Sequence alignment for CL0288

PF05544

T3HPD_HUMAN/22-352-----VVDMHTGGEPLRIVLAGCPEVSGPTLLAKRRYMRQHL..DHVRRRLMFEPRGHRDMYGAVLVPSE-------LPD
A9CFV0_AGRFC/7-330-----CIDSHTCGNPVRLVAGGGPLLPHLPISERRDLFVRNH..DWVRQALMFEPRGHDIMSGAVIYPAY-------RDD
D0BA10_BRUME/8-331-----CVDGHTCGNPVRLVAGGGPNLNGSTMMEKCAHFLAEY..DWIRTGLMFEPRGHDMMSGSILYPPT-------RPD
T3HPD_PSEAE/9-334-----IVSCHAEGEVGDVIVGGVAAPPGATLWEQSRWIARD...QDLRNFVLNEPRGGVFRHANLLVPAK-------DPR
4HYPE_XANCP/6-311-----VIDSHTAGEPTRVVLAGFPDLGDGDLAQCRERFRSDF..DHWRSAIACEPRGSDTMVGALLLPPR-------DPS
4HYPE_PSEAE/6-313-----IIDSHTGGEPTRLVIGGFPDLGQGDMAERRRLLGERH..DAWRAACILEPRGSDVLVGALLCAPV-------DPE
3HD4E_AGRFC/9-334-----VISAHAEGEVGDVIVGGVKPPPGETIWEQSRFIARD...ETLRNFVLNEPRGGVFRHVNLLVPPK-------HPD
Q988B5_RHILO/9-333-----VVGCHAEGEVGDVIIGGVLPPAGRTMMDKMITMERDH..DHIRRMLICEPRGSVARHVNLLVPST-------RED
4HYPE_AGRFC/9-333-----LLDVHCEGEIGRVVTGGAPKIPGNTVAEQLHWMNTDPQGEALRRFLTLEPRGTPMGSVDLLLPPK-------HPD
D0B556_BRUME/9-333-----IVGCHAEGEVGDVIVGGVAPPPGETVWEQSRFIAND...ETLRNFVLNKPRGGVFRHVNLLVPPK-------DPR
PRCMA_TRYCC/78-420-----CIDMHTEGEAARIVTSGLPHIPGSNMAEKKAYLQENM..DYLRRGIMLEPRGHDDMFGAFLFDPI-------EEG
Q93RX9_STRCO/9-332-----AVDSHTEGMPTRVITGGVGVLPGATMFERRQRFVAER..DHLRTLLMCEPRGHASMSGAILQPPT-------RPD
M4TUF7_9XANT/9-335-----VVDCHAEGEVGKVIVGGVGNIPGTTMFEKKLYLEQHR..DDIRKLVLQEPRGATWHNANIILPPS-------HPE
4HYPE_RHIME/8-331-----CIDGHTCGNPVRLVSGGGPRLEGANMLEKRAHFLKEF..DWIRTGLMFEPRGHDMMSGSILYPPT-------RPD

PF02567

YFHB_BACSU/9-289--YEAFTSSPGKGNPAGVVLQGD.....DYTEDEMQIIAERA----------------GYSETSFIRK.........SES
PHZF_PSEAE/7-274--IDAFASEPLQGNPVAVFFDCD.....DLSGERMQRMAREM----------------NLSESTFVLRP........QQD
YDDE_ECOLI/8-291--VDAFTSQPFRGNSAGVVFPAD.....NLSEAQMQLIAREL----------------GHSETAFLLHS.........DD
Q9ZVS2_ARATH/12-282--VDAFAESAFKGNPAAVCFLEDD...NERDDAWLQSLATEF----------------NISETCFLTPII.......GDL
YHI9_YEAST/10-290--VDVFTEKPFMGNPVAVINFLEID.ENEVSQEELQAIANWT----------------NLSETTFLFKPS.......DKK
Y1330_DEIRA/21-304--VAAFTTVPGQGNRAGVVLDAG.....ELTGEQMQRLAAFL----------------EAPETVFVTRLS......D...
Q9RJQ0_STRCO/11-286--YSAFTDDPAGGNPAGVVLDAS.....GLDDPAMLAIAAEV----------------GYSETAFVTGGD.......AER
Y1019_SYNY3/8-300--LDVFTDQLFGGNPLAVFPDAE.....GLTDGQMQKIAAEI----------------NYSETVFVLPPV.......TET
Q9SDD7_ORYSJ/11-305--VDAFAAEPFKGNPAAVCLLEGEDAAAAADERWMQSVAAEF----------------NLSETAFLIRDPSSSAAAADAA
F4JHW1_ARATH/31-309--VDAFTDSAFKGNPAAVCFLNDD...NERDDTWLQSLAAEF----------------NISETCFLIPIT.......GFQ
Q66GM9_ARATH/14-302--VDAFTESAFKGNQAAVCFLEED...HERDDVWLQSMASEF----------------DLPLTCFLIPIP......GSEP

PF01678

DAPF_HAEIN/3-124-----FSKMHGLGNDFVVVDGVTQ...NV------------------------------------------------FFT
DAPF_METTH/4-131-----FSKMHGLGNDYVVIDESAQ...EC------------------------------------------------IPE
DAPF_BACSU/6-131-----FTKMHGLGNSYIYVNQFEE...QL------------------------------------------------PEE
DAPF1_NOSS1/152-267-----CAATIGNPHCVILLDDINS...EV------------------------------------------------ARN
DAPF_METJA/165-285-----SVVNVGNPHAVIFVEDNN....ID------------------------------------------------LDF
DAPF_ARCFU/5-128-----FTKMHGNGNDFVLIDEFEG...VI------------------------------------------------VGE
DAPF_HELPY/3-118-----FYKYSGSGNDFLIVQSFKK...KD------------------------------------------------FSN
DAPF_AQUAE/147-267-----VFINTGVPHFVVPVEDVEK...VN------------------------------------------------VIK
DAPF_ECOLI/151-267-----GVVSMGNPHCVIQVDDVDT...AA------------------------------------------------VET
DAPF_METTH/159-277-----TALSVGNPHAIIFVDDAEG...VD------------------------------------------------LDR
DAPF1_NOSS1/3-124-----FYKYHALGNDYLVINPQDL...KF------------------------------------------------PLT
DAPF_HELPY/144-258-----YLIDTGVPHLVGFVENKEG...LN------------------------------------------------SLN
DAPF_STRCO/152-274-----RNVNMGNPHAVAFVADLDH...AG------------------------------------------------DLY
DAPF_HAEIN/151-267-----GAVSMGNPHCVVQVDDIQT...AN------------------------------------------------VEQ
DAPF_ARCFU/153-266-----YAANTGVPHVAVFVDSLDF....D------------------------------------------------IVP
DAPF_SYNY3/5-126-----FSKYHGLGNDFILVDNRQS...TE------------------------------------------------PCL
DAPF_AQUAE/3-132-----FWKLQGSGNDFVVIDDRDEKLESF------------------------------------------------LKE
DAPF_METJA/3-130-----FTKMHALGNDYIVINEFDG...EK------------------------------------------------VKE
DAPF_SYNY3/156-272-----TCVSMGNPHCLTFVDDVDS...LN------------------------------------------------LTE
DAPF_MYCLE/161-279-----VAVDVGNPHLACMDPQLSL...EE------------------------------------------------LAA
DAPF_STRCO/7-135-----FLKGHGTENDFVIVPDPEN...AL------------------------------------------------DLP
DAPF_MYCLE/3-142-----FAKGHGTQNDFVVLPDVEA...DV------------------------------------------------TFT
DAPF_BACSU/160-277-----TAVSMGNPHIVFPIADIEQ...AP------------------------------------------------LTT
DAPF_MYCTU/3-141-----FAKGHGTQNDFVLLPDVDA...EL------------------------------------------------VLT

PF04303

YRAM_BACSU/1-361MVKTNVTIMRGGTSKGVFFHESAMPNNK....NEWEPFLLDVMGSPDKR..QIDGLGGGNSLTSKVAIIKKAYTSDIDVH
Q9I5E5_PSEAE/6-391QIRIPATYLRGGTSKGVFFRLEDLPESCRVPGEARDRLFMRVIGSPDPYAAHIDGMGGATSSTSKCVILSKSSQPGHDVD
Q987N7_RHILO/9-356LLAIPCVLMRGGTSKGPFFLANDLPADA....IERDKILLSVMGSGHPL..QIDGIGGGNPVTSKVAIVGPASIPGADVD
Q9KSB9_VIBCH/7-389QIRIPATYMRGGTSKGVFFRLNDLPLEAQLPGAARDALLLRVIGSPDPYGKQIDGMGGATSSTSKTVIVSASSRTDHDVD
Q9PDY6_XYLFA/22-406QCRIPATYLRGGTSKGVFFRLEELPPACRVPGPARDALLLRVIGSPDPYGKQIDGMGGGSSSTSKVVIIAPSAYPNHDVD
YBHH_ECOLI/1-350MKKIPCVMMRGGTSRGAFLLAEHLPEDQ....TQRDKILMAIMGSGNDL..EIDGIGGGNPLTSKVAIISRSSDPRADVD

PF05544

T3HPD_HUMAN/22-352AHLGVLFLHN--EGYSSMCGHAVLALGRFALDFGLVPAPPAGTREARVN..IHCPCGLVTA----------FVACEDG..
A9CFV0_AGRFC/7-330CDFAVIFIEV--SGCLPMCGAGTIGLVTAAIEEGLVTPR...IPG.RLS..IETPAGKVDI----------QYDKPGE..
D0BA10_BRUME/8-331CDVAVLFIET--SGCLPMCGHGTIGTVTMAIEQGLVTPK...TPG.KLN..LDTPAGLVAI----------EYEQDGQ..
T3HPD_PSEAE/9-334AQMGWIIMEP--ADTPPMSGSNSLCVATVLLDSGILPMR...EPLTRLL..LEAPGGLIEA----------RAECRDG..
4HYPE_XANCP/6-311ACTGVIFFNN--VGYLGMCGHGTIGVVRTLAELGRIAPG...QHR......IETPVGTVGV----------ALADDGT..
4HYPE_PSEAE/6-313ACAGVIFFNN--SGYLGMCGHGTIGLVASLAHLGRIGPG...VHR......IETPVGEVEA----------TLHEDGS..
3HD4E_AGRFC/9-334ADAAFIIMEP--EDTPPMSGSNSICVSTVLLDGGIVPMQ...EPETHML..LEAPGGLVKV----------RAECRNG..
Q988B5_RHILO/9-333CAAGAIIMEP--TEYPPMSGSNTICVATVLLETGMVPMQ...EPETRFK..LDMPGGVIEV----------RAQCRDG..
4HYPE_AGRFC/9-333AHAAFVILQP--DQAHASSGSNSICATTALLESGMVEMQ...EPETVII..LETAAGLVKA----------TATCRDG..
D0B556_BRUME/9-333AQMGFIIMEP--ADTPPMSGSNSICVSTVLLDSGIIAMQ...EPVTHMV..LEAPGGIIEV----------EAECRNG..
PRCMA_TRYCC/78-420ADLGMVFMDT--GGYLNMCGHNSIAAVTAAVETGIVSVP...AKATNVPVVLDTPAGLVRG----------TAHLQSGTE
Q93RX9_STRCO/9-332ADYGVLFIEV--SGCLPMCGHGTIGVATVLVETGMVEVT...EPETTVR..LDTPAGLVTA----------RVRVRDG..
M4TUF7_9XANT/9-335ASMGFVILEA--TEYPAMSGSNTICVATVLLETGILPMQ...EPITDLV..LEAPAGLIRV----------RCDCKDG..
4HYPE_RHIME/8-331CDVAVLFIET--SGCLPMCGHGTIGTITMGIENGLITPR...EPG.KLS..IDAPAGKVDI----------TYRQEGR..

PF02567

YFHB_BACSU/9-289ADLELRYFTP--GHEMNLCGHATVASLYALCEKGML....--ESGKTYS--IQTKAGILPVK..........ISEKDG--
PHZF_PSEAE/7-274GDARIRIFTP--VNELPFAGHPLLGTAIALGAET......--.DKDRLF--LETRMGTVP...........FALERQD--
YDDE_ECOLI/8-291SDVRIRYFTP--TVEVPICGHATVAAHYVRAKVLGL....--.GNCTIW--QTSLAGKHRV..........TIEKHND--
Q9ZVS2_ARATH/12-282PRFRLRWFTP--VAEVDLCGHATLASAHVLFSTGLV....--.GSETVE--FDTLSGILTAK.........HLKNDDD--
YHI9_YEAST/10-290YDYKLRIFTP--RSELPFAGHPTIGSCKAFLEFTKN....--TTATSLV--QECKIGAVPI................T--
Y1330_DEIRA/21-304GLGRVRYFTP--TQEVDFCGHATVALGRVLAQAGRW....--.RGEALE--LETLAGRIPLR..........LVLDAG--
Q9RJQ0_STRCO/11-286RRFRVRYFSP--LAEVAFCGHATVALAVALAERLG.....--..PGEVV--LDTPAGEIPV..........STAVDGT--
Y1019_SYNY3/8-300GNFRLRIFTP--KRELDFAGHPTIGTTYLLGLLQPPS..P--LVTTTWQ--LEEPVGLVPV.T.......LHYKQGQL--
Q9SDD7_ORYSJ/11-305PRFRLRWFTP--VAEVNLCGHATLASAHFLFTTVLAKQQH--AAAAMVE--FVTRSGILTAKKVPAPPPPANDGGVPG--
F4JHW1_ARATH/31-309ARFSLRWFTP--LAEVDLCGHATLASAHCLFSNGLV....--.DSDMVE--FVTRSGILTAKRVS..DTSELSDGEVK--
Q66GM9_ARATH/14-302PRFLLRWFTA--VAEMDICGHATLASAHSIFSNSLV....--GSSDTVE--FSTNSGILTAK.........RLSDCDS--

PF01678

DAPF_HAEIN/3-124.....PETIR--RLANRHCGIGFDQLLIVEA............--------PYDPELDFHYR..........IFNADG--
DAPF_METTH/4-131D..KKPEFVR--EVCTRGFSVGADGVIFVQ.............--------PASGEGDIRFR..........IFNADG--
DAPF_BACSU/6-131K...LSEIAI--QVSSVYTGIGSDGMILIC.............--------.PSDQAPVKMR..........IFNNDG--
DAPF1_NOSS1/152-267.......FGP--IFEGYPLFPNRTNVQFMK.............--------.VLDRSTIQIE..........IWERGA--
DAPF_METJA/165-285VREHLDVIGK--EIEHHEAFPERINVHFVK.............--------.VLNPNEIRIV..........TWERGA--
DAPF_ARCFU/5-128E..EKPRFVR--AVCHRNFGVGADGALFVQ.............--------.PSQKADVRFR..........YFNSDG--
DAPF_HELPY/3-118.......LAK--QVCHRHEGFGADGLVVVL.............--------.PSKDYDYEWD..........FYNSDG--
DAPF_AQUAE/147-267......LGRA--IRFHEEFQPKGTNVNFVQ.............--------.PVSEDTIKVR.........TYERGVE--
DAPF_ECOLI/151-267.......LGP--VLESHERFPERANIGFMQ.............--------.VVKREHIRLR..........VYERGA--
DAPF_METTH/159-277.......LGP--AIENHPLFPERINVHFVE.............--------.VVSPSEIIMV..........TWERGA--
DAPF1_NOSS1/3-124.....PEKIK--IICHRNFGIGSDGILLGP.............--------LASTKAQFALR..........IFNPDG--
DAPF_HELPY/144-258.......TLE--LRALRHEFNANINIAFIE.............--------...NKETIFLQ.........TYERGVE--
DAPF_STRCO/152-274.......APP--SHAPAGAYPDGVNVEFVV.............--------.DRGPRHVAMR..........VHERGS--
DAPF_HAEIN/151-267.......LGP--LLESHERFPERVNAGFMQ.............--------.IINKEHIKLR..........VYERGA--
DAPF_ARCFU/153-266.......LAR--KIRYSEIFPEGTNVNFAK.............--------..VDGDTITVR.........TYERGVE--
DAPF_SYNY3/5-126....TPDQAQ--QLCDRHFGIGADGVIFAL.............--------PGQGGTDYTMR..........IFNSDG--
DAPF_AQUAE/3-132RGVSKEDFVR--KVCAFHTGVGADGLILIKN............--------PDNPENDFKWE..........FFNSDG--
DAPF_METJA/3-130E..EKAEFSR--KICRRGFSVGADGVIFIQK............--------PTSDEYDVRFR..........IFNSDG--
DAPF_SYNY3/156-272.......IGP--LFEHHPQFSQRTNTEFIQ.............--------.VLGSDRLKMR..........VWERGA--
DAPF_MYCLE/161-279L...D.LGAP--VHLDRVQFPDGVNIEVLT.............--------.APVDGMVQMR..........VHERGV--
DAPF_STRCO/7-135.....PAAVA--ALCDRRAGLGGDGLLHVVRSA........AH--------PEARGMAAEAEWF......MDYRNGDG--
DAPF_MYCLE/3-142.....AAQVA--ALCNRRQGLGADGVLRVTTAG........AA--------VTAGVLEHLPDGVSCSDWYMDYRNADG--
DAPF_BACSU/160-277.......LGP--VIEKDPRFPEGINVEFVE.............--------.TVNEQELHFR..........VWERGS--
DAPF_MYCTU/3-141.....AARVA--ALCDRRKGLGADGVLRVTTAGAAQAVGVLDS--------LP........EGVRVTDWYMDYRNADG--

PF04303

YRAM_BACSU/1-361YTFGQVSISEEKVDFKGNCGNISAAVGPFAIEEGLV.KAKEP...MTAVRILNTNTNKMIIA---------EVEVEDGQV
Q9I5E5_PSEAE/6-391YLYGQVSIDKPFVDWSGNCGNLSTGAGAFALHAGLVDPARIPEDGICEVRIWQANIGKTIIA---------HVPVSGGQV
Q987N7_RHILO/9-356YLFAQVRVDQQIVDTSPNCGNMLAAVGPFAIEAGLV.PVRGE...TTLVRIHNVNTSKLIEA---------EVPTPNGSV
Q9KSB9_VIBCH/7-389YLFGQVAIDKPFVDWSGNCGNLSAAVGPFAIHAGLIPAECIPHNGVVAVKVWQVNISKTIVV---------HVPIVNGAV
Q9PDY6_XYLFA/22-406YLFGQVAIERACVDWTGNCGNLSAAVGPFAIAAGIVDPARVPHRGICSVRIWQANIGKTIVA---------HVPIIDGQV
YBHH_ECOLI/1-350YLFAQVIVHEQRVDTTPNCGNMLSGVGAFAIENGLI.AATSP...VTRVRIRNVNTGTFIEA---------DVQTPNGVV

PF05544

T3HPD_HUMAN/22-352RSHGPVRFHSVPAFVLATDLMVDVPGH.GK----------VMVDIAYGGAFYAFVTAEKLGLDICSAKTRDLVDAASAVT
A9CFV0_AGRFC/7-330.FVESVRIFNVASYLHAADVEVNVPGL.GK----------LVVDIAYGGNYYAVIEPQVGWPGLDGMTAGDVVDLSQKLR
D0BA10_BRUME/8-331.YVERVRLTNVPAFLYAEGLEVECPDL.GP----------IKVDVAYGGNFYAIVEPQENYTDMDDYSALQLIAWSPVLR
T3HPD_PSEAE/9-334.KAERVEIRNVPSFADRLDAWIEVEGL.GS----------LQVDTAYGGDSFVIADARRLGFALRADEAAELVATGLKIT
4HYPE_XANCP/6-311.....VSIDNVESYRHAAGVEVDVPGH.GR----------VRGDVAWGGNWFFITEQA..PCALGLAQQRELTAYTEAIR
4HYPE_PSEAE/6-313.....VSVRNVPAYRYRRQVSVEVPGI.GR----------VSGDIAWGGNWFFLVAGH..GQRLAGDNLDALTAYTVAVQ
3HD4E_AGRFC/9-334.KAERIFVQNLPSFAAKLDAELEVEGL.GK----------LKVDTAYGGDSFVIVDAEAMGFSLKPEEAHEIARLGVRIT
Q988B5_RHILO/9-333.KCVSITLRNAPAFVDRLDASIEVEGL.GT----------LTVDIAYGGMFYAIVDAKALGFSIAPDEARELAVAGEKIR
4HYPE_AGRFC/9-333.RCEKVKLTMVPSFVHELDVSIDTPEW.GR----------VTMDISYGGIFYALVDVRQIGLTIEKANAAKLVAAGMTLK
D0B556_BRUME/9-333.KAERISVRNVPSFADRLDAPLDVTGL.GT----------IMVDTAYGGDSFVIVDAAQIGMKIEPGQARELAEIGVKIT
PRCMA_TRYCC/78-420SEVSNASIINVPSFLYQQDVVVVLPKPYGE----------VRVDIAFGGNFFAIVPAEQLGIDISVQNLSRLQEAGELLR
Q93RX9_STRCO/9-332.HAESVTLENVASYSHALDQVVDVPGH.GE----------VRYDIAYGGNFYAFVRTDDLGIPFERAHKQPLLDAGLAVM
M4TUF7_9XANT/9-335.KVTRVKLVNQPAFVYHLDAKVEVAGI.GT----------VSADIAFGGMTFALVDASSLGFEIVPAEARELCEYGQKIK
4HYPE_RHIME/8-331.FVEEVRLTNVPSFLYAEGLAAEVEGL.GE----------IVVDVAYGGNFYAIVEPQKNFRDMADHTAGELVGWSPKLR

PF02567

YFHB_BACSU/9-289-RIHITLEQASPQFKPFTGDRKKLADALGI----------TDEDF.............HEDLPIVFGSTGIWTAIVPLKS
PHZF_PSEAE/7-274-GKVVACSMQQPIPTWEHFSRPAELLAALG----------LKGS................TFPIEVYRNGPRHVFVGLES
YDDE_ECOLI/8-291-DYRISLEQGTPGFEPPLEGETRAAIINAL----------HLTEDD...........ILPGLPIQVATTGHSKVMIPLKP
Q9ZVS2_ARATH/12-282-GEESSIELDFPVVPTYEVNYIDDDLSLFS----------KALN...............GATILDVKAT.KKDLLVVLSS
YHI9_YEAST/10-290-INEGLISFKAPMADYESISSEMIADYEKA----------IGLK..............F.IKPPALLHTGPEWIVALVED
Y1330_DEIRA/21-304-GGECRVWMHQPAFGTRAVGRGWHRELAEA----------LGLSDR..........LLHRGLPLAAASTGLWSVFLPLLD
Q9RJQ0_STRCO/11-286-GAVRATLTSVPTRSRPALPAERDAALGAL----------GWTAAD...........LDPALPAHVAFGGNDHLVLAAAS
Y1019_SYNY3/8-300-VQTELTVAQLPQTKDSAPSCEDLALLLGL----------SIDQL............QQGEYEPQAYSCGLPFLFIPLIN
Q9SDD7_ORYSJ/11-305-EEKLFIELDFPMIDLVEYDSAETLSIPET----------LNGA................RVVSVWKSSTAGDLIVELSS
F4JHW1_ARATH/31-309-GGTFLIELNFPVVTTCDVNLSDVSSSMIT----------KALN...............GATIVDIKATATNNILVVLPS
Q66GM9_ARATH/14-302-KRSFLIEMNFPVITTCEYSSKDVSIFSKA----------LNGATIVDVRETKTDRLIFKPLIGAFKTTSTDQIIVVLSS

PF01678

DAPF_HAEIN/3-124--------------------------------------------------------------------------------
DAPF_METTH/4-131--------------------------------------------------------------------------------
DAPF_BACSU/6-131--------------------------------------------------------------------------------
DAPF1_NOSS1/152-267--------------------------------------------------------------------------------
DAPF_METJA/165-285--------------------------------------------------------------------------------
DAPF_ARCFU/5-128--------------------------------------------------------------------------------
DAPF_HELPY/3-118--------------------------------------------------------------------------------
DAPF_AQUAE/147-267--------------------------------------------------------------------------------
DAPF_ECOLI/151-267--------------------------------------------------------------------------------
DAPF_METTH/159-277--------------------------------------------------------------------------------
DAPF1_NOSS1/3-124--------------------------------------------------------------------------------
DAPF_HELPY/144-258--------------------------------------------------------------------------------
DAPF_STRCO/152-274--------------------------------------------------------------------------------
DAPF_HAEIN/151-267--------------------------------------------------------------------------------
DAPF_ARCFU/153-266--------------------------------------------------------------------------------
DAPF_SYNY3/5-126--------------------------------------------------------------------------------
DAPF_AQUAE/3-132--------------------------------------------------------------------------------
DAPF_METJA/3-130--------------------------------------------------------------------------------
DAPF_SYNY3/156-272--------------------------------------------------------------------------------
DAPF_MYCLE/161-279--------------------------------------------------------------------------------
DAPF_STRCO/7-135--------------------------------------------------------------------------------
DAPF_MYCLE/3-142--------------------------------------------------------------------------------
DAPF_BACSU/160-277--------------------------------------------------------------------------------
DAPF_MYCTU/3-141--------------------------------------------------------------------------------

PF04303

YRAM_BACSU/1-361KYDGDVTISGVPGSGSPIYLNFHDAAGSVT..GHLLPTGNSSEFLDTSQ.GQIEVSIIDYANPLVFVEASSIGLDGTELA
Q9I5E5_PSEAE/6-391QETGDFELDGVTFPAAEIVLEFLDPSDDGEDGGAIFPTGNLVDDLEVPGVGTFKATMINAGIPTVFVNAEEIGYRGTELR
Q987N7_RHILO/9-356SYLGEAAIDGVPGRGAPIALTFMDAAGART..GQLFPTGNPVDTIDG.....VAVTCIDCAMPMILIEADSVGATGFESA
Q9KSB9_VIBCH/7-389QECGEFELDGVTFAAAEVQVDFVDPADDS...GAMFPTGNVMDDLQVPGIGTLNATFINSGIPTIFVDAEALGYQGTELQ
Q9PDY6_XYLFA/22-406QESGDFMMEGAAFPGAEVRLEFFNPADVGG.DRAMFPTGHLIDTLEVPGLGPIEATLINAGIPMLCVDAHALGYTGTELQ
YBHH_ECOLI/1-350EYEGSARIDGVPGTAAPVALTFLNAAGTKT..GKVFPTDNQIDYFDD.....VPVTCIDMAMPVVIIPAEYLGKTGYELP

PF05544

T3HPD_HUMAN/22-352EAVKAQFKINH--------PDSEDLAFLYGTILTDGKDAYTK.EPTTN-------------------ICVFADEQVDRSP
A9CFV0_AGRFC/7-330DALGTICDPVH--------PDDERIRGVHHAIWCDRPVSAEA..DGRG-------------------AVFYGDKAIDRSP
D0BA10_BRUME/8-331QRLNEKYKFQH--------PELPDINRLSHILWTGKPKHPQA..HARN-------------------AVFYGDKAIDRSP
T3HPD_PSEAE/9-334HAANEQLGFRH--------PTNPDWDHLSFCQLAAPPERRDGVLGANN-------------------AVVIRPGKIDRSP
4HYPE_XANCP/6-311LALEAA....G--------ITGEAGGEIDHIEISGVAPDGSG..AARN-------------------FVLCPGLAYDRSP
4HYPE_PSEAE/6-313QALDDQ....D--------IRGEDGGAIDHIELFADDPHA....DSRN-------------------FVLCPGKAYDRSP
3HD4E_AGRFC/9-334NAANKALGFDH--------PENPDWRHFSFCLFAGKVERTAEGLRAGA-------------------AVAIQPGKVDRSP
Q988B5_RHILO/9-333RAAREQLDVVH--------PQFDHVRGVSIVQFAMPFQGPGN..VTRN-------------------TCIVSPGRSDRSP
4HYPE_AGRFC/9-333DLVNREMTVVH--------PEIPAISGVAYVMFRDVDADG....SIRT-------------------CTTMWPGRADRSP
D0B556_BRUME/9-333KAANEQLGFRH--------PE.RDWRHISFCQITEPVTREGDVLTGVN-------------------TVAIRPAKFDRSP
PRCMA_TRYCC/78-420TEINRSVKVQH--------PQLPHINTVDCVEIYGPPTNPEA..NYKN-------------------VVIFGNRQADRSP
Q93RX9_STRCO/9-332DAINKQNPVSH--------PENPDIDVCHHVYLEAPGSTAE...HSRH-------------------AMAIHPGWFDRSP
M4TUF7_9XANT/9-335AAAAEQLDVAF--------PGNPDMPGITMTQFTGPLSRADGKFFSRN-------------------TTIVSPGRCDRSP
4HYPE_RHIME/8-331AALNAKYEFVH--------PEHPEIRGLSHIQWTGKPTQPEA..HARN-------------------AVFYGEKAIDRSP

PF02567

YFHB_BACSU/9-289LEASKKMVPDNK....QFPEVLVDLPKASVHPFTFETVHPDSDLHGRH-------------------FSSPYSGTIEDPV
PHZF_PSEAE/7-274VAALSALHPDH........RALCDFPDLAV....NCFAGAGRHWRSRM-------------------FS.PAYGVVEDAA
YDDE_ECOLI/8-291EVDIDALSPDLN....ALTAISKKIGCNGFFPFQIRPGKNETD..GRM-------------------FS.PAIGIVEDPV
Q9ZVS2_ARATH/12-282WEAVIDLKPRL........DEISKCPCEGMMVTAAASDGSTYDFCSRY-------------------FA.PRFGINEDPV
YHI9_YEAST/10-290AETCFNANPNFAM...LAHQTKQNDHVGIILAGPKKEAAIKNSYEMRA-------------------FA.PVINVYEDPV
Y1330_DEIRA/21-304ASLLEGLEPDL.......PRIAELSRELGVVSVYAYAPVGVNRFAARD-------------------FA.PLVGIPEDPV
Q9RJQ0_STRCO/11-286RARLADLDYDF.......DALAEVMRRYGWTTVDLVWRESAGLYHARN-------------------PF.PVGGVVEDPA
Y1019_SYNY3/8-300EEALNRISFNPSVWQNLLAGQWADCVYCLAPGDPSLGLSDNKLIHGRM-------------------FA.PGLGIAEDPA
Q9SDD7_ORYSJ/11-305GKEVADIIPNI........NEIKKCDGRGVIVTGPAPAGSDYDFFSRF-------------------FC.PKFGIDEDPV
F4JHW1_ARATH/31-309KESVTELQPRM........DDILKCPCDGIIVTAAGSTGSSYDFYSRY-------------------FA.PKFGVDEDPV
Q66GM9_ARATH/14-302WESVIEFQPRV........DDIVKCPGKVMIVTAAAPQGSPFDFCSRL-------------------FA.PKLGLNEDSV

PF01678

DAPF_HAEIN/3-124---------------------------------------------------------------------------SEVSQ
DAPF_METTH/4-131---------------------------------------------------------------------------SEAEM
DAPF_BACSU/6-131---------------------------------------------------------------------------SEGKN
DAPF1_NOSS1/152-267---------------------------------------------------------------------------GYTLA
DAPF_METJA/165-285---------------------------------------------------------------------------GYTTA
DAPF_ARCFU/5-128---------------------------------------------------------------------------SEAAM
DAPF_HELPY/3-118---------------------------------------------------------------------------SKAGM
DAPF_AQUAE/147-267---------------------------------------------------------------------------SETLA
DAPF_ECOLI/151-267---------------------------------------------------------------------------GETQA
DAPF_METTH/159-277---------------------------------------------------------------------------GPTMA
DAPF1_NOSS1/3-124---------------------------------------------------------------------------SEAEK
DAPF_HELPY/144-258---------------------------------------------------------------------------DFTLA
DAPF_STRCO/152-274---------------------------------------------------------------------------GETRS
DAPF_HAEIN/151-267---------------------------------------------------------------------------GETQA
DAPF_ARCFU/153-266---------------------------------------------------------------------------GETLS
DAPF_SYNY3/5-126---------------------------------------------------------------------------SEPEM
DAPF_AQUAE/3-132---------------------------------------------------------------------------SVAEM
DAPF_METJA/3-130---------------------------------------------------------------------------SEAEM
DAPF_SYNY3/156-272---------------------------------------------------------------------------GITLA
DAPF_MYCLE/161-279---------------------------------------------------------------------------GETRS
DAPF_STRCO/7-135---------------------------------------------------------------------------SVAEM
DAPF_MYCLE/3-142---------------------------------------------------------------------------SVAQM
DAPF_BACSU/160-277---------------------------------------------------------------------------GITQA
DAPF_MYCTU/3-141---------------------------------------------------------------------------SAAQM

PF04303

YRAM_BACSU/1-361EEFT.DLQ.LAQFEELRSIAAEKCGFASRFSATKLSPAVPKLAIVAKPEKYKDSTGAWHSSVEMDLHIRMMSMQKPHQAL
Q9I5E5_PSEAE/6-391EEINGDPQQLARFERIRVAGALRMGLIKTPEEAATRQHTPKIAFVAPPRDYRTASGKLVAAGDIDLLVRALSMGKLHHAM
Q987N7_RHILO/9-356AELNADKELLGRLEKLRIAAGERMG.LGDVRDQV....TPKPVLISRPT....SGG......DIS..VRYFMPHQCHPSL
Q9KSB9_VIBCH/7-389EAINSDPQALAKFETLRAYGALKMGLIERIEEAQNRQHTPKIAFVSGAKSYLASSGKRVEADSVDLLVRALSMGKLHHAM
Q9PDY6_XYLFA/22-406EAINGDPHALVCLETLRAYGALRMGVIGHLEDMVQHQHTPKLAFVAPPADYVASGGRHVHATEIDVLVRAMSMGRLHHAM
YBHH_ECOLI/1-350AELDADKALLARIESIRLQAGKAMG.LGDVSNMV....IPKPVLISPAQ....KGG......AIN..VRYFMPHSCHRAL

PF05544

T3HPD_HUMAN/22-352TGSGVTARIALQYHKGLL---ELNQMRAFKSSATGSVFTGKAVREAKCGDFK............AVIVEVSGQAHYTGTA
A9CFV0_AGRFC/7-330GGTGTSARMAQLHGKGRL---KAGETFRQE.SLIGTIFEGKVEEETTVGSFS............GIRPSIGGWARIIGHN
D0BA10_BRUME/8-331CGTGTSARMAQLAAKGKL---KPGDEFIHE.SIIGSLFHGRVERAAEVAGRP............AIVPSIAGWARMTGYN
T3HPD_PSEAE/9-334CGTGCSARMAVLQAKGQL---RVGERFVGR.SIIGSEFHCHIESLTELGGRP............AILPCLSGRAWITGIH
4HYPE_XANCP/6-311CGTGTSAKLACLAADGKL---AEGERWLQQ.GILGSAFEGSY....RHSGRG.............IAPRISGHAFITARS
4HYPE_PSEAE/6-313CGTGTSAKLACLAADGKL---LPGQPWRQA.SVIGSQFEGRYEWLDGQPGGP.............IVPTIRGRAHVSAEA
3HD4E_AGRFC/9-334TGTALSARMAVLHARGEM---KEGETLTAV.SLIGSTFTGRILGTTTVGDRP............AILPEISGRGWITGIH
Q988B5_RHILO/9-333TGTGTSARMAVLQARGLM---GVGDVLIHE.SIIGSRFTGRIVELAEIAGRK............AIVPEITGRAWITGEH
4HYPE_AGRFC/9-333CGTGNSANLATLYARGKV---KVGDEYKSR.SIIGSEFDVGLSAVTEVAGRP............AVIPTIAGRGFTFGLH
D0B556_BRUME/9-333TGTGCSARMAVLHAKGQM---KAGERFIGK.SVLGTEFHCRLDKVLELGGKP............AISPIISGRAWVTGTS
PRCMA_TRYCC/78-420CGTGTSAKMATLYAKGQL---RIGETFVYE.SILGSLFQGRVLGEERIPGVKVPVTKDAEEGMLVVTAEITGKAFIMGFN
Q93RX9_STRCO/9-332CGTGTSARMAQLHARGLL---PAGRDFVNE.SFIGSRFVGRVLGETTVGGRP............AVLPSVTGRAWITGTA
M4TUF7_9XANT/9-335CGAGSSARLAALHAKGVL---AKGDTLVHE.SIIGSRFECGIEDMSNVGDYP............AVVPSIAGQAWISGLS
4HYPE_RHIME/8-331CGTGTSARIAQLAAKGKL---KVGDEFVHE.SIIGSLFKGRVEAAAKVADRD............AIIPSIAGWARMTGIN

PF02567

YFHB_BACSU/9-289TGTASGVMGAYMKHYGNA....EQHKFIIE-QGQEIGKDGKVEIEMNEAGGH--------------V.....KVNMTGTA
PHZF_PSEAE/7-274TGSAAGPLAIHLARHRQI...PYGQQIEIL-QGVEIGRPSRMYARAEGAGER--------------V....SAVEVSGNG
YDDE_ECOLI/8-291TGNANGPMGAWLVHHNVLPHDGNVLRVKGH-QGRALGRDGMIEVTVTI.R..--------------.DNQPEKVTISGTA
Q9ZVS2_ARATH/12-282TGSAHCALAHYWSLRMNK........CDFF-AYQASSRGGTLK.......VH--------------LDKEKQRVLLRGKA
YHI9_YEAST/10-290CGSGSVALARYLQEVYKF...EKTTDITIS-EGGRLKRNGLMLASIK....K--------------EADNSTSYYIAGHA
Y1330_DEIRA/21-304TGSAGGALLALLASEGRLPLRGNRASGLIY-QGHALGTPGEIEVEVEVRGTR--------------V....EAVQVGGCA
Q9RJQ0_STRCO/11-286TGAAAAAFGGYLRELGLV...TGPATIAVR-QGEDMGRTSELL.......IE--------------VGPRDPRTRVTGQA
Y1019_SYNY3/8-300TGSGVAALGGYLDDRLDT...PGSHHWQIE-QGKALGRPSQLQLTV....VK--------------DGQGIRAVKVAGRS
Q9SDD7_ORYSJ/11-305CGSAHCVLAPYWGGKLGK........QKLT-AFQASPRSGTLYLELDG...E--------------NR....RVRIQGEA
F4JHW1_ARATH/31-309CGSAHCALAHYWSIKMNK........FDFL-AYQASSRSGTIR.......IH--------------LDKEKQRVLLRGKA
Q66GM9_ARATH/14-302CGSAHCSLAHYWSLKMNK........CDFV-AFAASQRSGTLK.......VH--------------YDKEKQRVLLTGKA

PF01678

DAPF_HAEIN/3-124CGNG.ARCFARFVTLKGL---T.....NKK-DISVSTQKGNMVLTVKDDNQ.-----------------...IRVNMGEP
DAPF_METTH/4-131CGNG.IRCFSKFVYDNAI---V.....RKR-RLEVETLAGIKTVELEVEDGA-----------------VVSSRVDMGTA
DAPF_BACSU/6-131CGNG.LRCVAKYAYEHKL---V.....EET-SFLIETLSGLVKAEVQVENGK-----------------VNVVTVDMGEP
DAPF1_NOSS1/152-267SGSSSSAAAATAHKLGL.---......CDS-KIIVKMPGGDILIQIKDDFH.-----------------....ISMTDSV
DAPF_METJA/165-285CGTGTTASVIMAHKLGK.---......TNN-RVLAHLDGGDLEIEIKDD...-----------------...GVYMIGDA
DAPF_ARCFU/5-128CGNG.IRCFSRYVVEE.G---Y.....AGE-RLRVETLAGILELEVKRENG.-----------------W.WVKVDMGKP
DAPF_HELPY/3-118CGNA.SRCVGLFAYQHAI---A........-SKNHVFLAGKREISICIEEPN-----------------..IIESNLGNY
DAPF_AQUAE/147-267CGTGATACAIVSYLKGLV---K......KK-PVNVLTRSGEVLTIDFSEDLK-----------------...EVFLTGSV
DAPF_ECOLI/151-267CGSGACAAVAVGIQQGL.---......LAE-EVRVELPGGRLDIAWKGPGHP-----------------....LYMTGPA
DAPF_METTH/159-277CGTGATASVIAGVKLEK.---......LDD-SVLVHLPGGELKIDVYQDGTE-----------------..LGAYMEGDA
DAPF1_NOSS1/3-124SGNG.LRIFSRYLWDMGL---V.....DEK-PFSIETAGGIVESAIKDAGKT-----------------...VQVEMGKV
DAPF_HELPY/144-258CGTGMAAVFIAARIFYNT---P......KK-AALIPKSNESLELSLKNDG..-----------------....IFYKGAV
DAPF_STRCO/152-274CGTGACAVAVATARRDGL---DPAATGTPA-TYTVDVPGGTLVITERPDGE.-----------------....IEMTGPA
DAPF_HAEIN/151-267CGSGACAAVAVGIMQGL.---......LNN-NVQVDLPGGSLMIEWNGVGHP-----------------....LYMTGEA
DAPF_ARCFU/153-266CGTGSVAVAAIANRLGLT---G.......S-KVDVVTKGGLLKIELTEDT..-----------------....AYMTGGA
DAPF_SYNY3/5-126CGNG.IRCLAKFLADLEG---V.....EEK-TYRIHTLAGVITPQLLADGQ.-----------------...VKVDMGEP
DAPF_AQUAE/3-132CGNG.SRCAVRFAYERGI---V......GN-KVRFETLAGVIKAEVYENGRK-----------------...VKVQLTPP
DAPF_METJA/3-130CGNG.IRCFSKYVYER.I---M.....KKN-PLKVETKGGLRVSEMEIEGDE-----------------VKKIKVYMGVP
DAPF_SYNY3/156-272CGTGACATVVAAVLTGR.---......GDR-RCTVELPGGNLEIEWSAQDNR-----------------....LYMTGPA
DAPF_MYCLE/161-279CGTGTVAAAVAALASAG.---A.....DTG-TLTVRVPGGDVVITITDVTS.-----------------.....YLRGPS
DAPF_STRCO/7-135CGNG.VRVFARYLQHAGH---V.....TEG-DLAVATRGG...VKTVHIAK.-----------------NGDVTVGMGRA
DAPF_MYCLE/3-142CGNG.VRVFAHYLRASGL---E.....SCD-EFVVGSLAGPRLVNVHHVDEL-----------------NADVTVDMGKA
DAPF_BACSU/160-277CGTGACAAAVASVLNGVS---K.....RNQ-DITVHLAGGDLVINWKDNGH.-----------------....VMMTGPA
DAPF_MYCTU/3-141CGNG.VRVFAHYLRASGL---E.....VRD-EFVVGSLAGPRPVTCHHVEAA-----------------YADVSVDMGKA

PF04303

YRAM_BACSU/1-361AVTGAICTTRALSVEGAIPARIAKNHS..T-KVRLAHSSGIIETMVEPTG..--------------.......IKIVRTA
Q9I5E5_PSEAE/6-391MGTAAVAIGTAAAIPGTLVNLAAGGGE.RS-AVRFGHPSGTLRVGAEASQAN--------------GEWTVTKAIMSRSA
Q987N7_RHILO/9-356ATTGAVGIATACISQGTVASLLIGLRAPPV-VLSIEHPSGHLDVKLYERD..--------------...GKVVAGILRTA
Q9KSB9_VIBCH/7-389MGTAAVAIASAAAVPGTLVNLAAGGGE.RT-SVTFGHPSGTLKVGAKAKQGK--------------QGWQIERAIMSRSA
Q9PDY6_XYLFA/22-406MGTAAVALGTAAAIPGTLVNRAAGGGL.RR-VVRFGHPSGTLQVGAEVHQVD--------------GQWSVSNVRMSRSA
YBHH_ECOLI/1-350AITGAIAISSSCALEGTVTRQIVPSVG.YG-NINIEHPSGALDVHLSNEGQD--------------A..TTLRASVIRTT

PF05544

T3HPD_HUMAN/22-352SFIIEDDDPLRDGFL
A9CFV0_AGRFC/7-330TIFVDDRDPLAHGFQ
D0BA10_BRUME/8-331TIFIDDRDPFAHGFS
T3HPD_PSEAE/9-334QYLLDPDDPWPQGYR
4HYPE_XANCP/6-311QLLIDPADPFAWGIV
4HYPE_PSEAE/6-313TLLLADDDPFAWGIR
3HD4E_AGRFC/9-334QHMLDPSDPWPEGYR
Q988B5_RHILO/9-333SYYLDPTDPYPQGYV
4HYPE_AGRFC/9-333QVGLDPFDPLGDGFA
D0B556_BRUME/9-333QLMLDPSDPFPHGYR
PRCMA_TRYCC/78-420TMLFDPTDPFKNGFT
Q93RX9_STRCO/9-332QYLLDPSDPYPAGFT
M4TUF7_9XANT/9-335QLGLDPSDPYAEGFT
4HYPE_RHIME/8-331TIFIDDRDPFAHGFV

PF02567

YFHB_BACSU/9-289VYSETR---------
PHZF_PSEAE/7-274AAFAEG---------
YDDE_ECOLI/8-291VILFHA---------
Q9ZVS2_ARATH/12-282VTVMEG---------
YHI9_YEAST/10-290TTVIDG---------
Y1330_DEIRA/21-304AVEREG---------
Q9RJQ0_STRCO/11-286VPV.SG---------
Y1019_SYNY3/8-300VLVSEG---------
Q9SDD7_ORYSJ/11-305VTVMAG---------
F4JHW1_ARATH/31-309VTVMEG---------
Q66GM9_ARATH/14-302VTVMKG---------

PF01678

DAPF_HAEIN/3-124IWE------------
DAPF_METTH/4-131TFK------------
DAPF_BACSU/6-131RLT------------
DAPF1_NOSS1/152-267TKL------------
DAPF_METJA/165-285VMV------------
DAPF_ARCFU/5-128KFG------------
DAPF_HELPY/3-118.KI------------
DAPF_AQUAE/147-267YKV------------
DAPF_ECOLI/151-267VHV------------
DAPF_METTH/159-277VMV------------
DAPF1_NOSS1/3-124SFW------------
DAPF_HELPY/144-258RYI------------
DAPF_STRCO/152-274VIV------------
DAPF_HAEIN/151-267THI------------
DAPF_ARCFU/153-266SRV------------
DAPF_SYNY3/5-126QLL------------
DAPF_AQUAE/3-132SKP------------
DAPF_METJA/3-130KFK------------
DAPF_SYNY3/156-272QRV------------
DAPF_MYCLE/161-279VLV------------
DAPF_STRCO/7-135.LL------------
DAPF_MYCLE/3-142NLL------------
DAPF_BACSU/160-277ETV------------
DAPF_MYCTU/3-141NR.------------

PF04303

YRAM_BACSU/1-361RRIMDGTVYTH----
Q9I5E5_PSEAE/6-391RILMEGWVRVP----
Q987N7_RHILO/9-356RRLFEGHVFAK----
Q9KSB9_VIBCH/7-389RILMEGWVRVP----
Q9PDY6_XYLFA/22-406RVLMEGWVRVP----
YBHH_ECOLI/1-350RKIFSGEVYLP----

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window