Sequence alignment for CL0290

PF01137

RTC1_MOUSE/8-340VDGG--------IMEGGGQILRVSTALSCLLGLP----LRV.QKIRAGRST.PGLRPQHLSGLEMVRDLCGGHLEGAEIG
Q8SRP7_ENCCU/11-319CPES--------........LELILVCSLLSKNT----VKVAVGRRYSMAK.........SFVKLLQGISHGSSHSWEEG
RCL1_CAEEL/2-342SSET--------LEFSGCNFFRIRLAYSILSGRP----IRI.INIRKNDDR.PGIRDFESKLIGLLEKVTNGTKVEISRT
RCL1_HUMAN/8-343LSYA--------....GCNFLRQRLVLSTLSGRP----VKI.RKIRARDDN.PGLRDFEASFIRLLDKITNGSRIEINQT
RCL1_DROME/7-349EGNC--------LIYRGSNFLKQRLILACLSGKP----VKI.SQIRSEDETAPGLREYEISLIRLLDKITNGTKIELNPA
RCL1_ARATH/1-351MVMM--------KKMKGSQSFRQRLLLSTLSSTP----ISI.DEIRADETI.PGLRPHEVNLLRLLEIVTDDAVVDINET
RCL1_YEAST/5-341APKY--------TTFQGSQNFRLRIVLATLSGKP----IKI.EKIRSGDLN.PGLKDYEVSFLRLIESVTNGSVIEISYT
RCL1_SCHPO/3-340TGQL--------KRFKGCEYLTHRLVLATLSGTP----IRV.EGIYPDEAD.PGVKDYQVSFLRLLEKLTNGSVIEISYT
RTCA_NOSS1/4-336IDGS--------YGEGGGQVLRTSLSLAAITGEP----IRI.AGIRAGRRK.PGLAAQHLTAVRAAARICHGELQGDALG
RTCA_RALSO/13-335LDGA--------QGEGGGQILRTALTLSMLTGTP----FRI.ERIRAGRSK.PGLMRQHLTAVQAAAEVSGATVEGAEAG
RTCA_ECOLI/7-328LDGA--------QGEGGGQILRSALSLSMITGQP----FTI.TSIRAGRAK.PGLLRQHLTAVKAATEICGATVEGAELG
RTCA_SALTY/7-328LDGA--------QGEGGGQILRSALSLSMITGQP----FEM.SGIRAGRAK.PGLLRQHLTAVRAATEICGAQVNGDELG
RTCA_PSEAE/8-328LDGS--------..EGGGQILRSALSLSMTSGQP----LRI.RNIRGRRSR.PGLLRQHLTAVRAAAEICAAEVEGAELG
RTCA_HALSA/4-329LDGS--------..SGGGQLVRTALTCAAVSGES----FRM.RYVRRARSN.PGLQAQHCAAVNAVADICDAATDGVEVG
RTCA_METTH/4-326IDGS--------EGEGGGAVVRVSTALAAVTSRS----VRV.YNIRARRSR.SGLSHQHLTAVRAVARISNGTLRGDELG
RTCA_AERPE/9-342VDGS--------MGEGGGQILRTAVALAAVLGRP----LRI.VNIRAKRRP.PGLRPQHLTAVRAVAAISGGRLRGAEVG
RTCA_METAC/4-345IDGS--------YGEGGGQVVRTAVALSAVTGKD----VKV.TNIRKNRPN.PGLKQQHLKALETAARICEARVSGLFPG
RTCA_METMA/4-342IDGS--------YGEGGGQLVRTAVALSAVTGEE----IKV.TNIRENRPN.PGLKQQHLKALETAAKICGARVSGLSQG
RTCA_ARCFU/4-322IDGS--------FGEGGGQILRTAVALSCVTGKA----VRI.RNIRANRPK.PGLAAQHLKGIEAAKIISNAEVEGLRIG
RTCA_SULSO/4-326IDGS--------FGEGGGQILRTSLTLSVITGKP----FRI.FNIRANRPN.PGLQRQHLWAVRAMKMISNAETKGDEVG
RTCA_SULTO/4-327IDGS--------FGEGGGQILRTSLTLSALTKKP----FRI.YKIRANRPK.PGLQRQHLTAVEAVKKLTNAKVKGDFVG
RTCA_METJA/6-324IDGS--------YLEGGGQIIRTAVSLSALTQKP----VKI.INIRKKRKN.KGLAPQHVSAVKAVKKLCNAEVFGLNVG
RTCA_PYRHO/4-327IDGS--------YGEGGGQILRTSVALSTITGEP----VRI.VNIRANRPN.PGLRPQHLHAILALKHLANAEVKGAHVG
RTCA_PYRFU/4-327IDGS--------YGEGGGQILRTSIALSAITGEP----VKI.INIRANRPN.PGLRPQHLNAILALKKLANAKVEGAEVG
RTCA_PYRAE/5-333IDGS--------YGEGGGQILRTSIALSALLGRP----VEI.VNIRAKRAN.PGLQPQHLTGVKVAALLTDAEVKGAEKG
RTCA_METKA/6-338IDGS--------YGEGGGQILRTAVGMSALTGEP----VRI.YNIRANRPR.PGLSHQHLHAVKAVAEICDAECEGLEIG
RTCA_AQUAE/7-349LDGS--------YGEGGGQIVRTALFLSTLLQVP----VRI.YNIRAKREK.PGLKRQHLNIVKLLKRFAKAKVKGDELG
RTC1_DICDI/38-374IDGS--------ILEGGGQILRNSVALASLFNKA----ISI.EKIRYNRDQ.PGLKNQHKAGIDLMSRLFKAHLTGCSVG
RTC1_DROME/9-341IDGS--------YLEGGGQALRNALSLSCILGKP----VRV.VKIRASRPS.PGLSHQHLHGLNLLRDITNADVVGNYLL

PF00275

AROA_CAMJE/6-419LQTP..VNAILENIAADKSISHRFAIFSLLTQEE....NKA-QNYLLAQD--TLNTLEIIKNLG...AKIEQKDSCVKII
AROA_STAA8/7-425IDISGPLKGEI.EVPGDKSMTHRAIMLASLAEGV....STI-YKPLLGED--CRRTMDIFRLLGVEI.KEDDEKLVVTSP
MURA_AQUAE/15-412IRGGKPLTGKV.KISG.AKNAALPIMFATILTE.E..PCTI-TNVPDLLD--VRNTLLLLRELGAELEFL.N.NTVFINP
AROA_AQUAE/4-425IEKIKRVKGEL.RVPSDKSITHRAFILGALASGE....TLV-RKPLISGD--TLATLEILKAIR...TKVREGKEEVLIE
ARO1_YEAST/409-865KDIPADQQKVV.IPPGSKSISNRALILAALGEGQ....CKI-KNLLHSDD--TKHMLTAVHELKGATISWEDNGETVVVE
AROA_AERSA/6-420LEPISRVAGEV.NLPGSKSVSNRALLLAALARGT....TRL-TNLLDSDD--IRHMLAALTQLG.VKYKLSADKTECTVH
MURA_MYCLE/7-406VTGGNRLSGEV.TVGG.AKNSVLKLMAATLLAE.G..TSTI-TNCPDILD--VPLMAEVLRGLGATVELY.G.DVARITS
AROA_SOLLC/83-514LXPIKDISGTV.KLPGSKSLSNRILLLAALSEGR....TVV-DNLLSSDD--IHYMLGALKTLG.LHVEDDNENQRAIVE
AROA_METJA/6-419VKKTDRLEGIV.KAPPSKSYTHRAVIGASLADGV....SRI-INPLWGAD--CLSSVHGCRMLGA.NIELDKEKDEWIVK
AROA_SYNY3/20-441PAQGVALTGRL.RVPGDKSISHRALMLGAIATGE....TII-EGLLLGED--PRSTAHCFRAMGAEISELNSEKIIVQGR
MURA_PSEPU/6-407ITGGACLDGEI.RISG.AKNAALPILAATLLAD.G..PVTV-GNLPHLHD--ITTMIELFGRMGIEPVID.EKLAVEIDP
AROA_METTH/5-409VEKSGNLEGTV.KAPPSKSYTHRAVIIAALAEGV....SEI-RDPLIAED--TLSSLNACRAFG...IRVD.EGDAWTVH
MURA_CHLPN/6-427VFGCGRLNGEV.KVSG.AKNAATKLLVASLLSD.Q..KCTL-RNVPDIGD--VSLTVELCKSLGAHVSWDKETEVLEIYT
AROA_BUCAP/7-421LKPVSYINGTI.YLPGSKSISNRVLLLSAMANGI....TCL-TNLLDSQD--TQYMLNALRKIG.IKFFLSNNNTTCHVH
AROA_DICNO/8-426TAPVSALSGEI.TICGDKSMSHRALLLAALAEGQ....TEI-RGFLACAD--CLATRQALRALGVDI.QREKEIVTIRGV
AROA_PASHA/6-426LTPISRVEGEI.NLPGSKSLSNRALLLAALATGT....TQV-TNLLDSDD--IRHMLNALKALG.VKYELSDDKTVCVVE
MURA_SHIFL/6-406VQGPTKLQGEV.TISG.AKNAALPILFAALLAE.E..PVEI-QNVPKLKD--VDTSMKLLSQLGAKVER...NGSVHIDA
AROA_MYCTU/7-419PTAPTPVRATV.TVPGSKSQTNRALVLAALAAAQGRGASTI-SGALRSRD--TELMLDALQTLG...LRVDGVGSELTVS
MURA_HAEIN/6-408VYGQSRLSGSV.NISG.AKNAALPILFAAILAT.E..PVKL-TNVPELKD--IETTLKILRQLGVVVDRD.ATGAVLLDA
AROA_CORGL/17-425PRARGPIVSDL.AIPGSKSITNRALILAALASTP....STI-IDVLRSRD--TDLMTDGLRSLGITITEE..AVDRYRVE
AROA_KLEPN/6-420LQPIARVDGTV.NLPGSKSVSNRALLLAALARGT....TVL-TNLLDSDD--VRHMLNALSALG.VHYVLSSDRTRCEVT
MURA1_BACSU/6-407VRGGQKLNGTV.KVEG.AKNAVLPVIAASLLASEE..KSVI-CDVPTLSD--VYTINEVLRHLGADVHFE..NNEVTVNA
AROA_PASMU/10-432LNPISYIEGEV.RLPGSKSLSNRALLLSALAKGK....TTL-TNLLDSDD--VRHMLNALKELG.VTYQLSEDKSVCEIE

PF01137

RTC1_MOUSE/8-340STEITFTP...........EKIRGG.VHTADT......KTAGSVCLLMQVSMPC-----------------VLFAASPSE
Q8SRP7_ENCCU/11-319..YVLFAP...........GALRGG.DTTVVC......SDE..ISMYIEPLLVL-----------------CPFVTEPLR
RCL1_CAEEL/2-342GTQVIFRP...........GMITGG.VVNLDC......GTERCISYFLEPLLLL-----------------SPFCKVPMV
RCL1_HUMAN/8-343GTTLYYQP...........GLLYGG.SVEHDC......SVLRGIGYYLESLLCL-----------------APFMKHPLK
RCL1_DROME/7-349GTSVMFSP...........GLLHGG.QLNHDC......CVQRGIGYYLDALIAL-----------------GPFCKSPLQ
RCL1_ARATH/1-351GTRLKYKP...........GTIVGGKNLVHSC......SLSRSIGYYLEPLLLL-----------------GLFGKKPLS
RCL1_YEAST/5-341GTTVIYRP...........GIIVGG.ASTHIC......PSSKPVGYFVEPMLYL-----------------APFSKKKFS
RCL1_SCHPO/3-340GTSFIYRP...........GNIIGG.RVVHDC......PTTKGIGYFLEPILIL-----------------CLFAKTPTS
RTCA_NOSS1/4-336STMLEFIP..........GGGVKAG.NYIFDVSEVQQGGSAGAITLVLQTILLP-----------------LALADGDSH
RTCA_RALSO/13-335SQALAFAP...........GPIHGG.DYRFAI......GTAGSCTLVLQTVLPA-----------------LWFADAPST
RTCA_ECOLI/7-328SQRLLFRP...........GTVRGG.DYRFAI......GSAGSCTLVLQTVLPA-----------------LWFADGPSR
RTCA_SALTY/7-328SQQLRFTP...........GPIRGG.EYRFAI......GSAGSCMLVLQTVLPA-----------------LWFADGSSR
RTCA_PSEAE/8-328SRELAFRP...........GAIRAG.DYAFAI......GSAGSCSLVLQTLLPA-----------------LLAANGESR
RTCA_HALSA/4-329SEAFSFEPEVAAEEADDDEEPTLGG.TTSVEV......GTAGSIPLVFDSLLPL-----------------AGALDEPIT
RTCA_METTH/4-326SMELEFSP...........GRVTGG.TFNFDV......KTAGSTGLVLQAIMVA-----------------AAASEGEID
RTCA_AERPE/9-342STSLEFTP...........GRVRGG.RYRFDV......GTAGSVALIIQALAPL-----------------LAYSDSPVE
RTCA_METAC/4-345SSELFFSP...........VEIKGG.KYEVDI......GTAGSITLLLQSLMPA-----------------LPFAKEKVK
RTCA_METMA/4-342SSELFFAP...........VEIKGG.KYNIDI......GTAGSITLLLQCIMPA-----------------LPFVEEKVE
RTCA_ARCFU/4-322STEIVFNP...........GSVRGG.NFRVDI......GTAGSVTLIFQTVLLP-----------------LLFADRDST
RTCA_SULSO/4-326SKELTFIP...........HEIKGNSIIDIDI......GTAGSVTLIMQTMIPA-----------------II..NKNMR
RTCA_SULTO/4-327STELVFEP...........EDIVEKGDFEFDV......GTAGSVTLILQTILPL-----------------LI..NRNIK
RTCA_METJA/6-324SEELTFIP...........SKLSPK.DFTIDI......GTAGSISLVIQTLLPL-----------------SLGINKKFT
RTCA_PYRHO/4-327SRELVFIP...........KKLEAK.EISIDI......GTAGSITLVLQALLPA-----------------MVFAREKVK
RTCA_PYRFU/4-327SREVTFIP...........GELKGG.EIRVDI......GTAGSITLVLQALLPA-----------------MVFAKDTVE
RTCA_PYRAE/5-333STRLYFEP...........KTLKCG.NFSIDI......GTAGSISLIVQTLAPI-----------------LLYAPCPTQ
RTCA_METKA/6-338STEIVFEP...........GKVKGG.EYEVDI......GTAGSVTLLLQAVKLA-----------------AIAADGPVE
RTCA_AQUAE/7-349SIELEYKP...........QKLKPG.YYEVNF......DTAGSIPLFLQTILPL-----------------SLFVPGEVV
RTC1_DICDI/38-374SCKLYYQPT.........QKTIQDDGVIEADT......KTAGSICLMIQVSLPC-----------------LIFAPHSTK
RTC1_DROME/9-341SSTVEFTP...........RTILDN.TYRVET......HTAASITLIYQMALPV-----------------LLFAGRPSR

PF00275

AROA_CAMJE/6-419P.PKEILS-----------P.....-NCILDC------GNSGTAMRLMIGFLAG.IS......GFFVLSGDKYLNNRPMR
AROA_STAA8/7-425G.YQSFNT-----------P.....-HQVLYT------GNSGTTTRLLAGLLSG.LG......IESVLSGDVSIGKRPMD
MURA_AQUAE/15-412S.INSFIT-----------NQ...E-.IIRRM------RASVLSLGPLLGRFGRAV.........VGLPGGCSIGARPID
AROA_AQUAE/4-425GRNYTFLE-----------P.....-HDVLDA------KNSGTTARIMSGVLST.QP......FFSVLTGDESLKNRPML
ARO1_YEAST/409-865GHGGSTLS-----------A....C-ADPLYL------GNAGTASRFLTSLAAL.VNST.SSQKYIVLTGNARMQQRPIA
AROA_AERSA/6-420GLGRSFAV-----------S....A-PVNLFL------GNAGTAMRPLCAALCL.GS......GEYMLGGEPRMEERPIG
MURA_MYCLE/7-406PDEPKYDA-----------DF...A-.AVRQF------RASVCVLGPLVGRCKQAR.........VALPGGDAIGSRPLD
AROA_SOLLC/83-514GCGGQFPV-----------GKKSEE-EIQLFL------GNAGTAMRPLTAAVTV.AGG....HSRYVLDGVPRMRERPIG
AROA_METJA/6-419G..GELKT-----------P.....-DNIIDI------GNSGTTLRILTSIASQ.IP.....KGYAILTGDDSIRKRPMQ
AROA_SYNY3/20-441GLGQLQEP-----------S.....-.TVLDA------GNSGTTMRLMLGLLAGQKD......CLFTVTGDDSLRHRPMS
MURA_PSEPU/6-407RTIKTLVA-----------PY...E-.LVKTM------RASILVLGPMVARFGEAE.........VALPGGCAIGSRPVD
AROA_METTH/5-409GSGGELET-----------P.....-DDVIYL------GNSGTTLRLMTSVAG..LA.....ENYTVLTGDESLRTRPMQ
MURA_CHLPN/6-427PEIQCTRV-----------PP...T-.FSNVN------RIPILLLGALLGRCPEGVY........VPTVGGDAIGERTLN
AROA_BUCAP/7-421GIGKAFHL-----------S....H-PISLFL------GNAGTAMRPLLAALSL.YE......NNVVLSGDDRMHERPIA
AROA_DICNO/8-426GFLGLQPP-----------K.....-.APLNM------QNSGTSMRLLAGILAA.QR......FESVLCGDESLEKRPMQ
AROA_PASHA/6-426GIGGAFKV-----------Q....N-GLSLFL------GNAGTAMRPLAAALCL.KGA...ETAQIILTGEPRMKERPIK
MURA_SHIFL/6-406RDVNVFCA-----------PY...D-.LVKTM------RASIWALGPLVARFGQGQ.........VSLPGGCTIGARPVD
AROA_MYCTU/7-419G...RIEP-----------G....P-GARVDC------GLAGTVLRFVPPLAAL.GS......VPVTFDGDQQARGRPIA
MURA_HAEIN/6-408SNINHFTA-----------PY...E-.LVKTM------RASIWALAPLVARFHQGQ.........VSLPGGCSIGARPVD
AROA_CORGL/17-425P..GQLSA-----------G.....-..SVEC------GLAGTVMRFLPPVAAF.AD......GPVHFDGDPQARVRPMT
AROA_KLEPN/6-420GTGGPLQA-----------G....S-ALELFL------GNAGTAMRPLAAALCL.GS......NDIVLTGEPRMKERPIG
MURA1_BACSU/6-407SYALQTEA-----------PF...E-.YVRKM------RASVLVMGPLLARTGHAR.........VALPGGCAIGSRPID
AROA_PASMU/10-432GLGRAFEW-----------Q....S-GLALFL------GNAGTAMRPLTAALCL.STPNKEGKNEIVLTGEPRMKERPIQ

PF01137

RTC1_MOUSE/8-340LRLK------------------------------GGTNAEMAPQIDYTMMVFK---------------------------
Q8SRP7_ENCCU/11-319IRFK------------------------------GITNGKL..CVDLIRIAHF---------------------------
RCL1_CAEEL/2-342IKLK------------------------------GVTNAPGEISVDGMKASWL---------------------------
RCL1_HUMAN/8-343IVLR------------------------------GVTNDQVDPSVDVLKATAL---------------------------
RCL1_DROME/7-349CTLR------------------------------GVTNSKDSPSVDHIKGAAL---------------------------
RCL1_ARATH/1-351IRLK------------------------------GITNDPRDASVDTFRSTTL---------------------------
RCL1_YEAST/5-341ILFK------------------------------GITASHNDAGIEAIKWGLM---------------------------
RCL1_SCHPO/3-340LTLT------------------------------GVTSSNEDIGVDVLRTSVL---------------------------
RTCA_NOSS1/4-336ITLR------------------------------GGTHVIFSPTVTYIERVYL---------------------------
RTCA_RALSO/13-335VAVS------------------------------GGTHNRAAPPVDFLIRAWQ---------------------------
RTCA_ECOLI/7-328VEVS------------------------------GGTDNPSAPPADFIRRVLE---------------------------
RTCA_SALTY/7-328VEVH------------------------------GGTHNQAAPSADFICRVWE---------------------------
RTCA_PSEAE/8-328VRIS------------------------------GGTHNPLAPPADFLRDSWL---------------------------
RTCA_HALSA/4-329ATLT------------------------------GGTDAKWAPPMDYFQHVKL---------------------------
RTCA_METTH/4-326VTVS------------------------------GGTDVLWAPTCDYLREVTI---------------------------
RTCA_AERPE/9-342VELT------------------------------GGTDVPMAPTIDYMREVFA---------------------------
RTCA_METAC/4-345LTIK------------------------------GGTDVAWSPTIDYLQHVTL---------------------------
RTCA_METMA/4-342LTIR------------------------------GGTDVAWSPTIDYLKHVTL---------------------------
RTCA_ARCFU/4-322LTVT------------------------------GGTDVAWAPPVDYFKNVTL---------------------------
RTCA_SULSO/4-326IKIK------------------------------GGTDVPKSPTIDYIRLVYL---------------------------
RTCA_SULTO/4-327VTIK------------------------------GGTDVPKSPSIDYIRLTFL---------------------------
RTCA_METJA/6-324VKIK------------------------------GGTDVKRAPPIDYVKNVTL---------------------------
RTCA_PYRHO/4-327FRIT------------------------------GGTDVSWSPPVDYLSNVTL---------------------------
RTCA_PYRFU/4-327FKIT------------------------------GGTDVSWSPPVDYLINVTM---------------------------
RTCA_PYRAE/5-333ITVT------------------------------GGTDVAWAPPIDYMRFVFT---------------------------
RTCA_METKA/6-338MEVR------------------------------GGTDVKWSPPVDYEINVNA---------------------------
RTCA_AQUAE/7-349IKVI------------------------------GGTDVPKSPTIDWVRFVFL---------------------------
RTC1_DICDI/38-374MVLG------------------------------GGTNCDFAPAADYIQNVFL---------------------------
RTC1_DROME/9-341LIVS------------------------------GGTNVDFAPPVEYMQEVLL---------------------------

PF00275

AROA_CAMJE/6-419RISKPLTQIGARIYGRNEANLAPLCIEG...QKLKAFNFKSEISSAQVKTAMILSAFRADN..VCTFSE....ISLSRNH
AROA_STAA8/7-425RVLRPLKLMDANIEGIED.NYTPLIIKP...SVIKGINYQMEVASAQVKSAILFASLFSKE..PTIIKE....LDVSRNH
MURA_AQUAE/15-412QHLKFFKEAGADVEVREGYVYVNLK.......EKRRVHFKFDLVTVTGTENALLYLASVPE..ESILEN..IALEPEVMD
AROA_AQUAE/4-425RVVEPLREMGAKIDGREEGNKLPIAIRG...GNLKGISYFNKKSSAQVKSALLLAGLRAEG..MTEVVE....PYLSRDH
ARO1_YEAST/409-865PLVDSLRANGTKIEYLNNEGSLPIKVYTDSVFKGGRIELAATVSSQYVSSILMCAP.YAEEPVTLALVGGKPISKLYVDM
AROA_AERSA/6-420HLVDCLALKGAHIQYLKKDGYPPLVVDAK.GLWGGDVHVDGSVSSQFLTAFLMAAPAMAPV.IPRIHIKGELVSKPYIDI
MURA_MYCLE/7-406MHQAGLRQLGARCNIEHGCVVASAE.......TLRGAEIQLEFPSVGATENILMAAVVAEG..VTTIHN..AAREPDVVD
AROA_SOLLC/83-514DLVDGLKQLGAEVDCSLGTNCPPVRIVSKGGLPGGKVKLSGSISSQYLTALLMAAP.LALGDVEIEIID.KLISVPYVEM
AROA_METJA/6-419PLLDALKQLNIEAFSSKLDGTAPIIVKSG.KIYGNVVKIRGDISSQFITSLMMLLPFNKED.TEIILTS.PLKSKPYIDI
AROA_SYNY3/20-441RVIQPLQQMGAKIWARSNGKFAPLAVQG...SQLKPIHYHSPIASAQVKSCLLLAGLTTEG..DTTVTE....PALSRDH
MURA_PSEPU/6-407LHIRGLEAMGAKIEVQGGYIKAKAP..E...GGLRGAHFFFDTVSVTGTENIMMAAALAKG..RSVLQN..AAREPEVVD
AROA_METTH/5-409PLLDALRPLGVEALSSRMNGLPPIIVRG..GLRGGSTSIRGDVSSQFISSILIAAPLT.EG.VEVMVEG.DFISRPYVDM
MURA_CHLPN/6-427FHFEGLKQLGVQISSDSSGYYAKAP......RGLKGNYIHLPYPSVGATENLILAAIHAKG..RTVIKN..VALEAEILD
AROA_BUCAP/7-421HLVDALKQGGATLEYKKGIGYPPVLTKG..GFKGGSIMLDGSISSQFLTSLLMVAP.LALQNTNIFIKG.NLVSKPYIDI
AROA_DICNO/8-426RIITPLVQMGAKIVSHSN.FTAPLHISG...RPLTGIDYALPLPSAQLKSCLILAGLLADG..TTRLHT....CGISRDH
AROA_PASHA/6-426HLVDALRQVGAEVQYLENEGYPPLAISNS.GLQGGKVQIDGSISSQFLTALLMSAP.LAESDMEIEIIG.DLVSKPYIDI
MURA_SHIFL/6-406LHISGLEQLGATIKLEEGYVKASV...D...GRLKGAHIVMDKVSVGATVTIMCAATLAEG..TTIIEN..AAREPEIVD
AROA_MYCTU/7-419PLLDALRELGVAVD...GTGLP.FRVRGNGSLAGGTVAIDASASSQFVSGLLLSAASFTDG.LTVQHTGSSLPSAPHIAM
MURA_HAEIN/6-408LHISGLEKLGADIVLEEGYVKAQV...S...DRLVGTRIVIEKVSVGATLSIMMAATLAKG..TTVIEN..AAREPEIVD
AROA_CORGL/17-425SILDALRSLGVEVD...N.NNLPFTVNAGEVPEGGVVEIDASGSSQFVSGLLLSAPRFKNG.VTVKHVGGRLPSMPHIEM
AROA_KLEPN/6-420HLVDALRQGGAQIDYLEQENYPPLRLRG..GFTGGDVEVDGSVSSQFLTALLMASP.LAPQDTVIAIKG.ELVSRPYIDI
MURA1_BACSU/6-407QHLKGFEAMGAEIKVGNGFIEAEVKG......RLQGAKIYLDFPSVGATENLIMAAALAEG..TTTLEN..VAKEPEIVD
AROA_PASMU/10-432HLVDALCQAGAEIQYLEQEGYPPIAIRNT.GLKGGRIQIDGSVSSQFLTALLMAAP.MAEADTEIEIIG.ELVSKPYIDI

PF01137

RTC1_MOUSE/8-340--PIAEKFGFTFN...CDIKTR--GYYPKGGGEVIVRVS........PVKRLDPINLTDRGSVTKIYGRAFVAGVLPLKV
Q8SRP7_ENCCU/11-319--NVLRRFGINGC..EIVVRKR--GFAPEGKGEVLFTVD.......RPGKVCT.IALESPEKILKVRGLVLSSRVSSVPA
RCL1_CAEEL/2-342--KVYNKFVLNDEKLDIKIQAR--GLKPEGGGVVVFTAP........IVKTLRPVKRQQVGKVCKIRGQAYVTKVTPSLA
RCL1_HUMAN/8-343--PLLKQFGIDGESFELKIVRR--GMPPGGGGEVVFSCP........VRKVLKPIQLTDPGKIKRIRGMAYSVRVSPQMA
RCL1_DROME/7-349--SLLKRFLLVDEGLELKVVRR--GVAPLGGGEIIFRCP........VRKSLRAIQFQSQGMVKRIRGTVYACKVSPAMA
RCL1_ARATH/1-351--NIIKRFGVPAEDLELKIEAR--GVAPNGGGEVLLTVP........NIKTLSAVHWVEEGMVKKIRGTTFSTRVTSDFE
RCL1_YEAST/5-341--PVMEKFGVREC..ALHTLKR--GSPPLGGGEVHLVVDS......LIAQPIT.MHEIDRPIISSITGVAYSTRVSPSLV
RCL1_SCHPO/3-340--PSLQKRFQVGDELELRILKR--GSAPGGGGEVNFLCP.......VIKESLPPIRLSEFGRVFRIRGIASSTRVSPAFA
RTCA_NOSS1/4-336--PMLCRMGIKAQ...VKLGAW--GWYPRGGGEVNLQVKGGCQLCGLNLLERGELKRVQGLAVATELPAHIPQRMANRAE
RTCA_RALSO/13-335--PLLARMGVTQT...LALKRH--GFYPAGGGEVLATVT.......PCAGRLGALHLTERGALRELSGQGIVANVRPGVA
RTCA_ECOLI/7-328--PLLAKIGIHQQ...TTLLRH--GFYPAGGGVVATEVS........PVASFNTLQLGERGNIVQMRGEVLLAGVPRHVA
RTCA_SALTY/7-328--PLLARMGISQR...TTLIKH--GFYPAGGGAAATVVE........PAASLRGLTLISRGETLRTTAEALLAAVPYHVG
RTCA_PSEAE/8-328--PLLQRMGAEVD...LELLRH--GFVPAGGGELLARVR........P.ARWRPLQLEHPGAALRRQARALLAGIPGHVG
RTCA_HALSA/4-329--PLLREHGIDAT...VSVDRR--GFYPRGGGEATLTVE........PSTPTP.ITLTERGDREALTAYSVAESSLADDE
RTCA_METTH/4-326--PVLEMMGYSAR...IEIIRR--GYYPEGGGRVHAIIE........PSELRP.ITLEESEIHAVRGISHSRNLPVHVAE
RTCA_AERPE/9-342--SILAMLGYEIE...IRVLRR--GHYPRGGGRVVVRVPD......PPGGFRA..RSFVERGPLKGVYVRSHAVKLPGSI
RTCA_METAC/4-345--RALEQLGYAGI...VTLKKR--GYYPRGGGEVSAVFE........PCKLRS.FHFRRVKENRRTGEARREEETRNEGR
RTCA_METMA/4-342--RALEQFGYAGS...VTLKER--GYYPRGGGSVSAVFE........PCKLHG.FHFRKTEGNKKTESNPVGEGLKGEKS
RTCA_ARCFU/4-322--RALREMGAECE...LEVLKR--GYYPKGGGMVRLTVR........PAEMKGVVYERIDEIVRGVSHCQNLPGHVAERQ
RTCA_SULSO/4-326--EILRKIGIESK...VNLIKR--GHYPEGGGEVIIENV........NGNPSD.FSLLELGKLIMIKGISHVSSLPSHIA
RTCA_SULTO/4-327--SLLEKIGIRVN...LILIRR--GHYPEGGGEIKITEV........KGNPSS.FSLMERGELLMIKGISHVSSLPSHIA
RTCA_METJA/6-324--KILRNFGVLTE...LKVLKR--GFYPEGGGEVIFEVK........PSKIKK.FDLIEHSKSNLVEGISYVQNLDESIA
RTCA_PYRHO/4-327--FALEKIGIHGE...IRVIRR--GHYPKGGGIVEGYVE........PWNEKRELVAKEYSRIIKIEGISHATNLPSHVA
RTCA_PYRFU/4-327--FALRKIGIEGE...IKLLRR--GHYPKGGGIVAGYVK........PWIERKELIAEEFENIYKVSGISHATNLPAHVA
RTCA_PYRAE/5-333--KVLERFGAKLS...IELIRR--GHYPRGGGRAVVRAE........PVKRLKAVESEEFGNVVKISGISHAVNLPPHVA
RTCA_METKA/6-338--HYLDRLGYRYE...LEVLRR--GHYPRGGGIVRARME........PPKRLKPLEAVKFGELESVRGISHCVRLPPHVA
RTCA_AQUAE/7-349--HYIYKVPEFIR...LEVLKR--GFYPAGGGIVQLSVRNKL..EKQPENLQE.VKEYLKDKVNLYRTERGEIRKIHVFS
RTC1_DICDI/38-374--PIATTMGFKCE...MSIDKR--GFYPKGGGAVTLTTQ.......PLTQPLSPITIVNKGEVNRIVIKSYFTSPRISPL
RTC1_DROME/9-341--PNLKHFGVSFD...LKVQRY--GFYPRGQGRCQLDVQ........PVTKLNSGKLVAFGRIKSVSGVAYCAGRLPVNI

PF00275

AROA_CAMJE/6-419SENMLKAMKAPIR---VSNDGL..SLEINPLKK..PLKA---QNIIIPNDPSSAFYFVLAAIILPKSQIILKNILLNPTR
AROA_STAA8/7-425TETMFKHFNIPIE---A..EGL..SINTTPEAIRYIKPA---.DFHVPGDISSAAFFIVAALITPGSDVTIHNVGINPTR
MURA_AQUAE/15-412LIEVLKKMGAHVK---VEGRS....AYVKGSEN...LKG---FTHSVIPDRIEAGTFMVGAVLTDG.EILLENARINHLR
AROA_AQUAE/4-425TERMLKLFGAEVI---TIPEERGHIVKIKGGQE...LQG---TEVYCPADPSSAAYFAALATLAPEGEIRLKEVLLNPTR
ARO1_YEAST/409-865TIKMMEKFGINVE---TSTTEP..YTYYIPKGHY.INPS---.EYVIESDASSATYPLAFAAMTGT.TVTVPNIGFESLQ
AROA_AERSA/6-420TLHIMNSSGVVIE---HDNYKL...FYIKGNQSI.VSPG---.DFLVEGDASSASYFLAAGAIKG..KVRVTGIGKHSI.
MURA_MYCLE/7-406LCTMLNQMGAQVE---GVGSPT...MTITGVPR...LYP---TEHRVIGDRIVAATWGIAAAMTRG.DIAVTGVDPAHLQ
AROA_SOLLC/83-514TLKLMERFGVFVE---HSSGWD..RFLVKGGQKY.KSPG---.KAFVEGDASSASYFLAGAAVTGG.TVTVEGCGTSSLQ
AROA_METJA/6-419TLDILNKFGIKID---K..TDN..GFLVYGNQKY.KPID---..YIVEGDYSSASYLIAAGVLINS.NITIENLFANSKQ
AROA_SYNY3/20-441SERMLQAFGAKLT---IDPVTH..SVTVHGPAH...LTG---QRVVVPGDISSAAFWLVAASILPGSELLVENVGINPTR
MURA_PSEPU/6-407LANFINAMGGKVQ---GAGTDT...IVIDGVER...LHS---ANYRVMPDRIETGTYLVAAAVTGG.RVKVKDTDPTILE
AROA_METTH/5-409TVDVMERFSVPVD---Y..SEG..TFRVEP.AVY.RGLD---..YTVEGDYSSASYLAGAVAAAGG.DVLIENLFRDSRQ
MURA_CHLPN/6-427LVLFLQKAGADIT---TDNDRT...IDIFGTGG...LGS---VDHTILPDKIEAASFGMAAVVSGG.RVFVRNAKQELLI
AROA_BUCAP/7-421TLNLMKSFGVNIV---N.DCYK..SFYIKGNQKY.ESPG---.NYLVEGDASSASYFLAAAAIKGG.SVKVVGVGKKSVQ
AROA_DICNO/8-426TERMLPLFGGALE---IK..KE..QIIVTGGQK...LHG---CVLDIVGDLSAAAFFMVAALIAPRAEVVIRNVGINPTR
AROA_PASHA/6-426TLSMMNDFGITVE---N.RDYK..TFLVKGKQGY.VAPQ---GNYLVEGDASSASYFLASGAIKG..KVKVTGIGKKSIQ
MURA_SHIFL/6-406TANFLITLGAKIS---GQGTDR...IVIEGVER...LGG---GVYRVLPDRIETGTFLVAAAISRG.KIICRNAQPDTLD
AROA_MYCTU/7-419TAAMLRQAGVDID---D.STPN..RWQVRPGP...VAAR---.RWDIEPDLTNAVAFLSAAVVSGG.TVRITGWPRVSVQ
MURA_HAEIN/6-408TADFLNKMGAKIT---GAGSAH...ITIEGVER...LTG---CEHSVVPDRIETGTFLIAAAISGG.CVVCQNTKADTLD
AROA_CORGL/17-425TVDMLRSAGIEIE---E..SEN..QWVVHPGEI...LGR---.TWRIEPDLSNATPFLAAAAVTGG.TIKINHWPIKTTQ
AROA_KLEPN/6-420TLHLMKTFGVEVE---N.QAYQ..RFIVRGNQQY.QSPG---.DYLVEGDASSASYFLAAGAIKGG.TVKVTGIGRNSVQ
MURA1_BACSU/6-407LANYINGMGGKIR---GAGTGT...IKIEGVEK...LHG---VKHHIIPDRIEAGTFMVAAAITEG.NVLVKGAVPEHLT
AROA_PASMU/10-432TLKMMQTFGVEVE---N.QAYQ..RFLVKGHQQY.QSPH---.RFLVEGDASSASYFLAAAAIKG..KVKVTGVGKNSIQ

PF01137

RTC1_MOUSE/8-340AKDMAAAAVRCIRKE----IRDL-------YVSIQPVQEA.............RDQ--AFGNGSGIIIVAETSTGCLF--
Q8SRP7_ENCCU/11-319KEMTDRIKEMLGDIL----NTKV-------FSNMSNR..................V--DSGPSPGFQCAVFAESKSGI--
RCL1_CAEEL/2-342YRMIDAAKKAMHGYI----SDVY-------ITVDQRKGDAGG.........ASPGY--GLFLTAETTEGVIYQAEAIS--
RCL1_HUMAN/8-343NRIVDSARSILNKFI----PDIY-------IYTDHMKGVNS..........GKSPG--FGLSLVAETTSGTFLSAELA--
RCL1_DROME/7-349NRTVEAAKGCMLKFL----PDVY-------IYTDQNKGKMSG........NSPGFG--ICLIAETTDGVCFAADCCSN--
RCL1_ARATH/1-351HSMRFAARGIFNNLL----PDVH-------IFQDHRAGAQAGKSPGYGISLAAETT--TGCFISADTTVSCERPDETG--
RCL1_YEAST/5-341NRMIDGAKKVLKNLQ----CEVN-------ITADVWRGE..............NSG--KSPGWGITLVAQSKQKGWSY--
RCL1_SCHPO/3-340NRLVESARGVLNPFI----PDVF-------IYTDVRRGD...............EC--GNSPGYSITLVAETNKGCSY--
RTCA_NOSS1/4-336NLLRTAGLRVSMQAL----REKG-------VA........................--....PGAGIFLTAEYCNSLT--
RTCA_RALSO/13-335RRELEALAARVPGVV----GSVR-------ELSPA.....................--..EGPGNALVLDAVHEHVTE--
RTCA_ECOLI/7-328EREIATLAGSFSLHE----QNIH-------NLPRD.....................--..QGPGNTVSLEVESENITE--
RTCA_SALTY/7-328EREVATLEAHFPQAE----KNVV-------ALEGG.....................--..CGPGNALSLMIQSEQLTE--
RTCA_PSEAE/8-328ERELERVRQRLGWSD----EERQ-------LEFLAE....................--.DQGPGNALLLRIDCEHICA--
RTCA_HALSA/4-329VAEQQATAAAPDAAH----EIAY-------TDAD......................--...SAGSAVVLAAEYEHSRA--
RTCA_METTH/4-326RQAESAMKILRGAGL----DVDI-------MVEDAS....................--.GPVGRGSGITLWAEGNTRL--
RTCA_AERPE/9-342AERQARSAASLVRER----LGVD-------PIVEIEAYKP.............HRD--PHLGPGTGVLVWAVFGETVM--
RTCA_METAC/4-345NQNQRIEIQGISHAS----NLPA-------HVPARQAEAAESLLL..EAGYGSRTK--IQSFELLSTGSGITLWSGYC--
RTCA_METMA/4-342MMEEIIGVSHASNLP----AHVP-------ARQAESARSLFLEA.....GYDARID--VSSSEFFSTGSGITLWKGYC--
RTCA_ARCFU/4-322ASSARNFLEERGIRA----EIRT-------EVL.......................--....KGLSTGSGIVLWSGYK--
RTCA_SULSO/4-326ERQKDSAKAILSKLG----VQIE-------IETDVRQ...................--GEVSKGSGIALAAIGEKSII--
RTCA_SULTO/4-327ERQAKSAKEFLLSKI----KIPV-------EIEIDVR..................E--NERSKGSGIALTAIFEKTFL--
RTCA_METJA/6-324RRMRKKAVDLLNKEK----LLPN-------IKIE......................--..CSKGISTGAGIVLWNDTL--
RTCA_PYRHO/4-327ERQARAAKDELLQLK----VPIE-------IRTEIS....................--RSIGPGSGIVVWAETDCLRL--
RTCA_PYRFU/4-327ERQAKAAMEELKVLG----VPIE-------IKKEVS....................--HSLGPGSGIVVWAETECLRL--
RTCA_PYRAE/5-333ERQAKAAREELSKMG----LDAD-------IAIEVRN..................D--GLGPGSGVVIWAVSDAGNVI--
RTCA_METKA/6-338ERQAKAASEIIEREL----GIRP-------EIEIETYPKG.............RDP--HLGPGSGIVLWAEDDQGNRI--
RTCA_AQUAE/7-349VAHEELRERKVAERQ----AKGA-------IEALKNLGYPEPE......VYRQYAN--ANSIGTSITIWLEDTKGNVL--
RTC1_DICDI/38-374VAERMNNTAKKLIKK----DFKK-------VDVETELIDV.............SKF--SFGDGTFIEIRAYTDQGCIF--
RTC1_DROME/9-341AIDMQQTAQREIHRL----WPSQ-------QCSIEPIKHS.............RQK--AFHNGAGILMTVNTTSDVVL--

PF00275

AROA_CAMJE/6-419...IEAYK.ILQKMGAKLEMTIT.......QNDFETIGEIRVE....SSKLNGIEVKDNIAWLIDEAPALAIAFALAK..
AROA_STAA8/7-425SGI...ID.IVEKMG....GNIQLFNQTTGAEPTASIRIQY.TP..MLQPITIEGE..LVPKAIDELPVIALLCTQAV..
MURA_AQUAE/15-412.....AVVEKLKLIG....GEVV.......EEN.GNLRVFR........KESLRAC..DIETQVYPGFPTDMQAQFMA..
AROA_AQUAE/4-425DGFYRKLIEMGGDISFENYRELS.......NEPMADLVVRPVDN...LKPVKVSPE..EVPTLIDEIPILAVLMAFAD..
ARO1_YEAST/409-865.GDARFARDVLKPMG....CKIT.......QTATSTTVSGPPV....GTLKPLKHV..DMEPMTDAFLTACVVAAISHDS
AROA_AERSA/6-420.GDIHFAD.VLERMG....ARIT.......WGDDFIEAEQGP........LHGVDM..DMNHIPDXAMTIAXVALFAE..
MURA_MYCLE/7-406.....LVLHKLHDAG....ATVT.......QTD.DSFRVAQ........YERPKAV..NVATLPFPGFPTDLQPMAIA..
AROA_SOLLC/83-514.GDVKFAE.VLEKMG....AEVT.......WTENSVTVKGPPRNSSGMKHLRAIDV..NMNKMPDVAMTLAVVALFAD..
AROA_METJA/6-419.GDKAIIN.IVKEMG....ADIK.......VKKDKVIIEGEY.......SLKGIDV..DVKDIPDLVPTIAVLGCFAE..
AROA_SYNY3/20-441TGVLEVLAQMGADITPENERLVT.......GEPVADLRVRASH....LQGCTFGGE..IIPRLIDEIPILAVAAAFAE..
MURA_PSEPU/6-407.....AVLEKLKEAG....ADIN.......TGE.DWIELDMH.......GKRPKAV..NLRTAPYPAFPTDMQAQFIS..
AROA_METTH/5-409.GDRIILD.IISDMG....AEVR.......RGEDHVRIASTG.......ELSGVSV..NLHDAPDLLPTVAVLGALAT..
MURA_CHLPN/6-427.....PFLKMLRSIG....GGFL.......VSE.SGIEFFQE.......RPLVGGV..VLETDVHPGFLTDWQQPFAV..
AROA_BUCAP/7-421.GDIKFAD.VLEKMG....AIID.......WGDSFIVCRHNK........LEKIDL..DMNHIPDAAMTIAIVALFAK..
AROA_DICNO/8-426AAIITLLQKMGGRIELHHQRFWG.......AEPVADIVVYHSK....LRGITVAPE..WIANAIDELPIFFIAAACAE..
AROA_PASHA/6-426.GDRLFAD.VLEKMG....AKIT.......WGEDFIQAEQSP........LKGVDM..DMNHIPDAAMTIATTALFAE..
MURA_SHIFL/6-406.....AVLAKLRDAG....ADIE.......VGE.DWISLDMH.......GKRPKAV..NVRTAPHPAFPTDMQAQFTL..
AROA_MYCTU/7-419PAD..HILAILR...Q.LNAVVI.......HADSSLEVRGPT......G.YDGFDV..DLRAVGELTPSVAALAALASP.
MURA_HAEIN/6-408.....AVIDKLREAG....AQVD.......VTE.NSITLDML.......GNRPKAV..NIRTAPHPGFPTDMQAQFTL..
AROA_CORGL/17-425PGD..AIRSILERMG....CEVEL....VAQGEGYDLSVTGP......VALKGIEI..DMSDIGELTPTVAALAALAS..
AROA_KLEPN/6-420.GDIRFAD.VLEKMG....ATVT.......WGEDYIACTRGE........LNAIDM..DMNHIPDAAMTIATAALFAR..
MURA1_BACSU/6-407.....SLIAKMEEMG....VTIK.......DEG.EGLRVIG........PKELKPI..DIKTMPHPGFPTDMQSQMMA..
AROA_PASMU/10-432.GDRLFAD.VLEKMG....AHIT.......WGDDFIQVEKGN........LKGIDM..DMNHIPDAAMTIATTALFAE..

PF01137

RTC1_MOUSE/8-340-----AGSSLGKRGVNADKVGIEAAEMLLANLRHGGTVDEY----------------------LQDQLIIFMALANG.IS
Q8SRP7_ENCCU/11-319-----YYSIGSGEGLTPRETATAACKDLLRSVKYGGVFDKK----------------------LLYLALSLMSLSSTSIG
RCL1_CAEEL/2-342-----RPKGESGVPILPEDIGIEAGHALLQQIYMGGALDSS----------------------AQILASTFMTLCPKDVS
RCL1_HUMAN/8-343-----SNPQGQGAAVLPEDLGRNCARLLLEEIYRGGCVDST----------------------NQSLALLLMTLGQQDVS
RCL1_DROME/7-349-----TREESEDTPSIPENLGKEVALRLLDEIYRGGCVDSS----------------------YQWLAALYIALGQKHVS
RCL1_ARATH/1-351-----ELDVEKKERSPAEDTGVEVASWLLQEIEKGGVVDST----------------------HQGLLFLLCALSEQDVS
RCL1_YEAST/5-341-----FAEDIGDAGSIPEELGEKVACQLLEEISKSAAVGRN----------------------QLPLAIVYMVIGKEDIG
RCL1_SCHPO/3-340-----AAEHCGEAGETPEDVGSFCAKKLLEVIESGGCVDPY----------------------TQPSTLTGMLLSSEDVN
RTCA_NOSS1/4-336-----GFGGFGRLRLSSEKVAEIACGQLLQFHETGAPVDEH----------------------LADQLLLPAVLASE.SS
RTCA_RALSO/13-335-----VFTGFGERGVPAEQVAHGVASAALRYLHSTAAVDEY----------------------LADQLVLPMALAGA..G
RTCA_ECOLI/7-328-----RFFVVGEKRVSAEVVAAQLVKEVKRYLASTAAVGEY----------------------LADQLVLPMALAGA..G
RTCA_SALTY/7-328-----LFAAFGVKGTSAEAVANQVAHEARRYLASPAAVGEH----------------------LADQLILPLALAGE..G
RTCA_PSEAE/8-328-----TFCAFGQAGVSAERVAEQVATQAIGWMESGCAADEH----------------------LADQLLLPMALAGA..G
RTCA_HALSA/4-329-----GFAALGERGVSADAVGENAADALAAFESGPGAVDSH----------------------LADQLVPVVAVAGG...
RTCA_METTH/4-326-----GAVSLGKPGKRAEKVGSEAARELLGFIESGSPLDRY----------------------MGDQIIPYMALTG.DS.
RTCA_AERPE/9-342-----GGDSIGKKGKPAEVVGREAAESLLEDMATGAALDRH----------------------MSDMAPVYLALAGG.VS
RTCA_METAC/4-345-----GGSALGKKGLPAEKVGRRAAEEIILELSSKAPVDVH----------------------LADQLIPYMALAGN..S
RTCA_METMA/4-342-----GGSALGKKGLPAEKVGRQAAEEVIKELRAGAAVDIH----------------------LADQLIPYMALAGN..S
RTCA_ARCFU/4-322-----GGSALGERGKRAEVVGQEAAESLYRELMSDAAFDAH----------------------LADQVMPFAAMARGRT.
RTCA_SULSO/4-326-----GADSLGERGKRAEIVGEEAARKLIDNLNTKAAVDVH----------------------MSDMLMIFTSLFGG...
RTCA_SULTO/4-327-----GSDSLGEKGKRAEIVGEEAAKSIYEEIISNATVDRH----------------------MSDMLMLYASLYYG...
RTCA_METJA/6-324-----GGSCLGEKGLRAEIVAERAVNELLKERESGMALDKY----------------------MGDQIIPFLAFGKG...
RTCA_PYRHO/4-327-----GGDALGKKGKPAEIVGKEAAQELLDQLKPGHCVDKF----------------------LGDQLIPFLAFSGG...
RTCA_PYRFU/4-327-----GGDALGKKGKPAEEVGREAAQELLSQVKTKACVDKF----------------------LGDQIIPFLAISGG...
RTCA_PYRAE/5-333-----GGDSLGERGKPAETVGKEAAQKLIAVLKTRASVDPH----------------------MADMAVLYMALAEGRS.
RTCA_METKA/6-338-----GADALGEKGKPAEVVGREAAEQLVQRLRTGMALDEH----------------------MGDQILPFLAIADGES.
RTCA_AQUAE/7-349-----GADNLGKKGKLAEVVGAEAVKKLHEDWSSGATVDRH----------------------LADHLIPLMALVGG...
RTC1_DICDI/38-374-----GATGNGAIGVPAEKVAEDAANSLLKDLQDGGCMDEY----------------------LQDQLIIFMALAKGKS.
RTC1_DROME/9-341-----GASALGKKRIDGHVLGSEASCQLGDYMRKQVCVDDY----------------------MQDQLIIYMALAVGRS.

PF00275

AROA_CAMJE/6-419.....GKSSLINAKELRVKESDRIAVMVENLKLCGVEARELD...........DGFE......IEGGC....ELKSSKIK
AROA_STAA8/7-425.....GTSTIKDAEELKVKETNRIDTTADMLNLLGFELQPTN...........DGLI.....IHPSEF....KTN.ATVD
MURA_AQUAE/15-412.....LLSVAKGKSRIKENIFEHRFHHAQELNRLGANITVR.............G........NTAYVEGVERLYGSEVY
AROA_AQUAE/4-425.....GVSEVKGAKELRYKESDRIKAIVTNLRKLGVQVEEFE...........DGFA......IHGTK....EIKGGVIE
ARO1_YEAST/409-865DPNSANTTTIEGIANQRVKECNRILAMATELAKFGVKTTELPDG......IQVHGLNSIKDLKVPSDS.....SGPVGVC
AROA_AERSA/6-420.....GPTSIRNIYNWRVKETDRLHAMATDVRKLGVS.EEGD..........LHY........ITVTPP..TQLKHAEID
MURA_MYCLE/7-406.....LTSIADGTSMITENVFEARFRFVEEMIRLGADARTD.............G........HHAVVRGLPQLSSAPVW
AROA_SOLLC/83-514.....GPTTIRDVASWRVKETERMIAICTELRKLGATVVEGS...........DYCI.....ITPPEK.....LNVTEID
AROA_METJA/6-419.....GKTEIYNGEHVRLKECDRLRACAVELKKMGADIEEKP...........DGLI.....IRGVKK.....LKGAKLN
AROA_SYNY3/20-441.....GTTRIEDAAELRVKESDRLAAIASELGKMGAKVTEFD...........DGLEIQGGSPLQG..........AEVD
MURA_PSEPU/6-407.....LNAIAEGTGAVIETIFENRFMHVYEMHRMGAQIQVE.............G........NTAIVTGVKALK.VPGN
AROA_METTH/5-409.....GRTEIGGVEHARYKETDRISTCAAELRRLGVDVTELP...........DGMI.....IEGG.......ASGGTVW
MURA_CHLPN/6-427.....LLSQAQGSSVIHETVHENRLGYLHGLQHMGAECQLFHQCLSTKACRYAIGNF.....PHSAVIHGATPLWASHLV
AROA_BUCAP/7-421.....GTSIIKNIYNWRVKETDRLSAMSKELKKVGAIIKEGR...........DCLS.....ITPPNF.....FKFAEID
AROA_DICNO/8-426.....GTTFVGNLSELRVKESDRLAAMAQNLQTLGVACDVGA...........DFIHIYGRSDRQFL........PARVN
AROA_PASHA/6-426.....GETVIRNIYNWRVKETDRLTAMATELRKVGAEVEEGE...........DFIR......IQPLAL..ENFQHAEIE
MURA_SHIFL/6-406.....LNLVAEGTGFITETVFENRFMHVPELSRMGAHAEIE.............S........NTVICHGVEKLSGAQVM
AROA_MYCTU/7-419....GSVSRLSGIAHLRGHETDRLAALSTEINRLGGTCRETP...........DGLV......ITATP.....LRPGIWR
MURA_HAEIN/6-408.....LNMVAEGTSIITETIFENRFMHIPELIRMGGKAEIE.............G........NTAVCHGVEQLSGTEVI
AROA_CORGL/17-425.....TESRLTGIAHLRGHETDRLAALTAEINKLGGKCTELK...........DGLL.....IEPAS......LHGGVWH
AROA_KLEPN/6-420.....GTTTLRNIYNWRVKETDRLFAMATELRKVGAEVEEGE...........DYIR.....ITPPLT.....LQFAEIG
MURA1_BACSU/6-407.....LLLRASGTSMITETVFENRFMHAEEFRRMNGDIKIE.............G........RSVIINGPVQLQGAEVA
AROA_PASMU/10-432.....GETVIRNIYNWRVKETDRLTAMATELRKVGAEVEEGE...........DFIR......IQPLNL..AQFQHAEIE

PF01137

RTC1_MOUSE/8-340RIKTGSVTL..HTQT--------------AIHFAEQL.AKAKF.TVKK--
Q8SRP7_ENCCU/11-319SLWVGRVDS..EVQG--------------ILDLLKRF.FGFEY.EVRS--
RCL1_CAEEL/2-342HFLYGPLPM..YSVH--------------ALRHLKQF.FEIEF.KMED--
RCL1_HUMAN/8-343KVLLGPLSP..YTIE--------------FLRHLKSF.FQIMF.KIET--
RCL1_DROME/7-349KFLTGALSN..YTVH--------------FLQHLRDF.FSITF.KLEN--
RCL1_ARATH/1-351KVRVGTLSP..YAVE--------------TLRNIKEF.LGVKF.AIKP--
RCL1_YEAST/5-341RLRINKEQIDERFII--------------LLRDIKKI.FNTEV.FLKP--
RCL1_SCHPO/3-340TIVVGQLGITSQLVV--------------FLRDVKAL.FNCEY.RFKE--
RTCA_NOSS1/4-336QYKVAEVST..HLTT--------------NAAVIEKFGLG.KI.TVNQ--
RTCA_RALSO/13-335CFTAVTASP..HLTT--------------NIAVIEKF.LPVHI.TVQA--
RTCA_ECOLI/7-328EFTVAHPSC..HLLT--------------NIAVVERF.LPVRF.SLIE--
RTCA_SALTY/7-328AFTVARASA..HLLT--------------NIAVVERF.LPVRF.SCEA--
RTCA_PSEAE/8-328SFTTPRLSA..HLQS--------------NRRVIERF.LPVRI.GDQA--
RTCA_HALSA/4-329EVRAPEVTT..HIET--------------CVDLLAEF.DY.DI.DIEH--
RTCA_METTH/4-326RVRTCELTL..HAET--------------NIILSEKI.TGRRF.RVEG--
RTCA_AERPE/9-342TVFGARLTG..HAST--------------ILELLRIMVDGFEY.RILE--
RTCA_METAC/4-345SYTVRELTL..HAAT--------------NIWVTEQF.LDVKF.RIEE--
RTCA_METMA/4-342SFTVRELTL..HAAT--------------NIWVTEQF.LDVKF.KIKE--
RTCA_ARCFU/4-322EYTTSEVTM..HQKS--------------NAYVINTF.LGKVV.KFEG--
RTCA_SULSO/4-326EYIGAELTS..HAYT--------------NMEIIRKF.LDVKI.EISG--
RTCA_SULTO/4-327EYIGSELTS..HART--------------NSEIIKKF.LNVNI.QISG--
RTCA_METJA/6-324IVGVSEITN..HTKT--------------NMWVVKHF.LDVDF.EIKE--
RTCA_PYRHO/4-327VIWVSEITN..HLKT--------------NIWVVESF.LGRIF.DVDG--
RTCA_PYRFU/4-327KIKVAEITK..HLIT--------------NVWVVEQF.FGKVF.EVKG--
RTCA_PYRAE/5-333RISTSEETM..HLKT--------------NMYIIEQF.LRVKFSTMEK--
RTCA_METKA/6-338VFGVTGVDP..HLPT--------------NAWVVEKF.LPVSV.EIRG--
RTCA_AQUAE/7-349EIRVPQFTG..HLLT--------------NIWVCEQF.LGKIF.EVDE--
RTC1_DICDI/38-374QIKTGPISL..HTQT--------------SIHITSLM.TGAIF.TITP--
RTC1_DROME/9-341TMRTGKLTN..HTRT--------------AINVAEQM.TGVKF.DVAM--

PF00275

AROA_CAMJE/6-419SYGDHRIAMSFAILG..LLC.........GIEIDDSDCIKTSFPNFIEIL
AROA_STAA8/7-425SLTDHRIGMMLAVASLLSSE.........PVKIKQFDAVNVSFPGFLPKL
MURA_AQUAE/15-412ST.DLRASASLVLAGLVAQG.........ETVVRDVYHLDRGYEKLEEKL
AROA_AQUAE/4-425TFKDHRIAMAFAVLGLVVEEE.........VIIDHPECVTVSYPEFWEDI
ARO1_YEAST/409-865TYDDHRVAMSFSLLAGMVNSQNERDEVANPVRILERHCTGKTWPGWWDVL
AROA_AERSA/6-420TYKHHRIAMCFSLVA..LSDI........AVTINDPGCTSKTFPDYFDKL
MURA_MYCLE/7-406CS.DIRAGAGLVLAGLVADG.........DTEVYDVFHIDRGYPLFVENL
AROA_SOLLC/83-514TYDDHRMAMAFSLAA..CADV........PVTIKNPGCTRKTFPDYFEVL
AROA_METJA/6-419TYHDHRLVMAFTIAG..LKAE.......GETIIEGEEAVKISFPNFVDVM
AROA_SYNY3/20-441SLTDHRIAMALAIAALGSGGQ.........TIINRAEAAAISYPEFFGTL
MURA_PSEPU/6-407G..HLRASASLVLSALVAEG.........DTLIDRIYHIDRGYECIEEKL
AROA_METTH/5-409SHGDHRLAMAFTLIG..LR.E.......GITIRD.AEVFSVSFPDFPERM
MURA_CHLPN/6-427IP.DLRAGFAYVMAALIAEGG........GSIIENTHLLDRGYTNWVGKL
AROA_BUCAP/7-421TYNDHRMAMCFSLIC..LSGI........SVRILNPNCISKTFPSYFENF
AROA_DICNO/8-426SFGDHRIAMSLAVAGVRAAGE.........LLIDDGAVAAVSMPQFRDFA
AROA_PASHA/6-426TYNDHRMAMCFSLIA..LSNT........EVTILDPNCTAKTFPTYFREL
MURA_SHIFL/6-406AT.DLRASASLVLAGCIAEG.........TTVVDRIYHIDRGYERIEDKL
AROA_MYCTU/7-419AYADHRMAMAGAIIG..LRVA........GVEVDDIAATTKTLPEFPRLW
MURA_HAEIN/6-408AT.DLRASISLVLAGCIATG.........ETIVDRIYHIDRGYEHIEDKL
AROA_CORGL/17-425SYADHRMATAGAIIGLAVDG..........VQVEDIKTTSKTFPGFENVW
AROA_KLEPN/6-420TYNDHRMAMCFSLVA..LSDT........PVTILDPKCTAKTFPDYFGQL
MURA1_BACSU/6-407AT.DLRAGAALILAGLVAEG.........HTRVTELKHLDRGYVDFHQKL
AROA_PASMU/10-432TYNDHRMAMCFALIA..LSQT........SVTILDPSCTAKTFPTFFDTF

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window