Sequence alignment for CL0288

PF05544

PRCM_HUMAN/22-352VVDMHTG-----GEPLRIVLAGCPEVSGPTLLAKRRYMRQHL..DHVRRRLMFEPRGHRDMYGAVLVPSE-------LPD
A9CFV0_AGRT5/7-330CIDSHTC-----GNPVRLVAGGGPLLPHLPISERRDLFVRNH..DWVRQALMFEPRGHDIMSGAVIYPAY-------RDD
HYPRE_BRUME/8-331CVDGHTC-----GNPVRLVAGGGPNLNGSTMMEKCAHFLAEY..DWIRTGLMFEPRGHDMMSGSILYPPT-------RPD
Y1255_PSEAE/9-334IVSCHAE-----GEVGDVIVGGVAAPPGATLWEQSRWIARD...QDLRNFVLNEPRGGVFRHANLLVPAK-------DPR
Q8P833_XANCP/6-311VIDSHTA-----GEPTRVVLAGFPDLGDGDLAQCRERFRSDF..DHWRSAIACEPRGSDTMVGALLLPPR-------DPS
HYPRE_PSEAE/6-313IIDSHTG-----GEPTRLVIGGFPDLGQGDMAERRRLLGERH..DAWRAACILEPRGSDVLVGALLCAPV-------DPE
A9CH01_AGRT5/9-334VISAHAE-----GEVGDVIVGGVKPPPGETIWEQSRFIARD...ETLRNFVLNEPRGGVFRHVNLLVPPK-------HPD
Q988B5_RHILO/9-333VVGCHAE-----GEVGDVIIGGVLPPAGRTMMDKMITMERDH..DHIRRMLICEPRGSVARHVNLLVPST-------RED
A9CKB4_AGRT5/9-333LLDVHCE-----GEIGRVVTGGAPKIPGNTVAEQLHWMNTDPQGEALRRFLTLEPRGTPMGSVDLLLPPK-------HPD
Y1586_BRUME/9-333IVGCHAE-----GEVGDVIVGGVAPPPGETVWEQSRFIAND...ETLRNFVLNKPRGGVFRHVNLLVPPK-------DPR
PRCMA_TRYCC/78-420CIDMHTE-----GEAARIVTSGLPHIPGSNMAEKKAYLQENM..DYLRRGIMLEPRGHDDMFGAFLFDPI-------EEG
Q93RX9_STRCO/9-332AVDSHTE-----GMPTRVITGGVGVLPGATMFERRQRFVAER..DHLRTLLMCEPRGHASMSGAILQPPT-------RPD
Q8PKE4_XANAC/9-335VVDCHAE-----GEVGKVIVGGVGNIPGTTMFEKKLYLEQHR..DDIRKLVLQEPRGATWHNANIILPPS-------HPE
Q92WS1_RHIME/8-331CIDGHTC-----GNPVRLVSGGGPRLEGANMLEKRAHFLKEF..DWIRTGLMFEPRGHDMMSGSILYPPT-------RPD

PF02567

Q9SY11_ARATH/12-290-VDAFTDSAFK.GNPAAVCFLNDDN...ERDDTWLQSLAAEF----------------NISETCFLIPITG.......FQ
Y2735_MYCBO/8-225-LRVFTDSDGNFGNPLGVINASK......VEHRDRQQLAAQS----------------GYSETIFVDLPS.......PGS
YFHB_BACSU/9-289-YEAFTSSPGK.GNPAGVVLQGD.....DYTEDEMQIIAERA----------------GYSETSFIRK.........SES
PHZF_PSEAE/7-274-IDAFASEPLQ.GNPVAVFFDCD.....DLSGERMQRMAREM----------------NLSESTFVLRP........QQD
Q9SY10_ARATH/21-309-VDAFTESAFK.GNQAAVCFLEEDH...ERDDVWLQSMASEF----------------DLPLTCFLIPIP......GSEP
YDDE_ECOLI/8-291-VDAFTSQPFR.GNSAGVVFPAD.....NLSEAQMQLIAREL----------------GHSETAFLLHS.........DD
Q9ZVS2_ARATH/12-282-VDAFAESAFK.GNPAAVCFLEDDN...ERDDAWLQSLATEF----------------NISETCFLTPII.......GDL
YHI9_YEAST/10-290-VDVFTEKPFM.GNPVAVINFLEIDE.NEVSQEELQAIANWT----------------NLSETTFLFKPS.......DKK
Q54378_STRLN/9-281-VDMFAHEPFS.GSQLTVVPDAD.....GLTDAAMEALAREV----------------NTPETAFVLPPAD.......PG
PHZF_PSECL/7-274-IDAFASAPLE.GNPVTVFFDAD.....DLSATQMQRIAREM----------------NLSETTFVLKPR........NC
Y1330_DEIRA/21-304-VAAFTTVPGQ.GNRAGVVLDAG.....ELTGEQMQRLAAFL----------------EAPETVFVTRLSD.........
Q9RJQ0_STRCO/11-286-YSAFTDDPAG.GNPAGVVLDAS.....GLDDPAMLAIAAEV----------------GYSETAFVTGGD.......AER
Y1019_SYNY3/8-300-LDVFTDQLFG.GNPLAVFPDAE.....GLTDGQMQKIAAEI----------------NYSETVFVLPPV.......TET
Q9SDD7_ORYSJ/11-305-VDAFAAEPFK.GNPAAVCLLEGEDAAAAADERWMQSVAAEF----------------NLSETAFLIRDPSSSAAAADAA

PF01678

DAPF_HAEIN/3-124FSKMH-------GLGNDFVVVDGVTQ...NVFFT.....PET--------------------------------------
DAPF_METTH/4-131FSKMH-------GLGNDYVVIDESAQ...ECIPEDKK..PEF--------------------------------------
DAPF_BACSU/6-131FTKMH-------GLGNSYIYVNQFEE...QLPEEK...LSEI--------------------------------------
DAPF_MYCTU/157-275LAVDV-------GNPHLACVDSQLTV...DGLAALD....VG--------------------------------------
DAPF1_NOSS1/152-267CAATI-------GNPHCVILLDDINS...EVARN.......F--------------------------------------
DAPF_PSEFL/5-126FTKMH-------GLGNDFMVLDLVSQ...HAHIL.....PKH--------------------------------------
DAPF_METJA/165-285SVVNV-------GNPHAVIFVEDNN....IDLDFVREHLDVI--------------------------------------
DAPF_MYCTU/3-142FAKGH-------GTQNDFVLLPDVDA...ELVLT.....AAR--------------------------------------
DAPF_ARCFU/5-128FTKMH-------GNGNDFVLIDEFEG...VIVGEEEK..PRF--------------------------------------
DAPF_HELPY/3-118FYKYS-------GSGNDFLIVQSFKK...KDFSN.......L--------------------------------------
DAPF_AQUAE/147-267VFINT-------GVPHFVVPVEDVEK...VNVIK......LG--------------------------------------
DAPF_ECOLI/151-267GVVSM-------GNPHCVIQVDDVDT...AAVET.......L--------------------------------------
DAPF_METTH/159-277TALSV-------GNPHAIIFVDDAEG...VDLDR.......L--------------------------------------
DAPF1_NOSS1/3-124FYKYH-------ALGNDYLVINPQDL...KFPLT.....PEK--------------------------------------
DAPF_PSEFL/153-269AAVSM-------GNPHAVLRVADINS...APVHE.......L--------------------------------------
DAPF_HELPY/144-258YLIDT-------GVPHLVGFVENKEG...LNSLN.......T--------------------------------------
DAPF_STRCO/152-274RNVNM-------GNPHAVAFVADLDH...AGDLY.......A--------------------------------------
DAPF_HAEIN/151-267GAVSM-------GNPHCVVQVDDIQT...ANVEQ.......L--------------------------------------
DAPF_ARCFU/153-266YAANT-------GVPHVAVFVDSLDF....DIVP.......L--------------------------------------
DAPF_SYNY3/5-126FSKYH-------GLGNDFILVDNRQS...TEPCLT....PDQ--------------------------------------
DAPF_AQUAE/3-132FWKLQ-------GSGNDFVVIDDRDEKLESFLKERGVSKEDF--------------------------------------
DAPF_METJA/3-130FTKMH-------ALGNDYIVINEFDG...EKVKEEEK..AEF--------------------------------------
DAPF_ECOLI/3-124FSKMH-------GLGNDFMVVDAVTQ...NVFFS.....PEL--------------------------------------
DAPF_SYNY3/156-272TCVSM-------GNPHCLTFVDDVDS...LNLTE.......I--------------------------------------
DAPF_MYCLE/161-279VAVDV-------GNPHLACMDPQLSL...EELAALD....LG--------------------------------------
DAPF_STRCO/7-135FLKGH-------GTENDFVIVPDPEN...ALDLP.....PAA--------------------------------------
DAPF_MYCLE/3-142FAKGH-------GTQNDFVVLPDVEA...DVTFT.....AAQ--------------------------------------
DAPF_BACSU/160-277TAVSM-------GNPHIVFPIADIEQ...APLTT.......L--------------------------------------

PF04303

YRAM_BACSU/1-361MVKTNVTIMRGGTSKGVFFHESAMPNNK....NEWEPFLLDVMGSPDKR..QIDGLGGGNSLTSKVAIIKKAYTSDIDVH
Q9I5E5_PSEAE/6-391QIRIPATYLRGGTSKGVFFRLEDLPESCRVPGEARDRLFMRVIGSPDPYAAHIDGMGGATSSTSKCVILSKSSQPGHDVD
Q987N7_RHILO/9-356LLAIPCVLMRGGTSKGPFFLANDLPADA....IERDKILLSVMGSGHPL..QIDGIGGGNPVTSKVAIVGPASIPGADVD
YBHH_SHIFL/1-350MKKIPCVMMRGGTSRGAFLLAEHLPEDQ....TQRDKILMAIMGSGNDL..EIDGIGGGNPLTSKVAIISRSSDPRADVD
Q9KSB9_VIBCH/7-389QIRIPATYMRGGTSKGVFFRLNDLPLEAQLPGAARDALLLRVIGSPDPYGKQIDGMGGATSSTSKTVIVSASSRTDHDVD
Q9PDY6_XYLFA/22-406QCRIPATYLRGGTSKGVFFRLEELPPACRVPGPARDALLLRVIGSPDPYGKQIDGMGGGSSSTSKVVIIAPSAYPNHDVD

PF05544

PRCM_HUMAN/22-352AHLGVLFLHNEGYS--SMCGHAVLALGRFALDFGLVPAPPAGTREARVN..IHCPCGLVTA-----------FVACEDG.
A9CFV0_AGRT5/7-330CDFAVIFIEVSGCL--PMCGAGTIGLVTAAIEEGLVTPR...IPG.RLS..IETPAGKVDI-----------QYDKPGE.
HYPRE_BRUME/8-331CDVAVLFIETSGCL--PMCGHGTIGTVTMAIEQGLVTPK...TPG.KLN..LDTPAGLVAI-----------EYEQDGQ.
Y1255_PSEAE/9-334AQMGWIIMEPADTP--PMSGSNSLCVATVLLDSGILPMR...EPLTRLL..LEAPGGLIEA-----------RAECRDG.
Q8P833_XANCP/6-311ACTGVIFFNNVGYL--GMCGHGTIGVVRTLAELGRIAPG...QHR......IETPVGTVGV-----------ALADDGT.
HYPRE_PSEAE/6-313ACAGVIFFNNSGYL--GMCGHGTIGLVASLAHLGRIGPG...VHR......IETPVGEVEA-----------TLHEDGS.
A9CH01_AGRT5/9-334ADAAFIIMEPEDTP--PMSGSNSICVSTVLLDGGIVPMQ...EPETHML..LEAPGGLVKV-----------RAECRNG.
Q988B5_RHILO/9-333CAAGAIIMEPTEYP--PMSGSNTICVATVLLETGMVPMQ...EPETRFK..LDMPGGVIEV-----------RAQCRDG.
A9CKB4_AGRT5/9-333AHAAFVILQPDQAH--ASSGSNSICATTALLESGMVEMQ...EPETVII..LETAAGLVKA-----------TATCRDG.
Y1586_BRUME/9-333AQMGFIIMEPADTP--PMSGSNSICVSTVLLDSGIIAMQ...EPVTHMV..LEAPGGIIEV-----------EAECRNG.
PRCMA_TRYCC/78-420ADLGMVFMDTGGYL--NMCGHNSIAAVTAAVETGIVSVP...AKATNVPVVLDTPAGLVRG-----------TAHLQSGT
Q93RX9_STRCO/9-332ADYGVLFIEVSGCL--PMCGHGTIGVATVLVETGMVEVT...EPETTVR..LDTPAGLVTA-----------RVRVRDG.
Q8PKE4_XANAC/9-335ASMGFVILEATEYP--AMSGSNTICVATVLLETGILPMQ...EPITDLV..LEAPAGLIRV-----------RCDCKDG.
Q92WS1_RHIME/8-331CDVAVLFIETSGCL--PMCGHGTIGTITMGIENGLITPR...EPG.KLS..IDAPAGKVDI-----------TYRQEGR.

PF02567

Q9SY11_ARATH/12-290ARFSLRWFTPLAEV--DLCGHATLASAHCLFSNGLVD...--..SDMVE--FVTRSGILTAK...RVSDTSELSDGEVK-
Y2735_MYCBO/8-225TTAHATIHTPRTEI--PFAGHPTVGASWWLRERG......--..TPINT--LQVPAGIVQV............SYHGDL-
YFHB_BACSU/9-289ADLELRYFTPGHEM--NLCGHATVASLYALCEKGMLE...--.SGKTYS--IQTKAGILPVK...........ISEKDG-
PHZF_PSEAE/7-274GDARIRIFTPVNEL--PFAGHPLLGTAIALGAET......--.DKDRLF--LETRMGTVP............FALERQD-
Q9SY10_ARATH/21-309PRFLLRWFTAVAEM--DICGHATLASAHSIFSNSLVG...--.SSDTVE--FSTNSGILTAK..........RLSDCDS-
YDDE_ECOLI/8-291SDVRIRYFTPTVEV--PICGHATVAAHYVRAKVLGL....--.GNCTIW--QTSLAGKHRV...........TIEKHND-
Q9ZVS2_ARATH/12-282PRFRLRWFTPVAEV--DLCGHATLASAHVLFSTGLV....--.GSETVE--FDTLSGILTAK..........HLKNDDD-
YHI9_YEAST/10-290YDYKLRIFTPRSEL--PFAGHPTIGSCKAFLEFTKNT...--.TATSLV--QECKIGAVPI.................T-
Q54378_STRLN/9-281ATYRVRVFTLAGET--PFGGHSSLGTAVTLVRLGR.....--.......--..VAPGAVAQECGSRLHSLSVGPDKGTV-
PHZF_PSECL/7-274GDALIRIFTPVNEL--PFAGHPLLGTAIALGAHT......--.DNHRLF--LETQMGTIA............FELERQN-
Y1330_DEIRA/21-304GLGRVRYFTPTQEV--DFCGHATVALGRVLAQAGRW....--.RGEALE--LETLAGRIPLR...........LVLDAG-
Q9RJQ0_STRCO/11-286RRFRVRYFSPLAEV--AFCGHATVALAVALAERLG.....--..PGEVV--LDTPAGEIPV...........STAVDGT-
Y1019_SYNY3/8-300GNFRLRIFTPKREL--DFAGHPTIGTTYLLGLLQPPSP..--LVTTTWQ--LEEPVGLVPV.........TLHYKQGQL-
Q9SDD7_ORYSJ/11-305PRFRLRWFTPVAEV--NLCGHATLASAHFLFTTVLAKQQH--AAAAMVE--FVTRSGILTAK.KVPAPPPPANDGGVPG-

PF01678

DAPF_HAEIN/3-124--------IRRLAN--RHCGIGFDQLLIVEAP...----------------.YDPELDFHYR..........IFNADGS-
DAPF_METTH/4-131--------VREVCT--RGFSVGADGVIFVQ.P...----------------.ASGEGDIRFR..........IFNADGS-
DAPF_BACSU/6-131--------AIQVSS--VYTGIGSDGMILIC.....----------------.PSDQAPVKMR..........IFNNDGS-
DAPF_MYCTU/157-275--------APVSFD--GAQFPDGVNVEVLT.....----------------.APVDGAVWMR..........VHERGVG-
DAPF1_NOSS1/152-267--------GPIFEG--YPLFPNRTNVQFMK.....----------------.VLDRSTIQIE..........IWERGAG-
DAPF_PSEFL/5-126--------AKQWGD--RHTGIGFDQLLIVEAP...----------------.NNPDVDFRYR..........IFNADGS-
DAPF_METJA/165-285--------GKEIEH--HEAFPERINVHFVK.....----------------.VLNPNEIRIV..........TWERGAG-
DAPF_MYCTU/3-142--------VAALCD--RRKGLGADGVLRVTTAGAA----------------QAVGVLDSLPEGVRVTDWYMDYRNADGS-
DAPF_ARCFU/5-128--------VRAVCH--RNFGVGADGALFVQ.....----------------.PSQKADVRFR..........YFNSDGS-
DAPF_HELPY/3-118--------AKQVCH--RHEGFGADGLVVVL.....----------------.PSKDYDYEWD..........FYNSDGS-
DAPF_AQUAE/147-267--------RAIRFH--EEFQPKGTNVNFVQ.....----------------.PVSEDTIKVR.........TYERGVES-
DAPF_ECOLI/151-267--------GPVLES--HERFPERANIGFMQ.....----------------.VVKREHIRLR..........VYERGAG-
DAPF_METTH/159-277--------GPAIEN--HPLFPERINVHFVE.....----------------.VVSPSEIIMV..........TWERGAG-
DAPF1_NOSS1/3-124--------IKIICH--RNFGIGSDGILLGP.....----------------LASTKAQFALR..........IFNPDGS-
DAPF_PSEFL/153-269--------GPKIEH--HPRFPARVNVGFLQ.....----------------.VIDRHRAQLR..........VWERGAG-
DAPF_HELPY/144-258--------LELRAL--RHEFNANINIAFIE.....----------------...NKETIFLQT.........YERGVED-
DAPF_STRCO/152-274--------PPSHAP--AGAYPDGVNVEFVV.....----------------.DRGPRHVAMR..........VHERGSG-
DAPF_HAEIN/151-267--------GPLLES--HERFPERVNAGFMQ.....----------------.IINKEHIKLR..........VYERGAG-
DAPF_ARCFU/153-266--------ARKIRY--SEIFPEGTNVNFAK.....----------------..VDGDTITVR.........TYERGVEG-
DAPF_SYNY3/5-126--------AQQLCD--RHFGIGADGVIFALP....----------------.GQGGTDYTMR..........IFNSDGS-
DAPF_AQUAE/3-132--------VRKVCA--FHTGVGADGLILIKNP...----------------.DNPENDFKWE..........FFNSDGS-
DAPF_METJA/3-130--------SRKICR--RGFSVGADGVIFIQKP...----------------.TSDEYDVRFR..........IFNSDGS-
DAPF_ECOLI/3-124--------IRRLAD--RHLGVGFDQLLVVEPP...----------------.YDPELDFHYR..........IFNADGS-
DAPF_SYNY3/156-272--------GPLFEH--HPQFSQRTNTEFIQ.....----------------.VLGSDRLKMR..........VWERGAG-
DAPF_MYCLE/161-279--------APVHLD--RVQFPDGVNIEVLT.....----------------.APVDGMVQMR..........VHERGVG-
DAPF_STRCO/7-135--------VAALCD--RRAGLGGDGLLHVVRSAAH----------------PEARGMAAEAE......WFMDYRNGDGS-
DAPF_MYCLE/3-142--------VAALCN--RRQGLGADGVLRVTTAGAA----------------VTAGVLEHLPDGVSCSDWYMDYRNADGS-
DAPF_BACSU/160-277--------GPVIEK--DPRFPEGINVEFVE.....----------------.TVNEQELHFR..........VWERGSG-

PF04303

YRAM_BACSU/1-361YTFGQVSISEEKVDFKGNCGNISAAVGPFAIEEGLV.KAKEP...MTAVRILNTNTNKMIIA----------EVEVEDGQ
Q9I5E5_PSEAE/6-391YLYGQVSIDKPFVDWSGNCGNLSTGAGAFALHAGLVDPARIPEDGICEVRIWQANIGKTIIA----------HVPVSGGQ
Q987N7_RHILO/9-356YLFAQVRVDQQIVDTSPNCGNMLAAVGPFAIEAGLV.PVRGE...TTLVRIHNVNTSKLIEA----------EVPTPNGS
YBHH_SHIFL/1-350YLFAQVIVHEQRVDTTPNCGNMLSGVGAFAIENGLI.AATSP...VTRVRIRNVNTGTFIEA----------DVQTPNGV
Q9KSB9_VIBCH/7-389YLFGQVAIDKPFVDWSGNCGNLSAAVGPFAIHAGLIPAECIPHNGVVAVKVWQVNISKTIVV----------HVPIVNGA
Q9PDY6_XYLFA/22-406YLFGQVAIERACVDWTGNCGNLSAAVGPFAIAAGIVDPARVPHRGICSVRIWQANIGKTIVA----------HVPIIDGQ

PF05544

PRCM_HUMAN/22-352.RSHGPVRFHSVPAFVLATDLMVDVPGH.GK-------------------------VMVDIA------------YGGAFY
A9CFV0_AGRT5/7-330..FVESVRIFNVASYLHAADVEVNVPGL.GK-------------------------LVVDIA------------YGGNYY
HYPRE_BRUME/8-331..YVERVRLTNVPAFLYAEGLEVECPDL.GP-------------------------IKVDVA------------YGGNFY
Y1255_PSEAE/9-334..KAERVEIRNVPSFADRLDAWIEVEGL.GS-------------------------LQVDTA------------YGGDSF
Q8P833_XANCP/6-311......VSIDNVESYRHAAGVEVDVPGH.GR-------------------------VRGDVA------------WGGNWF
HYPRE_PSEAE/6-313......VSVRNVPAYRYRRQVSVEVPGI.GR-------------------------VSGDIA------------WGGNWF
A9CH01_AGRT5/9-334..KAERIFVQNLPSFAAKLDAELEVEGL.GK-------------------------LKVDTA------------YGGDSF
Q988B5_RHILO/9-333..KCVSITLRNAPAFVDRLDASIEVEGL.GT-------------------------LTVDIA------------YGGMFY
A9CKB4_AGRT5/9-333..RCEKVKLTMVPSFVHELDVSIDTPEW.GR-------------------------VTMDIS------------YGGIFY
Y1586_BRUME/9-333..KAERISVRNVPSFADRLDAPLDVTGL.GT-------------------------IMVDTA------------YGGDSF
PRCMA_TRYCC/78-420ESEVSNASIINVPSFLYQQDVVVVLPKPYGE-------------------------VRVDIA------------FGGNFF
Q93RX9_STRCO/9-332..HAESVTLENVASYSHALDQVVDVPGH.GE-------------------------VRYDIA------------YGGNFY
Q8PKE4_XANAC/9-335..KVTRVKLVNQPAFVYHLDAKVEVAGI.GT-------------------------VSADIA------------FGGMTF
Q92WS1_RHIME/8-331..FVEEVRLTNVPSFLYAEGLAAEVEGL.GE-------------------------IVVDVA------------YGGNFY

PF02567

Q9SY11_ARATH/12-290--GGTFLIELNFPVVTTCDVNLSDVSSSMIT-------------------------KALN...............GATIV
Y2735_MYCBO/8-225--TAISARSEWAPEFAIHD............-------------------------........................
YFHB_BACSU/9-289--RIHITLEQASPQFKPFTGDRKKLADALGI-------------------------TDEDF.............HEDLPI
PHZF_PSEAE/7-274--GKVVACSMQQPIPTWEHFSRPAELLAALG-------------------------LKGS................TFPI
Q9SY10_ARATH/21-309--KRSFLIEMNFPVITTCEYSSKDVSIFSKA-------------------------LNGATIVDVRETKTDRLIFKPLIG
YDDE_ECOLI/8-291--DYRISLEQGTPGFEPPLEGETRAAIINAL-------------------------HLTEDD...........ILPGLPI
Q9ZVS2_ARATH/12-282--GEESSIELDFPVVPTYEVNYIDDDLSLFS-------------------------KALN...............GATIL
YHI9_YEAST/10-290--INEGLISFKAPMADYESISSEMIADYEKA-------------------------IGLKF...............IKPP
Q54378_STRLN/9-281--TAEKPVEAREPDLRLLTAAAGVDPA....-------------------------...................DVVEA
PHZF_PSECL/7-274--GSVVAASMDQPIPTWTALGRDVELLKALG-------------------------ISDS................TFPI
Y1330_DEIRA/21-304--GGECRVWMHQPAFGTRAVGRGWHRELAEA-------------------------LGLS..........DRLLHRGLPL
Q9RJQ0_STRCO/11-286--GAVRATLTSVPTRSRPALPAERDAALGAL-------------------------GWTAAD...........LDPALPA
Y1019_SYNY3/8-300--VQTELTVAQLPQTKDSAPSCEDLALLLGL-------------------------SIDQLQ............QGEYEP
Q9SDD7_ORYSJ/11-305--EEKLFIELDFPMIDLVEYDSAETLSIPET-------------------------LNGA................RVVS

PF01678

DAPF_HAEIN/3-124--------------------------------------------------------------------------------
DAPF_METTH/4-131--------------------------------------------------------------------------------
DAPF_BACSU/6-131--------------------------------------------------------------------------------
DAPF_MYCTU/157-275--------------------------------------------------------------------------------
DAPF1_NOSS1/152-267--------------------------------------------------------------------------------
DAPF_PSEFL/5-126--------------------------------------------------------------------------------
DAPF_METJA/165-285--------------------------------------------------------------------------------
DAPF_MYCTU/3-142--------------------------------------------------------------------------------
DAPF_ARCFU/5-128--------------------------------------------------------------------------------
DAPF_HELPY/3-118--------------------------------------------------------------------------------
DAPF_AQUAE/147-267--------------------------------------------------------------------------------
DAPF_ECOLI/151-267--------------------------------------------------------------------------------
DAPF_METTH/159-277--------------------------------------------------------------------------------
DAPF1_NOSS1/3-124--------------------------------------------------------------------------------
DAPF_PSEFL/153-269--------------------------------------------------------------------------------
DAPF_HELPY/144-258--------------------------------------------------------------------------------
DAPF_STRCO/152-274--------------------------------------------------------------------------------
DAPF_HAEIN/151-267--------------------------------------------------------------------------------
DAPF_ARCFU/153-266--------------------------------------------------------------------------------
DAPF_SYNY3/5-126--------------------------------------------------------------------------------
DAPF_AQUAE/3-132--------------------------------------------------------------------------------
DAPF_METJA/3-130--------------------------------------------------------------------------------
DAPF_ECOLI/3-124--------------------------------------------------------------------------------
DAPF_SYNY3/156-272--------------------------------------------------------------------------------
DAPF_MYCLE/161-279--------------------------------------------------------------------------------
DAPF_STRCO/7-135--------------------------------------------------------------------------------
DAPF_MYCLE/3-142--------------------------------------------------------------------------------
DAPF_BACSU/160-277--------------------------------------------------------------------------------

PF04303

YRAM_BACSU/1-361VKYDGDVTISGVPGSGSPIYLNFHDAAGSVT..GHLLPTGNSSEFLDTSQ.GQIEVSIIDYANPLVFVEASSIGLDGTEL
Q9I5E5_PSEAE/6-391VQETGDFELDGVTFPAAEIVLEFLDPSDDGEDGGAIFPTGNLVDDLEVPGVGTFKATMINAGIPTVFVNAEEIGYRGTEL
Q987N7_RHILO/9-356VSYLGEAAIDGVPGRGAPIALTFMDAAGART..GQLFPTGNPVDTIDG.....VAVTCIDCAMPMILIEADSVGATGFES
YBHH_SHIFL/1-350VEYEGSARIDGVPGTAAPVALTFLNAAGTKT..GKVFPTDNQIDYFDD.....VPVTCIDMAMPVVIIPAEYLGKTGYEL
Q9KSB9_VIBCH/7-389VQECGEFELDGVTFAAAEVQVDFVDPADDS...GAMFPTGNVMDDLQVPGIGTLNATFINSGIPTIFVDAEALGYQGTEL
Q9PDY6_XYLFA/22-406VQESGDFMMEGAAFPGAEVRLEFFNPADVGG.DRAMFPTGHLIDTLEVPGLGPIEATLINAGIPMLCVDAHALGYTGTEL

PF05544

PRCM_HUMAN/22-352AFVTAEKLGLDICSAKTRDLVDAASAVTEAVKAQFKINHPDSEDLAFLYGTILTDGKDAYTK.EPTTNICVFADEQVDRS
A9CFV0_AGRT5/7-330AVIEPQVGWPGLDGMTAGDVVDLSQKLRDALGTICDPVHPDDERIRGVHHAIWCDRPVSAEA..DGRGAVFYGDKAIDRS
HYPRE_BRUME/8-331AIVEPQENYTDMDDYSALQLIAWSPVLRQRLNEKYKFQHPELPDINRLSHILWTGKPKHPQA..HARNAVFYGDKAIDRS
Y1255_PSEAE/9-334VIADARRLGFALRADEAAELVATGLKITHAANEQLGFRHPTNPDWDHLSFCQLAAPPERRDGVLGANNAVVIRPGKIDRS
Q8P833_XANCP/6-311FITEQA..PCALGLAQQRELTAYTEAIRLALEAA....GITGEAGGEIDHIEISGVAPDGSG..AARNFVLCPGLAYDRS
HYPRE_PSEAE/6-313FLVAGH..GQRLAGDNLDALTAYTVAVQQALDDQ....DIRGEDGGAIDHIELFADDPHA....DSRNFVLCPGKAYDRS
A9CH01_AGRT5/9-334VIVDAEAMGFSLKPEEAHEIARLGVRITNAANKALGFDHPENPDWRHFSFCLFAGKVERTAEGLRAGAAVAIQPGKVDRS
Q988B5_RHILO/9-333AIVDAKALGFSIAPDEARELAVAGEKIRRAAREQLDVVHPQFDHVRGVSIVQFAMPFQGPGN..VTRNTCIVSPGRSDRS
A9CKB4_AGRT5/9-333ALVDVRQIGLTIEKANAAKLVAAGMTLKDLVNREMTVVHPEIPAISGVAYVMFRDVDADG....SIRTCTTMWPGRADRS
Y1586_BRUME/9-333VIVDAAQIGMKIEPGQARELAEIGVKITKAANEQLGFRHPE.RDWRHISFCQITEPVTREGDVLTGVNTVAIRPAKFDRS
PRCMA_TRYCC/78-420AIVPAEQLGIDISVQNLSRLQEAGELLRTEINRSVKVQHPQLPHINTVDCVEIYGPPTNPEA..NYKNVVIFGNRQADRS
Q93RX9_STRCO/9-332AFVRTDDLGIPFERAHKQPLLDAGLAVMDAINKQNPVSHPENPDIDVCHHVYLEAPGSTAE...HSRHAMAIHPGWFDRS
Q8PKE4_XANAC/9-335ALVDASSLGFEIVPAEARELCEYGQKIKAAAAEQLDVAFPGNPDMPGITMTQFTGPLSRADGKFFSRNTTIVSPGRCDRS
Q92WS1_RHIME/8-331AIVEPQKNFRDMADHTAGELVGWSPKLRAALNAKYEFVHPEHPEIRGLSHIQWTGKPTQPEA..HARNAVFYGEKAIDRS

PF02567

Q9SY11_ARATH/12-290DIKATATNNILVVLPSKESVTELQPRM........DDILKCPCDGIIVTAAGSTGSSYDF----YSRYFA.PKFGVDEDP
Y2735_MYCBO/8-225.............LDSLDALAAADP.............ADFPDDIAHYLWTWTDRSAGSL----RARMFA.ANLGVTEDE
YFHB_BACSU/9-289VFGSTGIWTAIVPLKSLEASKKMVPDNKQF....PEVLVDLPKASVHPFTFETVHPDSDL----HGRHFSSPYSGTIEDP
PHZF_PSEAE/7-274EVYRNGPRHVFVGLESVAALSALHPDH........RALCDFPDLAV....NCFAGAGRHW----RSRMFS.PAYGVVEDA
Q9SY10_ARATH/21-309AFKTTSTDQIIVVLSSWESVIEFQPRV........DDIVKCPGKVMIVTAAAPQGSPFDF----CSRLFA.PKLGLNEDS
YDDE_ECOLI/8-291QVATTGHSKVMIPLKPEVDIDALSPDLNAL....TAISKKIGCNGFFPFQIRPGKNETD.----.GRMFS.PAIGIVEDP
Q9ZVS2_ARATH/12-282DVKAT.KKDLLVVLSSWEAVIDLKPRL........DEISKCPCEGMMVTAAASDGSTYDF----CSRYFA.PRFGINEDP
YHI9_YEAST/10-290ALLHTGPEWIVALVEDAETCFNANPNFAML...AHQTKQNDHVGIILAGPKKEAAIKNSY----EMRAFA.PVINVYEDP
Q54378_STRLN/9-281PVRTAGFGPAFHYLQVREGVV...PGAR......ADLELMARRDLPDVMVFSWDPRTRQA----TARVFA.PGYGMPEDP
PHZF_PSECL/7-274EIYHNGPRHVFVGLPSIAALSALHPDH........RALSSFHDMAI....NCFAGAGRRW----RSRMFS.PAYGVVEDA
Y1330_DEIRA/21-304AAASTGLWSVFLPLLDASLLEGLEPDL.......PRIAELSRELGVVSVYAYAPVGVNRF----AARDFA.PLVGIPEDP
Q9RJQ0_STRCO/11-286HVAFGGNDHLVLAAASRARLADLDYDF.......DALAEVMRRYGWTTVDLVWRESAGLY----HARNPF.PVGGVVEDP
Y1019_SYNY3/8-300QAYSCGLPFLFIPLINEEALNRISFNPSVWQNLLAGQWADCVYCLAPGDPSLGLSDNKLI----HGRMFA.PGLGIAEDP
Q9SDD7_ORYSJ/11-305VWKSSTAGDLIVELSSGKEVADIIPNI........NEIKKCDGRGVIVTGPAPAGSDYDF----FSRFFC.PKFGIDEDP

PF01678

DAPF_HAEIN/3-124-----------------------------------------------------------------------------EVS
DAPF_METTH/4-131-----------------------------------------------------------------------------EAE
DAPF_BACSU/6-131-----------------------------------------------------------------------------EGK
DAPF_MYCTU/157-275-----------------------------------------------------------------------------ETR
DAPF1_NOSS1/152-267-----------------------------------------------------------------------------YTL
DAPF_PSEFL/5-126-----------------------------------------------------------------------------EVE
DAPF_METJA/165-285-----------------------------------------------------------------------------YTT
DAPF_MYCTU/3-142-----------------------------------------------------------------------------AAQ
DAPF_ARCFU/5-128-----------------------------------------------------------------------------EAA
DAPF_HELPY/3-118-----------------------------------------------------------------------------KAG
DAPF_AQUAE/147-267-----------------------------------------------------------------------------ETL
DAPF_ECOLI/151-267-----------------------------------------------------------------------------ETQ
DAPF_METTH/159-277-----------------------------------------------------------------------------PTM
DAPF1_NOSS1/3-124-----------------------------------------------------------------------------EAE
DAPF_PSEFL/153-269-----------------------------------------------------------------------------ETQ
DAPF_HELPY/144-258-----------------------------------------------------------------------------FTL
DAPF_STRCO/152-274-----------------------------------------------------------------------------ETR
DAPF_HAEIN/151-267-----------------------------------------------------------------------------ETQ
DAPF_ARCFU/153-266-----------------------------------------------------------------------------ETL
DAPF_SYNY3/5-126-----------------------------------------------------------------------------EPE
DAPF_AQUAE/3-132-----------------------------------------------------------------------------VAE
DAPF_METJA/3-130-----------------------------------------------------------------------------EAE
DAPF_ECOLI/3-124-----------------------------------------------------------------------------EVA
DAPF_SYNY3/156-272-----------------------------------------------------------------------------ITL
DAPF_MYCLE/161-279-----------------------------------------------------------------------------ETR
DAPF_STRCO/7-135-----------------------------------------------------------------------------VAE
DAPF_MYCLE/3-142-----------------------------------------------------------------------------VAQ
DAPF_BACSU/160-277-----------------------------------------------------------------------------ITQ

PF04303

YRAM_BACSU/1-361AEEFT.DLQ.LAQFEELRSIAAEKCGFASRFSATKLSPAVPKLAIVAKPEKYKDSTGAWHSSVEMDLHIRMMSMQKPHQA
Q9I5E5_PSEAE/6-391REEINGDPQQLARFERIRVAGALRMGLIKTPEEAATRQHTPKIAFVAPPRDYRTASGKLVAAGDIDLLVRALSMGKLHHA
Q987N7_RHILO/9-356AAELNADKELLGRLEKLRIAAGERMG.LGDVRDQV....TPKPVLISRPT....SGG......DIS..VRYFMPHQCHPS
YBHH_SHIFL/1-350PAELDADKALLARIESIRLQAGKAMG.LGDVSNMV....IPKPVLISPAQ....KGG......AIN..VRYFMPHSCHRA
Q9KSB9_VIBCH/7-389QEAINSDPQALAKFETLRAYGALKMGLIERIEEAQNRQHTPKIAFVSGAKSYLASSGKRVEADSVDLLVRALSMGKLHHA
Q9PDY6_XYLFA/22-406QEAINGDPHALVCLETLRAYGALRMGVIGHLEDMVQHQHTPKLAFVAPPADYVASGGRHVHATEIDVLVRAMSMGRLHHA

PF05544

PRCM_HUMAN/22-352PTGSGVTARIALQYHKGLL---ELNQMRAFKSSATGSVFTGKAVREAKCGDFK............AVIVEVSGQAHYTGT
A9CFV0_AGRT5/7-330PGGTGTSARMAQLHGKGRL---KAGETFRQE.SLIGTIFEGKVEEETTVGSFS............GIRPSIGGWARIIGH
HYPRE_BRUME/8-331PCGTGTSARMAQLAAKGKL---KPGDEFIHE.SIIGSLFHGRVERAAEVAGRP............AIVPSIAGWARMTGY
Y1255_PSEAE/9-334PCGTGCSARMAVLQAKGQL---RVGERFVGR.SIIGSEFHCHIESLTELGGRP............AILPCLSGRAWITGI
Q8P833_XANCP/6-311PCGTGTSAKLACLAADGKL---AEGERWLQQ.GILGSAFEGSY....RHSGRG.............IAPRISGHAFITAR
HYPRE_PSEAE/6-313PCGTGTSAKLACLAADGKL---LPGQPWRQA.SVIGSQFEGRYEWLDGQPGGP.............IVPTIRGRAHVSAE
A9CH01_AGRT5/9-334PTGTALSARMAVLHARGEM---KEGETLTAV.SLIGSTFTGRILGTTTVGDRP............AILPEISGRGWITGI
Q988B5_RHILO/9-333PTGTGTSARMAVLQARGLM---GVGDVLIHE.SIIGSRFTGRIVELAEIAGRK............AIVPEITGRAWITGE
A9CKB4_AGRT5/9-333PCGTGNSANLATLYARGKV---KVGDEYKSR.SIIGSEFDVGLSAVTEVAGRP............AVIPTIAGRGFTFGL
Y1586_BRUME/9-333PTGTGCSARMAVLHAKGQM---KAGERFIGK.SVLGTEFHCRLDKVLELGGKP............AISPIISGRAWVTGT
PRCMA_TRYCC/78-420PCGTGTSAKMATLYAKGQL---RIGETFVYE.SILGSLFQGRVLGEERIPGVKVPVTKDAEEGMLVVTAEITGKAFIMGF
Q93RX9_STRCO/9-332PCGTGTSARMAQLHARGLL---PAGRDFVNE.SFIGSRFVGRVLGETTVGGRP............AVLPSVTGRAWITGT
Q8PKE4_XANAC/9-335PCGAGSSARLAALHAKGVL---AKGDTLVHE.SIIGSRFECGIEDMSNVGDYP............AVVPSIAGQAWISGL
Q92WS1_RHIME/8-331PCGTGTSARIAQLAAKGKL---KVGDEFVHE.SIIGSLFKGRVEAAAKVADRD............AIIPSIAGWARMTGI

PF02567

Q9SY11_ARATH/12-290VCGSAHCALAHYWSIKMNK........FDFL-AYQASSRSGTIR.......IH--------------LDKEKQRVLLRGK
Y2735_MYCBO/8-225ATGAAAIRITDYLSRDL...........TIT-QGKGSLIHTTWS.........--------------...PEGWVRVAGR
YFHB_BACSU/9-289VTGTASGVMGAYMKHYGNA....EQHKFIIE-QGQEIGKDGKVEIEMNEAGGH--------------V.....KVNMTGT
PHZF_PSEAE/7-274ATGSAAGPLAIHLARHRQI...PYGQQIEIL-QGVEIGRPSRMYARAEGAGER--------------V....SAVEVSGN
Q9SY10_ARATH/21-309VCGSAHCSLAHYWSLKMNK........CDFV-AFAASQRSGTLK.......VH--------------YDKEKQRVLLTGK
YDDE_ECOLI/8-291VTGNANGPMGAWLVHHNVLPHDGNVLRVKGH-QGRALGRDGMIEVTVTIR...--------------.DNQPEKVTISGT
Q9ZVS2_ARATH/12-282VTGSAHCALAHYWSLRMNK........CDFF-AYQASSRGGTLK.......VH--------------LDKEKQRVLLRGK
YHI9_YEAST/10-290VCGSGSVALARYLQEVYKF...EKTTDITIS-EGGRLKRNGLMLASIK....K--------------EADNSTSYYIAGH
Q54378_STRLN/9-281ACASNALGLGEWLVAAGRLPAADGTYEYLIR-QGVGSPRVGTVECSVTV....--------------DSGCAVRASATGS
PHZF_PSECL/7-274ATGSAAGPLAIHLARHGQI...EFGQQIEIL-QGVEIGRPSLMFARAEGRADQ--------------L....TRVEVSGN
Y1330_DEIRA/21-304VTGSAGGALLALLASEGRLPLRGNRASGLIY-QGHALGTPGEIEVEVEVRGTR--------------V....EAVQVGGC
Q9RJQ0_STRCO/11-286ATGAAAAAFGGYLRELGLV...TGPATIAVR-QGEDMGRTSELL.......IE--------------VGPRDPRTRVTGQ
Y1019_SYNY3/8-300ATGSGVAALGGYLDDRLDT...PGSHHWQIE-QGKALGRPSQLQLTV....VK--------------DGQGIRAVKVAGR
Q9SDD7_ORYSJ/11-305VCGSAHCVLAPYWGGKLGK........QKLT-AFQASPRSGTLYLELDG...E--------------NR....RVRIQGE

PF01678

DAPF_HAEIN/3-124QCGNG.ARCFARFVTLKGL---T.....NKK-DISVSTQKGNMVLTVKDDNQ.-----------------...IRVNMGE
DAPF_METTH/4-131MCGNG.IRCFSKFVYDNAI---V.....RKR-RLEVETLAGIKTVELEVEDGA-----------------VVSSRVDMGT
DAPF_BACSU/6-131NCGNG.LRCVAKYAYEHKL---V.....EET-SFLIETLSGLVKAEVQVENGK-----------------VNVVTVDMGE
DAPF_MYCTU/157-275SCGTGTVAAAVAALAAVG.---S.....PTG-TLTVHVPGGEVVVTVTDATS.-----------------.....FLRGP
DAPF1_NOSS1/152-267ASGSSSSAAAATAHKLGL.---......CDS-KIIVKMPGGDILIQIKDDFH.-----------------....ISMTDS
DAPF_PSEFL/5-126QCGNG.ARCFARFVLDKRL---T.....AKR-QIRVETKSGIIELDVRSDGQ.-----------------...IGVNMGA
DAPF_METJA/165-285ACGTGTTASVIMAHKLGK.---......TNN-RVLAHLDGGDLEIEIKDD...-----------------...GVYMIGD
DAPF_MYCTU/3-142MCGNG.VRVFAHYLRASGL---E.....VRD-EFVVGSLAGPRPVTCHHVEAA-----------------YADVSVDMGK
DAPF_ARCFU/5-128MCGNG.IRCFSRYVVEE.G---Y.....AGE-RLRVETLAGILELEVKRENG.-----------------.WWVKVDMGK
DAPF_HELPY/3-118MCGNA.SRCVGLFAYQHAI---A........-SKNHVFLAGKREISICIEEPN-----------------..IIESNLGN
DAPF_AQUAE/147-267ACGTGATACAIVSYLKGLV---K......KK-PVNVLTRSGEVLTIDFSEDLK-----------------...EVFLTGS
DAPF_ECOLI/151-267ACGSGACAAVAVGIQQGL.---......LAE-EVRVELPGGRLDIAWKGPGHP-----------------....LYMTGP
DAPF_METTH/159-277ACGTGATASVIAGVKLEK.---......LDD-SVLVHLPGGELKIDVYQDGTE-----------------L..GAYMEGD
DAPF1_NOSS1/3-124KSGNG.LRIFSRYLWDMGL---V.....DEK-PFSIETAGGIVESAIKDAGKT-----------------...VQVEMGK
DAPF_PSEFL/153-269ACGTGACAAAVAAISQGW.---......MDS-PLLIDLPGGRLSIEWAGPGQP-----------------....VMMTGP
DAPF_HELPY/144-258ACGTGMAAVFIAARIFYNT---P......KK-AALIPKSNESLELSLKNDG..-----------------....IFYKGA
DAPF_STRCO/152-274SCGTGACAVAVATARRDGL---DPAATGTPA-TYTVDVPGGTLVITERPDGE.-----------------....IEMTGP
DAPF_HAEIN/151-267ACGSGACAAVAVGIMQGL.---......LNN-NVQVDLPGGSLMIEWNGVGHP-----------------....LYMTGE
DAPF_ARCFU/153-266SCGTGSVAVAAIANRLGLT---G.......S-KVDVVTKGGLLKIELTEDT..-----------------....AYMTGG
DAPF_SYNY3/5-126MCGNG.IRCLAKFLADLEG---V.....EEK-TYRIHTLAGVITPQLLADGQ.-----------------...VKVDMGE
DAPF_AQUAE/3-132MCGNG.SRCAVRFAYERGI---V......GN-KVRFETLAGVIKAEVYENGRK-----------------...VKVQLTP
DAPF_METJA/3-130MCGNG.IRCFSKYVYER.I---M.....KKN-PLKVETKGGLRVSEMEIEGDE-----------------VKKIKVYMGV
DAPF_ECOLI/3-124QCGNG.ARCFARFVRLKGL---T.....NKR-DIRVSTANGRMVLTVTDDDL.-----------------...VRVNMGE
DAPF_SYNY3/156-272ACGTGACATVVAAVLTGR.---......GDR-RCTVELPGGNLEIEWSAQDNR-----------------....LYMTGP
DAPF_MYCLE/161-279SCGTGTVAAAVAALASAG.---A.....DTG-TLTVRVPGGDVVITITDVTS.-----------------.....YLRGP
DAPF_STRCO/7-135MCGNG.VRVFARYLQHAGH---V.....TEG-DLAVATRGG...VKTVHIAK.-----------------NGDVTVGMGR
DAPF_MYCLE/3-142MCGNG.VRVFAHYLRASGL---E.....SCD-EFVVGSLAGPRLVNVHHVDEL-----------------NADVTVDMGK
DAPF_BACSU/160-277ACGTGACAAAVASVLNGVS---K.....RNQ-DITVHLAGGDLVINWKDNGH.-----------------....VMMTGP

PF04303

YRAM_BACSU/1-361LAVTGAICTTRALSVEGAIPARIAKNHS..T-KVRLAHSSGIIETMVEPTG..--------------.......IKIVRT
Q9I5E5_PSEAE/6-391MMGTAAVAIGTAAAIPGTLVNLAAGGGE.RS-AVRFGHPSGTLRVGAEASQAN--------------GEWTVTKAIMSRS
Q987N7_RHILO/9-356LATTGAVGIATACISQGTVASLLIGLRAPPV-VLSIEHPSGHLDVKLYERD..--------------...GKVVAGILRT
YBHH_SHIFL/1-350LAITGAIAISSSCALEGTVTRQIVPSVG.YG-NINIEHPSGALDVHLSNEGQD--------------A..TTLRASVIRT
Q9KSB9_VIBCH/7-389MMGTAAVAIASAAAVPGTLVNLAAGGGE.RT-SVTFGHPSGTLKVGAKAKQGK--------------QGWQIERAIMSRS
Q9PDY6_XYLFA/22-406MMGTAAVALGTAAAIPGTLVNRAAGGGL.RR-VVRFGHPSGTLQVGAEVHQVD--------------GQWSVSNVRMSRS

PF05544

PRCM_HUMAN/22-352ASFIIEDDDPLRDGFL
A9CFV0_AGRT5/7-330NTIFVDDRDPLAHGFQ
HYPRE_BRUME/8-331NTIFIDDRDPFAHGFS
Y1255_PSEAE/9-334HQYLLDPDDPWPQGYR
Q8P833_XANCP/6-311SQLLIDPADPFAWGIV
HYPRE_PSEAE/6-313ATLLLADDDPFAWGIR
A9CH01_AGRT5/9-334HQHMLDPSDPWPEGYR
Q988B5_RHILO/9-333HSYYLDPTDPYPQGYV
A9CKB4_AGRT5/9-333HQVGLDPFDPLGDGFA
Y1586_BRUME/9-333SQLMLDPSDPFPHGYR
PRCMA_TRYCC/78-420NTMLFDPTDPFKNGFT
Q93RX9_STRCO/9-332AQYLLDPSDPYPAGFT
Q8PKE4_XANAC/9-335SQLGLDPSDPYAEGFT
Q92WS1_RHIME/8-331NTIFIDDRDPFAHGFV

PF02567

Q9SY11_ARATH/12-290AVTVMEG---------
Y2735_MYCBO/8-225VVSDGVA---------
YFHB_BACSU/9-289AVYSETR---------
PHZF_PSEAE/7-274GAAFAEG---------
Q9SY10_ARATH/21-309AVTVMKG---------
YDDE_ECOLI/8-291AVILFHA---------
Q9ZVS2_ARATH/12-282AVTVMEG---------
YHI9_YEAST/10-290ATTVIDG---------
Q54378_STRLN/9-281VVPVARG---------
PHZF_PSECL/7-274GVTFGRG---------
Y1330_DEIRA/21-304AAVEREG---------
Q9RJQ0_STRCO/11-286AVPV.SG---------
Y1019_SYNY3/8-300SVLVSEG---------
Q9SDD7_ORYSJ/11-305AVTVMAG---------

PF01678

DAPF_HAEIN/3-124PIWE------------
DAPF_METTH/4-131ATFK------------
DAPF_BACSU/6-131PRLT------------
DAPF_MYCTU/157-275SVLV------------
DAPF1_NOSS1/152-267VTKL------------
DAPF_PSEFL/5-126PRLV------------
DAPF_METJA/165-285AVMV------------
DAPF_MYCTU/3-142ANRL------------
DAPF_ARCFU/5-128PKFG------------
DAPF_HELPY/3-118Y.KI------------
DAPF_AQUAE/147-267VYKV------------
DAPF_ECOLI/151-267AVHV------------
DAPF_METTH/159-277AVMV------------
DAPF1_NOSS1/3-124VSFW------------
DAPF_PSEFL/153-269AVRV------------
DAPF_HELPY/144-258VRYI------------
DAPF_STRCO/152-274AVIV------------
DAPF_HAEIN/151-267ATHI------------
DAPF_ARCFU/153-266ASRV------------
DAPF_SYNY3/5-126PQLL------------
DAPF_AQUAE/3-132PSKP------------
DAPF_METJA/3-130PKFK------------
DAPF_ECOLI/3-124PNFE------------
DAPF_SYNY3/156-272AQRV------------
DAPF_MYCLE/161-279SVLV------------
DAPF_STRCO/7-135A.LL------------
DAPF_MYCLE/3-142ANLL------------
DAPF_BACSU/160-277AETV------------

PF04303

YRAM_BACSU/1-361ARRIMDGTVYTH----
Q9I5E5_PSEAE/6-391ARILMEGWVRVP----
Q987N7_RHILO/9-356ARRLFEGHVFAK----
YBHH_SHIFL/1-350TRKIFSGEVYLP----
Q9KSB9_VIBCH/7-389ARILMEGWVRVP----
Q9PDY6_XYLFA/22-406ARVLMEGWVRVP----

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window