------------------------------
Q17MS1_AEDAE/186-440..ILENPSEIRTILATSGLLIPMLDHNDPYQTA-----------------------------------------------
A6TWL7_ALKMQ/9-245...MDQVERLNYVEKH......LISPH......-----------------------------------------------
Q1DA50_MYXXD/88-329...LSEAERLELVHHH......VLFQQ..SDRF-----------------------------------------------
Y164_STAEQ/16-244...MDQQSKMKLVAKH......LVSPE......-----------------------------------------------

PF03074

GSH1_YEAST/253-647--------------------------------------------------------------------------------
GSH1_HUMAN/236-610--------------------------------------------------------------------------------
GSH1_ONCVO/243-613--------------------------------------------------------------------------------
GSH1_MOUSE/236-610--------------------------------------------------------------------------------
GSH1_RAT/236-610--------------------------------------------------------------------------------
GSH1_SCHPO/299-657--------------------------------------------------------------------------------
O77252_TRYCR/321-672--------------------------------------------------------------------------------
Q26820_9TRYP/306-657--------------------------------------------------------------------------------
GSH1_CAEEL/241-614--------------------------------------------------------------------------------
P90557_LEITA/314-665--------------------------------------------------------------------------------

PF04107

CAAL_HALSA/15-298--------------------------------------------------------------------------------
CAAL_PSEAE/12-290--------------------------------------------------------------------------------
Q9RD01_STRCO/37-342--------------------------------------------------------------------------------
Y2307_ARCFU/12-285--------------------------------------------------------------------------------
P74515_SYNY3/5-287--------------------------------------------------------------------------------
CAAL_ECOLI/14-292--------------------------------------------------------------------------------
GSHA_MYCTU/46-355--------------------------------------------------------------------------------
Q9RH09_ZYMMB/53-361--------------------------------------------------------------------------------
CAAL_STRCO/4-283--------------------------------------------------------------------------------
CAAL_MYCBO/20-297--------------------------------------------------------------------------------
Q9A2Z2_CAUCR/50-358--------------------------------------------------------------------------------
Q9JMV4_BRAJP/24-335--------------------------------------------------------------------------------

PF00120

GLNA_HALVD/117-366--------------------------------------------------------------------------------
GLNA_SYNP2/104-382--------------------------------------------------------------------------------
GLNA_AZOC5/103-379--------------------------------------------------------------------------------
Q9Y9Z7_AERPE/97-368--------------------------------------------------------------------------------
GLNA_NOSS1/103-383--------------------------------------------------------------------------------
GLNA_SHIFL/102-379--------------------------------------------------------------------------------
GLNA_BACCE/105-354--------------------------------------------------------------------------------
E7QAF9_YEASB/107-352--------------------------------------------------------------------------------
O86055_HERSE/104-381--------------------------------------------------------------------------------
O33342_MYCTU/121-374--------------------------------------------------------------------------------
Q9HYP0_PSEAE/75-331--------------------------------------------------------------------------------
GLNA_METJA/115-365--------------------------------------------------------------------------------
GLNA_XENLA/110-359--------------------------------------------------------------------------------
Q97VQ9_SULSO/102-347--------------------------------------------------------------------------------
Q977Z8_THEVO/122-372--------------------------------------------------------------------------------
GLNA1_MYCTU/105-387--------------------------------------------------------------------------------
GLNA_AGABI/105-350--------------------------------------------------------------------------------
GLNA_PYRAB/96-339--------------------------------------------------------------------------------
GLNA_METTH/107-353--------------------------------------------------------------------------------
GLNA_LACLA/106-356--------------------------------------------------------------------------------
Q9KZC7_STRCO/124-376--------------------------------------------------------------------------------
Q9A3S2_CAUCR/129-384--------------------------------------------------------------------------------
GLNA_CLOSA/105-353--------------------------------------------------------------------------------
O85177_AMYMD/104-383--------------------------------------------------------------------------------
Q98A06_RHILO/120-375--------------------------------------------------------------------------------
Q9I3F1_PSEAE/117-372--------------------------------------------------------------------------------
GLNA_THEMA/102-350--------------------------------------------------------------------------------
GLNA3_RHILP/97-349--------------------------------------------------------------------------------
GLNA_AZOBR/103-379--------------------------------------------------------------------------------
Q9AEL4_CORGT/87-338--------------------------------------------------------------------------------
GLNA_SULSO/104-381--------------------------------------------------------------------------------
GLNA2_DROME/116-365--------------------------------------------------------------------------------
GLNA_AZOVI/100-377--------------------------------------------------------------------------------
GLNA_ARCFU/116-402--------------------------------------------------------------------------------
GLNA2_FRAAL/84-326--------------------------------------------------------------------------------
Q9K665_BACHD/115-365--------------------------------------------------------------------------------
Q9SC91_MEDTR/118-374--------------------------------------------------------------------------------
Q986Q4_RHILO/115-369--------------------------------------------------------------------------------
Q9I6J3_PSEAE/114-370--------------------------------------------------------------------------------
GLNA_HAEIN/106-383--------------------------------------------------------------------------------
O88070_STRCO/130-380--------------------------------------------------------------------------------
Q9AMT8_BRAJP/106-360--------------------------------------------------------------------------------
GLNA_HELPJ/111-388--------------------------------------------------------------------------------
GLNA1_DROME/147-395--------------------------------------------------------------------------------
O31044_SYNPW/104-383--------------------------------------------------------------------------------
Q97FR9_CLOAB/167-449--------------------------------------------------------------------------------
Q98CH5_RHILO/124-382--------------------------------------------------------------------------------
GLNA_COLGL/109-354--------------------------------------------------------------------------------
GLNA_STAAW/107-356--------------------------------------------------------------------------------
GLNA_LACDE/107-356--------------------------------------------------------------------------------
Q9C213_NEUCS/546-806--------------------------------------------------------------------------------
Q9U307_CAEEL/115-364--------------------------------------------------------------------------------
P95692_STRAG/106-359--------------------------------------------------------------------------------
GLNA1_STRFL/101-378--------------------------------------------------------------------------------
PUUA_ECOLI/133-390--------------------------------------------------------------------------------
Q9FAR9_SHEVI/102-379--------------------------------------------------------------------------------
GLNA_METMP/110-357--------------------------------------------------------------------------------
Q98H15_RHILO/126-382--------------------------------------------------------------------------------
GLNA1_ALNGL/103-351--------------------------------------------------------------------------------
Q9RX64_DEIRA/111-359--------------------------------------------------------------------------------
Q27747_PARLI/109-358--------------------------------------------------------------------------------
GLNA_SULAC/107-383--------------------------------------------------------------------------------
Q9RDW7_LACRH/107-356--------------------------------------------------------------------------------
Q9A6W3_CAUCR/103-379--------------------------------------------------------------------------------
Q9SCP3_ARATH/507-763--------------------------------------------------------------------------------
P95529_PSEPU/135-401--------------------------------------------------------------------------------
Q9RDS6_STRCO/104-363--------------------------------------------------------------------------------
Q9A3R4_CAUCR/118-375--------------------------------------------------------------------------------
GLNA_THIFE/104-378--------------------------------------------------------------------------------
GLNA1_RHILV/103-379--------------------------------------------------------------------------------
Q9HT65_PSEAE/105-353--------------------------------------------------------------------------------
GLNA2_STRVR/89-333--------------------------------------------------------------------------------
Q98EM0_RHILO/120-375--------------------------------------------------------------------------------
GLNA_HALSA/115-364--------------------------------------------------------------------------------
Q53045_RHORU/103-379--------------------------------------------------------------------------------
GLNA_METCA/102-379--------------------------------------------------------------------------------
Q9I275_PSEAE/120-376--------------------------------------------------------------------------------
GLNA2_MYCTU/106-357--------------------------------------------------------------------------------
Q988Z8_RHILO/141-397--------------------------------------------------------------------------------
Q97W07_SULSO/106-349--------------------------------------------------------------------------------
Q44249_ACISP/140-407--------------------------------------------------------------------------------
LGSN_HUMAN/181-427--------------------------------------------------------------------------------
GLNA2_HORVU/165-413--------------------------------------------------------------------------------
O07752_MYCTU/111-358--------------------------------------------------------------------------------
Q9ZF05_9CYAN/195-477--------------------------------------------------------------------------------
GLNA_NEIGO/105-382--------------------------------------------------------------------------------
GLNA2_STRHY/85-330--------------------------------------------------------------------------------
Q9HT51_PSEAE/117-373--------------------------------------------------------------------------------
GLNA_AQUAE/105-379--------------------------------------------------------------------------------
Q9PCD9_XYLFA/137-414--------------------------------------------------------------------------------
GLNA_RHOCA/103-378--------------------------------------------------------------------------------
Q97S86_STRPN/106-358--------------------------------------------------------------------------------
O96463_SKECO/151-401--------------------------------------------------------------------------------
GLNA1_FRAAL/104-383--------------------------------------------------------------------------------
Q79VE3_CORGL/105-386--------------------------------------------------------------------------------

PF12224

Q311H8_DESDG/19-291-----------------------------------------------------------------...............
Q2HBV5_CHAGB/10-268-----------------------------------------------------------------...............
Q67LG7_SYMTH/9-197-----------------------------------------------------------------...............
A6G6Z1_9DELT/9-197-----------------------------------------------------------------...............
Q5LF69_BACFN/74-277-----------------------------------------------------------------...............
A6KZ00_BACV8/75-278-----------------------------------------------------------------...............
A7ALF5_9PORP/71-272-----------------------------------------------------------------...............
A5D072_PELTS/13-222-----------------------------------------------------------------...............
O86176_DICNO/4-232-----------------------------------------------------------------...............
Q1DBA6_MYXXD/2-223-----------------------------------------------------------------...............
B8I7I6_CLOCE/4-236-----------------------------------------------------------------...............
Q24NQ7_DESHY/4-240-----------------------------------------------------------------...............
A7VE77_9CLOT/4-240-----------------------------------------------------------------...............
A5N406_CLOK5/4-240-----------------------------------------------------------------...............
Q252G7_DESHY/4-240-----------------------------------------------------------------...............
A3DFX9_CLOTH/2-240-----------------------------------------------------------------...............
B0K6R6_THEPX/2-240-----------------------------------------------------------------...............
A3DG69_CLOTH/7-247-----------------------------------------------------------------...............
A7B449_RUMGN/13-255-----------------------------------------------------------------...............
A5KNA4_9FIRM/6-244-----------------------------------------------------------------...............
A7VHZ7_9CLOT/7-244-----------------------------------------------------------------...............
A6P0C2_9FIRM/7-247-----------------------------------------------------------------...............
A6NU92_9FIRM/5-246-----------------------------------------------------------------...............
A7VEY9_9CLOT/228-465-----------------------------------------------------------------...............
Q2LU27_SYNAS/194-396-----------------------------------------------------------------...............
A6NXI0_9FIRM/22-218-----------------------------------------------------------------...............
A6RSA1_BOTFB/8-281-----------------------------------------------------------------...............
A6RWE1_BOTFB/15-325-----------------------------------------------------------------...............
A6S997_BOTFB/48-350-----------------------------------------------------------------...............
A7EWG5_SCLS1/49-355-----------------------------------------------------------------...............
A6RWC8_BOTFB/15-290-----------------------------------------------------------------...............
A6F4K8_9ALTE/17-284-----------------------------------------------------------------...............
A1U270_MARAV/19-286-----------------------------------------------------------------...............
A3J9P7_9ALTE/19-286-----------------------------------------------------------------...............
Q1N2M0_9GAMM/21-286-----------------------------------------------------------------...............
Q21GI0_SACD2/15-285-----------------------------------------------------------------...............
A1SY20_PSYIN/16-290-----------------------------------------------------------------N..............
A6Q4S5_NITSB/14-275-----------------------------------------------------------------...............
Q1NPF7_9DELT/17-289-----------------------------------------------------------------...............
Q1QYE1_CHRSD/31-310-----------------------------------------------------------------VEF............
Q0A4Z7_ALHEH/26-298-----------------------------------------------------------------...............
A6GSC5_9BURK/17-282-----------------------------------------------------------------...............
Q2SFT5_HAHCH/19-280-----------------------------------------------------------------...............
A4A8R3_9GAMM/16-277-----------------------------------------------------------------...............
A3WME7_9GAMM/21-284-----------------------------------------------------------------...............
Q5QYT8_IDILO/18-278-----------------------------------------------------------------...............
A6FM81_9RHOB/18-271-----------------------------------------------------------------...............
A6DW96_9RHOB/16-269-----------------------------------------------------------------...............
A3TW22_9RHOB/18-271-----------------------------------------------------------------...............
A3K2K5_9RHOB/17-270-----------------------------------------------------------------...............
Q0FIK0_9RHOB/23-278-----------------------------------------------------------------...............
Q0AQY0_MARMM/8-327-----------------------------------------------------------------GTELDHAEGGIAKVV
Q2L5I9_CLOPF/180-403-----------------------------------------------------------------...............

PF04262

GSH1_PSEAE/6-381--------------------------------------------------------------------------------
Q9RDU4_PSESP/6-381--------------------------------------------------------------------------------
GSH1_ECOLI/6-381--------------------------------------------------------------------------------
GSH1_CLOAB/6-390--------------------------------------------------------------------------------
GSH1_BUCAI/6-382--------------------------------------------------------------------------------
GSHAB_PASMU/1-337--------------------------------------------------------------------------------
GSH1_VIBCH/5-379--------------------------------------------------------------------------------

PF14395

B7DSA7_9BACL/212-472--------------------------------------------------------------------------------
C0ZEZ5_BREBN/171-428--------------------------------------------------------------------------------
B0TB99_HELMI/204-455--------------------------------------------------------------------------------
C6CUQ2_PAESJ/144-402--------------------------------------------------------------------------------
D3E8P9_GEOS4/163-421--------------------------------------------------------------------------------
Q0AXS0_SYNWW/193-453--------------------------------------------------------------------------------
B0TBC1_HELMI/214-474--------------------------------------------------------------------------------
B0TET0_HELMI/208-468--------------------------------------------------------------------------------

PF09899

A3HSI4_9BACT/278-1112.PDLSHEEFKTKPPLN.......................SKRIFKTALVVEAREGKLFVFFPPV.ST.MEQYLDLVQAVE
Q1B9K6_MYCSS/283-1101AEQTDAEVEDADSLPT.............................TAMVTEVRDRVLYVFLPPT.EE.LEHFVDLVGRIE
Q4ZYW4_PSEU2/275-1090SDSLTSALKSTDTDAE...............RAPKIDESADWLTRTALCAEAREGRLYLFMPPL.QK.LEEYLELVAVIE
A0L4M6_MAGSM/274-1111TKTAKKGKEPAIPPHP......................QVETFMQTALCVEVREGRLYLFIPPL.TH.VEGFLALVSVIE
Q2W952_MAGSA/302-1132GAPKATVLQQVPVDLR...............PVETAKGLVSENVRTALCVQPRDGRLNVFLPPV.ET.AEQYLDLIEAVE
Q11VA3_CYTH3/275-1141TPARRKINEAVEEEKQ.....HSKHKKIEKEIKEAQPLFYVPLIKTALCVEVRDGILYVFLPPL.KY.IEHYLDLLTSIE
A2VKS3_MYCTU/329-1149PHTDRAVVEDPETAPT.............................TALVAEVRGGLVHIFLPPT.DA.LEHFIDLVARVE
A0NMX9_9RHOB/275-1105HFTAAEGQQDRQEQTL..................PEGELGEASVRTALSVEARDGRLCVFMPPV.ER.IEDYLELISVAE
A4XQ07_PSEMY/275-1095PQSA............................RPACGQSAASIVRTALCAEPREGRLYLFMPPL.AH.LEDYLELVAAIE
A9W7N2_METEP/297-1111PKGADRANGAGMEGVA...........................VRTALSVEPRDGVLCVFMPPV.ER.ADDYIDLVGHLE
Q47BP1_DECAR/275-1115MQSRRAGSSASGQGEG.......RAWEKPTDTVPGFKESAGWITRLAMCAEPRDGRLYVFMPPT.EK.LDDYLEIVAAVE
Q2SNA7_HAHCH/275-1090LKPLSKAESRPLAEMA...........................IHTAMCAEVREGYLHAFMPPV.ST.LEEYVALLDALS
Q31N62_SYNE7/1-727.....................................LAPPNSLKLALVVRQVEQQLRVFLPPL.IS.VPAYLQLVQAIA
A8LRF2_DINSH/275-1107SSTASEGGETQTAQYL.....................TEIGGPVRTAISVEPREGKLCVFLPPV.ES.AADYLELLAATE
Q1MBT5_RHIL3/277-1103SFHADESNRGRIEQTL.....................GELRGAVRTAMSVEPRDGRLCVFMPPV.ER.IEDYLELIAAAE
Q89QZ5_BRAJA/275-1084EAPPRVAPEHLNTSIP...........................VRTAMSVEVRDGVLCAFMPPV.ER.IEDYLELVAALE
Q1YG30_MOBAS/275-1127EQTMEGPAGTMRQSIGSAGMTSSAGTAAPTPPAEPSPNAILGAVRTAIAIEPRDGKLCVFMPPL.ET.AEAYLDLLGAVE
A3VDN8_9RHOB/278-1112EAQGAEPAQEIVEQVL.....................DTVGGVVRTALSVEPRDGRLCVFMPPT.ES.VDDYLELVAAAE
A6C0B7_9PLAN/274-1115GNVQHQVLQRVGAGGG......FDTIDLEQEPEAETPPLEPAVIRTAMCFEARDGVLHIFMPPV.DH.LESYLELLAEIE
A3XIL1_LEEBM/275-1116AEKPKKKNGKVDHNAD....................KKEKNPFARTAICAEVRDKKLYLFLPPL.DN.AETFIDLMASVE
A3PN00_RHOS1/275-1102SFTASAPGQTMVEQIL......................GDEGAVRTALAVEVRDGRLCIFMPPV.EA.VEDYLDLLTAAE
A1U538_MARAV/275-1097WNSHSQAGRPSSELKP.................PAKGKSAPEIVRTALCVEPREGILRVFMPPL.GE.LEPYLALVSAIE
A1VL54_POLNA/295-1117LKARKPAPVDGNPEPR.........................DVIHTALCVQVRNGRLHVFMPPV.QR.IEDYLALVTSVE
Q21G23_SACD2/275-1112AEPVKEPNAKQTQTVP..........................VVRTALCVESRKGKLHLFIPPI.PL.LDDYVALIAAIE
A6GT43_9BURK/286-1103KPSAKASVASVADDKA.................PVLKESATHIVRTAMCVQARNGHLYVFMPPL.EV.LDDYLELVARIE
Q7UKP5_RHOBA/275-1113DESRERIHPQVLDEED.................DDNLPTSEDVVQTALCVECRYGRLYVFMPPT.QR.IEDYLDLVTAVE
A4TX61_9PROT/275-1111PSDARVIGQNVGKPQA...............LRQTDKGMVSDNVRTALCIQPREGHLCVFLPPV.ET.AEQYLDLIEAIE
B0SXH9_CAUSK/275-1086PSAATSPH...................................VRTAIIFEPRGGVLYVFMPPV.ET.VEDYLELVAEVE
Q2RR87_RHORT/275-1085PPPLAAAPPKDSRSDA..........................VVRTALCVEARGGRLHVFMPPA.ET.LENYLALLHEVE
A1K5W6_AZOSB/275-1124PAAGGMPGSGGEDGNS...NSKARSQAEITDRKPQGKQSAGWITRTAMCAEARNGTLYVFMPPV.AT.LEDYLEIAAAVE
Q1ND53_9SPHN/280-1118DAEGGASAQDRVEQVI.......................IEGAVRTAITVEPHGAHLSVFLPPV.RE.LEDYLELIAQVE
Q218C6_RHOPB/275-1085AAAKSSAEKPKKKQVP...........................VRTAMSIEVRDGVLCAFMPPV.EK.LEDYLELIAAVE
A5VFM9_SPHWW/295-1120APAAGAAAQERQEQVL.......................IEGAVRTAITVEAKDGHVAVFLPPT.ER.LEDYLELIAEIE
Q98HG6_RHILO/275-1114SFTAATGQQDRVEQEI.....................TEIGGAVRTALSVEPRDGRLCVFMPPV.EA.LEDYLELVAASE
C0AE57_9BACT/275-1117LAPGHGPGQRAQQPDP..............ARRPAEGESAPHIIRTALCVQPRDGRLHVFMPPI.TL.AEDYLDLISGIE
B0UHH5_METS4/274-1075..SRPAARSRPVPGVP...........................VRTALAIEPRDGAVCVFMPPV.ER.ADEYVELVATLE
C1DJA3_AZOVD/275-1116TGEGPGSGASPRSLGA.......TGEGLRQATAPAPFESAAGIVRTALCVEPRNGRLYLFMPPL.ER.LEDYLELVAAIE
A3YWY7_9SYNE/14-726........................................EGVLRQVLTLEVSRNGWNLFLPPLPRQPLEQLLHLIAEAS
A6VTZ0_MARMS/275-1113LESVAKQHFAKKPAAP................ALAPEKTLKNVIRTTLCIEPRDGRLHIFMPPM.TH.LEHFVDVLEQLE
Q07VI7_RHOP5/275-1098GDGERGNRQERIEQVL...................SPSGEDATVRTALSVESRDGRLTVFLPPT.EK.LEDWLELVACVE

PF03136

PAFA_CORGL/10-445--------------------------------------------------------------------------------
Q7UWL2_RHOBA/26-608--------------------------------------------------------------------------------
A6G895_9DELT/3-562--------------------------------------------------------------------------------
Q7WZ91_9ACTO/5-426--------------------------------------------------------------------------------
PAFA_KINRD/3-425--------------------------------------------------------------------------------
A3TL35_9MICO/3-425--------------------------------------------------------------------------------
PAFA_MYCS2/3-424--------------------------------------------------------------------------------
PAFA_ARTS2/3-425--------------------------------------------------------------------------------
PAFA_CORDI/11-437--------------------------------------------------------------------------------
PAFA_CORJK/6-436--------------------------------------------------------------------------------
PAFA_BIFLO/27-456--------------------------------------------------------------------------------
A3EPC1_9BACT/3-425--------------------------------------------------------------------------------
Q828J1_STRAW/4-459--------------------------------------------------------------------------------
A8LH56_FRASN/73-531--------------------------------------------------------------------------------
Q47NY8_THEFY/10-466--------------------------------------------------------------------------------
A0LU48_ACIC1/2-458--------------------------------------------------------------------------------
A1SK11_NOCSJ/4-459--------------------------------------------------------------------------------
A6W968_KINRD/4-497--------------------------------------------------------------------------------
Q5YUX0_NOCFA/2-457--------------------------------------------------------------------------------
A4FBX9_SACEN/2-456--------------------------------------------------------------------------------
A1R6Q5_ARTAT/19-506--------------------------------------------------------------------------------
Q8NQD9_CORGL/2-460--------------------------------------------------------------------------------
Q8FTE4_COREF/2-463--------------------------------------------------------------------------------
Q6NH93_CORDI/2-457--------------------------------------------------------------------------------
Q4JVP6_CORJK/4-450--------------------------------------------------------------------------------
A7BC88_9ACTO/4-485--------------------------------------------------------------------------------
Q8G3G5_BIFLO/4-488--------------------------------------------------------------------------------
A7A4U7_BIFAD/16-491--------------------------------------------------------------------------------
A3EPC5_9BACT/10-458--------------------------------------------------------------------------------
A3ETM5_9BACT/5-463--------------------------------------------------------------------------------
A3ETM1_9BACT/26-469--------------------------------------------------------------------------------

PF00217

KTRC_SCHMA/141-382--------------------------------------------------------------------------------
Q7PYN5_ANOGA/203-445--------------------------------------------------------------------------------
Q4AED1_9ANNE/113-361--------------------------------------------------------------------------------
Q4AED2_9ANNE/113-360--------------------------------------------------------------------------------
KCRB_HUMAN/120-367--------------------------------------------------------------------------------
Q1Q1E9_9BACT/18-252--------------------------------------------------------------------------------
KARG_LIMPO/114-356--------------------------------------------------------------------------------
A3DGD2_CLOTH/9-244--------------------------------------------------------------------------------
Q9VST4_DROME/143-385--------------------------------------------------------------------------------
Q4AEC5_9ANNE/149-396--------------------------------------------------------------------------------
Q9NKV5_OCTVU/106-347--------------------------------------------------------------------------------
Y120_BACSK/19-255--------------------------------------------------------------------------------
KARG_LIOJA/108-349--------------------------------------------------------------------------------
A6QBA0_SULNB/100-342--------------------------------------------------------------------------------
Q8MWR8_9BIVA/125-367--------------------------------------------------------------------------------
A3ZT72_9PLAN/20-254--------------------------------------------------------------------------------
A7XZJ5_GLYDO/114-356--------------------------------------------------------------------------------
Q6XLN0_HETGL/163-406--------------------------------------------------------------------------------
Q4AEC8_RIFPA/122-369--------------------------------------------------------------------------------
Q177S3_AEDAE/202-445--------------------------------------------------------------------------------
A6XH18_9METZ/115-362--------------------------------------------------------------------------------
A6CSY9_9BACI/19-254--------------------------------------------------------------------------------
KCRF_STRPU/908-1155--------------------------------------------------------------------------------
Q5TP29_ANOGA/189-444--------------------------------------------------------------------------------
Y282_PELTS/19-256--------------------------------------------------------------------------------
Y860_HALOH/19-252--------------------------------------------------------------------------------
Q2B1J8_9BACI/19-255--------------------------------------------------------------------------------
Q1HBJ2_BRABE/114-362--------------------------------------------------------------------------------
KARG_HALMK/111-353--------------------------------------------------------------------------------
A6XH11_9METZ/115-365--------------------------------------------------------------------------------
Y102_BACHD/19-254--------------------------------------------------------------------------------
Q6F4H6_HEDDI/131-378--------------------------------------------------------------------------------
A6XH14_CLAPR/119-361--------------------------------------------------------------------------------
Q760P7_ANABR/106-348--------------------------------------------------------------------------------
A4F2K7_9CUCU/128-370--------------------------------------------------------------------------------
A6F800_9GAMM/114-356--------------------------------------------------------------------------------
Y077_GEOTN/19-255--------------------------------------------------------------------------------
KCRS_RAT/154-401--------------------------------------------------------------------------------
KARG2_CAEEL/117-359--------------------------------------------------------------------------------
Q6BDZ3_9BILA/120-367--------------------------------------------------------------------------------
Q67ER6_CHAVR/889-1136--------------------------------------------------------------------------------
O45011_CAEEL/156-398--------------------------------------------------------------------------------
Q6BDZ2_POLMI/114-361--------------------------------------------------------------------------------
Q6RSH2_TETAR/120-367--------------------------------------------------------------------------------
Q8T6T7_URECA/107-354--------------------------------------------------------------------------------
KCRF_STRPU/161-408--------------------------------------------------------------------------------
A7RNR3_NEMVE/152-399--------------------------------------------------------------------------------
A7S6V8_NEMVE/867-1114--------------------------------------------------------------------------------
Q7T1J2_CHAAC/120-367--------------------------------------------------------------------------------
A6XH13_9METZ/149-396--------------------------------------------------------------------------------
Q67ER6_CHAVR/504-751--------------------------------------------------------------------------------
Y092_OCEIH/19-255--------------------------------------------------------------------------------
Q4AED0_SIPCU/113-355--------------------------------------------------------------------------------
A0D308_PARTE/131-376--------------------------------------------------------------------------------
Y701_CHLPN/18-250--------------------------------------------------------------------------------
Y194_CLOK5/10-245--------------------------------------------------------------------------------
Q7UMV3_RHOBA/22-257--------------------------------------------------------------------------------
Q6APG0_DESPS/133-375--------------------------------------------------------------------------------
Q9NKV6_9MOLL/108-349--------------------------------------------------------------------------------
Y070_BACP2/19-254--------------------------------------------------------------------------------
Q3A9N0_CARHZ/16-253--------------------------------------------------------------------------------
KCRF_STRPU/534-781--------------------------------------------------------------------------------
Q5L768_CHLAB/18-250--------------------------------------------------------------------------------
Q760P6_CRAGI/107-349--------------------------------------------------------------------------------
A7RGZ5_NEMVE/118-356--------------------------------------------------------------------------------
A1HTJ5_9FIRM/19-255--------------------------------------------------------------------------------
B1YGS1_EXIS2/18-248--------------------------------------------------------------------------------
Y110_BACA2/19-254--------------------------------------------------------------------------------
Y2442_CLOPE/7-240--------------------------------------------------------------------------------
Q4W3A2_SUBDO/130-379--------------------------------------------------------------------------------
Y3134_SYMTH/19-256--------------------------------------------------------------------------------
Q9BKE8_CIOIN/114-361--------------------------------------------------------------------------------
Y2328_THETN/3-239--------------------------------------------------------------------------------
A6M9J4_LOCMI/114-356--------------------------------------------------------------------------------
Y2368_SYNWW/20-257--------------------------------------------------------------------------------
A8MLV0_ALKOO/9-245--------------------------------------------------------------------------------
B8G1T2_DESHD/17-252--------------------------------------------------------------------------------
Q73L28_TREDE/13-247--------------------------------------------------------------------------------
Q4MIA1_BACCE/19-254--------------------------------------------------------------------------------
Q4AEC6_9ANNE/106-353--------------------------------------------------------------------------------
A5I7N7_CLOBH/9-243--------------------------------------------------------------------------------
Q67E02_GLOPY/117-364--------------------------------------------------------------------------------
Y3260_BACLD/19-254--------------------------------------------------------------------------------
Y3190_CLOAB/9-244--------------------------------------------------------------------------------
A7YVI5_TOXCA/157-399--------------------------------------------------------------------------------
Y161_MOOTA/16-253--------------------------------------------------------------------------------
A6XH19_9METZ/153-400--------------------------------------------------------------------------------
Y046_CHLMU/17-249--------------------------------------------------------------------------------
Y1086_CLONN/9-244--------------------------------------------------------------------------------
Q9XZF5_CHAVR/108-356--------------------------------------------------------------------------------
KLOM_EISFO/108-355--------------------------------------------------------------------------------
Q67ER6_CHAVR/136-383--------------------------------------------------------------------------------
Q38EV2_TRYB2/136-378--------------------------------------------------------------------------------
A7RQU9_NEMVE/116-364--------------------------------------------------------------------------------
Y2634_CLOTE/8-241--------------------------------------------------------------------------------
Q14TA8_9CNID/153-400--------------------------------------------------------------------------------
Q296Q2_DROPS/207-449--------------------------------------------------------------------------------
A7S6V8_NEMVE/487-734--------------------------------------------------------------------------------
A0DI85_PARTE/130-381--------------------------------------------------------------------------------
Q291M9_DROPS/185-440--------------------------------------------------------------------------------
A3IET5_9BACI/18-253--------------------------------------------------------------------------------
Q9BLC7_APLKU/109-351--------------------------------------------------------------------------------
KARG_STIJA/110-358--------------------------------------------------------------------------------
KCRM_TORMA/120-367--------------------------------------------------------------------------------
A6XH09_9METZ/111-359--------------------------------------------------------------------------------
Y179_DESRM/19-256--------------------------------------------------------------------------------
Q8N0P4_9BIVA/478-719--------------------------------------------------------------------------------
A7S6L6_NEMVE/110-357--------------------------------------------------------------------------------
A7RER2_NEMVE/138-389--------------------------------------------------------------------------------
Q4AEC7_RIFPA/105-352--------------------------------------------------------------------------------
Q75ZZ3_LAMJA/120-367--------------------------------------------------------------------------------
Q17MS1_AEDAE/186-440--------------------------------------------------------------------------------
A6TWL7_ALKMQ/9-245--------------------------------------------------------------------------------
Q1DA50_MYXXD/88-329--------------------------------------------------------------------------------
Y164_STAEQ/16-244<