Sequence alignment for CL0294

PF07393

Q750R9_ASHGO/111-822---------------FKAIVSNYDALDEKLSS................VTQVVAPLGEKLEKSMRAKNS........YVK
Q6BHS9_DEBHA/103-810---------------VDRITRKFGSLDTKISE................VSNRIDPLGNSLNKITNSRDR........STE
SEC10_ARATH/139-817---------------VDGLFESFARLDGRISS................VGQTAAKIGDHLQSADAQRET........ASQ
Q2HG63_CHAGB/108-854---------------LDQSMDQFEALDLTLNNPSTTTN...GNSRADGGGNIAVQIGEKLEELDRKRRK........AQD
Q7PQN8_ANOGA/88-705---------------HQVSVDYFHQLDEKINS................VAGKVIHLGEQLQNVNMPRSR........AVE
A1D556_NEOFI/126-876---------------LNTLSDGFDQIKLTTSVPSEEV.....HELEKDPVLGALKQVRSVRGEARVEYG........KVH
Q2URB8_ASPOR/132-879---------------LKTLSDGFDQITLSTPATTGKS.....NELEDDSVLGALQQVRSVRGEARNEYG........KVH
E7KRR3_YEASL/120-862---------------LHTTLLTFDKLDDRLTN................VTQVVSPLGDKLETAIKKKQN........YIQ
Q4RLZ1_TETNG/80-698---------------NQVAFQHFQELDEHISY................VATKVCHLGDQLEGVNTPRQR........AVE
Q55N90_CRYNB/170-1008---------------QQWGTSKEQNLLDFEDLPLPSRPTGSSSSHGRTTGFFALTPTMPLPSASFSSHSPGPYYLAYKTH
Q0IP77_ORYSJ/117-800---------------VDGLFDSFARLDSRISS................VGQTAAKIGDHLQSAESQRET........ASQ
A2EZD8_TRIVA/69-728---------------LQETKDRSNELYASTNQ................ISVDFSKVTDQLDFAASLVQR........AED
Q2GXU3_CHAGB/166-960---------------VQEVADGFETMKVGGTTARAPHHPHQDPSTDPEALLRVIKNAKSVRGLARQEYG........KIY
Q2TVY5_ASPOR/116-891---------------LKQTIESFQQLDTSLNGTGAGPGP.TGSELSGSTGNMAVETGRKLEELDRQRRR........ALD
Q5BGH2_EMENI/123-870---------------VTPISDGFDQINLSASAANDVV......DLDTDPVLGALKLARSIRGEARQEYG........KIH
Q6CDC8_YARLI/101-777---------------VQSTVSEYTDMEQLMAE................VSKQTSSLGDKMDRISGQHQK........AIA
EXOC5_DROME/89-705---------------HQTAIDVFGQLDEKINS................VAGKIMHLGEQLENVNTPRSR........SVE
A1DAY7_NEOFI/117-893---------------LKQTIDSFQQLDTSLNGAGLSG.....GELPGATGNMAVETGRRLEELDRQRRR........ALD
EXOC5_CAEEL/46-659---------------NGEAIDKMKQLDHTMQA................VSTKVVHLGDQLESVDQPRSR........AHD
Q6FMF7_CANGA/102-810---------------LGKLVDNYNYLDNKLTS................INQMVSPLSEKLQNSIKKKKN........YIK
A0A0D1E7P5_USTMA/134-1026---------------FVAVGNSFNSLEDRISE................VGRTAIRIGEQLETIDKQRNR........ASE
SEC10_SCHPO/101-799---------------FAQVLELSRHLEDNVND................MRSGLVDAGQELERAENNRKR........ILS
Q5KJ89_CRYNJ/95-875---------------FEAIGKSFSNLESKVTD................VGRTAVRI........................
Q5AS51_EMENI/111-841---------------LKQAIESFQQLDTSFQSAGPG.......DTALGSGNMAVETGRRLEELDRQRRR........ALD
Q6CQC0_KLULA/109-807---------------LKDIVQNYDQLDHKLSA................VTQVVSPLGTKLEKSIKQKNA........YIK
C4YGD5_CANAW/103-782---------------IDEATKKFDILDTQISD................VSTRINPLGNTLNKITNSRDR........SLE

PF10191

Q7QA49_ANOGA/2-731DVSAFSGDDFDVSSWINASYERSQKTATGSVGKE.AFVSSLVSKMQLYVQQINVALEQTGGQVLKNIPKVISDANMLQIE
Q29C94_DROPS/2-737DVSALSEATFSPADWINANYKKYIEENGSKDGDATSFIQSYVAKLQLYVQQVNYAVEESSRQVVSSMPRIAKESTTLHSD
Q172R1_AEDAE/2-704DLSCFSQDSFDVVQWTNDYFKSNGNADNKEAM.....VSSLVSRLQLYVEQMNYSLEKSSQQLIVTMPHVIKDVKMIQTE
COG7_RAT/2-767DFSKFLADDFDVKDWINAAFRAGPKDGAAGKADG..HAATLVMKLQLFIQEVNHAVEETSLQALQNMPKVLRDVEALKQE
Q5FW35_XENTR/2-765DFSRFLADDFEVKDWVNAAFKSVQKD.APAKVDA..HASTLVMKLQLFIQEVNNSVEEISHQALQNMPRVLRDVEAVRQE
Q655R9_ORYSJ/5-868DASEFGAEGFDPKRWINAALDARHPSEPLDRF.....LADAEERLRSAADDAAAALERDSADALRRVPLACRDALRLRDD
Q9FGN0_ARATH/4-832DLGPFSDEKFDAKRWVNSSCQARHPQDSLEKH.....LVDLEMKLQIASEEIGASLEEQSGGALLRVPRATRDVLRLRDD

PF08318

E9EW04_METRA/274-613------------------------------------------------LETARESLCGLFLREFEKAAG--------DGD
B6JXE3_SCHJY/165-484------------------------------------------------LRQATDSLYTLFLREFQRAAR--------EQD
COG4_DROME/166-496------------------------------------------------LEDATEKTRVLIAKRFDEAVK--------ADD
M3D3E3_SPHMS/178-512------------------------------------------------LNDAAESLKGLFVREFEKAES--------DGD
C4QWJ7_PICPG/179-518------------------------------------------------LEVWIKDLSQILTKEFDRAAS--------ERN
B8LT52_TALSN/189-530------------------------------------------------LHNAAESLCGLFLREFDKAVK--------ENN
S3CMB0_GLAL2/185-536------------------------------------------------IENAKESLCMLFLREFEKAAA--------EGD
COG4_SCHPO/163-481------------------------------------------------LKEITESLHTLFWREFHKAAR--------NQD
L8FSC8_PSED2/189-538------------------------------------------------LENAKESLCGLFLREFDKAAK--------EGD
F0XR72_GROCL/199-557------------------------------------------------LEQARASLCGLFLREFERAAH--------DGD
V8NZE8_OPHHA/148-457------------------------------------------------LQEAEQQLKTIVTEKFDVAMK--------QED
F6TNZ6_XENTR/114-423------------------------------------------------LQEAEQHLKVVVSEKFDAATK--------SGD
G8BDV4_CANPC/186-525------------------------------------------------IDNWVKQLTVVFQKQFNEAAS--------KRD
C5WWS3_SORBI/192-503------------------------------------------------..DIKRRLEGLARRRLAAVID--------AQD
A8X3I7_CAEBR/217-546------------------------------------------------.SSAKDRLSKILKSRLTEAVQ--------KGD
U1HW21_ENDPU/187-524------------------------------------------------LENASESLCGLFLREFDKAIK--------DND
J3NYL1_GAGT3/212-567------------------------------------------------LESARESLCGLFLREFDRAAA--------DAD
D5GK94_TUBMM/197-545------------------------------------------------LENAAESLCGLFLREFERAAE--------AAD
F6I2Y2_VITVI/183-485------------------------------------------------..ASKKQLEGIVRKRLAAAVD--------QRD
T1KVK7_TETUR/162-476------------------------------------------------LHEAEDKLKTLVMRKFDEAVV--------EKD
G8BYJ4_TETPH/194-538------------------------------------------------INKWSDELKEIFQKRFMKAAE--------SSD
Q5TNE6_ANOGA/167-491------------------------------------------------LEQATVQMQQMVNQKFDEAVK--------RDD
J4GWL1_FIBRA/183-513------------------------------------------------LQAAREELLAIFRQEFDRASQ--------SRD
H2VA38_TAKRU/70-376------------------------------------------------LQEAEQKLRVIVAEKLDEAVA--------AVD
A3LT54_PICST/195-541------------------------------------------------.NGWIAQLTEIFKKKFNDAAH--------DKN
B7QAG5_IXOSC/93-401------------------------------------------------LREAENKLRRIVMKKFSEAVN--------EGD
C5LP43_PERM5/114-451------------------------------------------------LED...EVCSLVRKAFDNAII--------SGD
G3AM87_SPAPN/194-515------------------------------------------------ISKWIDDLTLVFKDKFNTAAE--------AKD
R8BYD5_TOGMI/1157-1500------------------------------------------------LESAKESLCGLFLREFEKAAK--------EGD
A5DUI4_LODEL/191-536------------------------------------------------IAKWTDQLAEVFKSQFTEAAK--------ARD
F4NT70_BATDJ/197-515------------------------------------------------LESAQATLTNMVMEAFETAAC--------NDK
C5GF37_AJEDR/230-568------------------------------------------------LENAAESLCGLFLREFERAVK--------DNN
B2AA74_PODAN/219-562------------------------------------------------LESARESLCNLFLREFRKAAE--------DGD
N1JE83_BLUG1/191-526------------------------------------------------.SSARESLCSLFIREFEKAAT--------EGD
W4ZDW5_STRPU/172-484------------------------------------------------LHEAEHNLKALVRKKLDQAIS--------SSD
G0W4A1_NAUDC/213-564------------------------------------------------IDNWCRELTTLFKEKFITAAQ--------KKD
Q4DDH2_TRYCC/242-662------------------------------------------------.ASARESAREKLLEKFRVASR--------SND
Q16TS8_AEDAE/167-489------------------------------------------------LEQAATQIRQVVTQKFDEAVK--------KDD
E9FQQ8_DAPPU/154-462------------------------------------------------LHEAQAQLCRVLQQKFDEAVR--------DAD
C5M6Q7_CANTT/193-537------------------------------------------------IANWTDELTEVFKEQFNDAAK--------ERN
V5GSU0_PSEBG/199-579------------------------------------------------L...RKTMLTAFTDAFIRSTQ--------NKD
X6MJK6_RETFI/5-348------------------------------------------------..DSKERLQHLVKEKCENALS--------GND
M2R7X1_CERS8/181-514------------------------------------------------LQQAREELLAIFRREFEKASQ--------SRD
A0A068Y5W7_ECHMU/114-419------------------------------------------------.........SRVSASFDNFAT--------VEN
D6WJA3_TRICA/162-474------------------------------------------------LQDAASQLQAIVEHKFNEAVK--------CED
G8Y9D0_PICSO/191-527------------------------------------------------LDNWIAILTKRFQQGFNQAAE--------KRE
Q57XU9_TRYB2/282-625------------------------------------------------IVNARQTVREKLMKRFYSAKV--------VND
G2Y0X2_BOTF4/187-528------------------------------------------------IEEAKKSLCGLFLREFEKAAE--------EGD
E0VZ92_PEDHC/157-456------------------------------------------------LEEVAEHLRVVVAKKFNEAII--------DED
B0CT70_LACBS/161-472------------------------------------------------LQAAREKLLVIFRQNFEQASR--------SRD
Q59T37_CANAL/195-551------------------------------------------------IANWIDKLTQVFKEKFTEAAK--------AKN
E9QGT9_DANRE/180-489------------------------------------------------LQEAERNLKTLVTTRLEEAVA--------TGD
K1WLQ9_TRIAC/267-644------------------------------------------------LDELRQVLLTTFRAEFELAAD--------RRD
F9XE54_ZYMTI/175-509------------------------------------------------LNSAAESLCGLFLREFEKAAR--------EGD
C5DG77_LACTC/179-498------------------------------------------------LKQWINQLAQVFHDNFVKAAR--------EQD
K5Y4H4_AGABU/183-506------------------------------------------------LQKAREHLLSVFLQNFEEASR--------SRD
I1JS41_SOYBN/186-485------------------------------------------------..AAKKQLEGIVRKKLSAAVD--------QRD
K0KE72_WICCF/171-504------------------------------------------------LEKWIEELTKIFTTEFQKAAE--------SKD
K4CGD4_SOLLC/174-477------------------------------------------------..ASKKQLEGIVRRKLAEAVD--------QRD
H2XLC7_CIOIN/111-421------------------------------------------------LKEARVAMSQVVAEQFDLAVL--------NND
S9VWR1_SCHCR/164-482------------------------------------------------LHEVIESLHALFQREFQKAAR--------DKD
U9TBS3_RHIID/182-496------------------------------------------------..DAKENLFVIFSREFEAAVY--------NRD
E3Q612_COLGM/198-538------------------------------------------------LETAKESLCGLFLREFEKATK--------EGD
Q6BTT0_DEBHA/227-568------------------------------------------------VQKWIELLTEEFQKGFNEASK--------NRN
K2S8E4_MACPH/175-516------------------------------------------------LENAAESLCGLFLREFEKAAK--------EGD
G8JQJ6_ERECY/189-517------------------------------------------------LDDWTIKLSKIFHEQFLHASR--------VQN
A0A0C4EWA8_PUCT1/187-568------------------------------------------------LENLIIQLTETFLKSFNAAAQ--------VKD
A9SCH4_PHYPA/154-467------------------------------------------------..ESKQKLEAIFRKKLAAAVE--------SKD
Q0UYP7_PHANO/174-513------------------------------------------------LDAAAESLCGLFLREFEKAAK--------EGD
M9MH30_PSEA3/203-582------------------------------------------------L...RKTMLTAFTDAFIRSTQ--------NKD
I2H5R5_TETBL/205-583------------------------------------------------IDNWCKELTDLFKSKFIDAAR--------SKN
A7TT52_VANPO/190-542------------------------------------------------.DRWCDELTQLFKDKFNTAAK--------TQD
T1J554_STRMM/179-485------------------------------------------------.RDAQSVLKDTVIRKFDESVR--------DED
A0A0D2XGD5_FUSO4/82-414------------------------------------------------IQTTRKSLCGLFLREFNAATE--------QGD
A7RPW3_NEMVE/163-477------------------------------------------------LQEAEEKLKAIVQQEFDQAIS--------KGD
B4KHQ6_DROMO/161-491------------------------------------------------LEEATEKIRELISKRFDEAVQ--------QDD
A8NGP6_COPC7/165-479------------------------------------------------LQAQRQTLLEVFKKKFEEASR--------SRD
D8QT59_SELML/156-463------------------------------------------------..ESKRKLEEVIKKRFYAAVD--------ARD
S8C8S4_DACHA/216-562------------------------------------------------LSNAAESLCGLFLREFDKATK--------AGD
N1PMN4_DOTSN/176-511------------------------------------------------LNSAAESLCGLFLREFEKAAR--------DGD
V5G2M7_BYSSN/194-532------------------------------------------------LHNAAESLCGLFLREFDKAVK--------DNN
F8Q674_SERL3/166-485------------------------------------------------LQTAREQLLKTFQRHFEQASQ--------SRD
M3AA99_PSEFD/191-526------------------------------------------------LHTAAESLCGLFLREFDKAAS--------EGD
G4MR42_MAGO7/219-567------------------------------------------------LESARESLCNLFLREFDKAAS--------EGD
J3KI74_COCIM/186-524------------------------------------------------LENAAESLCGLFLREFDRAVK--------END
G4U2Q1_PIRID/161-490------------------------------------------------LEEARKSLLDIFSRQFERASA--------ARD
R7YUM9_CONA1/175-511------------------------------------------------LNAAAESLCALFLREFERAAK--------DGD
G8ZSF3_TORDC/186-519------------------------------------------------VEKWCNELTEVYKSSFLEAAK--------SQD
G0SXA1_RHOG2/160-497------------------------------------------------.AQLRASLLETFVTAFRTAAE--------AND
S3C4S1_OPHP1/236-610------------------------------------------------LEQARESLCGLFLREFERAAK--------ESN
D8M8U8_BLAHO/154-504------------------------------------------------.KKSTETLIRALTEQFQSSMT--------KNK
C3YFK8_BRAFL/171-477------------------------------------------------LHKAEQELKVIINKEFDEAVA--------NKD
Q758T0_ASHGO/188-512------------------------------------------------LKDWTSRLSEVFTEQFQHAAK--------AQD
M5C4C1_THACB/161-521------------------------------------------------LADARAALLGVFRKEFDAAAI--------ARD
U4L2E9_PYROM/293-612------------------------------------------------.EMAAEGLCKLFLARFEKAVN--------EKD
J4KLZ9_BEAB2/1246-1586------------------------------------------------LENAKESLCTLFLREFEKAAA--------DGD
G7E1B8_MIXOS/165-515------------------------------------------------.SDYRQSLLETFLKEFEAACQ--------ERD
H2KS09_CLOSI/401-723------------------------------------------------LKRIQEHLVVLTEQRFTQALQ--------KND
W1NDY2_AMBTC/181-483------------------------------------------------..ESKRQLESIVRKKLSAAVD--------QQT
COG4_ARATH/176-479------------------------------------------------LHASKEQLEGIAKKKLLAAID--------QRD
H6C9G5_EXODN/179-515------------------------------------------------LENASASLCNLFIREFEKAVK--------DND
H3AVV6_LATCH/187-496------------------------------------------------LEEAEQRLKCIVTEKFDLAIK--------EGD
K5V063_PHACS/174-511------------------------------------------------LQDVREQLLRIFREQFEKVST--------SRD
B6HSP5_PENCW/191-531------------------------------------------------LDNAAESLCGLFLREFEKAVK--------END
G3BC56_CANTC/190-528------------------------------------------------IDNLVKQLIEVFKVQFDDAAA--------KKD
A0A068X7X6_HYMMI/106-417------------------------------------------------.RKLHQEVVSKVEVSFEKFVT--------VDD
M7NUP8_PNEMU/161-484------------------------------------------------LQDACDALNTICLKGFHQAAE--------IKD
U7PW27_SPOS1/225-627------------------------------------------------LEEARASLCGLFLREFERAAQ--------DGD
E6ZNH9_SPORE/195-575------------------------------------------------L...RKTMLTAFTDAFIRSTQ--------NKD
G0V8A6_NAUCC/189-534------------------------------------------------LDNWCMELTQLFKEQFIAAAN--------END
E7QLX6_YEASZ/190-525------------------------------------------------IKNWCKELTSLFQEQFMEATR--------TQD
C5DUL4_ZYGRC/172-510------------------------------------------------.NQWCEKCTKVFKTNFLDAAS--------RQD
E4UP45_ARTGP/209-548------------------------------------------------.SSAAESLCALFLREFEHAVK--------END
K1R201_CRAGI/174-481------------------------------------------------LQEAEEKLKSIVNTKFDAAVH--------SGD
Q6FTK7_CANGA/185-531------------------------------------------------LQQWCDELTEKFKERFQKATE--------EQN
D2V3G5_NAEGR/119-422------------------------------------------------.KKSEKKIKEIVSSKMKEALR--------DEN
G5C1P9_HETGA/267-575------------------------------------------------LQEAEQRLKAIVAEKFAIATK--------EGD
L8WI47_THACA/987-1357------------------------------------------------LADARTALLGVFRKEFDGAAI--------ARD
V2X3Q2_MONRO/169-474------------------------------------------------LQTAREELLRIFLRNFEQASQ--------AKD
A7UW80_NEUCR/259-612------------------------------------------------LENARESLCVLFLREFWKAAK--------EDD
M2NB58_BAUCO/172-509------------------------------------------------LDAAAESLCGLFLREFEKAAK--------EGD
C7ZFK3_NECH7/171-496------------------------------------------------.EIARESLCALFLRQFVSAAE--------DEN
K1WSR6_MARBU/231-588------------------------------------------------IENAKESLCGLFLREFEKAAD--------EGD
S0E9C5_GIBF5/167-499------------------------------------------------IQTARKSLCALFLREFNAAAA--------QGD
C4XYR0_CLAL4/197-532------------------------------------------------IDKWIAQLKTELQTLFDDAAK--------RKS
S2JH92_MUCC1/194-506------------------------------------------------LADAKANLFAIFSSKFDDAVA--------QRN
E9IBA8_SOLIN/158-464------------------------------------------------LQQAAMELRAVVTHKFDEAVK--------SED
A0A016PRI6_GIBZA/187-527------------------------------------------------LEEAKESLCGLFLREFEKAAE--------ESD
G0R6U4_HYPJQ/191-531------------------------------------------------LENARESLCGLFLREFDKAAA--------EGD
I2FV21_USTH4/206-592------------------------------------------------L...RKTMLKAFTDAFIKSTQ--------NKD
A8NFV8_BRUMA/216-544------------------------------------------------LREAANEMKSIIEKRFNQAVE--------DND
G0SCB4_CHATD/176-523------------------------------------------------LEQARESLCGLFLREFKKAAA--------EGD
W1QCQ6_OGAPD/210-555------------------------------------------------LDSWISELNNIFLSEFNEAAA--------KRD
Q5AW68_EMENI/201-531------------------------------------------------LDNAAESLCGLFLREFDKAVK--------ESN

PF07393

Q750R9_ASHGO/111-822SAELISFYKDFHLEGT.............................SANLESL.RTSSDWREKAQAAIL---VKQLLVLTR
Q6BHS9_DEBHA/103-810TIFLIRAYHGFYTKEK.............................YDPLEKL.RTSKVYEDKIKCAKT---VSNLLTLAK
SEC10_ARATH/139-817TIDLIKYLMEFNGSPG...............................DLMELSALFSDDSRVAEAASI---AQKLRSFAE
Q2HG63_CHAGB/108-854ANFLIQCWMEVMETGQ.............................LTSLEEI.QRQGGAENKVRCAVI---ARQLMRISQ
Q7PQN8_ANOGA/88-705AQLLLNHMAEFLTPGP..................................IVNDIYSDKSKLYEAADI---IQKLFQISQ
A1D556_NEOFI/126-876AA.LAPFYDDIVTSGP..............................SPDNLLFKEYPDP...EHQAQI---LSQLRLFAQ
Q2URB8_ASPOR/132-879AA.LAPFYNDITTEGA..............................SPDNLLFKKYTDP...QHQARI---LFQLQSFAK
E7KRR3_YEASL/120-862SVELIRRYNDFYSMGK.............................SDIVEQL.RLSKNWKLNLKSVKL---MKNLLILSS
Q4RLZ1_TETNG/80-698AQRLMTYFNEFLDGD...................................LRSDVFNNPDKIKEAADI---IQKLHLIAQ
Q55N90_CRYNB/170-1008HLSLLPFCKHLRSSPS............................PSSTLSLLFPPSPTTALPPSLSHQ---SSVLLSLIR
Q0IP77_ORYSJ/117-800TIDLIKYLMEFNSTPG...............................DLMELSPLFSDDSRVAEAASI---AQKLRSFAE
A2EZD8_TRIVA/69-728MSIIITYIQEFNKPLEDPPMVRAPNQPPPDPNNPDNPPQEVLVPAFDPLDILLKSIKFPPTLYQCAEL---CAKLFKIVT
Q2GXU3_CHAGB/166-960GA.LAPFYFDLVRAKT..............................HTDPLVFKVFRDP...ERQAQM---LANLRTFAK
Q2TVY5_ASPOR/116-891AHFLLECWDSVSNRGE.............................LTLLENL.RRSGTGEAKVRSAQI---ARQLLRISQ
Q5BGH2_EMENI/123-870AA.LAPFYDDIATLGP..............................SPENLLFQRYTEP...QQQAQI---LSQLQAFAR
Q6CDC8_YARLI/101-777SHFLINCYLSFVKKSS.............................CLELERMWKDGPSG..QRKCATY---VRQLLILSS
EXOC5_DROME/89-705AQKLLNFMSEFLAAGP.................................VIVNDIFADAARLSEAADV---IQKLYAISQ
A1DAY7_NEOFI/117-893AHFLIQCWDGVSNRGE.............................ITLLENL.RKSGTGEAKVRSAHI---ARQLLRISQ
EXOC5_CAEEL/46-659AHQLMQHFDEFLSDQP..................................LNSMIFTDPDKLLESADL---VHKLYSISQ
Q6FMF7_CANGA/102-810SIELIIQYNTFLKNGK.............................SEYVDNM.LNSKKLANRLNAAVL---IKNQLLLAR
A0A0D1E7P5_USTMA/134-1026AHDLIEFYY.MFARGD.............................TTKLEHL.RKEGGREGRIKTAVI---ARRLAAISR
SEC10_SCHPO/101-799SAELLRYYLE.FRSGK.............................PQTLMDF.FRTNNHDKMLLCAQR---TRQLLALAN
Q5KJ89_CRYNJ/95-875..........ATTGEN.............................TSPLEQLFATRTSRQGREKLAVV---LRRLMAISK
Q5AS51_EMENI/111-841AHFLLECWDGVSNRGE.............................IILLENL.RRSGSGEAKVRSAHI---ARQLLRISQ
Q6CQC0_KLULA/109-807SVELISFYASFLEEGD.............................CPELNKL.LESSDKRDICQGALI---LKSLLILTK
C4YGD5_CANAW/103-782TIFLIRAYHGFFMKEQ.............................YLPLETL.KNSKKLDDKLKCAKT---VRNLLNLAK

PF10191

Q7QA49_ANOGA/2-731SGLLKQRMNQVQREIAHLQTETGDCMVSLERLDDIKQRLQSSKQCLQEADGWGKLAGELDDLLEKSDIDASSGKLLSLQK
Q29C94_DROPS/2-737VSQLQEKMSAMRQEVAAVQNETGECMATLERLNTLQTKLQAAKESLQESDGWGNLLAELEDGFERNDLKGVCEKLIALQK
Q172R1_AEDAE/2-704VATLTDKMRQLQSDISHVNRDTGVYMHQLERLEGVYQKISIAKHGMKESDGWGKLTAELDDLLERNDIFGSKNKFIDLKK
COG7_RAT/2-767ASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQLAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQS
Q5FW35_XENTR/2-765ASFLKEQMILVKEDIKKFEQDTAQSMQVLVEMDKVKSRMQLAADSLQEADKWSTLSADIEETFKTQNITVISEKLTSMQV
Q655R9_ORYSJ/5-868AVSLRSHLASVLQSLSQAEGSSAESITALARIDTVKQRMEAAYATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRH
Q9FGN0_ARATH/4-832AVSLRGSVAGILQKLKKAEGSSADCIAALARVDNVKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRN

PF08318

E9EW04_METRA/274-613GAKVTRFFKLF---------------------------------------------------------------------
B6JXE3_SCHJY/165-484QRKITRFFKLF---------------------------------------------------------------------
COG4_DROME/166-496LASVERFFKIF---------------------------------------------------------------------
M3D3E3_SPHMS/178-512GARITRFFKLF---------------------------------------------------------------------
C4QWJ7_PICPG/179-518PDRITYYFKLF---------------------------------------------------------------------
B8LT52_TALSN/189-530GAKITRFFKLF---------------------------------------------------------------------
S3CMB0_GLAL2/185-536GARITRFFKLF---------------------------------------------------------------------
COG4_SCHPO/163-481QKEITRYFKLF---------------------------------------------------------------------
L8FSC8_PSED2/189-538GGKVTRFFKLF---------------------------------------------------------------------
F0XR72_GROCL/199-557DARVTRFFKLF---------------------------------------------------------------------
V8NZE8_OPHHA/148-457LLQVERFFKIF---------------------------------------------------------------------
F6TNZ6_XENTR/114-423LPQVERFFKIF---------------------------------------------------------------------
G8BDV4_CANPC/186-525VEHLTKYFQLF---------------------------------------------------------------------
C5WWS3_SORBI/192-503HPAVLRLVRLF---------------------------------------------------------------------
A8X3I7_CAEBR/217-546VAEMQRFVKLF---------------------------------------------------------------------
U1HW21_ENDPU/187-524GPKITRFFKLF---------------------------------------------------------------------
J3NYL1_GAGT3/212-567GARVTRFFKLF---------------------------------------------------------------------
D5GK94_TUBMM/197-545GEKVTRFFKLF---------------------------------------------------------------------
F6I2Y2_VITVI/183-485HPTILRFVRLF---------------------------------------------------------------------
T1KVK7_TETUR/162-476VASVERFFKIF---------------------------------------------------------------------
G8BYJ4_TETPH/194-538TEELTLMFKMF---------------------------------------------------------------------
Q5TNE6_ANOGA/167-491LASVERFFKIF---------------------------------------------------------------------
J4GWL1_FIBRA/183-513AAATSRFFKLF---------------------------------------------------------------------
H2VA38_TAKRU/70-376LAQVERFFKIF---------------------------------------------------------------------
A3LT54_PICST/195-541VEQLTKYFQLF---------------------------------------------------------------------
B7QAG5_IXOSC/93-401IASVERFFKIF---------------------------------------------------------------------
C5LP43_PERM5/114-451KDGVSKCGRLF---------------------------------------------------------------------
G3AM87_SPAPN/194-515VEQLTKYFQLF---------------------------------------------------------------------
R8BYD5_TOGMI/1157-1500GTKVTRFFKLF---------------------------------------------------------------------
A5DUI4_LODEL/191-536VERLTKFFQLF---------------------------------------------------------------------
F4NT70_BATDJ/197-515PDGIVRCFKLF---------------------------------------------------------------------
C5GF37_AJEDR/230-568DAKITRFFKLF---------------------------------------------------------------------
B2AA74_PODAN/219-562GARVTRFFKLF---------------------------------------------------------------------
N1JE83_BLUG1/191-526GSKVTRFFKLF---------------------------------------------------------------------
W4ZDW5_STRPU/172-484RPSVERFFKIF---------------------------------------------------------------------
G0W4A1_NAUDC/213-564IDELTLMFQMF---------------------------------------------------------------------
Q4DDH2_TRYCC/242-662KLTIMQATRLL---------------------------------------------------------------------
Q16TS8_AEDAE/167-489LASVERFFKIF---------------------------------------------------------------------
E9FQQ8_DAPPU/154-462AASVERFFKIF---------------------------------------------------------------------
C5M6Q7_CANTT/193-537VPQLTKFFQLF---------------------------------------------------------------------
V5GSU0_PSEBG/199-579EKEASRFFKLF---------------------------------------------------------------------
X6MJK6_RETFI/5-348LKVVLEFARLY---------------------------------------------------------------------
M2R7X1_CERS8/181-514AAATSRFFKLF---------------------------------------------------------------------
A0A068Y5W7_ECHMU/114-419TKAIEELFRIF---------------------------------------------------------------------
D6WJA3_TRICA/162-474LVAIERFFKIF---------------------------------------------------------------------
G8Y9D0_PICSO/191-527VPELTKYFQLF---------------------------------------------------------------------
Q57XU9_TRYB2/282-625KQTIMDTVRLL---------------------------------------------------------------------
G2Y0X2_BOTF4/187-528GVRVTRFFKLF---------------------------------------------------------------------
E0VZ92_PEDHC/157-456LASIERFFKIY---------------------------------------------------------------------
B0CT70_LACBS/161-472STATSRFFKLF---------------------------------------------------------------------
Q59T37_CANAL/195-551VEQLTKFFQLF---------------------------------------------------------------------
E9QGT9_DANRE/180-489LPQVERFFKIL---------------------------------------------------------------------
K1WLQ9_TRIAC/267-644EQEISRYFRLW---------------------------------------------------------------------
F9XE54_ZYMTI/175-509GSKVTRFFKLF---------------------------------------------------------------------
C5DG77_LACTC/179-498ITQLTAVFQLF---------------------------------------------------------------------
K5Y4H4_AGABU/183-506STATSRFFKLF---------------------------------------------------------------------
I1JS41_SOYBN/186-485HPAILRFIRLF---------------------------------------------------------------------
K0KE72_WICCF/171-504VEKLTSFFSFF---------------------------------------------------------------------
K4CGD4_SOLLC/174-477HSTVLRFIRLY---------------------------------------------------------------------
H2XLC7_CIOIN/111-421LTGVERFFKIF---------------------------------------------------------------------
S9VWR1_SCHCR/164-482QKEITRYFKLF---------------------------------------------------------------------
U9TBS3_RHIID/182-496QENISRFFKLF---------------------------------------------------------------------
E3Q612_COLGM/198-538GAKVTRFFKLF---------------------------------------------------------------------
Q6BTT0_DEBHA/227-568VSELTKYFQLF---------------------------------------------------------------------
K2S8E4_MACPH/175-516GTAVTRFFKLF---------------------------------------------------------------------
G8JQJ6_ERECY/189-517MELLTSYFQLF---------------------------------------------------------------------
A0A0C4EWA8_PUCT1/187-568EAATTRFFKLF---------------------------------------------------------------------
A9SCH4_PHYPA/154-467HDNVVRFVKLY---------------------------------------------------------------------
Q0UYP7_PHANO/174-513GSKVTRFFKLF---------------------------------------------------------------------
M9MH30_PSEA3/203-582EKEASRFFKLL---------------------------------------------------------------------
I2H5R5_TETBL/205-583IEDLTLMFKMF---------------------------------------------------------------------
A7TT52_VANPO/190-542IEELTLMFKMF---------------------------------------------------------------------
T1J554_STRMM/179-485LASVERFFKIF---------------------------------------------------------------------
A0A0D2XGD5_FUSO4/82-414GEEVARFFKLF---------------------------------------------------------------------
A7RPW3_NEMVE/163-477RSSVERFFKIF---------------------------------------------------------------------
B4KHQ6_DROMO/161-491LASVERFFKIF---------------------------------------------------------------------
A8NGP6_COPC7/165-479STATTRFFKLF---------------------------------------------------------------------
D8QT59_SELML/156-463HAGVVRFASLF---------------------------------------------------------------------
S8C8S4_DACHA/216-562GEKITRYFKLF---------------------------------------------------------------------
N1PMN4_DOTSN/176-511GARVTRFFKLF---------------------------------------------------------------------
V5G2M7_BYSSN/194-532GAKITRFFKLF---------------------------------------------------------------------
F8Q674_SERL3/166-485ATATSRFFKLF---------------------------------------------------------------------
M3AA99_PSEFD/191-526GARVTRFFKLF---------------------------------------------------------------------
G4MR42_MAGO7/219-567EAKVTRFFKLF---------------------------------------------------------------------
J3KI74_COCIM/186-524GAKITRFFKLF---------------------------------------------------------------------
G4U2Q1_PIRID/161-490SANTSRVFKLF---------------------------------------------------------------------
R7YUM9_CONA1/175-511GGRVTRFFKLF---------------------------------------------------------------------
G8ZSF3_TORDC/186-519IQQLTLIFKTF---------------------------------------------------------------------
G0SXA1_RHOG2/160-497TNNINRFFKLF---------------------------------------------------------------------
S3C4S1_OPHP1/236-610DAHVTRFFKLF---------------------------------------------------------------------
D8M8U8_BLAHO/154-504QTQVYRYCHLL---------------------------------------------------------------------
C3YFK8_BRAFL/171-477ATAVDRFFKIF---------------------------------------------------------------------
Q758T0_ASHGO/188-512VEQLTSYFELF---------------------------------------------------------------------
M5C4C1_THACB/161-521PVAISRFFKLF---------------------------------------------------------------------
U4L2E9_PYROM/293-612GEGITRFFKLF---------------------------------------------------------------------
J4KLZ9_BEAB2/1246-1586GTKVTRFFKLF---------------------------------------------------------------------
G7E1B8_MIXOS/165-515EANTSRYFKLF---------------------------------------------------------------------
H2KS09_CLOSI/401-723AAAVERFCKLF---------------------------------------------------------------------
W1NDY2_AMBTC/181-483HGEILRFVRIF---------------------------------------------------------------------
COG4_ARATH/176-479HPTILRFVRLY---------------------------------------------------------------------
H6C9G5_EXODN/179-515GARITRFFKLF---------------------------------------------------------------------
H3AVV6_LATCH/187-496LPQVERFFKIF---------------------------------------------------------------------
K5V063_PHACS/174-511AAATTRFFKLF---------------------------------------------------------------------
B6HSP5_PENCW/191-531GAKITRFFKLF---------------------------------------------------------------------
G3BC56_CANTC/190-528MQQLTKFFELF---------------------------------------------------------------------
A0A068X7X6_HYMMI/106-417AKSIEELFKIF---------------------------------------------------------------------
M7NUP8_PNEMU/161-484EKAMTRFFRLF---------------------------------------------------------------------
U7PW27_SPOS1/225-627DARVTRFFKLF---------------------------------------------------------------------
E6ZNH9_SPORE/195-575EKEASRFFKLF---------------------------------------------------------------------
G0V8A6_NAUCC/189-534VDTLTLVFKMF---------------------------------------------------------------------
E7QLX6_YEASZ/190-525IKELTLMFKMF---------------------------------------------------------------------
C5DUL4_ZYGRC/172-510VDQLTLTFQMF---------------------------------------------------------------------
E4UP45_ARTGP/209-548GAKITRFFKLF---------------------------------------------------------------------
K1R201_CRAGI/174-481FASIERFFKIF---------------------------------------------------------------------
Q6FTK7_CANGA/185-531IEELTLIFKMF---------------------------------------------------------------------
D2V3G5_NAEGR/119-422ETQIKRFSKLF---------------------------------------------------------------------
G5C1P9_HETGA/267-575LPQVERFFKIF---------------------------------------------------------------------
L8WI47_THACA/987-1357PVAISRFFKLF---------------------------------------------------------------------
V2X3Q2_MONRO/169-474AAATSRFFKLF---------------------------------------------------------------------
A7UW80_NEUCR/259-612PAKITRFFKLF---------------------------------------------------------------------
M2NB58_BAUCO/172-509GARVTRFFKLF---------------------------------------------------------------------
C7ZFK3_NECH7/171-496VDQLTRFFKLF---------------------------------------------------------------------
K1WSR6_MARBU/231-588GSKITRFFKLF---------------------------------------------------------------------
S0E9C5_GIBF5/167-499GAKVARFFKLF---------------------------------------------------------------------
C4XYR0_CLAL4/197-532VPEISKYFQLF---------------------------------------------------------------------
S2JH92_MUCC1/194-506QADITRYFKLF---------------------------------------------------------------------
E9IBA8_SOLIN/158-464LASVERFFKIF---------------------------------------------------------------------
A0A016PRI6_GIBZA/187-527GTKVTRFFKLF---------------------------------------------------------------------
G0R6U4_HYPJQ/191-531GAKVTRFFKLF---------------------------------------------------------------------
I2FV21_USTH4/206-592EKEASRFFKLF---------------------------------------------------------------------
A8NFV8_BRUMA/216-544VASIQRFFKLF---------------------------------------------------------------------
G0SCB4_CHATD/176-523AAKVTRFFKLF---------------------------------------------------------------------
W1QCQ6_OGAPD/210-555VQRLTYFFQLF---------------------------------------------------------------------
Q5AW68_EMENI/201-531GAKITRFFKLF---------------------------------------------------------------------

PF07393

Q750R9_ASHGO/111-822KIDT.......................................KSLPKTIETTSALEEY------------ASAMETELL
Q6BHS9_DEBHA/103-810KIAS.......................................PDLPKTDHCVTVIEKF------------SETMEKELL
SEC10_ARATH/139-817EDIGRQGAS............................AAAGNATPGRGLEVAVANLQDY------------CNELENRLL
Q2HG63_CHAGB/108-854RLDLASWGQSTNG....................FRGNGVTNGVTGTNRRHNTREALEKF------------SELLEQDLL
Q7PQN8_ANOGA/88-705DL..........................................PAQRFANAKKKIESK------------YDDVEMQLI
A1D556_NEOFI/126-876CD..........................................TTEGWRERNARLQSA------------ISMFETAAM
Q2URB8_ASPOR/132-879CD..........................................LTEGWHERLSHLQEA------------ISMFETAAI
E7KRR3_YEASL/120-862KLET.......................................SSIPKTINTKLVIEKY------------SEMMENELL
Q4RLZ1_TETNG/80-698EL..........................................PFDRFPDVKAKIASK------------YHDLERQLI
Q55N90_CRYNB/170-1008FLSPQ.....................................LQPLRDWGFLRQALLAA------------ADRFDSTCL
Q0IP77_ORYSJ/117-800EDVGRHGVP............................SAVGSANASRGLEVAVANLQEY------------CNELENRLL
A2EZD8_TRIVA/69-728SA..........................................ERDYLQNARINLIQY------------RERLKDQLL
Q2GXU3_CHAGB/166-960SD..........................................WSQGAQKREEKVDTM------------TGIFESAVL
Q2TVY5_ASPOR/116-891RLDQKSWNNSGGKNNG..............ASGHGAAEEGTVEETGLTRLNTREIIEKF------------SETLEKDLL
Q5BGH2_EMENI/123-870CD..........................................TTTGCENRHENLRAA------------VSMFETAAL
Q6CDC8_YARLI/101-777KID.........................................TVEACRRAQSDIEKF------------AEKIEKDLL
EXOC5_DROME/89-705DL..........................................PPGNFAESKRKIEKK------------YDEVERRLI
A1DAY7_NEOFI/117-893RLDPRSWDELRAKKDDL............YRNDDISVDEGTRGNINGIHRNTREIIEKF------------SETLEKDLL
EXOC5_CAEEL/46-659EL..........................................NKDKFANVQARIGQR------------YKVVEDLLI
Q6FMF7_CANGA/102-810KIET.......................................NSIPATKSTTSTIEKY------------AEEMENEML
A0A0D1E7P5_USTMA/134-1026EV..........................................DVAGAEQTRDSIDRY------------CERFERDML
SEC10_SCHPO/101-799EV..........................................DLPDSSETLARIEKF------------SEFLETNFL
Q5KJ89_CRYNJ/95-875DVADNAATLLSDAEAGAVPKEVTNGDGESQEPIVNQKVISKRRMEKEKAEKVRDEIEGY------------CERFEKELL
Q5AS51_EMENI/111-841RLDPKSWNESRSTEPY..............NDGHLAPNSNNMEGTNGFRWNTREIIEKF------------SETLEKDLL
Q6CQC0_KLULA/109-807KLDT.......................................KSVPKTQEVTQIIEQL------------ATDFEVRIL
C4YGD5_CANAW/103-782KVSD.......................................EKSPKSMKCITTIEQF------------GETMEKELL

PF10191

Q7QA49_ANOGA/2-731SLAAQV--------------------------------------GLHGHSERENLVEYF------------KNRLEALVS
Q29C94_DROPS/2-737SLHAQE--------------------------------------QLPGHAERLTQVEDF------------KNRLEALAS
Q172R1_AEDAE/2-704SISAQE--------------------------------------GLPGQTERTQQFEYF------------TNRMEALAS
COG7_RAT/2-767SLMMLV--------------------------------------DTPDYSEKCVHLEAL------------KNRLEALAS
Q5FW35_XENTR/2-765SLTMLV--------------------------------------DTPDYSEKCVYLEAL------------KNRLEAMCS
Q655R9_ORYSJ/5-868CLSAVG--------------------------------------EVAEFANVRKQLEVL------------EERLDDMVQ
Q9FGN0_ARATH/4-832CLSAVG--------------------------------------EVAEFANVRKQLEVL------------EDRLEAMVQ

PF08318

E9EW04_METRA/274-613--------------------------------------------PLIG..RADVGLDVY............GRYVCQGVA
B6JXE3_SCHJY/165-484--------------------------------------------PLIG..KDKEGVDAY............WHIFGGLIA
COG4_DROME/166-496--------------------------------------------PLVG..CHRTGIEKF............SLYICQKLA
M3D3E3_SPHMS/178-512--------------------------------------------PLIG..RGDVGLEAY............GRYVCGGIA
C4QWJ7_PICPG/179-518--------------------------------------------PLVG..QQSIGIKSY............SSFICNIIH
B8LT52_TALSN/189-530--------------------------------------------PLIG..RSEVGLDVY............GRYVCQGVA
S3CMB0_GLAL2/185-536--------------------------------------------PLIG..REDTGLDVY............GKYVCQGVA
COG4_SCHPO/163-481--------------------------------------------PLIG..KEKEGLEAY............WHFFGGIIA
L8FSC8_PSED2/189-538--------------------------------------------PLIG..RGERGLDVY............GTYVCGGVS
F0XR72_GROCL/199-557--------------------------------------------PLIG..RTDVGLDVY............GRYVCQGVA
V8NZE8_OPHHA/148-457--------------------------------------------PLLG..LHDEGLSNF............SRYLCKQVA
F6TNZ6_XENTR/114-423--------------------------------------------PLLG..LHEEGISKF............SGYLCKQVA
G8BDV4_CANPC/186-525--------------------------------------------PLIG..QEEVGLNCY............AKFICEIIS
C5WWS3_SORBI/192-503--------------------------------------------PLLG..LADEGLQVY............VAYLKKVVA
A8X3I7_CAEBR/217-546--------------------------------------------PLIH..EADEGLQRY............SVFLNQKID
U1HW21_ENDPU/187-524--------------------------------------------PLIG..RSDVGLDVY............GRYVCQGVA
J3NYL1_GAGT3/212-567--------------------------------------------PLIG..RGDVGLDVY............GRYVCQGVA
D5GK94_TUBMM/197-545--------------------------------------------PLIG..RTDVGLEVY............GRYVCQGVA
F6I2Y2_VITVI/183-485--------------------------------------------SPLN..LEEEGLQMY............VNYLKKVIG
T1KVK7_TETUR/162-476--------------------------------------------PLLK..QKDDGLRKF............SNYLCQQLS
G8BYJ4_TETPH/194-538--------------------------------------------PMIG..QDKLGLDMY............SKYVCNIIA
Q5TNE6_ANOGA/167-491--------------------------------------------PLLG..MHDEGLEKF............MTYICGKLQ
J4GWL1_FIBRA/183-513--------------------------------------------PAIG..WEVEGLQAY............AAFVVDLVK
H2VA38_TAKRU/70-376--------------------------------------------PLLG..LHQQGLARF............GQYLCTQIA
A3LT54_PICST/195-541--------------------------------------------PLIN..QEEIGLNCY............SKFICQIIS
B7QAG5_IXOSC/93-401--------------------------------------------PLLN..QHDEGLHKF............SLYLSAQIS
C5LP43_PERM5/114-451--------------------------------------------YPLG..MTTEAVARY............VRFIRQTLA
G3AM87_SPAPN/194-515--------------------------------------------PLIG..QEEIGLNCY............SKFICEIIK
R8BYD5_TOGMI/1157-1500--------------------------------------------PLIG..RGDVGLDVY............GRYVCQGVA
A5DUI4_LODEL/191-536--------------------------------------------PLIS..QEEIGLTCY............ANFICEIIN
F4NT70_BATDJ/197-515--------------------------------------------PLIG..KVDLGLDLF............SAHICRTVS
C5GF37_AJEDR/230-568--------------------------------------------PLIG..RSAVGLDVY............GRYVCQGVA
B2AA74_PODAN/219-562--------------------------------------------PLIG..RGDVGLDVY............GQYVCQGVA
N1JE83_BLUG1/191-526--------------------------------------------PLIG..KEETGLEAY............GRYICKGVA
W4ZDW5_STRPU/172-484--------------------------------------------PLLN..LHEEGLTKF............STYLQAQIV
G0W4A1_NAUDC/213-564--------------------------------------------PMVG..QDHLGLELY............SKYVCDIIA
Q4DDH2_TRYCC/242-662--------------------------------------------TQLG..FSEEGCSLY............CTWLCEHTI
Q16TS8_AEDAE/167-489--------------------------------------------PLLG..MHDEGLAKF............MTYICTKLQ
E9FQQ8_DAPPU/154-462--------------------------------------------PLLN..MHEEGISKF............GNYLAGQLR
C5M6Q7_CANTT/193-537--------------------------------------------PLIN..QEEIGLNCY............SKFICEIIN
V5GSU0_PSEBG/199-579--------------------------------------------PQVG..WKKEGLEVY............SSFARSMVR
X6MJK6_RETFI/5-348--------------------------------------------PYLD..LSKEGLSLY................CEALK
M2R7X1_CERS8/181-514--------------------------------------------PAIG..WEEEGLQAY............ANFVVDLIR
A0A068Y5W7_ECHMU/114-419--------------------------------------------PIIR..KHELGLTKY............GKYIATKIG
D6WJA3_TRICA/162-474--------------------------------------------PLLG..MHEEGIKAL............CTYLRTKVA
G8Y9D0_PICSO/191-527--------------------------------------------PLIQ..QEEVGLNCY............AKFICGIII
Q57XU9_TRYB2/282-625--------------------------------------------TLLG..FRDECCCMY............CSWMCEHTI
G2Y0X2_BOTF4/187-528--------------------------------------------PLIG..REEVGLDVY............GKYVCQGVA
E0VZ92_PEDHC/157-456--------------------------------------------PLLN..MHDEGLKEY............SLYLSSKLR
B0CT70_LACBS/161-472--------------------------------------------PAIG..WETEGLDAY............AAFVVDLVR
Q59T37_CANAL/195-551--------------------------------------------PLIN..QEEIGLNCY............SKFICEIIN
E9QGT9_DANRE/180-489--------------------------------------------PLLG..LHEQGLARF............AQYLCSQLA
K1WLQ9_TRIAC/267-644--------------------------------------------PGIG..AEDEGLAAY............GDFVVELVQ
F9XE54_ZYMTI/175-509--------------------------------------------PLIG..RRDVGLDAY............GRYVCGGIA
C5DG77_LACTC/179-498--------------------------------------------PLIR..KSDMGLDLY............SKYVCDMIA
K5Y4H4_AGABU/183-506--------------------------------------------PAIG..WEAEGLRAY............ADFVVHLVR
I1JS41_SOYBN/186-485--------------------------------------------TPLG..VEEEGLQVY............VGYLKKVIA
K0KE72_WICCF/171-504--------------------------------------------PMIG..KNHIGLDNY............SKFICNIIA
K4CGD4_SOLLC/174-477--------------------------------------------PPLA..LEEEGLQVY............VMYLKKVIA
H2XLC7_CIOIN/111-421--------------------------------------------PLLK..MEDEGLDKF............SHYLCQEIA
S9VWR1_SCHCR/164-482--------------------------------------------PLIG..KEKEGLESY............WHFFGGIIA
U9TBS3_RHIID/182-496--------------------------------------------PLIG..KETEGLDKY............SKFVCGIIA
E3Q612_COLGM/198-538--------------------------------------------PLIG..RGDVGLDVY............GRYVCQGVA
Q6BTT0_DEBHA/227-568--------------------------------------------PLIQ..KEEIGLNCY............SKFICQIIT
K2S8E4_MACPH/175-516--------------------------------------------PLIG..RSDVGLDAY............GRYVCHGVS
G8JQJ6_ERECY/189-517--------------------------------------------PKIG..NSEMGLDIY............SKHVCNILA
A0A0C4EWA8_PUCT1/187-568--------------------------------------------PLLGPSASESGLSAY............SDFVRTLIS
A9SCH4_PHYPA/154-467--------------------------------------------PPLR..LQEEGLRSY............VAYLRKVVA
Q0UYP7_PHANO/174-513--------------------------------------------PLIG..RTNVGLDAY............GRYVCQGVA
M9MH30_PSEA3/203-582--------------------------------------------PQIG..WKKEGLEVY............SSFARSMVR
I2H5R5_TETBL/205-583--------------------------------------------PMVG..ENTLGLDLY............SKYICDIIA
A7TT52_VANPO/190-542--------------------------------------------PMVG..QNDLGLELY............SKYVCDIIA
T1J554_STRMM/179-485--------------------------------------------PLLN..QHEEGLKKF............SKYLCSQIA
A0A0D2XGD5_FUSO4/82-414--------------------------------------------PVIGGGAEETGLEAY............GQYICQGMA
A7RPW3_NEMVE/163-477--------------------------------------------PLLN..QHAKGLGKY............SHYLCSMVA
B4KHQ6_DROMO/161-491--------------------------------------------PLVG..CHKIGIEKF............CGYICQKLS
A8NGP6_COPC7/165-479--------------------------------------------PAVG..WEEEGLEAY............AAFVVDLVR
D8QT59_SELML/156-463--------------------------------------------APLG..LHEEGIKAY............VSYLRRSVD
S8C8S4_DACHA/216-562--------------------------------------------PLIG..RSDTGLEVY............GGYVCRGVA
N1PMN4_DOTSN/176-511--------------------------------------------PLIG..RSHVGLEAY............GSYVCSGIA
V5G2M7_BYSSN/194-532--------------------------------------------PLIG..RSEVGLEVY............GRYVCQGVA
F8Q674_SERL3/166-485--------------------------------------------PVID..CQAEGLQAY............SSFVVKLIR
M3AA99_PSEFD/191-526--------------------------------------------PLIG..RSHVGLDAY............GRYVCSGIA
G4MR42_MAGO7/219-567--------------------------------------------PLIG..RGDVGLDIY............GRFVCQGVA
J3KI74_COCIM/186-524--------------------------------------------PLID..RSAVGLDVY............GRYVCQGVA
G4U2Q1_PIRID/161-490--------------------------------------------PEIG..WETEGLELY............ARFVVDLIR
R7YUM9_CONA1/175-511--------------------------------------------PLIG..RTDVGLDAY............GRYVCQGVA
G8ZSF3_TORDC/186-519--------------------------------------------PLVG..QNTLGLDLY............SKYVCDMIA
G0SXA1_RHOG2/160-497--------------------------------------------PMIE..EEEKGLEVY............ADWVAGIVR
S3C4S1_OPHP1/236-610--------------------------------------------PLIG..RTDVGLDVY............GRYVCQGVA
D8M8U8_BLAHO/154-504--------------------------------------------DSLG..EGRSILQPFLSLSSFELTHRLVQYLMTPLV
C3YFK8_BRAFL/171-477--------------------------------------------PLIG..LRDEGLKKF............TAYLCSQIA
Q758T0_ASHGO/188-512--------------------------------------------PKIG..YAELGLEVY............SKYVCDIIA
M5C4C1_THACB/161-521--------------------------------------------PTIN..CPADGLAAY............SDFVLDLVA
U4L2E9_PYROM/293-612--------------------------------------------PLIG..RGDTGLDVY............GRYVCTGVA
J4KLZ9_BEAB2/1246-1586--------------------------------------------PLID..RTEVGLDVY............GKYVCQGVA
G7E1B8_MIXOS/165-515--------------------------------------------PVIR..AEKEGLDAY............SKFICSIVH
H2KS09_CLOSI/401-723--------------------------------------------PLLG..RREDGLQRF............GGYLCTRIT
W1NDY2_AMBTC/181-483--------------------------------------------PMLG..LRAEGLQIY............VSYLRKVIS
COG4_ARATH/176-479--------------------------------------------SPLG..METEGLQLY............VGYLKKVIA
H6C9G5_EXODN/179-515--------------------------------------------PLIN..RSDVGLDIY............GRYVCQGVA
H3AVV6_LATCH/187-496--------------------------------------------PLLG..LHENGLSKF............SEYLCKQIA
K5V063_PHACS/174-511--------------------------------------------PAIG..WEEEGLQAY............ASFVVDLVK
B6HSP5_PENCW/191-531--------------------------------------------PLIG..RSEVGLDVY............GRYVCQGVA
G3BC56_CANTC/190-528--------------------------------------------PLIG..QEEVGLNCY............SKFISQVIT
A0A068X7X6_HYMMI/106-417--------------------------------------------PIIL..EHDMGLTKY............GTYLASKIG
M7NUP8_PNEMU/161-484--------------------------------------------PIIG..KSKEGLNVY............SEFISNMVI
U7PW27_SPOS1/225-627--------------------------------------------PLIG..RTDVGLDVY............GRYVCQGVA
E6ZNH9_SPORE/195-575--------------------------------------------PQVG..WKKEGLEVY............SSFARSMVR
G0V8A6_NAUCC/189-534--------------------------------------------PMVG..QDSLGLDLY............SKYVCDIIA
E7QLX6_YEASZ/190-525--------------------------------------------PMIG..QDVLGLDLY............SKYVCDIIA
C5DUL4_ZYGRC/172-510--------------------------------------------PLIG..QDSLGLDLY............SKYVCDIVA
E4UP45_ARTGP/209-548--------------------------------------------PLIG..KSDVGLDVY............GRYVCQGVA
K1R201_CRAGI/174-481--------------------------------------------PLIG..LHEEGLTKF............GKFLSSQIA
Q6FTK7_CANGA/185-531--------------------------------------------PMVG..QDNLGLDLY............SKYVCDIIA
D2V3G5_NAEGR/119-422--------------------------------------------SPLC..MNEDGLSLY................VDFLS
G5C1P9_HETGA/267-575--------------------------------------------PLLG..LHEEGLSKF............SEYLCKQVA
L8WI47_THACA/987-1357--------------------------------------------PTIN..CPADGLAAY............SDFVLDLVA
V2X3Q2_MONRO/169-474--------------------------------------------PAIG..WEKEGLEAY............ASFVVDLVR
A7UW80_NEUCR/259-612--------------------------------------------PLIG..RGDVGLDAY............GQYVCQGVA
M2NB58_BAUCO/172-509--------------------------------------------PLIG..RRDVGLDAY............GRYVCTGIA
C7ZFK3_NECH7/171-496--------------------------------------------PLIG..RAEVGLDVY............ARYICRGVA
K1WSR6_MARBU/231-588--------------------------------------------PLIG..REDTGLEVY............GRYVCQGVA
S0E9C5_GIBF5/167-499--------------------------------------------PVIGGGAEETGLEAY............GQYICQGMA
C4XYR0_CLAL4/197-532--------------------------------------------PLID..QEEVGLNCY............SKFICSIIT
S2JH92_MUCC1/194-506--------------------------------------------PLIN..CQTEGLDKY............SRFVCNIIK
E9IBA8_SOLIN/158-464--------------------------------------------PLLG..MHLEGLKKF............CSYLCTKLH
A0A016PRI6_GIBZA/187-527--------------------------------------------PLIG..RAEVGLDVY............GRYVCQGVA
G0R6U4_HYPJQ/191-531--------------------------------------------PLIG..RADVGLDVY............GKYVCQGVA
I2FV21_USTH4/206-592--------------------------------------------PQVG..WKKEGLEVY............SSFARSMVR
A8NFV8_BRUMA/216-544--------------------------------------------PLLN..EHMKGIELI............GNYLCSEIH
G0SCB4_CHATD/176-523--------------------------------------------PLIG..RGDVGLDVY............GQYVCQGVA
W1QCQ6_OGAPD/210-555--------------------------------------------PLIG..KSDVGLSCY............SRFICNIIS
Q5AW68_EMENI/201-531--------------------------------------------PLIG..RSEVGLDVY............GRYVCQGVA

PF07393

Q750R9_ASHGO/111-822DSFNLAYRNND...F-------DKLNEIALI...LKHYNGGV....NVIQSFINQHEYFA.DAELIKQ.NEADVAVFSNS
Q6BHS9_DEBHA/103-810KKFDVYYECDE...Y-------DRMKEVASI...LHQFNGGA....TVVQLFLNKHDFML.DTENL.....DDNSLLDNE
SEC10_ARATH/139-817SRFDAASQRRD...L-------STMSECAKI...LSQFNRGT....SAMQHYVATRPMFI.............DVEVMNS
Q2HG63_CHAGB/108-854KQFNNSYRRQN...F-------DDMMECARV...LHDFNGGA....SVIAAFVNQHQFFI.DRDQLI...TDEVTTDG..
Q7PQN8_ANOGA/88-705EEFATAQKMEN...I-------ERMKELSDI...LSQFKGYT....QVIDVYIEQSQATT....................
A1D556_NEOFI/126-876KEFRQGYESED..ID-------GTMRKYAHV...LFTLNGGD....SAIEFFINHNHLIT.QKSDLGR.VADCIDG....
Q2URB8_ASPOR/132-879KEFRHGYETED..ID-------NRMRQYAHV...LYTLNGGA....AAVELFIHHNHLVT.RRSDYGK.PGDCIDA....
E7KRR3_YEASL/120-862ENFNSAYRENN...F-------TKLNEIAII...LNNFNGGV....NVIQSFINQHDYFI.DTKQIDLENEFENVFIKNV
Q4RLZ1_TETNG/80-698QEFTAAQRRGE...I-------GRMREVAAV...LLHFKGYA....HCVDVYIKQCQEGA....................
Q55N90_CRYNB/170-1008VAFEVSDGKKD...E-------EGMKEAAESSWKVWEAGGGDREKWECGRVWVEKREVFY............DTSRWDSL
Q0IP77_ORYSJ/117-800ARFDTASQRRE...M-------STMAECAKI...LSQFNRGT....SAMQHYVATRPMFI.............DVDIMSI
A2EZD8_TRIVA/69-728EQFVANSKINK....-------YEQAKCASA...LGLLSHEY....EAMEAFIKSTPIMTDAGKKY..............
Q2GXU3_CHAGB/166-960REFEQGYEFWD..VD-------GRMNKYAHV...LALLNGSS....AAVELFIQKHPVFT.DREVLAN.SMDCVNQ....
Q2TVY5_ASPOR/116-891KQFDDFYRKAN...F-------EGMKDCATV...LQDFNGGS....SVIALFVNQHQFFI.DRSQLV...TEEVGGDL..
Q5BGH2_EMENI/123-870KEFRHGYETDD..ID-------GRMKNYAHV...LYTLNGGG....SASELFTHHNHIIT.RKAELGQ.TNDCIDT....
Q6CDC8_YARLI/101-777DVFDQAYRNAD...M-------LMMKDSADV...LTDFNGGT....NVIMAFVNQHDFFIAQDKVV......AANSEPDE
EXOC5_DROME/89-705EEFATAQKSED...I-------ERMKTLAQI...LSQFKGYT....QCVDAYIEQSQMQP....................
A1DAY7_NEOFI/117-893KQFDDFYRKAN...F-------EGMRDCATV...LQDFSGGA....SVTALFVNQHQFFI.DRSQLV...TEELGGDL..
EXOC5_CAEEL/46-659EEFVRSQRDEK....-------.KMAEVAKI...LSEFKGYS....GCVDRYVD..........................
Q6FMF7_CANGA/102-810TKFNNAYRENN...F-------TQLNEIALI...LNHYNDGI....NVIQSFINQHNFFL.DSDEVNKSMTGESPYLSED
A0A0D1E7P5_USTMA/134-1026KLFDKFYRRSD...P-------KMMSHIAKV...LQGFNGGA....SCVQIYVNQHDFFI.SKDRV.....GEANGIELS
SEC10_SCHPO/101-799KFFNNEYRKPN...W-------KGMASFGTI...LQEFNGGA....SVVREFVNQHEFFI.AADKV.....QSRQGLEQD
Q5KJ89_CRYNJ/95-875KLFDRSYRKGD...P-------RMMAHCAKT...LQEFNGGA....SCIQIYVNQHDFFIKDHSQIE...KDEQDGVRV.
Q5AS51_EMENI/111-841RQFDDFYRKAN...F-------EGMKDCATV...LQDFNGGA....SVVALFVNQHQFFI.DRSQLV...TEEVGGDP..
Q6CQC0_KLULA/109-807QGFNAAYREND...Y-------SRLHQLAWI...LDTFNNGV....NIIKNFTDKHQFFE.ESSNFS...AKESALFTDD
C4YGD5_CANAW/103-782RKFEIASEDEDDIDF-------DMMNQIAQI...LFEYNEGI....NVIQTFVIKNDIVIENEEKS...........LDE

PF10191

Q7QA49_ANOGA/2-731PSVVVALRSMD---T.......AACRRYVGI---FEGIGRLA----QLKQYYRTVLKTFV-------------------Q
Q29C94_DROPS/2-737PSVVQCFAESN---L.......EQAQHYVQI---FASIQRLP----QLQQYYRAVQKNLW-------------------Q
Q172R1_AEDAE/2-704PSVIQYIQQGD---V.......TQCLKYVEI---FRIIDRLP----QLKQCYRTVHKNAL-------------------V
COG7_RAT/2-767PQIVAAFTSQS---V.......DQSKVFVKV---FTEIDRMP----QLLAYYYKCHKVQL-------------------L
Q5FW35_XENTR/2-765PQIVAAFNSQS---V.......DQAKMFVKV---FSEIDRMP----QLLAYYYKCHKVQL-------------------V
Q655R9_ORYSJ/5-868PRLVDALSNRK---PTNFGWKVDAVQDLRGI---LIRIGRFK----SLEVQYTKIHVKPL-------------------K
Q9FGN0_ARATH/4-832PRLTDALTYHK---V.......DVAQDLRVI---LIRIGRFK----SLELQYSKVRLKPI-------------------K

PF08318

E9EW04_METRA/274-613GTARATLKDSV-----------GAHGRK...---........----.........EGFFY--------------------
B6JXE3_SCHJY/165-484AKARATMDQPV-----------S........---........----.........HVLFF--------------------
COG4_DROME/166-496NKAQKELRNAQ-----------DIAKAES..---........----........RLQLAY--------------------
M3D3E3_SPHMS/178-512ARARSNMSSTR-----------.......A.---........----........RDGMFY--------------------
C4QWJ7_PICPG/179-518EQSRLNMKTSQ-----------G........---........----.........TNTSH--------------------
B8LT52_TALSN/189-530SRARANLNAG.-----------.......PG---G.......----.....SQVKDGYFY--------------------
S3CMB0_GLAL2/185-536GRARGNLKEG.-----------.......TK---G.......----.....VGAQDGFFY--------------------
COG4_SCHPO/163-481SKARATLDEPP-----------T........---........----.........HALFF--------------------
L8FSC8_PSED2/189-538ERARATLREA.-----------.......TG---KQIDR...----..DRAGEGKDGFFY--------------------
F0XR72_GROCL/199-557AAARTVMGTEA-----------ASA....T.---........----........PSPFFY--------------------
V8NZE8_OPHHA/148-457NKAEENLQLAL-----------QTDPTDR..---........----........RYAVLF--------------------
F6TNZ6_XENTR/114-423KKAEENLQLAL-----------GTEGGER..---........----........RAALIF--------------------
G8BDV4_CANPC/186-525ESSKNLTQTIN-----------SITATDL..---........----.........KPGIF--------------------
C5WWS3_SORBI/192-503LRARADFEHLA-----------ELTSATQP.---........----.......TSERLDF--------------------
A8X3I7_CAEBR/217-546KLAEENLAIMR-----------AGGTDDN..---........----........RRNVLY--------------------
U1HW21_ENDPU/187-524GRARANLNAG.-----------.......TG---G.......----.....SQSKDGYFY--------------------
J3NYL1_GAGT3/212-567GTARQTLRDGP-----------PAATTPGGG---GG......----....GGTTTAGFFY--------------------
D5GK94_TUBMM/197-545ARARDALAAKR-----------QAVADGAG.---........----.......GLGDFFY--------------------
F6I2Y2_VITVI/183-485MRSRLEYEHLV-----------ELMEQSSG.---........----.......NQSNVNF--------------------
T1KVK7_TETUR/162-476QPNATESKSAG-----------LSEVSD...---........----.............H--------------------
G8BYJ4_TETPH/194-538EESRTLMTING-----------NDNLEQSI.---........----........KRPGFF--------------------
Q5TNE6_ANOGA/167-491VKAAKELRSSM-----------DIAKAEK..---........----........RAAVAY--------------------
J4GWL1_FIBRA/183-513VRAPASAKTS.-----------.........---........----.........SPLYY--------------------
H2VA38_TAKRU/70-376SKAEENLHLAT-----------GGDLGEK..---........----........RAPLVF--------------------
A3LT54_PICST/195-541DTSKNLVTSTS-----------TVNAADL..---........----.........KVGIF--------------------
B7QAG5_IXOSC/93-401ETAHKNLKQAQ-----------ATSASDK..---........----........RANIIY--------------------
C5LP43_PERM5/114-451AQCKQKLSSVT-----------ATTTTSNDA---SSS.....----....SSSNVINEKY--------------------
G3AM87_SPAPN/194-515ETSRSLISQST-----------SG.......---........----.........KPGIF--------------------
R8BYD5_TOGMI/1157-1500GTARSTLKEG.-----------.......TG---G.......----.....HGRKDGFFY--------------------
A5DUI4_LODEL/191-536ESSKNLTSTVN-----------NIHASEL..---........----.........KPGIF--------------------
F4NT70_BATDJ/197-515RSCQDGIRAAI-----------EAGK.....---........----.........QKMVY--------------------
C5GF37_AJEDR/230-568ARARANLHAG.-----------.......AG---A.......----.....EQRKDGFFY--------------------
B2AA74_PODAN/219-562GTARTVLKEG.-----------......AST---VG......----....GQGRKDGFFF--------------------
N1JE83_BLUG1/191-526ARARDSLRED.-----------.......SK---........----.......GKDALFF--------------------
W4ZDW5_STRPU/172-484SNAREHLEIAS-----------SVDSSDR..---........----........RAGVLY--------------------
G0W4A1_NAUDC/213-564NESRKILTFEK-----------KNL......---........----.........SNLYY--------------------
Q4DDH2_TRYCC/242-662AALKKMVDREL-----------RKMDDPT..---........----........EAGMSH--------------------
Q16TS8_AEDAE/167-489AKAQKELRSSM-----------DIAKAEK..---........----........RTTVAF--------------------
E9FQQ8_DAPPU/154-462DKTPKTLRPTD-----------GDSNNIR..---........----.........ANVYF--------------------
C5M6Q7_CANTT/193-537ETSKNLTKGLE-----------NAHDL....---........----.........KPGIF--------------------
V5GSU0_PSEBG/199-579EKGRSITDSLG-----------SGKAQ....---........----.........NPTHF--------------------
X6MJK6_RETFI/5-348RETMMELENRS-----------LLFDCKEFV---DI......----....KNSKEEHIPY--------------------
M2R7X1_CERS8/181-514IRPPASAKTS.-----------.........---........----.........SPLYY--------------------
A0A068Y5W7_ECHMU/114-419EKAETQFAVVT-----------STQSFD...---........----.........KPNVH--------------------
D6WJA3_TRICA/162-474ATAEKNLKSAM-----------TTPQSDK..---........----........RHSVIY--------------------
G8Y9D0_PICSO/191-527ETSRNLITSTH-----------KDSNTEV..---........----.........KSGLY--------------------
Q57XU9_TRYB2/282-625VALNKMVEREL-----------RKIDDPN..---........----........EAGMSH--------------------
G2Y0X2_BOTF4/187-528GTARKNLKEG.-----------.......AK---G.......----.....ERGKEGFFY--------------------
E0VZ92_PEDHC/157-456QTAEKNLKVAL-----------DTAKTDL..---........----........KPNIIF--------------------
B0CT70_LACBS/161-472VRAPASAKTS.-----------.........---........----.........SPLYY--------------------
Q59T37_CANAL/195-551ETSKSLTAGLE-----------NAHDL....---........----.........KPAIF--------------------
E9QGT9_DANRE/180-489SKAEENLILAV-----------GSDLGER..---........----........RAPVIF--------------------
K1WLQ9_TRIAC/267-644SRARKDKDGQR-----------S........---........----.........SPLYY--------------------
F9XE54_ZYMTI/175-509SRARSNMSSTQ-----------.......P.---........----........KDGMFY--------------------
C5DG77_LACTC/179-498TQSRKVMTSTT-----------SK.......---........----.........SPGFF--------------------
K5Y4H4_AGABU/183-506GRAPASANTS.-----------.........---........----.........SPLYY--------------------
I1JS41_SOYBN/186-485MRSRMEFEQLV-----------EMMDQ....---........----.........QNVNF--------------------
K0KE72_WICCF/171-504NQSRLIITNQS-----------QQD......---........----.........KYGFY--------------------
K4CGD4_SOLLC/174-477MRSRLEYEQLV-----------EMMSDQQGS---........----.......SQNQLNF--------------------
H2XLC7_CIOIN/111-421KSSSENLKQAL-----------QIETGDT..---........----........RYSLIF--------------------
S9VWR1_SCHCR/164-482SKARATLDEPS-----------S........---........----.........HSFFF--------------------
U9TBS3_RHIID/182-496GKSQANLAEMA-----------I........---........----.........GTNFY--------------------
E3Q612_COLGM/198-538GTARSVLKES.-----------.......PG---A.......----.....QARKEGFFY--------------------
Q6BTT0_DEBHA/227-568DTSRSLINSAS-----------GGSNAAT..---........----.........KHGMY--------------------
K2S8E4_MACPH/175-516SRARTNLNTAV-----------A......S.---........----........RENFFY--------------------
G8JQJ6_ERECY/189-517EQSRKIMMGQI-----------DK.......---........----.........PHMFF--------------------
A0A0C4EWA8_PUCT1/187-568VPSSITRPTDG-----------A........---........----.........KPASI--------------------
A9SCH4_PHYPA/154-467MRARGDYEVLI-----------EALGSTDGG---........----......RGAGTADF--------------------
Q0UYP7_PHANO/174-513ARARANFNSAP-----------PAQ....R.---........----........KEGFFY--------------------
M9MH30_PSEA3/203-582EKGRAISDSLL-----------PGKAQ....---........----.........HPTHF--------------------
I2H5R5_TETBL/205-583NESRKIITDET-----------NKNSDNGAH---HI......----.....NPSKIPGFY--------------------
A7TT52_VANPO/190-542DESRKLMTSSG-----------NNNLEESL.---........----........KRPGFY--------------------
T1J554_STRMM/179-485ETAQKNLKLAL-----------GSAPGDK..---........----........RANVIF--------------------
A0A0D2XGD5_FUSO4/82-414ETVRSALGGAH-----------KERG...K.---........----........QNDFFY--------------------
A7RPW3_NEMVE/163-477ATAQQNLEQID-----------ITKDSDR..---........----........HANVLF--------------------
B4KHQ6_DROMO/161-491AKAQKELRNAQ-----------DIAKAER..---........----........RQHLAY--------------------
A8NGP6_COPC7/165-479IRTPASAKTS.-----------.........---........----.........SPLYF--------------------
D8QT59_SELML/156-463HRARDGFAAVK-----------ETP......---........----.........DQADF--------------------
S8C8S4_DACHA/216-562ERMRAVRGRK.-----------.......N.---........----........DGPLFY--------------------
N1PMN4_DOTSN/176-511ARARSNMSSTQ-----------.......K.---........----........REGLFY--------------------
V5G2M7_BYSSN/194-532ARARTNLNAG.-----------.......AA---........----......GSQDGFFY--------------------
F8Q674_SERL3/166-485VQPMVFDQTT.-----------.........---........----.........SSHYF--------------------
M3AA99_PSEFD/191-526SRARSNMSSTR-----------.......R.---........----........RDGIFY--------------------
G4MR42_MAGO7/219-567GMARQTLRDG.-----------.....PGVT---AA......----....GGQQQNTFFF--------------------
J3KI74_COCIM/186-524SRARANLNTG.-----------.......TG---G.......----.....AQSKDGFFY--------------------
G4U2Q1_PIRID/161-490ARAPAGVKAS.-----------.........---........----.........SPMYY--------------------
R7YUM9_CONA1/175-511SRARTNLNSGA-----------G......R.---........----........KDGFFY--------------------
G8ZSF3_TORDC/186-519EQSRRLMTMET-----------K........---........----.........KRGVF--------------------
G0SXA1_RHOG2/160-497AKTGALSTKSQ-----------.........---........----.........SPTHF--------------------
S3C4S1_OPHP1/236-610QSARNVWKDAG-----------SDPSSTNTS---........----......TQRDTRFY--------------------
D8M8U8_BLAHO/154-504EQTKKDNQLLQ-----------SQRSAHH..---........----.........VGVVV--------------------
C3YFK8_BRAFL/171-477NTSEQNLQIAI-----------GTTSTER..---........----........RANVVY--------------------
Q758T0_ASHGO/188-512GQSRKIMTGST-----------ER.......---........----.........RHMFY--------------------
M5C4C1_THACB/161-521RRAPPSVKAS.-----------.........---........----.........SPVYY--------------------
U4L2E9_PYROM/293-612GRAREVMNQD.-----------.......Q.---........----........KGDFFF--------------------
J4KLZ9_BEAB2/1246-1586GTARTTLKDG.-----------.......IG---G.......----.....QTRKDGFFY--------------------
G7E1B8_MIXOS/165-515GRSKAALTQKA-----------N........---........----.........SLLYF--------------------
H2KS09_CLOSI/401-723KHCEGLFGLSE-----------LSDDPKTTG---........----......QVKRTMIC--------------------
W1NDY2_AMBTC/181-483MRTRMEFDTVK-----------EFIDQSRP.---........----........PSEINF--------------------
COG4_ARATH/176-479LRGRMEYENVV-----------ELMEQGL..---........----.........GQVNF--------------------
H6C9G5_EXODN/179-515ARARANLNAG.-----------.......TG---G.......----.....NQSKDDFFY--------------------
H3AVV6_LATCH/187-496NKAKENLLLAM-----------GSDMTDR..---........----........RAAVMF--------------------
K5V063_PHACS/174-511VRAPASAKTS.-----------.........---........----.........SPLYY--------------------
B6HSP5_PENCW/191-531AKARANLNGA.-----------.......TG---G.......----.....AQTKDGFFY--------------------
G3BC56_CANTC/190-528DTSRSLIQSIS-----------SGSGGEAS.---........----........KKIGLY--------------------
A0A068X7X6_HYMMI/106-417EKAANQLALAV-----------TGGSLS...---........----.........ESNVH--------------------
M7NUP8_PNEMU/161-484QNKHKLMSAMG-----------ILDEKSID.---........----.......TKISMSY--------------------
U7PW27_SPOS1/225-627ESARNVFRGET-----------PQPAAVPAA---A.......----......SRHDGFFF--------------------
E6ZNH9_SPORE/195-575EKGRSISDALG-----------SGKAQ....---........----.........HPTHY--------------------
G0V8A6_NAUCC/189-534EESRKILTQKI-----------SQST.....---........----.........NTSYY--------------------
E7QLX6_YEASZ/190-525DESRKIMSNSM-----------ENSTK....---........----.........FQGFF--------------------
C5DUL4_ZYGRC/172-510GQSRKIMTGEN-----------K........---........----.........RPGVF--------------------
E4UP45_ARTGP/209-548ARARSNLNAG.-----------.......TG---G.......----.....AQAKDDFFY--------------------
K1R201_CRAGI/174-481EKSRGNLMIAE-----------SVTHKDK..---........----........NANVIY--------------------
Q6FTK7_CANGA/185-531DESRKLMSSSA-----------NADVDATI.---........----.......TRRSGFF--------------------
D2V3G5_NAEGR/119-422DKCRKELESLD-----------EVERLTYIR---K.......----......QQQQYVSF--------------------
G5C1P9_HETGA/267-575SKAEENLLLVL-----------RSDMSDR..---........----........RAAVIF--------------------
L8WI47_THACA/987-1357RRAPPSVKG..-----------.........---........----...........VVI--------------------
V2X3Q2_MONRO/169-474VRAPVSAKTS.-----------.........---........----.........SPLYF--------------------
A7UW80_NEUCR/259-612NRARAILKDG.-----------......VGA---VGGAANAN----APPTLRPKKDGIFY--------------------
M2NB58_BAUCO/172-509ARARSSMNTSQ-----------.......R.---........----........REGLFY--------------------
C7ZFK3_NECH7/171-496NAARETLKQAG-----------TS.....S.---........----........RDVFFY--------------------
K1WSR6_MARBU/231-588ARARGGLREG.-----------.......TK---G.......----.....SAGQDGFFY--------------------
S0E9C5_GIBF5/167-499ETARSALRRPQ-----------EERG...R.---........----........QNDLFY--------------------
C4XYR0_CLAL4/197-532DTSRTLINSAM-----------QGDASS...---........----.........KKGIY--------------------
S2JH92_MUCC1/194-506ARCAEELKTGL-----------IA.......---........----.........APTYF--------------------
E9IBA8_SOLIN/158-464ETAQKNLQAAL-----------EIKSNDK..---........----........RAAVIF--------------------
A0A016PRI6_GIBZA/187-527GTARATLKDA.-----------.......MN---G.......----......QRREGFFY--------------------
G0R6U4_HYPJQ/191-531GTARATLKDG.-----------.......MA---G.......----.....QNRKEGIIY--------------------
I2FV21_USTH4/206-592EKGRAISDSLA-----------SGKAQ....---........----.........HPIHF--------------------
A8NFV8_BRUMA/216-544QFAERNYKVML-----------AGGIDDT..---........----........RISVLY--------------------
G0SCB4_CHATD/176-523GQARAMLKEG.-----------.....TTGA---AA......----....GQPRKDGVFF--------------------
W1QCQ6_OGAPD/210-555DQSRTNLRSVQ-----------GKDV.....---........----.........HSSFY--------------------
Q5AW68_EMENI/201-531AKARSNLNTG.-----------.......TG---........----.......QQDGFFY--------------------

PF07393

Q750R9_ASHGO/111-822ALTEKLTN..AE----------------------EHDMFYPKTLVESLSSMEEIVKAEAEIVRRVF...EERAPV-VMKL
Q6BHS9_DEBHA/103-810AIWNKLSD..PD----------------------FGENIKDESTEALLDGLKISIKGQARIVQQVF....EDATP-VLKI
SEC10_ARATH/139-817DIRLVLGDHGSQ----------------------PSPSNVARGLSALFKEITDTVRKEAATITAVF....PTPNE-VMAI
Q2HG63_CHAGB/108-854ETWDQLAD..PD----------------------SDPPGVEPSLQSLVDEVKIVMQEESFIIKRAF....PYYET-VLIK
Q7PQN8_ANOGA/88-705............----------------------.......YGGRDVFEGIVPLCHKHYKIIQQVF....NAPDK-VISK
A1D556_NEOFI/126-876..........LN----------------------Q..RVKLEHTQAFFTRLSVAYNEEVSIINRAF....PPSMN-VGPT
Q2URB8_ASPOR/132-879..........SS----------------------Q..SVKLDQTQAFFTRLSVAYNEEVAIINRAF....PPSLK-VALP
E7KRR3_YEASL/120-862KFKEQLID..FE----------------------NHSVIIETSMQNLINDVETVIKNESKIVKRVF...EEKATH-VIQL
Q4RLZ1_TETNG/80-698............----------------------.......YLRNDVFEDTAILCQRVNKQVGEVF....SSPET-VMAK
Q55N90_CRYNB/170-1008ENIIKVQTQSGA----------------------TIRQLDFTPMDAFMSHVLEAFRIDAEIAHSVF....PSKAK-VVLS
Q0IP77_ORYSJ/117-800DIQVVLGEEGPQ----------------------ADHICIAEGLSVLYKEIADTVRREATTIMAVF....PSPNE-VMSI
A2EZD8_TRIVA/69-728....HFKEKYLF----------------------EDESILLDHYKGLCSFFVTDCKKSWDLIDVIFTGSQQPKTV-LVTT
Q2GXU3_CHAGB/166-960...........A----------------------LADSITLEPSRRFFEVLTRKVNEQAGIIERIF....PNPVH-VFWV
Q2TVY5_ASPOR/116-891EAWEQLAD..PD----------------------SEPLKVEPSLQSLIDEVKVVVQEESAIIKRAF....PYYEQ-VLGK
Q5BGH2_EMENI/123-870..........LT----------------------Q..KVKLHQTQAFFTRLSVAFNEEVSIINRAF....PPALQ-LAQP
Q6CDC8_YARLI/101-777AVLKELAD..PN----------------------NSDPQFDHVTEELCSEVVSVVNTETEIIKRVF....KEPVV-VLQV
EXOC5_DROME/89-705............----------------------.......YSGKDIFIGIVPLCKHHYEIIQKVF....ANPQQ-VMSK
A1DAY7_NEOFI/117-893DSWEQLAD..PD----------------------AEPLKVEPSLQSLVDEVKVVVQEESAIIKRAF....PFYEQ-VLGK
EXOC5_CAEEL/46-659..........FL----------------------CQSIHPRGDGGEILADCLQLCRTQQPRISAIF....PSPHT-VMQK
Q6FMF7_CANGA/102-810.VRDKLMD..PN----------------------YHIIVYSQELVDMLKNIEEVIKNESKIVKRVF...EDSASY-VLQL
A0A0D1E7P5_USTMA/134-1026QIWTHMAD..PD----------------------HAPPKSEPSLTALFNEIRQTVEIEAQIISAVF....PNPLV-VMQT
SEC10_SCHPO/101-799PIWLILPD..PT----------------------QKIPPLIQTLSSLFSELCSVIEGDCAVIKRVF....PNPEL-VLQT
Q5KJ89_CRYNJ/95-875DIWATIGN..PD----------------------EPPPTTEPGLEALCKSIRSTISQESQIMKAVF...YPNSSA-VMEG
Q5AS51_EMENI/111-841ESWEKLAD..PD----------------------AEPSGVEPSLQSLVDEVRVVVQEESAIIRRAF....PNYEQ-VLGK
Q6CQC0_KLULA/109-807VFKAELMN..PD----------------------SHILKYDEKVVEYIQSVFNAIENESKVVATVF...ENKAPN-VMHL
C4YGD5_CANAW/103-782QEWALLAD..SR----------------------RSDFKIDE..QATFDTLKFEIKSRARISKKVF....ADPTP-VIKI

PF10191

Q7QA49_ANOGA/2-731EQWSSAIEGSES..........................GGSDVLKEFYDHLVELLKSHLRWSCQCF----GE.AT.DCVL
Q29C94_DROPS/2-737QQWKQTLELQGTET.....................QPQQQQQFLTLYYDQLLEHCQRQVKWCSNLF----SEEST.QPFL
Q172R1_AEDAE/2-704EKWSKIAEAEDS.........................YDMNSVLSEFNNVILEFLQNQQKWCKQVF----QSHLE..PLE
COG7_RAT/2-767ATWQELCQRD...........................LPLDRQLTGLYHALLGAWHTQTQWATQVF----KNPYE.VVTV
Q5FW35_XENTR/2-765TVWQELCQSD...........................MPLDRQLTEFYDTLLSAWHTQLQWVSQVF----KKPQE.VVTV
Q655R9_ORYSJ/5-868KLWEDFDLKQRAKRVEMEK..........YGGESINSLSFASWLPNFYDETLLYLEQEWKWCLTAF----PEEYKSLVPK
Q9FGN0_ARATH/4-832QLWEDFDTKQRANKLANERSESQRLSSGDEFQSTSSQTSFASWLTSFYDELLLYLEQEWKWCMVAF----PDDYMTLVPK

PF08318

E9EW04_METRA/274-613----------------------------------------ANALTRLFEHIAQIVESHGGLVERHY--------------
B6JXE3_SCHJY/165-484----------------------------------------SQAFAGLLEHVSTIINNHLPLVHRYY--------------
COG4_DROME/166-496----------------------------------------ADRLTAILENFARVVEVNQPIIEAFY--------------
M3D3E3_SPHMS/178-512----------------------------------------AHALTKLFEHIAQIVEGHQPLVERHY--------------
C4QWJ7_PICPG/179-518----------------------------------------AFLILKLFETISNILIQHSNVIKKHY--------------
B8LT52_TALSN/189-530----------------------------------------ASALTKLFEHIAQIIDGHGALVERHY--------------
S3CMB0_GLAL2/185-536----------------------------------------ANALTRLFEHIAQIVENHGQLVERHY--------------
COG4_SCHPO/163-481----------------------------------------AQAFTGLVEHVASIIRAHTPLVQKYY--------------
L8FSC8_PSED2/189-538----------------------------------------ANALTKLFEHIAQIVDGHGGLVERHY--------------
F0XR72_GROCL/199-557----------------------------------------PNALAKLFAHISQIVEAHGALVERHY--------------
V8NZE8_OPHHA/148-457----------------------------------------ADTLTLLFEGIARIVETHQPIVETYY--------------
F6TNZ6_XENTR/114-423----------------------------------------ADTLTLLFEGIARIVETHQPILETYY--------------
G8BDV4_CANPC/186-525----------------------------------------DTVAMQLFENVSMMLSQHGPLIKRYY--------------
C5WWS3_SORBI/192-503----------------------------------------VGCLTRLFKDIVLAVEENDAVLRELR--------------
A8X3I7_CAEBR/217-546----------------------------------------ADTLFMFFEGVAEIIESNLPVLEHSY--------------
U1HW21_ENDPU/187-524----------------------------------------ANALTKLFEHIAQIIDGHGSLIERHY--------------
J3NYL1_GAGT3/212-567----------------------------------------AQALTQLFEHIARIVDGHGALVERHY--------------
D5GK94_TUBMM/197-545----------------------------------------ANAVTRLFEHIANIVEQHGKLIERHY--------------
F6I2Y2_VITVI/183-485----------------------------------------VGCLTNLFKDIVLAVQENSEILRSLC--------------
T1KVK7_TETUR/162-476----------------------------------------IGQLTNLFESIAKMIDVHTPLFETYY--------------
G8BYJ4_TETPH/194-538----------------------------------------SQVLLHLFKLVSTVINEHSKVITVSY--------------
Q5TNE6_ANOGA/167-491----------------------------------------ADTLTILLENIARVIEVNQAIIENCY--------------
J4GWL1_FIBRA/183-513----------------------------------------VTALTALFESIAMIVDQHQPIVDKYY--------------
H2VA38_TAKRU/70-376----------------------------------------ADTLTLLLEGIARVIETHQPIVETYY--------------
A3LT54_PICST/195-541----------------------------------------STITIQLFESISMMLSQHGPLIKRYY--------------
B7QAG5_IXOSC/93-401----------------------------------------ADTVTLLFEGIARTVEIHQPLVETYY--------------
C5LP43_PERM5/114-451----------------------------------------VNTLTDVFLAVADIIQDHQRNIEEQF--------------
G3AM87_SPAPN/194-515----------------------------------------AEVTIQLFESISMMLSQHGPLIKRYY--------------
R8BYD5_TOGMI/1157-1500----------------------------------------ANALTKLFEHIAQIVEGHGGLVERHY--------------
A5DUI4_LODEL/191-536----------------------------------------STVTMQLFENVSMMLSQHGPLIKRHY--------------
F4NT70_BATDJ/197-515----------------------------------------VDLLTKLFEAIATMIDRQIDLVETYY--------------
C5GF37_AJEDR/230-568----------------------------------------ANALTKLFEHIAQIVDGHGALVERHY--------------
B2AA74_PODAN/219-562----------------------------------------ANALTRLFEHIAHIVDGHGALVEKHY--------------
N1JE83_BLUG1/191-526----------------------------------------ALVLTRLFEHIAQIIEGHGSLVEIHY--------------
W4ZDW5_STRPU/172-484----------------------------------------ADALTNLFEDVGKIIEVHQPLVETYY--------------
G0W4A1_NAUDC/213-564----------------------------------------SNALLHLFKIVSTIINDHSKIISASY--------------
Q4DDH2_TRYCC/242-662----------------------------------------LGLVSTVLDAVVAAFENEEEFIRETF--------------
Q16TS8_AEDAE/167-489----------------------------------------SDTLTVLLENIARVVEVNQAIIENCY--------------
E9FQQ8_DAPPU/154-462----------------------------------------ADTLTVLLESVARIVEIHQPLVETYY--------------
C5M6Q7_CANTT/193-537----------------------------------------ATIIMQLFENISMMLSQHGPLIKRYY--------------
V5GSU0_PSEBG/199-579----------------------------------------ALLLTSLFEHLASLIDMHQPVVDRHY--------------
X6MJK6_RETFI/5-348----------------------------------------VSVLEGLVDALFTVINDNVNNLKQMF--------------
M2R7X1_CERS8/181-514----------------------------------------IAALTALFESIAKIVDQHQPVVEKYY--------------
A0A068Y5W7_ECHMU/114-419----------------------------------------VDLMTYLLELVAQAIQTNESVIHDSY--------------
D6WJA3_TRICA/162-474----------------------------------------ADTLTLLFEGLARVVDTHQPLIETYY--------------
G8Y9D0_PICSO/191-527----------------------------------------SAMSRKLFENVSTMLVQHIPLIRKYY--------------
Q57XU9_TRYB2/282-625----------------------------------------LALVSAGLDLVVATFENEEEFVLETF--------------
G2Y0X2_BOTF4/187-528----------------------------------------AQALTRLFEHIAQIVEGHGGLVERHY--------------
E0VZ92_PEDHC/157-456----------------------------------------ADTITLLLEGTARVIETHQPLVDTYY--------------
B0CT70_LACBS/161-472----------------------------------------ITALTALFESIAMIVDQHQPVVEKYY--------------
Q59T37_CANAL/195-551----------------------------------------SNVVMQLFENISMMLSQHGPLIKKYY--------------
E9QGT9_DANRE/180-489----------------------------------------ADTLTLLLEGIARIVETHQPIVETYY--------------
K1WLQ9_TRIAC/267-644----------------------------------------LAQLTSLLEAIAHIVDQHQPVIAKYY--------------
F9XE54_ZYMTI/175-509----------------------------------------AGALTKLFEHIAQIVDGHEPLVERHY--------------
C5DG77_LACTC/179-498----------------------------------------AQALLHLFKIVSTIINEHSKIIAKYY--------------
K5Y4H4_AGABU/183-506----------------------------------------ITALTSLFESIALIVDQHQPVVEKYY--------------
I1JS41_SOYBN/186-485----------------------------------------VGCLTNLFKDIVLAIEENSEILSGLC--------------
K0KE72_WICCF/171-504----------------------------------------PAALMRLLEIISSMLNQHSTIIAKYY--------------
K4CGD4_SOLLC/174-477----------------------------------------VSCLTNLFKDIVLAIEENDETLRSLC--------------
H2XLC7_CIOIN/111-421----------------------------------------ADVLTLLFEGIARTVEKQQPLVETYY--------------
S9VWR1_SCHCR/164-482----------------------------------------SQAFTGLVEHVASIVRAHTPLVLRYY--------------
U9TBS3_RHIID/182-496----------------------------------------GNVLTKLFENIAHIIDQHQSAVETHY--------------
E3Q612_COLGM/198-538----------------------------------------ANALTRLFDHIARIVEGHGGLVERHY--------------
Q6BTT0_DEBHA/227-568----------------------------------------LTISMKLFENISMMLSQHGPLIKKYY--------------
K2S8E4_MACPH/175-516----------------------------------------ANALTKLFEHIAQIVGGHEPVVERHY--------------
G8JQJ6_ERECY/189-517----------------------------------------SQALLHLFKTVSTIINDHSKIITKSY--------------
A0A0C4EWA8_PUCT1/187-568----------------------------------------VIQLTSIVEQLALIIDQHQGVVDKYY--------------
A9SCH4_PHYPA/154-467----------------------------------------VGILNNIFKDIAFAVEENEDLLFDLA--------------
Q0UYP7_PHANO/174-513----------------------------------------GNTITKLFEHIAQIVDGHEPLVEQHY--------------
M9MH30_PSEA3/203-582----------------------------------------ALLLTSLFEHLAMLIDMHQPVVDRHY--------------
I2H5R5_TETBL/205-583----------------------------------------AKVILHLFKIVSTVINEHSKIISTSY--------------
A7TT52_VANPO/190-542----------------------------------------SQVLLHLFKIVSTIINEHSKIIAGSY--------------
T1J554_STRMM/179-485----------------------------------------ADTVTLLFEGIARVIEIHQPLVETYY--------------
A0A0D2XGD5_FUSO4/82-414----------------------------------------ANNLTRLFEHIVQIINSHSGLVERHY--------------
A7RPW3_NEMVE/163-477----------------------------------------ANTLTMLFEGIARMVEEHQPFVETYY--------------
B4KHQ6_DROMO/161-491----------------------------------------ADRLTSILENFARVVEVNQPIIEAFY--------------
A8NGP6_COPC7/165-479----------------------------------------VTALTSLFESIAMIVDQHQPVVEKYY--------------
D8QT59_SELML/156-463----------------------------------------VAALNNIFKDIAEAIEENEELLKSLN--------------
S8C8S4_DACHA/216-562----------------------------------------AGSLSQLFEYMAGLVERHTPLVEKHY--------------
N1PMN4_DOTSN/176-511----------------------------------------ANALTKLFEHIAQIVGGHEPLVERHY--------------
V5G2M7_BYSSN/194-532----------------------------------------AGALTKLFEHIAQIVEGHGPLVERHY--------------
F8Q674_SERL3/166-485----------------------------------------VAALTALFESIAMIVDQHQSVVEKYY--------------
M3AA99_PSEFD/191-526----------------------------------------ATALTKLFEHIAQIVDGHEPLVERHY--------------
G4MR42_MAGO7/219-567----------------------------------------AAALTKLFEHVARIIEGHGGLVERHY--------------
J3KI74_COCIM/186-524----------------------------------------ANALTKLFEHIAQIVEGHGGLVERHY--------------
G4U2Q1_PIRID/161-490----------------------------------------IAMVTALFESIAVIVDQHQPIVDKYY--------------
R7YUM9_CONA1/175-511----------------------------------------ANALTKLFEHIAQIVDSHQPLVEQHY--------------
G8ZSF3_TORDC/186-519----------------------------------------AQALLHLFKIVSTIINDHSKVIASCY--------------
G0SXA1_RHOG2/160-497----------------------------------------SALLTTLFEAIALILSQHQPVVEKYY--------------
S3C4S1_OPHP1/236-610----------------------------------------VHSLSKLFAHISQIVEGHGAIVERHY--------------
D8M8U8_BLAHO/154-504----------------------------------------GNLLGGLYQKAVELVDSVEDSFQNCF--------------
C3YFK8_BRAFL/171-477----------------------------------------ADTLTHLFEGIARLVETHQPLVETYY--------------
Q758T0_ASHGO/188-512----------------------------------------SKALLHLFKTVSTIINSHSQVISGCY--------------
M5C4C1_THACB/161-521----------------------------------------TAALTALYESVAGLIDQHQPIVEKYY--------------
U4L2E9_PYROM/293-612----------------------------------------AGAVTGLFEHIATIVEQHGKLVELHY--------------
J4KLZ9_BEAB2/1246-1586----------------------------------------ANALTKLFEHIAQIVEGHGGLVERHY--------------
G7E1B8_MIXOS/165-515----------------------------------------SQILTPLFEQIALIVSQHQPVVEKYY--------------
H2KS09_CLOSI/401-723----------------------------------------LDLLTQIVEFIAETVRDNQVYVETYF--------------
W1NDY2_AMBTC/181-483----------------------------------------VNCLTSLFKDIVLAVEENDAVLRELC--------------
COG4_ARATH/176-479----------------------------------------VGCLTNLFKDIVMAIEENDEILRGLC--------------
H6C9G5_EXODN/179-515----------------------------------------ANALARLFEHIAQIIEGHGGLVERHY--------------
H3AVV6_LATCH/187-496----------------------------------------ADTLTLLFEGIARVVETHQPIVETYY--------------
K5V063_PHACS/174-511----------------------------------------ITALTALYESVAMIVDQHQPVVEKYY--------------
B6HSP5_PENCW/191-531----------------------------------------ANALTRLFEHIAQIIDGHGGLVEHHY--------------
G3BC56_CANTC/190-528----------------------------------------SRSSMQLFENISMMLAQHAPLINRYY--------------
A0A068X7X6_HYMMI/106-417----------------------------------------VDLMTQLLELVAQAIQANETVIQQSY--------------
M7NUP8_PNEMU/161-484----------------------------------------ALIMQDMFEYVANIMNHHLPVIKKHY--------------
U7PW27_SPOS1/225-627----------------------------------------ANALAKLFTHISQIVEGHGALVERHY--------------
E6ZNH9_SPORE/195-575----------------------------------------ALLLTSLFEHLAMLIDMHQPVVDRHY--------------
G0V8A6_NAUCC/189-534----------------------------------------SQALLHLFKIVSTIINDHSKIIATCY--------------
E7QLX6_YEASZ/190-525----------------------------------------SQVLLHLFKIVSTIINDHSKVIATCY--------------
C5DUL4_ZYGRC/172-510----------------------------------------AQALLHLCKIVSTVINNHSQIIAACY--------------
E4UP45_ARTGP/209-548----------------------------------------ANALTRLFEHIAQIVDAHGALVERHY--------------
K1R201_CRAGI/174-481----------------------------------------AETATQLFESIANIIEVRQPLIETYF--------------
Q6FTK7_CANGA/185-531----------------------------------------AQVLLHLFKIVSTIINDHSKIIAASY--------------
D2V3G5_NAEGR/119-422----------------------------------------IDIITQILDIIVSYIEDCEDFVTSNF--------------
G5C1P9_HETGA/267-575----------------------------------------ADTLTLLFEGIARIVETHQPIVETYY--------------
L8WI47_THACA/987-1357----------------------------------------RHILT......AGLIDQHQPIVEKYY--------------
V2X3Q2_MONRO/169-474----------------------------------------ITTLTALFESVAMIVDQHQPVVEKYY--------------
A7UW80_NEUCR/259-612----------------------------------------ANALNLLFGHITQIVDGHGGLVERHY--------------
M2NB58_BAUCO/172-509----------------------------------------ANALTKLFEHIAQIVDGHEPLVERHY--------------
C7ZFK3_NECH7/171-496----------------------------------------ANCLTKLFEHIAQIVNSHSGLVRQHY--------------
K1WSR6_MARBU/231-588----------------------------------------ANALTRLFEHIAQIVDGHGGLVERHY--------------
S0E9C5_GIBF5/167-499----------------------------------------ANNLARLLEHIVQITNSHSGLVERHY--------------
C4XYR0_CLAL4/197-532----------------------------------------ASITKNLFESVSMMLSQHTPLINKHY--------------
S2JH92_MUCC1/194-506----------------------------------------ADALTRLFENIAVIIDQHQPLVEQHY--------------
E9IBA8_SOLIN/158-464----------------------------------------SDTMTLLFEGIARIIEVHQPIIETYY--------------
A0A016PRI6_GIBZA/187-527----------------------------------------ANALTKLFEHIAQIVEGHGGLVERHY--------------
G0R6U4_HYPJQ/191-531----------------------------------------ANSLTRLFQHIAQIVEGHGGLVERHY--------------
I2FV21_USTH4/206-592----------------------------------------ALLLTSLFEHLAMLIDMHQPVVDRHY--------------
A8NFV8_BRUMA/216-544----------------------------------------ADALTMLFEGIAREIQVYEPLIGSSY--------------
G0SCB4_CHATD/176-523----------------------------------------ANALTKLFDHIARIVEAHGGLVERHY--------------
W1QCQ6_OGAPD/210-555----------------------------------------AQVLFQLYQTIADIVHQHSRIITKYY--------------
Q5AW68_EMENI/201-531----------------------------------------ANTLTKLFEHIAQIIDGHGGLVERHY--------------

PF07393

Q750R9_ASHGO/111-822FLKQLMAKRVEPKATLFLNTSMT-----------I...............................SNLAY---------
Q6BHS9_DEBHA/103-810FIQRIYAQIIQNKISTLLQYSLS-----------V...............................STLAH---------
SEC10_ARATH/139-817LVQRVLEQRVTGILDKILAKPSL-----------MSPPP.......................VQEGGLLLY---------
Q2HG63_CHAGB/108-854FIQRVFQQSIQQRLEMVLDKATT-----------I...............................SSLAF---------
Q7PQN8_ANOGA/88-705FILNIYQLKINQFVQTKLDDRK.-----------................................DENKY---------
A1D556_NEOFI/126-876FVEKVAQDVLYPFLTAIFDELHR-----------S...............................NLESY---------
Q2URB8_ASPOR/132-879FIAKVGQDVLYPFLTAIFDELHR-----------I...............................NKESY---------
E7KRR3_YEASL/120-862FIQRVFAQKIEPRFEVLLRNSLS-----------I...............................SNLAY---------
Q4RLZ1_TETNG/80-698LIQNIFENKLQSHVKDRLDGTRH-----------S...............................DVEQY---------
Q55N90_CRYNB/170-1008FCDRLSNEVIGEYIHPLLSQARA-----------V...............................SQDLF---------
Q0IP77_ORYSJ/117-800LVQRVLEQRVTAILDKLLIKPSL-----------ANLPP.......................IEEGGLLHY---------
A2EZD8_TRIVA/69-728VFNTVFDAFISRVLNHYLETPS.-----------................................KQNRF---------
Q2GXU3_CHAGB/166-960FVDKVREDVVMEYATPLFDETHE-----------R...............................SIPSY---------
Q2TVY5_ASPOR/116-891FLQRVFQQSIQQRLEMVLEKANS-----------I...............................SSLAF---------
Q5BGH2_EMENI/123-870FVEKVGRDVLYPFLTAIFDELHR-----------S...............................NKEEY---------
Q6CDC8_YARLI/101-777FLQRVFAQRIQQRIELFLSSAEA-----------M...............................STLAY---------
EXOC5_DROME/89-705FILNIYQLKLHQYAMTKLEDKK.-----------................................DEEKY---------
A1DAY7_NEOFI/117-893FLQRVFQQSIQQRLEMVLEKANG-----------I...............................SSLAF---------
EXOC5_CAEEL/46-659LVLNIFTGRMKETITARLRECKD-----------T..............................DDQEHY---------
Q6FMF7_CANGA/102-810FIQRTFAQKIEPQLEFLLNSALS-----------F...............................SHLAY---------
A0A0D1E7P5_USTMA/134-1026FLQRVFAQSVQGFVEVIMDKAAD-----------INAPSFVGAGGNIDTKTAALELNPPSNSQPTTSHLAF---------
SEC10_SCHPO/101-799FFQRIFGQSIQNRLEEVMEIAKG-----------K...............................SNLAY---------
Q5KJ89_CRYNJ/95-875FLQRIFAQVIQQHLEGLVQRASS-----------I...............................STLAI---------
Q5AS51_EMENI/111-841FLQRVFQQSIQQRLEMVLEKANS-----------V...............................SSLAF---------
Q6CQC0_KLULA/109-807FIEKVFELKLRPLVVFLLNSALS-----------L...............................SSLAY---------
C4YGD5_CANAW/103-782FIQRMYAQIIRNKVTSLLQKSLS-----------V...............................SPLAH---------

PF10191

Q7QA49_ANOGA/2-731AVADALENLDPTRESVVRSALKR-----------A-------------------------------TDK...........
Q29C94_DROPS/2-737VIAELLPALQPTRDAHILQLLKT-----------S-------------------------------NER...........
Q172R1_AEDAE/2-704TVVDSLTNLQSLKQAFVMNHLKK-----------S-------------------------------VGK...........
COG7_RAT/2-767LLIQTLGALVPSLPMCLSEAVER-----------A-------------------------------GPELE.........
Q5FW35_XENTR/2-765LMIQTLAAMVPSIPVCLSTAMER-----------A-------------------------------SPEDK.........
Q655R9_ORYSJ/5-868VLVETMSELNSSFVSRVNLATGD-----------A-------------------------------VPETRSVAKGILDV
Q9FGN0_ARATH/4-832LLVETMGVLGASFVSRLNLATGD-----------A-------------------------------VPETKALAKGVMDL

PF08318

E9EW04_METRA/274-613--G..AGKMVR.VIERLQMEADV...........Q---------------------------------------------
B6JXE3_SCHJY/165-484--K..AENAID.VIGKLQSDCDH...........Q---------------------------------------------
COG4_DROME/166-496--GQASSSLID.MVSILQHECDT...........E---------------------------------------------
M3D3E3_SPHMS/178-512--G..PGSMTK.VIQRIQVEADR...........Q---------------------------------------------
C4QWJ7_PICPG/179-518--E..PRYILD.VMQKIQNECDL...........Q---------------------------------------------
B8LT52_TALSN/189-530--G..SGKMTR.VIERLQVEADV...........Q---------------------------------------------
S3CMB0_GLAL2/185-536--G..VGKMVK.VIERLQVEADV...........Q---------------------------------------------
COG4_SCHPO/163-481--K..AKNTIT.VIEKLQGDCDR...........Q---------------------------------------------
L8FSC8_PSED2/189-538--G..DGRMVR.VVERLQQEADV...........Q---------------------------------------------
F0XR72_GROCL/199-557--G..PGQMGR.VVARLQKEADV...........Q---------------------------------------------
V8NZE8_OPHHA/148-457--G..PGRLYA.LIKHLQAECDQ...........Q---------------------------------------------
F6TNZ6_XENTR/114-423--G..PGRLYM.LIKHLQAECDR...........Q---------------------------------------------
G8BDV4_CANPC/186-525--ASTYSDAMTYVVNKLQREVDL...........Q---------------------------------------------
C5WWS3_SORBI/192-503--G..DDGVAY.AIIELQEECDS...........R---------------------------------------------
A8X3I7_CAEBR/217-546--G..LEKLLD.FMFILQARIDE...........F---------------------------------------------
U1HW21_ENDPU/187-524--G..SGKTIR.VIERLQVEADL...........Q---------------------------------------------
J3NYL1_GAGT3/212-567--G..DGKMVR.VIERLQVEVDV...........Q---------------------------------------------
D5GK94_TUBMM/197-545--G..EGRMGK.VIERLQVEADT...........Q---------------------------------------------
F6I2Y2_VITVI/183-485--G..EDGIVY.AICELQEECDS...........R---------------------------------------------
T1KVK7_TETUR/162-476--G..PGNIIY.CVEVLQRECDR...........Q---------------------------------------------
G8BYJ4_TETPH/194-538--N..LTYMTN.VMEKVEKEAEL...........Q---------------------------------------------
Q5TNE6_ANOGA/167-491--G..PGRLVQ.ICRILQRECDD...........E---------------------------------------------
J4GWL1_FIBRA/183-513--G..PGKMTP.VLERLLLESDR...........V---------------------------------------------
H2VA38_TAKRU/70-376--G..PGHLYT.LITHLQQECDQ...........Q---------------------------------------------
A3LT54_PICST/195-541--SSTYPNALNYVISRIQNEIDT...........Q---------------------------------------------
B7QAG5_IXOSC/93-401--G..HGRLHT.MVEMLQKECDC...........Q---------------------------------------------
C5LP43_PERM5/114-451--G..PINFIM.VLRGLQSEVDI...........Q---------------------------------------------
G3AM87_SPAPN/194-515--S.EYPNALTYVITKIQREIDV...........Q---------------------------------------------
R8BYD5_TOGMI/1157-1500--G..TGKLVK.VIERLQMEADV...........Q---------------------------------------------
A5DUI4_LODEL/191-536--SLTYPDALPFVIRKIQKEIDL...........Q---------------------------------------------
F4NT70_BATDJ/197-515--G..PGRMLP.VMVRLQREADI...........Q---------------------------------------------
C5GF37_AJEDR/230-568--G..PGKMMR.VVERLQVEADV...........Q---------------------------------------------
B2AA74_PODAN/219-562--G..TGKMVK.VIERLQMEADV...........Q---------------------------------------------
N1JE83_BLUG1/191-526--G..KGMMVK.VIEILQEEANV...........Q---------------------------------------------
W4ZDW5_STRPU/172-484--G..PGKLLT.LIESLQKECDR...........Q---------------------------------------------
G0W4A1_NAUDC/213-564--G..KNYMIH.VMENVEKEADL...........Q---------------------------------------------
Q4DDH2_TRYCC/242-662--G..DAGLLK.LLTELHCKSTS...........Q---------------------------------------------
Q16TS8_AEDAE/167-489--G..AGRLVQ.VVAILQRECDD...........E---------------------------------------------
E9FQQ8_DAPPU/154-462--G..PGRLLQ.VVEHLQPECDK...........Q---------------------------------------------
C5M6Q7_CANTT/193-537--SETYPSALSYVISKIQREVDL...........Q---------------------------------------------
V5GSU0_PSEBG/199-579--G..LGNFSHGVMPGLQDECDR...........L---------------------------------------------
X6MJK6_RETFI/5-348--G..EGSELL.LAQKLYGEADR...........E---------------------------------------------
M2R7X1_CERS8/181-514--G..PGKMAR.VLERLLQECDR...........V---------------------------------------------
A0A068Y5W7_ECHMU/114-419--G..GNSLLN.FICMIQTQCDH...........H---------------------------------------------
D6WJA3_TRICA/162-474--G..PGRLLC.AVSILQKECDI...........Q---------------------------------------------
G8Y9D0_PICSO/191-527--SPTYPKAVHYVLARIQNELDS...........Q---------------------------------------------
Q57XU9_TRYB2/282-625--G..DAGLLL.LLTELHSRSTS...........Q---------------------------------------------
G2Y0X2_BOTF4/187-528--G..AGKMVR.VIERLQAEADV...........Q---------------------------------------------
E0VZ92_PEDHC/157-456--G..QDKMIT.FFKYVQQECDN...........Q---------------------------------------------
B0CT70_LACBS/161-472--G..SGKMEI.VVQRLLEECDR...........V---------------------------------------------
Q59T37_CANAL/195-551--SATYPSALSYVISKIQREIDL...........Q---------------------------------------------
E9QGT9_DANRE/180-489--G..PGRLHT.LLAHLQKECDK...........Q---------------------------------------------
K1WLQ9_TRIAC/267-644--G..RGRMGK.VVARLVRESDR...........V---------------------------------------------
F9XE54_ZYMTI/175-509--G..PGSMVK.VIERIQVEADA...........Q---------------------------------------------
C5DG77_LACTC/179-498--G..KQHMVH.IMAKVQREADM...........Q---------------------------------------------
K5Y4H4_AGABU/183-506--G..PGKMSS.VVIRLLEECDR...........V---------------------------------------------
I1JS41_SOYBN/186-485--G..EDGIVY.AICELQEECDS...........R---------------------------------------------
K0KE72_WICCF/171-504--G..ISNMTG.IIERVEREADS...........Q---------------------------------------------
K4CGD4_SOLLC/174-477--G..EDGIVY.AICELQEECDS...........R---------------------------------------------
H2XLC7_CIOIN/111-421--G..PGKLFV.LIKNVQLECDK...........Q---------------------------------------------
S9VWR1_SCHCR/164-482--K..AKNTIT.VIENLQYDCDR...........Q---------------------------------------------
U9TBS3_RHIID/182-496--G..PGKMIR.VIERLQEECDK...........Q---------------------------------------------
E3Q612_COLGM/198-538--G..SGKMVR.VIERLQQEADV...........Q---------------------------------------------
Q6BTT0_DEBHA/227-568--GSTYDNAISYVVTKIQHEIDS...........Q---------------------------------------------
K2S8E4_MACPH/175-516--G..SGMMGK.VIERLQMEADV...........Q---------------------------------------------
G8JQJ6_ERECY/189-517--G..AQNMVY.VMDKIQKEADL...........Q---------------------------------------------
A0A0C4EWA8_PUCT1/187-568--G..PRSMVT.VALKLNKELDR...........L---------------------------------------------
A9SCH4_PHYPA/154-467--G..EEGVAL.ALVELQEECDA...........R---------------------------------------------
Q0UYP7_PHANO/174-513--G..PGMMAK.VIERLQIEADV...........Q---------------------------------------------
M9MH30_PSEA3/203-582--G..AGNFSHGVMPGLQDECDR...........L---------------------------------------------
I2H5R5_TETBL/205-583--G..NIHMIH.VMEKIEKETDL...........Q---------------------------------------------
A7TT52_VANPO/190-542--G..KHHMSH.IMEKVQKEADL...........Q---------------------------------------------
T1J554_STRMM/179-485--G..HGQLLT.VVEMLQKECDR...........Q---------------------------------------------
A0A0D2XGD5_FUSO4/82-414--G..ADKVVK.VIERLQKEAGI...........Q---------------------------------------------
A7RPW3_NEMVE/163-477--G..PGQMPT.LLQILQVECDK...........Q---------------------------------------------
B4KHQ6_DROMO/161-491--GQESTSLVN.MMTILQRECDL...........E---------------------------------------------
A8NGP6_COPC7/165-479--G..QGKMRL.VVQRLLDECDR...........V---------------------------------------------
D8QT59_SELML/156-463--G..EDGLVY.AIRELQEECDS...........R---------------------------------------------
S8C8S4_DACHA/216-562--G..VGRMVK.VIDKLQIEVDT...........Q---------------------------------------------
N1PMN4_DOTSN/176-511--G..PGSMIK.VIERIQVEADA...........Q---------------------------------------------
V5G2M7_BYSSN/194-532--G..AGKMAR.VIERLQVEADV...........Q---------------------------------------------
F8Q674_SERL3/166-485--G..PGRMLV.VLKSLLGECDC...........V---------------------------------------------
M3AA99_PSEFD/191-526--G..QGSMTK.VIERIQVEADS...........Q---------------------------------------------
G4MR42_MAGO7/219-567--G..AGKMVR.VIERLQVEVDV...........Q---------------------------------------------
J3KI74_COCIM/186-524--G..SGKMTR.VIERLQVEADV...........Q---------------------------------------------
G4U2Q1_PIRID/161-490--G..QGKMLL.VAERLMNECDR...........V---------------------------------------------
R7YUM9_CONA1/175-511--G..NGTMTR.VIERLQNEADV...........Q---------------------------------------------
G8ZSF3_TORDC/186-519--G..TSYMIH.VMEKVEKEADL...........Q---------------------------------------------
G0SXA1_RHOG2/160-497--G..EGKMMS.VAGSLMTETDR...........L---------------------------------------------
S3C4S1_OPHP1/236-610--G..GGQMVK.VIKRLQKEADV...........Q---------------------------------------------
D8M8U8_BLAHO/154-504--VNEQFAYCY.LLRCVFIHCDTQVGFAFLSLFFQ---------------------------------------------
C3YFK8_BRAFL/171-477--G..PGRMLT.LMTELQKECDR...........Q---------------------------------------------
Q758T0_ASHGO/188-512--G..AKYMVH.IMDKVQKEADL...........Q---------------------------------------------
M5C4C1_THACB/161-521--G..SGNMHT.VVARLLRECDR...........V---------------------------------------------
U4L2E9_PYROM/293-612--G..EGKMVK.VVERLQVEADM...........Q---------------------------------------------
J4KLZ9_BEAB2/1246-1586--G..AGKMVR.VIERLQMEADV...........Q---------------------------------------------
G7E1B8_MIXOS/165-515--G..DGKMID.VVARLQTECDL...........Q---------------------------------------------
H2KS09_CLOSI/401-723--G..PGNLLA.IATPIQGVCDE...........F---------------------------------------------
W1NDY2_AMBTC/181-483--M..EDGVVY.AICELQEECDL...........W---------------------------------------------
COG4_ARATH/176-479--G..EDGVAY.AICELQEECDL...........R---------------------------------------------
H6C9G5_EXODN/179-515--G..PGKMAR.VIERLQVEADL...........Q---------------------------------------------
H3AVV6_LATCH/187-496--G..PGRLYT.LIKHLQVECDR...........Q---------------------------------------------
K5V063_PHACS/174-511--G..LGKMTS.VLKRLLQESDR...........V---------------------------------------------
B6HSP5_PENCW/191-531--G..PRKMGR.VIERLQVEADV...........Q---------------------------------------------
G3BC56_CANTC/190-528--ASTYSNALPYVINKIQPEIDS...........Q---------------------------------------------
A0A068X7X6_HYMMI/106-417--S..PDSLLK.FIQIVQGQCDH...........H---------------------------------------------
M7NUP8_PNEMU/161-484--N..CEDTLF.VIEKIHEKCIE...........Q---------------------------------------------
U7PW27_SPOS1/225-627--G..GGQMIK.VISRLQKEADV...........Q---------------------------------------------
E6ZNH9_SPORE/195-575--G..VGNFGHGVMPGLQEECDR...........L---------------------------------------------
G0V8A6_NAUCC/189-534--G..KKFMIH.VMENVEKEADL...........Q---------------------------------------------
E7QLX6_YEASZ/190-525--G..KKHMVH.VMEKVEKEADL...........Q---------------------------------------------
C5DUL4_ZYGRC/172-510--G..LHHMVH.VMEKVEKEVDL...........Q---------------------------------------------
E4UP45_ARTGP/209-548--G..PGKMGR.VVERLQVEADV...........Q---------------------------------------------
K1R201_CRAGI/174-481--G..SGKLFS.LMKILQKECDR...........Q---------------------------------------------
Q6FTK7_CANGA/185-531--G..VSHMLH.VMGKVQKEADL...........E---------------------------------------------
D2V3G5_NAEGR/119-422--G..GEKCTIYLINSLQHVCDK...........M---------------------------------------------
G5C1P9_HETGA/267-575--G..LGRLYT.LIKYLQVECDR...........Q---------------------------------------------
L8WI47_THACA/987-1357--G..LGNMHT.VVARLLRECDR...........V---------------------------------------------
V2X3Q2_MONRO/169-474--G..TGKMKQ.VVERLLQECDR...........V---------------------------------------------
A7UW80_NEUCR/259-612--G..GGKMIK.VIERLQGEADV...........Q---------------------------------------------
M2NB58_BAUCO/172-509--G..AGSMTK.VIERIQVEADV...........Q---------------------------------------------
C7ZFK3_NECH7/171-496--G..ASQVVK.VIEKLQAEADI...........Q---------------------------------------------
K1WSR6_MARBU/231-588--G..QGKMVK.VIERLQVEADV...........Q---------------------------------------------
S0E9C5_GIBF5/167-499--G..ADKVVK.VIERLQKEADI...........Q---------------------------------------------
C4XYR0_CLAL4/197-532--GDSYPDAVVFVVNKIQRVIDS...........Q---------------------------------------------
S2JH92_MUCC1/194-506--G..KGKMLR.VIQRLQEESDV...........Q---------------------------------------------
E9IBA8_SOLIN/158-464--G..PGRLLM.TISILQKECDR...........Q---------------------------------------------
A0A016PRI6_GIBZA/187-527--G..TGKMVR.VIERLQMEADV...........Q---------------------------------------------
G0R6U4_HYPJQ/191-531--G..AGKMVR.VIERIQMEADV...........Q---------------------------------------------
I2FV21_USTH4/206-592--G..VGHFGHGVMPGLQEECDR...........L---------------------------------------------
A8NFV8_BRUMA/216-544--G..PDKLVS.LIEILQKECDK...........E---------------------------------------------
G0SCB4_CHATD/176-523--G..TGKMVK.VIERLQMECDV...........Q---------------------------------------------
W1QCQ6_OGAPD/210-555--G...KNVLPKVLSAIQTECDL...........Q---------------------------------------------
Q5AW68_EMENI/201-531--G..PRKMNR.VIERLQLEADV...........Q---------------------------------------------

PF07393

Q750R9_ASHGO/111-822---------------LRTLHSVYSLINQFIK-------------------DLSEF.FIEMNW..................
Q6BHS9_DEBHA/103-810---------------VRVLHSLYVLVGDFTK-------------------DVKEF.LTTNEL..................
SEC10_ARATH/139-817---------------LRMLAVAYERTQELAK-------------------DLRAV.........................
Q2HG63_CHAGB/108-854---------------LRSLHSSRAYISALVE-------------------DLKTH.GLTEHP..................
Q7PQN8_ANOGA/88-705---------------LKTLSELYSRTMKLSA-------------------ELQEFFKGS.....................
A1D556_NEOFI/126-876---------------LIAVSGTFAQSLNLSE-------------------ALLPIQNTTDT...................
Q2URB8_ASPOR/132-879---------------LTAVSSTFAQCMNLSD-------------------TLLPIQSSAVN...................
E7KRR3_YEASL/120-862---------------VRILHGLFTLFGKFTK-------------------SLIDY.FQLLEI..................
Q4RLZ1_TETNG/80-698---------------LKNLYDLYTRTTALAT-------------------KLTEFNLGSD....................
Q55N90_CRYNB/170-1008---------------LRAAAATFVQAWKLVD-------------------VAMEVLGDEQNV..................
Q0IP77_ORYSJ/117-800---------------LRVLAVAYDKTKELAK-------------------ELQSI.........................
A2EZD8_TRIVA/69-728---------------CDMFYKLHNETDEMLK-------------------SIWAL.........................
Q2GXU3_CHAGB/166-960---------------LRAVSGIFEQTLQFLR-------------------TLTPPKGADVD...................
Q2TVY5_ASPOR/116-891---------------LRSLQSSRSYIGALVE-------------------DLKAH.GLTEHP..................
Q5BGH2_EMENI/123-870---------------LVSVSSTFAQCMNLCD-------------------NLLPIQNSLDT...................
Q6CDC8_YARLI/101-777---------------VRSLHLAYNVVSSLVK-------------------KLKDF.FSSENL..................
EXOC5_DROME/89-705---------------LRTLYELYSRTLKLST-------------------DLQIYMSTI.....................
A1DAY7_NEOFI/117-893---------------LRSLQSSRSYISGLVD-------------------DLKAH.GLTEHP..................
EXOC5_CAEEL/46-659---------------LRDLAYLYSSTLKMCK-------------------ELEKLHISP.....................
Q6FMF7_CANGA/102-810---------------VRTLHSLYSLLGKFVK-------------------DLTDY.FQLLEV..................
A0A0D1E7P5_USTMA/134-1026---------------LRALHMARSSALSLVN-------------------DLKLYDYRGAGIIGPAYASAHTANGDGVVS
SEC10_SCHPO/101-799---------------LRTLQTVVSSLRKLVA-------------------DLKTI.LENRGF..................
Q5KJ89_CRYNJ/95-875---------------LRILHLTHSICSSLVE-------------------DLKTYDSTLTTPPASS..............
Q5AS51_EMENI/111-841---------------LRSLQSSRSCISTLVD-------------------ELKAH.GLTEHP..................
Q6CQC0_KLULA/109-807---------------VRSLQSYFSITNNSVK-------------------QLAEF.LSNLKM..................
C4YGD5_CANAW/103-782---------------VRVLHSLYTLVGDFTE-------------------QIKDY.LTTEEL..................

PF10191

Q7QA49_ANOGA/2-731...............FWTLTQFSKVNVSMGS-------------------LIEGWVRGGPQQDIR---------------
Q29C94_DROPS/2-737...............LELLGLFSQVNHSFVL-------------------HLNSLLEQSHITL..---------------
Q172R1_AEDAE/2-704...............FEYLALIAASDCQFTN-------------------ALEKILIELPAD...---------------
COG7_RAT/2-767...............LTRLLEFYDTTAHFAK-------------------GLEMALLPHLQD...---------------
Q5FW35_XENTR/2-765...............LSTLLELYNATGHFAK-------------------SMETAILPNMGE...---------------
Q655R9_ORYSJ/5-868LSGDLPKSTKLQNKHLGALIDLHNMTGTFAR-------------------NIQHLFSE.......---------------
Q9FGN0_ARATH/4-832LSGDLPKGINIQTKHLEALIELHNVTGSFAR-------------------NIQHLFAE.......---------------

PF08318

E9EW04_METRA/274-613---------------GGIIMDTWSDERGIDR...................MITDV-------------------------
B6JXE3_SCHJY/165-484---------------GTLIINTMLEERKTLQ...................LIAQI-------------------------
COG4_DROME/166-496---------------VKNLLMEFNKNRQIQY...................RSKQV-------------------------
M3D3E3_SPHMS/178-512---------------GGLVLDSWSEDRRVHR...................RLTEI-------------------------
C4QWJ7_PICPG/179-518---------------CGLIFDTFWDTQRLDR...................VVNLV-------------------------
B8LT52_TALSN/189-530---------------GGIIIDTWSDERNVDR...................KLTDI-------------------------
S3CMB0_GLAL2/185-536---------------GGIILDTWGDERSVDR...................RLTDV-------------------------
COG4_SCHPO/163-481---------------GSIIVNTMFDVRRIDN...................LVSSI-------------------------
L8FSC8_PSED2/189-538---------------GGILLDTWGDERGIER...................RLTDV-------------------------
F0XR72_GROCL/199-557---------------GGIIIDAWGDRCHVDR...................RLTDA-------------------------
V8NZE8_OPHHA/148-457---------------VEKVVEKFTQQRDYRR...................QFQHV-------------------------
F6TNZ6_XENTR/114-423---------------VEKVVDKFVQHRDYHR...................KFQQV-------------------------
G8BDV4_CANPC/186-525---------------IGVITDTFYDARRLDK...................LFQDI-------------------------
C5WWS3_SORBI/192-503---------------GTQILRRYADYRKLAR...................LASDI-------------------------
A8X3I7_CAEBR/217-546---------------FRRLIEEFDTRRRLSHL................NRQVADV-------------------------
U1HW21_ENDPU/187-524---------------GGIILDAWADERQVDR...................KLTDI-------------------------
J3NYL1_GAGT3/212-567---------------GGIVLDSWSDERAVDR...................KLTDV-------------------------
D5GK94_TUBMM/197-545---------------GGIIIDTFTDERSIGR...................KLTDI-------------------------
F6I2Y2_VITVI/183-485---------------GSSILKKYLDYRKLAR...................LTSEI-------------------------
T1KVK7_TETUR/162-476---------------TKKILEDFVAKKNLSG...................VVSSV-------------------------
G8BYJ4_TETPH/194-538---------------AGLVLDTFAESKKLTR...................TVKEI-------------------------
Q5TNE6_ANOGA/167-491---------------VTKCVQEFCRNRQTGR...................RIAQI-------------------------
J4GWL1_FIBRA/183-513---------------VKDLLEGWEEERAMKR...................KISDT-------------------------
H2VA38_TAKRU/70-376---------------ANKIVDKFIQQRGYHN...................KFQIV-------------------------
A3LT54_PICST/195-541---------------IGIVADTFYDVRRLDK...................YFQDI-------------------------
B7QAG5_IXOSC/93-401---------------VKKILEDFKKNKQFKK...................KAQQI-------------------------
C5LP43_PERM5/114-451---------------AIAVIKRLRESRSITT...................IMEHF-------------------------
G3AM87_SPAPN/194-515---------------IGIIADTFYDTRRLDK...................LFQDI-------------------------
R8BYD5_TOGMI/1157-1500---------------GGIILDSWSDERGIDR...................KLTDV-------------------------
A5DUI4_LODEL/191-536---------------IGIIADTFYDARRLDK...................VFQDV-------------------------
F4NT70_BATDJ/197-515---------------SSIILGGLKETLQLER...................KVKEI-------------------------
C5GF37_AJEDR/230-568---------------GGIILESWSDDRHVDR...................KLTDI-------------------------
B2AA74_PODAN/219-562---------------GGIILDSWSDERTVDR...................RLTDV-------------------------
N1JE83_BLUG1/191-526---------------GGIILDTWGDERNIDR...................RLRDM-------------------------
W4ZDW5_STRPU/172-484---------------AQKIIDKFVEQRDFSR...................KSQQV-------------------------
G0W4A1_NAUDC/213-564---------------AGLLLDIFNESRNLDQ...................IVNNI-------------------------
Q4DDH2_TRYCC/242-662---------------CVPVLKDFLKKRQE.....................VLSSV-------------------------
Q16TS8_AEDAE/167-489---------------VVKLVLEFNKNRQIGR...................RVAQI-------------------------
E9FQQ8_DAPPU/154-462---------------AGQILTEFRRSRQLDK...................QIRLV-------------------------
C5M6Q7_CANTT/193-537---------------VGIIADTFYDLRRLDK...................YFQDI-------------------------
V5GSU0_PSEBG/199-579---------------GHRIMDSWREDRSVRR...................RLDEV-------------------------
X6MJK6_RETFI/5-348---------------IHKLLAHYIQHFDLPKLAKFVK......LIFILSLFFSEC-------------------------
M2R7X1_CERS8/181-514---------------VKDLLEGWEEARSMKR...................KLSDI-------------------------
A0A068Y5W7_ECHMU/114-419---------------AEIIFVDFKEKRDLSV...................ILQRA-------------------------
D6WJA3_TRICA/162-474---------------MKRILTEWARARQINK...................KIQLI-------------------------
G8Y9D0_PICSO/191-527---------------IGLIGDTFYDVRKVDA...................LAFQT-------------------------
Q57XU9_TRYB2/282-625---------------CVPVLKDFLKKRQE.....................VLQAV-------------------------
G2Y0X2_BOTF4/187-528---------------GGIVLDTWGDEKNVDR...................RLTDV-------------------------
E0VZ92_PEDHC/157-456---------------ASKIVNELINHRNLKN...................KIKQV-------------------------
B0CT70_LACBS/161-472---------------TKSLRDGWEEDRSMKR...................KLAEV-------------------------
Q59T37_CANAL/195-551---------------VGIIADTFYDLRRLDK...................HFQDI-------------------------
E9QGT9_DANRE/180-489---------------AQKIVDKFIQQRDYNN...................KFQVV-------------------------
K1WLQ9_TRIAC/267-644---------------VQRLVEGWEEERRVGR...................LIADT-------------------------
F9XE54_ZYMTI/175-509---------------GGLILDTWAEERRVSR...................KLTDV-------------------------
C5DG77_LACTC/179-498---------------AGLVLDSFFESRNFKE...................ILQDI-------------------------
K5Y4H4_AGABU/183-506---------------TKSLLEGWEEERGMKR...................KLSEV-------------------------
I1JS41_SOYBN/186-485---------------GSVILNKYMEYRQLAK...................LSSEI-------------------------
K0KE72_WICCF/171-504---------------AGLISDTFYDNRQISR...................LIDEI-------------------------
K4CGD4_SOLLC/174-477---------------GSTIIKKYMEYRKLAK...................VTSEI-------------------------
H2XLC7_CIOIN/111-421---------------TNVVLQKFKEVRSFKG...................TVQRV-------------------------
S9VWR1_SCHCR/164-482---------------GSIIISTMYDVRRITS...................LLNSI-------------------------
U9TBS3_RHIID/182-496---------------SQIILDTFFDERQIQR...................KLLDI-------------------------
E3Q612_COLGM/198-538---------------GGIILDSWSDERDVDR...................RLKDV-------------------------
Q6BTT0_DEBHA/227-568---------------IGLISDTFYDIKRIDK...................VIQDI-------------------------
K2S8E4_MACPH/175-516---------------GGIILDTWRDERNIDR...................KLTDI-------------------------
G8JQJ6_ERECY/189-517---------------AGLIWDTFMDTRRMDK...................LLDGI-------------------------
A0A0C4EWA8_PUCT1/187-568---------------MVRLLSAWETDQQLNR...................KLLSV-------------------------
A9SCH4_PHYPA/154-467---------------GSLIIKKYIEQRKLLK...................LTKDI-------------------------
Q0UYP7_PHANO/174-513---------------GGIMLDTWHDERNIDR...................KLTDI-------------------------
M9MH30_PSEA3/203-582---------------GHRIMDSWRQDRNVRR...................RLDEV-------------------------
I2H5R5_TETBL/205-583---------------TGLVLDIFLETRKVDR...................ILSEI-------------------------
A7TT52_VANPO/190-542---------------AGLILDIFMETKNLNH...................LVSDI-------------------------
T1J554_STRMM/179-485---------------LRRIIEEFKRVRNFEQ...................KTFLV-------------------------
A0A0D2XGD5_FUSO4/82-414---------------GGIILDMWNDERAVTR...................MMADI-------------------------
A7RPW3_NEMVE/163-477---------------ADQILDAFVKRRDLQH...................KIKSV-------------------------
B4KHQ6_DROMO/161-491---------------VKNLLLEFNKNRQIQY...................RIKQV-------------------------
A8NGP6_COPC7/165-479---------------TRGMRESWEEDRGVKR...................KMADI-------------------------
D8QT59_SELML/156-463---------------GSAIVKKYMEFRGLAK...................LEKEI-------------------------
S8C8S4_DACHA/216-562---------------GGIVIDSFWEERSIGR...................KLSDI-------------------------
N1PMN4_DOTSN/176-511---------------GGLILDTWAEERRVNR...................KLTDV-------------------------
V5G2M7_BYSSN/194-532---------------GGIILDTWRDERNIDR...................KLTDI-------------------------
F8Q674_SERL3/166-485---------------VEEFIQGWKSNRYIKQ...................KLADV-------------------------
M3AA99_PSEFD/191-526---------------GALILDTWAEERQLTR...................RLTDV-------------------------
G4MR42_MAGO7/219-567---------------GGIVLDSWSDDRTVDR...................RLKDV-------------------------
J3KI74_COCIM/186-524---------------GGIILETWSEERHVDR...................KLTDI-------------------------
G4U2Q1_PIRID/161-490---------------IKGLVEGWEEERGVKR...................KTFEL-------------------------
R7YUM9_CONA1/175-511---------------GGIILDTWQDERVIER...................KLTDI-------------------------
G8ZSF3_TORDC/186-519---------------AGLVFDIFNETRKIDR...................VVKDI-------------------------
G0SXA1_RHOG2/160-497---------------GLRVLANWEEERRIRK...................KVADV-------------------------
S3C4S1_OPHP1/236-610---------------GGIIVDAFNDDRGIDR...................KLTEV-------------------------
D8M8U8_BLAHO/154-504---------------AGQLFSTFASLRDLSV...................LFEDS-------------------------
C3YFK8_BRAFL/171-477---------------ARRVVDAFIKNRAYQK...................KAQQV-------------------------
Q758T0_ASHGO/188-512---------------AGIIWDTFMDVRRIEY...................LLAEI-------------------------
M5C4C1_THACB/161-521---------------VNGLYDGWEEERDISR...................KLSDA-------------------------
U4L2E9_PYROM/293-612---------------AGIIIDTFSDEKALER...................KLTDI-------------------------
J4KLZ9_BEAB2/1246-1586---------------GGIILDTWADERSLDR...................KMTDV-------------------------
G7E1B8_MIXOS/165-515---------------ALSVLERWHEERAISK...................KLSES-------------------------
H2KS09_CLOSI/401-723---------------INRIIRRFRTQYRLTE...................LFQVI-------------------------
W1NDY2_AMBTC/181-483---------------GTTIMKKYMEFRKLGK...................ITADI-------------------------
COG4_ARATH/176-479---------------GSLILKKYMDFRKLAI...................LASDI-------------------------
H6C9G5_EXODN/179-515---------------GGIILDTWADDRRIDR...................HLTEI-------------------------
H3AVV6_LATCH/187-496---------------SEELVENFIKQRDYHR...................KFQRV-------------------------
K5V063_PHACS/174-511---------------TKDLIEGWEEERAMKR...................KLADI-------------------------
B6HSP5_PENCW/191-531---------------GGIILDTWSDERHVDR...................KLMDI-------------------------
G3BC56_CANTC/190-528---------------IGLITDTFYDEKRLGK...................IIQDI-------------------------
A0A068X7X6_HYMMI/106-417---------------AELIFFSFKEKRNLEA...................LLQRA-------------------------
M7NUP8_PNEMU/161-484---------------CSIIIDSFWEERQVEK...................KLSFI-------------------------
U7PW27_SPOS1/225-627---------------GGIVVDAWSDERGVDR...................KLTDV-------------------------
E6ZNH9_SPORE/195-575---------------GHRIMDSWREDRNVRR...................RLDEV-------------------------
G0V8A6_NAUCC/189-534---------------AGLLLDIFAESRNLDG...................IVKDI-------------------------
E7QLX6_YEASZ/190-525---------------ASLILDIFMETRKIER...................TIHDI-------------------------
C5DUL4_ZYGRC/172-510---------------AGLVLDVFTEVRKLQR...................VVHGV-------------------------
E4UP45_ARTGP/209-548---------------GGIILESWAEERHVDR...................RLTDI-------------------------
K1R201_CRAGI/174-481---------------VRQILEKFKLKRDFDA...................VVQQV-------------------------
Q6FTK7_CANGA/185-531---------------AGLVFDIFSDTRKVKS...................VVREI-------------------------
D2V3G5_NAEGR/119-422---------------VKKVLDVYEKKRELND...................ILTAV-------------------------
G5C1P9_HETGA/267-575---------------VEKVVDKFTKQRDYQQ...................QFRLV-------------------------
L8WI47_THACA/987-1357---------------VNGLYDGWEEERDISRKVSPLHTTSHSLAHPHGVWKLSDA-------------------------
V2X3Q2_MONRO/169-474---------------VKGAIERWEEERSMAR...................KLLDV-------------------------
A7UW80_NEUCR/259-612---------------GGIIVDSWSDERGVDR...................ALTDV-------------------------
M2NB58_BAUCO/172-509---------------GGIILDTWAEERRISR...................KLTDV-------------------------
C7ZFK3_NECH7/171-496---------------GGIILDAWADDRSVDR...................MISDI-------------------------
K1WSR6_MARBU/231-588---------------GGIILDMWGDERSVDR...................RLTDV-------------------------
S0E9C5_GIBF5/167-499---------------GGIILDTWNEERSFAR...................IMADI-------------------------
C4XYR0_CLAL4/197-532---------------IGLITDTFYDVNRIEK...................LLQDI-------------------------
S2JH92_MUCC1/194-506---------------SVIILDRFLKARKLES...................KVRMP-------------------------
E9IBA8_SOLIN/158-464---------------VKKIVTVFTKHRSISK...................NVQMI-------------------------
A0A016PRI6_GIBZA/187-527---------------GGIIVDTWSDERGIDR...................KLTDV-------------------------
G0R6U4_HYPJQ/191-531---------------GGIILDTWSDERGVDK...................KLTDV-------------------------
I2FV21_USTH4/206-592---------------GHRIMDSWREDRNVRR...................RLDEV-------------------------
A8NFV8_BRUMA/216-544---------------AERIIDAFMKNRQFDS...................KAKMV-------------------------
G0SCB4_CHATD/176-523---------------GGIIVDSWSDERAVDR...................RLTDV-------------------------
W1QCQ6_OGAPD/210-555---------------SGLIFDTFWDAKNLDR...................AISDI-------------------------
Q5AW68_EMENI/201-531---------------GGIVVDTWSDERHIDR...................KLMDI-------------------------

PF07393

Q750R9_ASHGO/111-822.................DTNNS..LASALDQC..FTEIFSKIVFDRVKYFDVEKKCLESILIHMTSDFN----------.
Q6BHS9_DEBHA/103-810.................DMSNE..LCPTLDQC..YYDLFIEYTSE.SIYFNREKKNLEDTIYSIVQKFN----------.
SEC10_ARATH/139-817........................GCGDLDVEDLTESLFSSHK...DEYPEHERASLKQLYQAKMEELR----------.
Q2HG63_CHAGB/108-854.................EPCSA.QISQTLDQQ..LEELFVPYLIG.NSYIDRERRSLEEMYNSLLFKFT----------.
Q7PQN8_ANOGA/88-705........................EDDLLQKL..TANIFDRHL...ATYIEVESRTLDAKCQVELKKFY----------.
A1D556_NEOFI/126-876........................LDEFLHHI..VAKVYEPHI...DLYLAEELDHFRKNSAAVVDEWD----------R
Q2URB8_ASPOR/132-879........................FEEFLEHV..IAKVYEPHM...DLYLAEELDHFRKCSEAAVDEWD----------R
E7KRR3_YEASL/120-862.................DDSNQ.ILSTTLEQC..FADLFSHYLYDRSKYFGIEKRSLEAILVDMTSKFT----------.
Q4RLZ1_TETNG/80-698........................KHTFLSKL..IKSIFSTYL...ESYIDMEKEYLRNRGAMILQRYY----------.
Q55N90_CRYNB/170-1008................I.......KKEQVEDS..VFHMFEEHL...DDYLDDETERVKHHLEDICRIWE----------Q
Q0IP77_ORYSJ/117-800........................SCGDLDIEGLTESIFVSHK...DEYTEFEQASLRQQYQSKMAELR----------.
A2EZD8_TRIVA/69-728........................DGQTFSNQNIMENTFHNFQ...TSYETLETQALTNIMLEQVVP..----------.
Q2GXU3_CHAGB/166-960........................QEARAKEL..VLKAFEPHL...DLYLQDEIDEFARQAEEEVGEWE----------K
Q2TVY5_ASPOR/116-891.................DTISA.QTALILDQQ..LEDLFVPYFVG.SSYIEREKKTLEELYTSLLFKFT----------.
Q5BGH2_EMENI/123-870........................FEDLLHQT..IAQVYEPHM...DLYLAEELDFFRKGSEASVAEWD----------R
Q6CDC8_YARLI/101-777.................DTHDS..LAALLDQN..FADIFIPHIDK.NRYFESEKKSLSELISAALWKFA----------.
EXOC5_DROME/89-705........................DDDLLQKL..TQQIFIKHL...AGYAEMETKCLTAKCSTELEKFY----------.
A1DAY7_NEOFI/117-893.................DPVSS.QTALILDQQ..LEDLFVPYFVG.SSYIEREKKSLEELYTSLLFRFT----------.
EXOC5_CAEEL/46-659........................DSAFLSTL..TDSIFQRYI...ATYCSEELKYLNDQCSNLLQRFY----------.
Q6FMF7_CANGA/102-810.................ENEAN..LQAALEQC..YTDFFSRWLFDRSKYFDIEKRSLEIILIEMTSRFN----------.
A0A0D1E7P5_USTMA/134-1026DSIRLLGNDFAAGASQLAGASASPLATMLDQS..VEELFVPYMEG.IRYIDRESRSLADLYAGLLFKFI----------.
SEC10_SCHPO/101-799.................SVSDNSPLSLALNQY..MEDLLVPFIEV.DDYLKREEHSLRSLFRLSLYKYT----------.
Q5KJ89_CRYNJ/95-875............SRAPAPAGSGGSFSAFLDRA..LEEMYVPWLEG.TRYLECESKNLVELYAGLLSRFT----------.
Q5AS51_EMENI/111-841.................ETISS.QTSLILDQQ..LEDLFVPYFVG.SSYIEREKRTLEELYTSLLFKFT----------.
Q6CQC0_KLULA/109-807.................DSDGK..VSACLEKC..WKNLFIDILFDRSKYFEVEKRTLENVLVQKASDFN----------.
C4YGD5_CANAW/103-782.................DKDQE..LSAILDQS..HSDLFVEYIGD.NVYFNREKKNLEETIYGIIHQFN----------.

PF10191

Q7QA49_ANOGA/2-731------------------------CDDETTIDRLANSLFVFFGIFLKEYPTLENSQLEASLQGLTIVGT..........A
Q29C94_DROPS/2-737------------------------SDELHRQ..LGEAVFEYFHKFIQQYPRLEETQLSTQVDRLLSNQS..........T
Q172R1_AEDAE/2-704------------------------.....KAEDLSAALFSYFDVFVEQYPSLERSFSNKMLEEMKMNAA..........S
COG7_RAT/2-767------------------------.HNLVKVVELVDAVYGPYKPYQLKYGDLEESNLLIQISAVPLEHG..........E
Q5FW35_XENTR/2-765------------------------.YNLVKLIELVDAVFGPYKPYQLQYGDLEESNLLIQISAMPLERG..........E
Q655R9_ORYSJ/5-868------------------------.SDLLVLLNTLKAIYSPYETFKARYGQMERALLSAEMAGIDIRGAIARGVGAQGIE
Q9FGN0_ARATH/4-832------------------------.SELRILIDTLKAVYSPFESFKQKYGKMERAILSSEIAVVDLRGAVTRGVGAQGIE

PF08318

E9EW04_METRA/274-613----------------------------------------------KSYPFSFLVQSFL.....................
B6JXE3_SCHJY/165-484----------------------------------------------RSYTY.............................
COG4_DROME/166-496----------------------------------------------NESTQRSA..........................
M3D3E3_SPHMS/178-512----------------------------------------------KSYPFNFFVQSFL.....................
C4QWJ7_PICPG/179-518----------------------------------------------REYDYP............................
B8LT52_TALSN/189-530----------------------------------------------KSYAFTFLVQSFL.....................
S3CMB0_GLAL2/185-536----------------------------------------------KSYPFSFLVN........................
COG4_SCHPO/163-481----------------------------------------------ASYKY.............................
L8FSC8_PSED2/189-538----------------------------------------------KSYPFSFLVQSFLP....................
F0XR72_GROCL/199-557----------------------------------------------KSYPFSFLVQSFLAQQQRGST........STTSN
V8NZE8_OPHHA/148-457----------------------------------------------QSSAM.............................
F6TNZ6_XENTR/114-423----------------------------------------------QSCMM.............................
G8BDV4_CANPC/186-525----------------------------------------------KLYKFPVLSRR.......................
C5WWS3_SORBI/192-503----------------------------------------------NSYTK.............................
A8X3I7_CAEBR/217-546----------------------------------------------VHHKK.............................
U1HW21_ENDPU/187-524----------------------------------------------KSYAYTFLVQSFLP....................
J3NYL1_GAGT3/212-567----------------------------------------------KSYPFSFLVQSFLP....................
D5GK94_TUBMM/197-545----------------------------------------------KSYAFSFLVQSYMP....................
F6I2Y2_VITVI/183-485----------------------------------------------NSYKN.............................
T1KVK7_TETUR/162-476----------------------------------------------QKSSK.............................
G8BYJ4_TETPH/194-538----------------------------------------------KEWQRLQM..........................
Q5TNE6_ANOGA/167-491----------------------------------------------NDYIK.............................
J4GWL1_FIBRA/183-513----------------------------------------------ASHPP.............................
H2VA38_TAKRU/70-376----------------------------------------------QSSMM.............................
A3LT54_PICST/195-541----------------------------------------------KLYNFPVLARR.......................
B7QAG5_IXOSC/93-401----------------------------------------------RALLC.............................
C5LP43_PERM5/114-451----------------------------------------------QTIAD.............................
G3AM87_SPAPN/194-515----------------------------------------------GLYNFPRLE.........................
R8BYD5_TOGMI/1157-1500----------------------------------------------KSYPFSFLVQSLLP....................
A5DUI4_LODEL/191-536----------------------------------------------DLYTFPVLSKR.......................
F4NT70_BATDJ/197-515----------------------------------------------QQYEN.............................
C5GF37_AJEDR/230-568----------------------------------------------KSYAFTFLVQSFL.....................
B2AA74_PODAN/219-562----------------------------------------------RSYPFSFLVQSFVS....................
N1JE83_BLUG1/191-526----------------------------------------------KSNPFSYLVQSFL.....................
W4ZDW5_STRPU/172-484----------------------------------------------QLSLT.............................
G0W4A1_NAUDC/213-564----------------------------------------------KHWNEKYQNKDKKNY...................
Q4DDH2_TRYCC/242-662----------------------------------------------TSAGGINTNSSSSS....................
Q16TS8_AEDAE/167-489----------------------------------------------NDYIK.............................
E9FQQ8_DAPPU/154-462----------------------------------------------SEVLS.............................
C5M6Q7_CANTT/193-537----------------------------------------------KLYSFPILTKR.......................
V5GSU0_PSEBG/199-579----------------------------------------------QAYRFTGAATAKHT....................
X6MJK6_RETFI/5-348----------------------------------------------SYLNFFACFQENNR....................
M2R7X1_CERS8/181-514----------------------------------------------TNVGS.............................
A0A068Y5W7_ECHMU/114-419----------------------------------------------RHELL.............................
D6WJA3_TRICA/162-474----------------------------------------------TDLSR.............................
G8Y9D0_PICSO/191-527----------------------------------------------DNYSFPLLTGK.......................
Q57XU9_TRYB2/282-625----------------------------------------------DCTNNSPSP.........................
G2Y0X2_BOTF4/187-528----------------------------------------------RSYPFSFLVQSFL.....................
E0VZ92_PEDHC/157-456----------------------------------------------NEYNT.............................
B0CT70_LACBS/161-472----------------------------------------------INNPP.............................
Q59T37_CANAL/195-551----------------------------------------------KLYSFPVLTRR.......................
E9QGT9_DANRE/180-489----------------------------------------------QSNMM.............................
K1WLQ9_TRIAC/267-644----------------------------------------------ESSTFPLLSNPALLPPLFPSLVSTAGQLSLANLA
F9XE54_ZYMTI/175-509----------------------------------------------KSYPFNFLVSSFL.....................
C5DG77_LACTC/179-498----------------------------------------------RAFKE.............................
K5Y4H4_AGABU/183-506----------------------------------------------QNNPP.............................
I1JS41_SOYBN/186-485----------------------------------------------NAHNT.............................
K0KE72_WICCF/171-504----------------------------------------------QAYKFPILTNY.......................
K4CGD4_SOLLC/174-477----------------------------------------------NSYKS.............................
H2XLC7_CIOIN/111-421----------------------------------------------QQSLF.............................
S9VWR1_SCHCR/164-482----------------------------------------------KNYKF.............................
U9TBS3_RHIID/182-496----------------------------------------------QTHYN.............................
E3Q612_COLGM/198-538----------------------------------------------KSYPFSFLVQSFL.....................
Q6BTT0_DEBHA/227-568----------------------------------------------SLYNFPVLSKR.......................
K2S8E4_MACPH/175-516----------------------------------------------KSYAFSFLVRSFL.....................
G8JQJ6_ERECY/189-517----------------------------------------------KIWDES............................
A0A0C4EWA8_PUCT1/187-568----------------------------------------------QRYSFATQNQLLAAINNYGSVNPL.NSPAALHSS
A9SCH4_PHYPA/154-467----------------------------------------------AAHSK.............................
Q0UYP7_PHANO/174-513----------------------------------------------KSYAYSFLVQSFFP....................
M9MH30_PSEA3/203-582----------------------------------------------QAYRFTSAAMDAKT....................
I2H5R5_TETBL/205-583----------------------------------------------NEWNDLHSLKIKNLNKSLVANTH...HTREKSSS
A7TT52_VANPO/190-542----------------------------------------------NEWNQLQQKIAQR.....................
T1J554_STRMM/179-485----------------------------------------------QQLLT.............................
A0A0D2XGD5_FUSO4/82-414----------------------------------------------KSYPFYFLSKSMMP....................
A7RPW3_NEMVE/163-477----------------------------------------------TKSLN.............................
B4KHQ6_DROMO/161-491----------------------------------------------NDSSQRP...........................
A8NGP6_COPC7/165-479----------------------------------------------LNNPP.............................
D8QT59_SELML/156-463----------------------------------------------IAQTN.............................
S8C8S4_DACHA/216-562----------------------------------------------KSYAFSFLVQSFLA....................
N1PMN4_DOTSN/176-511----------------------------------------------KSYPFNFLVQSFL.....................
V5G2M7_BYSSN/194-532----------------------------------------------KSYAFTFLVQSFL.....................
F8Q674_SERL3/166-485----------------------------------------------SRSPL.............................
M3AA99_PSEFD/191-526----------------------------------------------KSYPFNFLVSSAL.....................
G4MR42_MAGO7/219-567----------------------------------------------KSYPFSFLVQSFLS....................
J3KI74_COCIM/186-524----------------------------------------------KSYAFTFLVQSFL.....................
G4U2Q1_PIRID/161-490----------------------------------------------LAYQR.............................
R7YUM9_CONA1/175-511----------------------------------------------RSYAFSFLVQSFLP....................
G8ZSF3_TORDC/186-519----------------------------------------------QNWNSYR...........................
G0SXA1_RHOG2/160-497----------------------------------------------RDHRFVGAGVL.......................
S3C4S1_OPHP1/236-610----------------------------------------------KSYPFSFLVQSFLNLQRGP............GAA
D8M8U8_BLAHO/154-504----------------------------------------------KTRLQ.............................
C3YFK8_BRAFL/171-477----------------------------------------------QQCMM.............................
Q758T0_ASHGO/188-512----------------------------------------------REWHE.............................
M5C4C1_THACB/161-521----------------------------------------------RTATF.............................
U4L2E9_PYROM/293-612----------------------------------------------KSYAYGFLVQSF......................
J4KLZ9_BEAB2/1246-1586----------------------------------------------KSYPFSFLVQSFL.....................
G7E1B8_MIXOS/165-515----------------------------------------------RAYRFQQLQALSQPAIV................P
H2KS09_CLOSI/401-723----------------------------------------------QNSST.............................
W1NDY2_AMBTC/181-483----------------------------------------------NSYSK.............................
COG4_ARATH/176-479----------------------------------------------NNSPN.............................
H6C9G5_EXODN/179-515----------------------------------------------RSYAFTFLVQSFMS....................
H3AVV6_LATCH/187-496----------------------------------------------QSSMM.............................
K5V063_PHACS/174-511----------------------------------------------SNPSF.............................
B6HSP5_PENCW/191-531----------------------------------------------KSYAFTFLVQSFL.....................
G3BC56_CANTC/190-528----------------------------------------------RLYDFPILRAR.......................
A0A068X7X6_HYMMI/106-417----------------------------------------------RHELM.............................
M7NUP8_PNEMU/161-484----------------------------------------------QMYSFE............................
U7PW27_SPOS1/225-627----------------------------------------------KSYPFSFLVQSFGMKGAGGS.........SSNSN
E6ZNH9_SPORE/195-575----------------------------------------------QAYKFTGAVVASKT....................
G0V8A6_NAUCC/189-534----------------------------------------------DDWNLRQRKHAQ......................
E7QLX6_YEASZ/190-525----------------------------------------------NEWEHSQ...........................
C5DUL4_ZYGRC/172-510----------------------------------------------NEWNSNPRHHQ.......................
E4UP45_ARTGP/209-548----------------------------------------------KSYAFTFLVQSFLP....................
K1R201_CRAGI/174-481----------------------------------------------QQNAV.............................
Q6FTK7_CANGA/185-531----------------------------------------------SEWNIAQKNK........................
D2V3G5_NAEGR/119-422----------------------------------------------SKKPN.............................
G5C1P9_HETGA/267-575----------------------------------------------QNNL..............................
L8WI47_THACA/987-1357----------------------------------------------RTATF.............................
V2X3Q2_MONRO/169-474----------------------------------------------QTASQ.............................
A7UW80_NEUCR/259-612----------------------------------------------KSYPFSFLVQSFLP....................
M2NB58_BAUCO/172-509----------------------------------------------RSYPFNFLVQSFLP....................
C7ZFK3_NECH7/171-496----------------------------------------------RSYPFVFLVQSIL.....................
K1WSR6_MARBU/231-588----------------------------------------------KSYPFSFLVHSFM.....................
S0E9C5_GIBF5/167-499----------------------------------------------KNYPFSFLSKSMVP....................
C4XYR0_CLAL4/197-532----------------------------------------------KLHSFSDLKNR.......................
S2JH92_MUCC1/194-506----------------------------------------------SAQSP.............................
E9IBA8_SOLIN/158-464----------------------------------------------NEYLR.............................
A0A016PRI6_GIBZA/187-527----------------------------------------------RSYPFSFLVQSFL.....................
G0R6U4_HYPJQ/191-531----------------------------------------------KSYPFSFLVQSFL.....................
I2FV21_USTH4/206-592----------------------------------------------QSYRFTGAVVANKT....................
A8NFV8_BRUMA/216-544----------------------------------------------EKITR.............................
G0SCB4_CHATD/176-523----------------------------------------------KSYPFTFLVQSFLP....................
W1QCQ6_OGAPD/210-555----------------------------------------------TNYGY.............................
Q5AW68_EMENI/201-531----------------------------------------------KSYAFTFLVQSFL.....................

PF07393

Q750R9_ASHGO/111-822TY....HEREIRARHLT.......AKLSASGDVKAELTT.........................YSIQG.........SN
Q6BHS9_DEBHA/103-810TY....NEKALSNKYLSTKLENLDNLEYNEKAPQEHHDRF........................SFHFS.........EK
SEC10_ARATH/139-817................................................................AESQQ.........VS
Q2HG63_CHAGB/108-854IY....HSR..................RKKTPTGFMAAIAQ......................QGTQLI.........AS
Q7PQN8_ANOGA/88-705................................................................ETKNH.........QK
A1D556_NEOFI/126-876QL....SEQAASTESFLMSN.VNRQADKRDFLTSFKKVIMAPVN...............ILPSFSSSKS.........SE
Q2URB8_ASPOR/132-879QL....SEQAASTESFLMSN.INRQADKKDFLTSFKKVIMAPVN...............LLPSFSGTKT.........NE
E7KRR3_YEASL/120-862VN....YDKEINKRVLL.......DKYKEKLSTNVDAFMHSPRG................NTHSRQDST.........SR
Q4RLZ1_TETNG/80-698................................................................DSKNH.........QK
Q55N90_CRYNB/170-1008QLGTSDSEQLSKSHTPTFLISANPDQVKRNVLASFKDALLLPVTIVPRTVTFGVNAIVSGGTQAVSGLAMLNPQKWTGKG
Q0IP77_ORYSJ/117-800................................................................AEAKQ.........QS
A2EZD8_TRIVA/69-728..............................................................................HL
Q2GXU3_CHAGB/166-960KL....SEQDASAESFYMANFTNRQADKKDFLTSFKKVVMMPVTVLPTTLTTFSLPGLPLGSPFASKPA.........AA
Q2TVY5_ASPOR/116-891TF....HAR..................RKKAATTFMASLSK......................SGTELL.........SS
Q5BGH2_EMENI/123-870QL....SEQAASTESFLLSN.VNRQADKRDFLTSFKKVIMAPVN...............ILPSFSNKSS.........EQ
Q6CDC8_YARLI/101-777EF....HEKKSSHKEGG......LLGR.....................................ITHSL.........DN
EXOC5_DROME/89-705................................................................ASKKH.........QK
A1DAY7_NEOFI/117-893TF....HAR..................RKRAATTFMASISK......................SGTELL.........SS
EXOC5_CAEEL/46-659...................................................................ES.........KK
Q6FMF7_CANGA/102-810TL....HEKDIRQRLLT.......NKFKASTNDSPETRINE......................LSTTNT.........AN
A0A0D1E7P5_USTMA/134-1026SF....HRTSAAAKRDKASGNTIFNRMRNQITATSDASSS........................TSSLG.........GS
SEC10_SCHPO/101-799SY....KIR..................LETPEPGLLRSLMTP....................LQGNMVA.........PT
Q5KJ89_CRYNJ/95-875RY....HETVLQAKPNSL.....LNKVVHQLASSSSAATTS......................STAQTA.........AA
Q5AS51_EMENI/111-841TF....HGR..................RKKAATTFMASLSK......................SGSELL.........AS
Q6CQC0_KLULA/109-807IS....FDSDIRPRSLA.......NKLNEVTDFKSSPELK........................ILTSR.........SG
C4YGD5_CANAW/103-782TA....NENIIANKSLAARLENLDNVQKPEKDRFSFAS........................................EK

PF10191

Q7QA49_ANOGA/2-731PADSVHNLESANAKIIRWALEAVTRCQDITQNCALLSLGSVL------------------------------------QN
Q29C94_DROPS/2-737PSDAVRHLEESTRKLYEWLKEACERCSAITSDLALCKLITLL------------------------------------NG
Q172R1_AEDAE/2-704VVENVSTLDACNAKVSKWFTDATNRCINITQNKSLPQLVKVF------------------------------------RS
COG7_RAT/2-767VIDCVQELSQSVHKLFGLASAAVDRCAKFTNGLGTCGLLTAL------------------------------------KS
Q5FW35_XENTR/2-765VLDCVQELSHSVSRLFSLASGAMDRCIKFTDGLGLCGLLQAL------------------------------------QS
Q655R9_ORYSJ/5-868LSETVRRMEESIPQIIVLLEAAVERCISLTGGSEADELVLAL------------------------------------DD
Q9FGN0_ARATH/4-832LSETVRRMEESIPQVVVLLEAAVERCIGFTGGSEADELILAL------------------------------------DD

PF08318

E9EW04_METRA/274-613..----------------------------------------------------------------------------PQ
B6JXE3_SCHJY/165-484..----------------------------------------------------------------------------..
COG4_DROME/166-496..----------------------------------------------------------------------------..
M3D3E3_SPHMS/178-512..----------------------------------------------------------------------------PA
C4QWJ7_PICPG/179-518..----------------------------------------------------------------------------..
B8LT52_TALSN/189-530..----------------------------------------------------------------------------PA
S3CMB0_GLAL2/185-536..----------------------------------------------------------------------------..
COG4_SCHPO/163-481..----------------------------------------------------------------------------..
L8FSC8_PSED2/189-538..----------------------------------------------------------------------------SH
F0XR72_GROCL/199-557GN----------------------------------------------------------------------------TG
V8NZE8_OPHHA/148-457..----------------------------------------------------------------------------..
F6TNZ6_XENTR/114-423..----------------------------------------------------------------------------..
G8BDV4_CANPC/186-525..----------------------------------------------------------------------------..
C5WWS3_SORBI/192-503..----------------------------------------------------------------------------..
A8X3I7_CAEBR/217-546..----------------------------------------------------------------------------..
U1HW21_ENDPU/187-524..----------------------------------------------------------------------------PQ
J3NYL1_GAGT3/212-567.Q----------------------------------------------------------------------------QK
D5GK94_TUBMM/197-545.S----------------------------------------------------------------------------TR
F6I2Y2_VITVI/183-485..----------------------------------------------------------------------------..
T1KVK7_TETUR/162-476..----------------------------------------------------------------------------..
G8BYJ4_TETPH/194-538..----------------------------------------------------------------------------..
Q5TNE6_ANOGA/167-491..----------------------------------------------------------------------------..
J4GWL1_FIBRA/183-513..----------------------------------------------------------------------------..
H2VA38_TAKRU/70-376..----------------------------------------------------------------------------..
A3LT54_PICST/195-541..----------------------------------------------------------------------------..
B7QAG5_IXOSC/93-401..----------------------------------------------------------------------------..
C5LP43_PERM5/114-451..----------------------------------------------------------------------------..
G3AM87_SPAPN/194-515..----------------------------------------------------------------------------..
R8BYD5_TOGMI/1157-1500..----------------------------------------------------------------------------QQ
A5DUI4_LODEL/191-536..----------------------------------------------------------------------------..
F4NT70_BATDJ/197-515..----------------------------------------------------------------------------..
C5GF37_AJEDR/230-568..----------------------------------------------------------------------------PA
B2AA74_PODAN/219-562.Q----------------------------------------------------------------------------PN
N1JE83_BLUG1/191-526..----------------------------------------------------------------------------SG
W4ZDW5_STRPU/172-484..----------------------------------------------------------------------------..
G0W4A1_NAUDC/213-564SI----------------------------------------------------------------------------KR
Q4DDH2_TRYCC/242-662..----------------------------------------------------------------------------SG
Q16TS8_AEDAE/167-489..----------------------------------------------------------------------------..
E9FQQ8_DAPPU/154-462..----------------------------------------------------------------------------..
C5M6Q7_CANTT/193-537..----------------------------------------------------------------------------..
V5GSU0_PSEBG/199-579.Q----------------------------------------------------------------------------PS
X6MJK6_RETFI/5-348.E----------------------------------------------------------------------------YF
M2R7X1_CERS8/181-514..----------------------------------------------------------------------------..
A0A068Y5W7_ECHMU/114-419..----------------------------------------------------------------------------..
D6WJA3_TRICA/162-474..----------------------------------------------------------------------------..
G8Y9D0_PICSO/191-527..----------------------------------------------------------------------------..
Q57XU9_TRYB2/282-625..----------------------------------------------------------------------------..
G2Y0X2_BOTF4/187-528..----------------------------------------------------------------------------PN
E0VZ92_PEDHC/157-456..----------------------------------------------------------------------------..
B0CT70_LACBS/161-472..----------------------------------------------------------------------------..
Q59T37_CANAL/195-551..----------------------------------------------------------------------------..
E9QGT9_DANRE/180-489..----------------------------------------------------------------------------..
K1WLQ9_TRIAC/267-644NT----------------------------------------------------------------------------TS
F9XE54_ZYMTI/175-509..----------------------------------------------------------------------------PT
C5DG77_LACTC/179-498..----------------------------------------------------------------------------..
K5Y4H4_AGABU/183-506..----------------------------------------------------------------------------..
I1JS41_SOYBN/186-485..----------------------------------------------------------------------------..
K0KE72_WICCF/171-504..----------------------------------------------------------------------------..
K4CGD4_SOLLC/174-477..----------------------------------------------------------------------------..
H2XLC7_CIOIN/111-421..----------------------------------------------------------------------------..
S9VWR1_SCHCR/164-482..----------------------------------------------------------------------------..
U9TBS3_RHIID/182-496..----------------------------------------------------------------------------..
E3Q612_COLGM/198-538..----------------------------------------------------------------------------.P
Q6BTT0_DEBHA/227-568..----------------------------------------------------------------------------..
K2S8E4_MACPH/175-516..----------------------------------------------------------------------------.P
G8JQJ6_ERECY/189-517..----------------------------------------------------------------------------..
A0A0C4EWA8_PUCT1/187-568LR----------------------------------------------------------------------------SL
A9SCH4_PHYPA/154-467..----------------------------------------------------------------------------..
Q0UYP7_PHANO/174-513..----------------------------------------------------------------------------TQ
M9MH30_PSEA3/203-582.Q----------------------------------------------------------------------------HS
I2H5R5_TETBL/205-583PS----------------------------------------------------------------------------IH
A7TT52_VANPO/190-542..----------------------------------------------------------------------------.D
T1J554_STRMM/179-485..----------------------------------------------------------------------------..
A0A0D2XGD5_FUSO4/82-414.V----------------------------------------------------------------------------QR
A7RPW3_NEMVE/163-477..----------------------------------------------------------------------------..
B4KHQ6_DROMO/161-491..----------------------------------------------------------------------------..
A8NGP6_COPC7/165-479..----------------------------------------------------------------------------..
D8QT59_SELML/156-463..----------------------------------------------------------------------------..
S8C8S4_DACHA/216-562..----------------------------------------------------------------------------GP
N1PMN4_DOTSN/176-511..----------------------------------------------------------------------------PS
V5G2M7_BYSSN/194-532..----------------------------------------------------------------------------PA
F8Q674_SERL3/166-485..----------------------------------------------------------------------------..
M3AA99_PSEFD/191-526..----------------------------------------------------------------------------AS
G4MR42_MAGO7/219-567.Q----------------------------------------------------------------------------QR
J3KI74_COCIM/186-524..----------------------------------------------------------------------------PN
G4U2Q1_PIRID/161-490..----------------------------------------------------------------------------..
R7YUM9_CONA1/175-511..----------------------------------------------------------------------------AQ
G8ZSF3_TORDC/186-519..----------------------------------------------------------------------------..
G0SXA1_RHOG2/160-497..----------------------------------------------------------------------------..
S3C4S1_OPHP1/236-610AG----------------------------------------------------------------------------AA
D8M8U8_BLAHO/154-504..----------------------------------------------------------------------------..
C3YFK8_BRAFL/171-477..----------------------------------------------------------------------------..
Q758T0_ASHGO/188-512..----------------------------------------------------------------------------..
M5C4C1_THACB/161-521..----------------------------------------------------------------------------..
U4L2E9_PYROM/293-612..----------------------------------------------------------------------------..
J4KLZ9_BEAB2/1246-1586..----------------------------------------------------------------------------PP
G7E1B8_MIXOS/165-515RK----------------------------------------------------------------------------TG
H2KS09_CLOSI/401-723..----------------------------------------------------------------------------..
W1NDY2_AMBTC/181-483..----------------------------------------------------------------------------..
COG4_ARATH/176-479..----------------------------------------------------------------------------..
H6C9G5_EXODN/179-515..----------------------------------------------------------------------------TQ
H3AVV6_LATCH/187-496..----------------------------------------------------------------------------..
K5V063_PHACS/174-511..----------------------------------------------------------------------------..
B6HSP5_PENCW/191-531..----------------------------------------------------------------------------.P
G3BC56_CANTC/190-528..----------------------------------------------------------------------------..
A0A068X7X6_HYMMI/106-417..----------------------------------------------------------------------------..
M7NUP8_PNEMU/161-484..----------------------------------------------------------------------------..
U7PW27_SPOS1/225-627AG----------------------------------------------------------------------------GG
E6ZNH9_SPORE/195-575.Q----------------------------------------------------------------------------PS
G0V8A6_NAUCC/189-534..----------------------------------------------------------------------------..
E7QLX6_YEASZ/190-525..----------------------------------------------------------------------------..
C5DUL4_ZYGRC/172-510..----------------------------------------------------------------------------..
E4UP45_ARTGP/209-548..----------------------------------------------------------------------------GA
K1R201_CRAGI/174-481..----------------------------------------------------------------------------..
Q6FTK7_CANGA/185-531..----------------------------------------------------------------------------..
D2V3G5_NAEGR/119-422..----------------------------------------------------------------------------..
G5C1P9_HETGA/267-575..----------------------------------------------------------------------------..
L8WI47_THACA/987-1357..----------------------------------------------------------------------------..
V2X3Q2_MONRO/169-474..----------------------------------------------------------------------------..
A7UW80_NEUCR/259-612..----------------------------------------------------------------------------QN
M2NB58_BAUCO/172-509.A----------------------------------------------------------------------------QK
C7ZFK3_NECH7/171-496..----------------------------------------------------------------------------.A
K1WSR6_MARBU/231-588..----------------------------------------------------------------------------PA
S0E9C5_GIBF5/167-499.F----------------------------------------------------------------------------QR
C4XYR0_CLAL4/197-532..----------------------------------------------------------------------------..
S2JH92_MUCC1/194-506..----------------------------------------------------------------------------..
E9IBA8_SOLIN/158-464..----------------------------------------------------------------------------..
A0A016PRI6_GIBZA/187-527..----------------------------------------------------------------------------PQ
G0R6U4_HYPJQ/191-531..----------------------------------------------------------------------------PQ
I2FV21_USTH4/206-592.Q----------------------------------------------------------------------------QP
A8NFV8_BRUMA/216-544..----------------------------------------------------------------------------..
G0SCB4_CHATD/176-523..----------------------------------------------------------------------------QN
W1QCQ6_OGAPD/210-555..----------------------------------------------------------------------------..
Q5AW68_EMENI/201-531..----------------------------------------------------------------------------.P

PF07393

Q750R9_ASHGO/111-822SKLSKVNSFIRSHLERDKKNAA..............RSPPLRQPTDNS............................PPPD
Q6BHS9_DEBHA/103-810KRLNQFTNFMKTHLSERNAR...........................N...........................STDFE
SEC10_ARATH/139-817ESSGTIGRSKGASISSSLQQ............................................................
Q2HG63_CHAGB/108-854AKDAYMERLDSSDLTPTQKRIM.............LRVAGVQDNSS................................NK
Q7PQN8_ANOGA/88-705KQIERFQELRRDMQALIGSR.......................................................ANINI
A1D556_NEOFI/126-876TKSDQESIGSEPSS..ALKS..................PNRFSTIASPALTPTVEA............PPTTELAAKAAV
Q2URB8_ASPOR/132-879SKSDEETSAGDAS...ALKG..................QNRFSTISMPTTPVTEA..............PTTELAAKAAI
E7KRR3_YEASL/120-862SKLSQFNSFLKTHLDKDHLSLN..............RTNTLSDSFNNSSSSTQYDVA.........NNSSSLVNSSFTAS
Q4RLZ1_TETNG/80-698RSIGT..GSIQELKERIRQR.......................................................TNLSL
Q55N90_CRYNB/170-1008GVVKEVKDGEEVVFEVTDVDEKTAEDMTNDDIMEGVRVTENVENVKEALEPSHASSSNDSHARSAAGSLESSHPSTPSPK
Q0IP77_ORYSJ/117-800ESTGTIGRSNGAAVTTSLQQ............................................................
A2EZD8_TRIVA/69-728KKLRQIIENAKKWLTRKEEV............................................................
Q2GXU3_CHAGB/166-960SANGSIAAADL......SQQ..................DSRAQSPAPSIQAAVDRSSSP.....MPGKAPTDELAAKAAL
Q2TVY5_ASPOR/116-891ARDAYINRLESSDFSPTQRRML.............LQVAGLRDANDLL..............................RR
Q5BGH2_EMENI/123-870QKPDRDSLAGD.SG..STPR..................ANRFSTISSPGTPPIQE.............APTTELAAKAAI
Q6CDC8_YARLI/101-777EDNKGIGNFMRNFRDRNERH........................................................STPD
EXOC5_DROME/89-705TATTK..GFRRNMEVLIATR.......................................................ANINI
A1DAY7_NEOFI/117-893ARDAYVNRLESSEFTPTQKKML.............LQLAGLKDQSDSM..............................KP
EXOC5_CAEEL/46-659HVKKQIGGGLHELKRDVAAR.......................................................LMN..
Q6FMF7_CANGA/102-810SKLSQITTFMKSRIDKDILPVS..............RSRSVKENENGS................................
A0A0D1E7P5_USTMA/134-1026SNTAQTSTAASSTVSTSKTSFFKLS.......NLADRVRGTHNTAATSSTLSVTAGSTATA.SAESSVDGQHVAGG..AH
SEC10_SCHPO/101-799GVHSQFNTKTEG........FL.............LRIADIQENLIQSG..........................SFITE
Q5KJ89_CRYNJ/95-875AISKYANLFTSSTNNPKTGTATPVLPPSFQKPGLAGQMRGA.NGADTATWGTGTSTPVI.....RSVTGQELKGDLVNKG
Q5AS51_EMENI/111-841AREAYINRLDSSEHSPTQKRVL.............IQVADLKESTDLA..............................RP
Q6CQC0_KLULA/109-807GRFSQLNLFLKNKFEKRFEH............................E..........................NPAQL
C4YGD5_CANAW/103-782KRMNQFKQYVTAKLKDRTRN...........................................................S

PF10191

Q7QA49_ANOGA/2-731YLLTYLDQYNKVQKQLAASQ-------------------------------------PSQT...................
Q29C94_DROPS/2-737IFKRQLENFGRIQRQLGLSL-------------------------------------GSSSYAAQS..............
Q172R1_AEDAE/2-704FVALYVEKYSTVQKQLMLNQ-------------------------------------NDE....................
COG7_RAT/2-767LFTKYVSHFTNALQSIRKKC-------------------------------------KLDDIPPNSLFQ...........
Q5FW35_XENTR/2-765LFKKYVTDFTLTLQSIRKKC-------------------------------------KLDNIPADSLFL...........
Q655R9_ORYSJ/5-868IMLQYISNLQETLKSLRIVC-------------------------------------GVDNTAHSDSSKKEAGLEKKEAQ
Q9FGN0_ARATH/4-832IMLQYISMLQETLKSLRVVC-------------------------------------GVDGTGDGVGSKKDASAEKRESS

PF08318

E9EW04_METRA/274-613APRSGTPRVNSPAVGG....------------------------------------------------------------
B6JXE3_SCHJY/165-484.........QSLKARLQGRV------------------------------------------------------------
COG4_DROME/166-496....GGGNLGSNSIQALGHY------------------------------------------------------------
M3D3E3_SPHMS/178-512QKSTLPTRTASPAPG.....------------------------------------------------------------
C4QWJ7_PICPG/179-518......VLVEALTTSSEDRS------------------------------------------------------------
B8LT52_TALSN/189-530QRATGTPRTGSPATRD....------------------------------------------------------------
S3CMB0_GLAL2/185-536..SFIPARTNSPAVGGGA..------------------------------------------------------------
COG4_SCHPO/163-481.........ILLHAKLKNRA------------------------------------------------------------
L8FSC8_PSED2/189-538RAAMGTTRTAGLGVGGDA..------------------------------------------------------------
F0XR72_GROCL/199-557TSLGTSPRIGSPAVADVDGV------------------------------------------------------------
V8NZE8_OPHHA/148-457....................------------------------------------------------------------
F6TNZ6_XENTR/114-423....................------------------------------------------------------------
G8BDV4_CANPC/186-525.LTDLHEH.....TVEQGRV------------------------------------------------------------
C5WWS3_SORBI/192-503............NLLSAMGS------------------------------------------------------------
A8X3I7_CAEBR/217-546....................------------------------------------------------------------
U1HW21_ENDPU/187-524RGNTGTPRSSSPANQP....------------------------------------------------------------
J3NYL1_GAGT3/212-567GGFGGTPRVNSPAGGAGTNS------------------------------------------------------------
D5GK94_TUBMM/197-545GPMGGPPRSGSPAPSGA...------------------------------------------------------------
F6I2Y2_VITVI/183-485....................------------------------------------------------------------
T1KVK7_TETUR/162-476....................------------------------------------------------------------
G8BYJ4_TETPH/194-538...KKNNRKLNGDSSDSEDS------------------------------------------------------------
Q5TNE6_ANOGA/167-491......NAGGGSTMGHYRKP------------------------------------------------------------
J4GWL1_FIBRA/183-513...........SGAGPAAIR------------------------------------------------------------
H2VA38_TAKRU/70-376....................------------------------------------------------------------
A3LT54_PICST/195-541.MNELQEQMNENRLSEE...------------------------------------------------------------
B7QAG5_IXOSC/93-401....................------------------------------------------------------------
C5LP43_PERM5/114-451................ECID------------------------------------------------------------
G3AM87_SPAPN/194-515..ITDEE.............------------------------------------------------------------
R8BYD5_TOGMI/1157-1500RGITGTPRVNSPALGSGSN.------------------------------------------------------------
A5DUI4_LODEL/191-536.MSDTMLEHEAGLEKQR...------------------------------------------------------------
F4NT70_BATDJ/197-515........QNRRKPQKGTSN------------------------------------------------------------
C5GF37_AJEDR/230-568ARGMGTPRANSPATRDAA..------------------------------------------------------------
B2AA74_PODAN/219-562RGFGGTPRVNSPAVGGTN..------------------------------------------------------------
N1JE83_BLUG1/191-526HKNASNSKPGTPVGVG....------------------------------------------------------------
W4ZDW5_STRPU/172-484..................RT------------------------------------------------------------
G0W4A1_NAUDC/213-564SISTDELQNDMENKNNNTST------------------------------------------------------------
Q4DDH2_TRYCC/242-662NARGQFPAGSVEAAAGSPVF------------------------------------------------------------
Q16TS8_AEDAE/167-489......SSGNPAAMGHYRKA------------------------------------------------------------
E9FQQ8_DAPPU/154-462....................------------------------------------------------------------
C5M6Q7_CANTT/193-537.LAELKEQMNQDQEGY....------------------------------------------------------------
V5GSU0_PSEBG/199-579TFKASFGVPGRTASPAAEST------------------------------------------------------------
X6MJK6_RETFI/5-348EKLLQQL.............------------------------------------------------------------
M2R7X1_CERS8/181-514........QYSLSPAIRKQP------------------------------------------------------------
A0A068Y5W7_ECHMU/114-419........FNNRPSTFASSG------------------------------------------------------------
D6WJA3_TRICA/162-474..................MS------------------------------------------------------------
G8Y9D0_PICSO/191-527.LDNTQEQLKDA........------------------------------------------------------------
Q57XU9_TRYB2/282-625..RGESNDNSGRSAVTSPRQ------------------------------------------------------------
G2Y0X2_BOTF4/187-528QRPTGISRTGSPAVGAAA..------------------------------------------------------------
E0VZ92_PEDHC/157-456....................------------------------------------------------------------
B0CT70_LACBS/161-472..........IPMFSSGIRR------------------------------------------------------------
Q59T37_CANAL/195-551.LAELKDHPNQDQESR....------------------------------------------------------------
E9QGT9_DANRE/180-489....................------------------------------------------------------------
K1WLQ9_TRIAC/267-644NISNALQSYAPRVKGGVTPA------------------------------------------------------------
F9XE54_ZYMTI/175-509QKPSSHLRTGSPAPG.....------------------------------------------------------------
C5DG77_LACTC/179-498.................NVS------------------------------------------------------------
K5Y4H4_AGABU/183-506..........ILMFTTTGRR------------------------------------------------------------
I1JS41_SOYBN/186-485...................N------------------------------------------------------------
K0KE72_WICCF/171-504.STMTSNSSRGGTPPPRSSF------------------------------------------------------------
K4CGD4_SOLLC/174-477....................------------------------------------------------------------
H2XLC7_CIOIN/111-421....................------------------------------------------------------------
S9VWR1_SCHCR/164-482.........LLLNAKIKHRN------------------------------------------------------------
U9TBS3_RHIID/182-496..........TQKRFSGLQK------------------------------------------------------------
E3Q612_COLGM/198-538QQRSGTPRVNSPAMGAGA..------------------------------------------------------------
Q6BTT0_DEBHA/227-568.FSDHEDPSGVDQ.......------------------------------------------------------------
K2S8E4_MACPH/175-516APSGGTPRSGSPAQRDRL..------------------------------------------------------------
G8JQJ6_ERECY/189-517......RGQWNKQQHFQQGS------------------------------------------------------------
A0A0C4EWA8_PUCT1/187-568AGNVQRTYNLPQSSVSSLNS------------------------------------------------------------
A9SCH4_PHYPA/154-467............HDMNFDMN------------------------------------------------------------
Q0UYP7_PHANO/174-513KPAGGTPRSNSPAN......------------------------------------------------------------
M9MH30_PSEA3/203-582TFKASFGAPARTASPAAGST------------------------------------------------------------
I2H5R5_TETBL/205-583GKVSSTEKNLHSRTNSSNEN------------------------------------------------------------
A7TT52_VANPO/190-542SLRRKNLNYNQNDNYQSDDD------------------------------------------------------------
T1J554_STRMM/179-485....................------------------------------------------------------------
A0A0D2XGD5_FUSO4/82-414GINFALR.............------------------------------------------------------------
A7RPW3_NEMVE/163-477....................------------------------------------------------------------
B4KHQ6_DROMO/161-491....NSSSMANSSMQSLGHY------------------------------------------------------------
A8NGP6_COPC7/165-479.............ITLASNR------------------------------------------------------------
D8QT59_SELML/156-463.........AEKDIVAQSKL------------------------------------------------------------
S8C8S4_DACHA/216-562SSGGGTPRSGSPRPGGL...------------------------------------------------------------
N1PMN4_DOTSN/176-511QKSSFNPRSDSPAPG.....------------------------------------------------------------
V5G2M7_BYSSN/194-532QRPAGTPRTGSPVNKDGT..------------------------------------------------------------
F8Q674_SERL3/166-485.........STLNTSSQKQA------------------------------------------------------------
M3AA99_PSEFD/191-526QKSALRLRSSSPAPA.....------------------------------------------------------------
G4MR42_MAGO7/219-567GGFGGTPRVNSPAGGVGTN.------------------------------------------------------------
J3KI74_COCIM/186-524PRGGGPQRANSPGIRDGT..------------------------------------------------------------
G4U2Q1_PIRID/161-490.......ATQVSSTQRTTVQ------------------------------------------------------------
R7YUM9_CONA1/175-511KPSAGTPRSGSPVKRDGAT.------------------------------------------------------------
G8ZSF3_TORDC/186-519....DEQSEENGGELHVNTS------------------------------------------------------------
G0SXA1_RHOG2/160-497.KKAAPKGTSPMTAQTGFEG------------------------------------------------------------
S3C4S1_OPHP1/236-610GLDGSLSRVNSPALGSSGD.------------------------------------------------------------
D8M8U8_BLAHO/154-504.................AYI------------------------------------------------------------
C3YFK8_BRAFL/171-477....................------------------------------------------------------------
Q758T0_ASHGO/188-512.........AQAQANKNHLH------------------------------------------------------------
M5C4C1_THACB/161-521.........QTLAPIARAKP------------------------------------------------------------
U4L2E9_PYROM/293-612LAGTKQARTGSPAVV.....------------------------------------------------------------
J4KLZ9_BEAB2/1246-1586QSRSNTPRMSSPAVGTGT..------------------------------------------------------------
G7E1B8_MIXOS/165-515FNAPFNTAPFRQMTNSPALT------------------------------------------------------------
H2KS09_CLOSI/401-723.........STSSGKSQSVA------------------------------------------------------------
W1NDY2_AMBTC/181-483....................------------------------------------------------------------
COG4_ARATH/176-479...................L------------------------------------------------------------
H6C9G5_EXODN/179-515RTASGTPRAGSPA.......------------------------------------------------------------
H3AVV6_LATCH/187-496....................------------------------------------------------------------
K5V063_PHACS/174-511.......QSLNTPAPIRRVA------------------------------------------------------------
B6HSP5_PENCW/191-531AQRPGPPRSQSPAV......------------------------------------------------------------
G3BC56_CANTC/190-528.LESEPPTRASSEF......------------------------------------------------------------
A0A068X7X6_HYMMI/106-417.........VNNRSSISATS------------------------------------------------------------
M7NUP8_PNEMU/161-484.....FLIKSFSSTLFQEPN------------------------------------------------------------
U7PW27_SPOS1/225-627GGGDGASRVNSPALGVD...------------------------------------------------------------
E6ZNH9_SPORE/195-575TFKASFGVPGRTASPAAGST------------------------------------------------------------
G0V8A6_NAUCC/189-534RQKQRTINNSMSDHNEVDND------------------------------------------------------------
E7QLX6_YEASZ/190-525.....KNEDVNIDSNQSDIE------------------------------------------------------------
C5DUL4_ZYGRC/172-510.PQYQQQQQQLQQQNQQYRE------------------------------------------------------------
E4UP45_ARTGP/209-548RGAAGTPRSNSPASWDT...------------------------------------------------------------
K1R201_CRAGI/174-481....................------------------------------------------------------------
Q6FTK7_CANGA/185-531..NKTQAYKDSGTDQNASQE------------------------------------------------------------
D2V3G5_NAEGR/119-422....................------------------------------------------------------------
G5C1P9_HETGA/267-575....................------------------------------------------------------------
L8WI47_THACA/987-1357.........QTLVPAARAKP------------------------------------------------------------
V2X3Q2_MONRO/169-474................SRRQ------------------------------------------------------------
A7UW80_NEUCR/259-612RGFGAPPRLNSPAPGT....------------------------------------------------------------
M2NB58_BAUCO/172-509PTIGSSPRTGSPAPG.....------------------------------------------------------------
C7ZFK3_NECH7/171-496WRQGQGV.............------------------------------------------------------------
K1WSR6_MARBU/231-588QKNMGITRTSSPAIGGGT..------------------------------------------------------------
S0E9C5_GIBF5/167-499GISFALR.............------------------------------------------------------------
C4XYR0_CLAL4/197-532.LTEFPEG............------------------------------------------------------------
S2JH92_MUCC1/194-506....................------------------------------------------------------------
E9IBA8_SOLIN/158-464....................------------------------------------------------------------
A0A016PRI6_GIBZA/187-527PPRGGTPRVNSPAIGQGN..------------------------------------------------------------
G0R6U4_HYPJQ/191-531PPRGGIPRMNSPAAGAGN..------------------------------------------------------------
I2FV21_USTH4/206-592TFKASFGVPGRTASPAAGST------------------------------------------------------------
A8NFV8_BRUMA/216-544....................------------------------------------------------------------
G0SCB4_CHATD/176-523RGFGGVQRVNSPAAGGGTN.------------------------------------------------------------
W1QCQ6_OGAPD/210-555.......PILVGSILRNIQT------------------------------------------------------------
Q5AW68_EMENI/201-531PQRTATPHANSPAT......------------------------------------------------------------

PF07393

Q750R9_ASHGO/111-822YTDLTHDEDPLFTLSCLDTMLKCAVESLARMMELI......PTNSSDFCVELVEVMLLGLISSYVESALE.AAY......
Q6BHS9_DEBHA/103-810KHEAESEKYSTLNINEVETVIKSAVESVARVLELA......PNKTPEYTLEIIEILLFDFGKLYISAGLE.VAYDT....
SEC10_ARATH/139-817...........ISVTVVTDFVRWNEEAITRCTLFSS....QPATLAANVKAIFTCLLDQV.SVYITEGLERARDSLSEAA
Q2HG63_CHAGB/108-854NDIEVSEQDGILSVAYAKRMIGWLAESVRRTLEMGS.....ASETPKDVNVLLNLLLTTMGQVYVETALD.AAL......
Q7PQN8_ANOGA/88-705AQIEDYGGETFLSEELAINLLQQSSHAFERCCLLSK.....ETDLPRNILKLTDTLLRYLLHEHCDYALD..........
A1D556_NEOFI/126-876MKSKLEGIRSLFSIEIALSLVHSAKSSLDRAAQFVKIGGETGAAAKQQCEAIFVSLLRILGHQHLIVGFNKAVDHL....
Q2URB8_ASPOR/132-879MKSKMEGIRSLFSIEVALSLVHAAKSGLERAAQFVQIGGDTGALAKQQCEAIFVALVRILGHRHLIVGFNKAVDHL....
E7KRR3_YEASL/120-862DIDNSPNSPANYSLNDVDSMLKCVVESTARVMELI......PNKAHLYILEILKIMFLGIVDSYMEIALE.VAY......
Q4RLZ1_TETNG/80-698GPVIDTHGETFLSPELVVNLLQETRHAFERCHRLSD.....PSDLPKNAFSIFLLLVEHLCVEHIDYALE..........
Q55N90_CRYNB/170-1008NNKSFDRLQLLVSLDTALELIQVDRDSLKRAETFVKYPGKVGTKVREAIEEIFIFLLKAVGDRHIAPGFKIATNQM....
Q0IP77_ORYSJ/117-800..........QISVTVVTEFVRWNEEAISRCTLLFS....QPATVAANVRSIFACLLDQV.SQYLTEGLDHARESLNHAA
A2EZD8_TRIVA/69-728....SYDIFSEFNPQMPITILTNGAAAWERCVVLCD.....PQRKHQVLKSLIDLVIQANLREYLITYLE..........
Q2GXU3_CHAGB/166-960MTSRLEGIKSLFSIEVALSLVHSAKASLGRVAVFIQLGGQAGGEAREQCEAIFVALLRILGSKHVKPGFDRAVAHL....
Q2TVY5_ASPOR/116-891TEIKLTEEDGLPSISHAKRMLKWLAEGVSRGLELSV.....SSETPKDMLALLTLLLSIMGEGYIEVCLD.AAL......
Q5BGH2_EMENI/123-870MKSKLEGIRSLFSIEVALGLVHAAKSSLERAARFMAIGGETGAAVKQQCEAIFVALLRILGHGHLIKGFDKAVDHL....
Q6CDC8_YARLI/101-777SPVPLEPEDGEIKIDVVQMCLKCLAESIQRVLELAH.....QNEINDCVVSLHDLLIESVGKSYIETGLD..........
EXOC5_DROME/89-705AAIEDYGGETFLSEELAINMLQEAKASLKRCRLLSN.....ETELPGNAIKLNDILLRFLMHEHVDYALE..........
A1DAY7_NEOFI/117-893TEIKLMEKDGLPNITYAKRMLKWLAEAVGRGLELGA.....TSETPKDVSALLSLLLSLMGEGYVEVCLD.AVL......
EXOC5_CAEEL/46-659..VETYGGETFVAEDVAISILQETKNAFGRANQLCD.....KEELPRHVENIVDVLLKYLYGEHLDYAVE..........
Q6FMF7_CANGA/102-810..PIDHAGDDGYNLETVDAIIKCIVEAIARVMELI......PNKATSCIYEILELASMGIIGSYVKNALE.VAY......
A0A0D1E7P5_USTMA/134-1026VEDELDDTDGDLSLDIAEKMLRWHAESIGRCVDLSS.....PSEVPKATFALLRVLTSAYIKTYVETALD.SAL......
SEC10_SCHPO/101-799DYITIEKNHSHLNSEKVYSFIGWHAEALNRASILIS.....SQDLSVVISSLVNLLDKLIREDYVFKELS.SIQ......
Q5KJ89_CRYNJ/95-875LEDKVWSTDGILAPTMAERMLKWHAEAVGRAVELSN.....SGDVGKNALALLKVLSEAIGRSFIETALD.STL......
Q5AS51_EMENI/111-841NDLIFTEEDGQPSISYAKRMLKWLAEAVGRGLELNM.....NNETPKDMATFLNLLLSIMGEGYLEVCLD.AAL......
Q6CQC0_KLULA/109-807NITSKKIDRDYFTLSYIDLMIKCSVESLARVTELV......PAIADDFTYELVETSLIGVIDSYIESALE.VAH......
C4YGD5_CANAW/103-782EPEPTFMECKSLNVGNVETVLKSVIESVARLLELV......PTKSADYALEVLEILIIDFGKLYIGAGLE.VVY......

PF10191

Q7QA49_ANOGA/2-731.........DWNLLQLSVVLLQYLGSFRQAAYEL-------EQTFLQQVLTKHSQL.................-------
Q29C94_DROPS/2-737........ENWSLLQYTMSQLQCLADFQVQLHQF-------EHDLHARMATLAAKL.................-------
Q172R1_AEDAE/2-704........INWSLMQLNLNLLQHLGDFMQIIEQC-------EKKIFVSL........................-------
COG7_RAT/2-767........EDWTAFQNSVRIIATCGELLRQCGDF-------EQQLANRILSTAGKYLSDSYSPRSLAGFQDSI-------
Q5FW35_XENTR/2-765........EDWSAFQNSVRIIGACGELLRQCGDF-------EQQLASRFLSIAGKHLSDTYSPRSLTGIQETS-------
Q655R9_ORYSJ/5-868RLVDVSEEEEWSIVQGALQILTVADCLTSRTSVF-------EASLRATLARIGTNFSISGFGSSLDKS..TAA-------
Q9FGN0_ARATH/4-832RKMDLTSNEEWSIVQGALQILTVADCLTSRSSVF-------EASLRATLARLNSSLSISLFGTNLDHNLSHLK-------

PF08318

E9EW04_METRA/274-613-GNPRSSEDEGVNMKEVDGLLNEIALMLGRWSLYTR-------------------FLSGKC...................
B6JXE3_SCHJY/165-484-IPIEQREAEAVPLLTLHPVLNEHGSIFSRWNAYKQ-------------------FISQLVWQ.................
COG4_DROME/166-496-RKPSGGSVDKLNPKEIDAIIAEITVMHARVELYFR-------------------FMRRRLQVH................
M3D3E3_SPHMS/178-512-SGRNSEDD.SVDMKEIDALLNESAIMLSRWSLYTR-------------------FLAGKT...................
C4QWJ7_PICPG/179-518-NVDRQPIDERISLSNIGDLLNELALILNRWSMYCK-------------------FFSSKW...................
B8LT52_TALSN/189-530-GLQEGEDE.GVDMKEIDAILNELGVMLERWSLYCR-------------------FVGDSC...................
S3CMB0_GLAL2/185-536-NGRTSEDE.GVDMKEVDALLNEAAMMLGRWSLYSR-------------------FLAGKCRVSPPTGV...........
COG4_SCHPO/163-481-FVSDQKELERVSLQTLHPILNEMSAIVSKWNISKI-------------------FISRLVL..................
L8FSC8_PSED2/189-538-NPRRSEDE.GVDMKEIDGILNETGMMLGRWSLYCR-------------------FLASRT...................
F0XR72_GROCL/199-557-SPRQSEDEGGVNMKEVDGLLSEIAVMLGRWSLYSR-------------------FLAMKS...................
V8NZE8_OPHHA/148-457-...RSLAGEKIEPRELDPILTEVTLMNARSELYLR-------------------FIRRRITSD................
F6TNZ6_XENTR/114-423-...RGSSTDKIEPRDLDPILSEVTLMSARTELYLR-------------------FIKRRVVSD................
G8BDV4_CANPC/186-525-SEDYEGLDDLVPIRYVGDLILELSLILHSWALYCK-------------------FVTIKY...................
C5WWS3_SORBI/192-503-MASAAGGNEGPDPREIELYLEEILALTQLGEDYTE-------------------FMVNKI...................
A8X3I7_CAEBR/217-546-FTAPEGLEDVPDALEVDAIASEICMMNTSVEMYWR-------------------FVSRRIGKNDADL............
U1HW21_ENDPU/187-524-NSRSSEDE.GVDMKEIDALLNEMAVMMGKWSLYVR-------------------FITDKC...................
J3NYL1_GAGT3/212-567-NPRASEDE.GVNMKEVDGLLAEIADMLGKWSLYTR-------------------FLAAKC...................
D5GK94_TUBMM/197-545-THRNSEDE.GVDVREVDMLLSEIGVMLGRWSLYCR-------------------FLARKC...................
F6I2Y2_VITVI/183-485-.RLSVGAAEGPDPREIELYLEEILSLMQLGEDYTE-------------------FMVSTI...................
T1KVK7_TETUR/162-476-STATANSINKVDPREIVGLLNDLMKINSRSETYFK-------------------FIRERTKKD................
G8BYJ4_TETPH/194-538-DAESMDGVQMISVNNISLLINEFSQILQNWSMYTR-------------------FFSVRW...................
Q5TNE6_ANOGA/167-491-SGGGGGSIDKLNAKDIDSLIGEITIMHSRAELYVK-------------------FIKRRCAND................
J4GWL1_FIBRA/183-513-RQTVGEEEDPVDPRDIDRVLTEAAGMGGRWSLFRR-------------------FMYDRLKEEFSDSEDD.........
H2VA38_TAKRU/70-376-...RSMPAEKMEPRELDPVLTEVTLMNARAELYLR-------------------FLRRRILSD................
A3LT54_PICST/195-541-NVDLNSTNDLVSIVQVGDLINELATILHHWSLYCK-------------------FITVKY...................
B7QAG5_IXOSC/93-401-...SSKQADKLDPRDLDVLLAEVALLNSRAELYIR-------------------FIGRRVASD................
C5LP43_PERM5/114-451-NNDASSIVDEIDLGEKDAVIDEICIIAQRCNQFDH-------------------YIHNISRQVVAELGNDD........
G3AM87_SPAPN/194-515-DTVVPIDDDLIPIRQVGDIISEMASIFHHWSLYCK-------------------FITAKY...................
R8BYD5_TOGMI/1157-1500-NQRDSEDE.GVNMKEVDGLLSEIAVMLGRWSLYSR-------------------FLAGKC...................
A5DUI4_LODEL/191-536-PYDETITDEILPIKSIGDLILELSSIIQSWSLYCK-------------------FVTIKY...................
F4NT70_BATDJ/197-515-LTDTQQMQPPVDPRELDLILGEITTVCQKAYYFDR-------------------FLRMRA...................
C5GF37_AJEDR/230-568-SQRSSEDE.GVDMKEIDGLLNEMAVMLGRWSLYSR-------------------FLADKC...................
B2AA74_PODAN/219-562-NGRQSEDE.GVDMKEVNALLSEIAVMLGRWSLYSR-------------------FLAGKC...................
N1JE83_BLUG1/191-526-NSNIHEEE.GISMKETDEILGEISMMLSRWSLYSR-------------------FLGGKC...................
W4ZDW5_STRPU/172-484-TYKSSNVHDKLDPRDLDVLLAECTLLNTRTELYLR-------------------FIRRRVTSD................
G0W4A1_NAUDC/213-564-IDNSSNKDIMIPMNQLSTLINEFSQILQNWSMYSR-------------------FFSVRW...................
Q4DDH2_TRYCC/242-662-PTTSSAVAATVDPRRTDQILEEMSHLVSCCHLYWT-------------------FAQSKQ...................
Q16TS8_AEDAE/167-489-S..GGGSVDKLNAKDIDALIGEITIIHSRAELYIK-------------------FIKRRCLND................
E9FQQ8_DAPPU/154-462-.TGGKVLHEKCDPRILDAVLAELTLLSSRTELYLR-------------------FLRRRIASD................
C5M6Q7_CANTT/193-537-RSSFESSDDLLPIRNIGDLIQELSSILENWSLYCK-------------------FITVKY...................
V5GSU0_PSEBG/199-579-ANSSFDEPSGPDGREVSKILTELAAMSSRWGYYRR-------------------FLQSRLSSGPDAGGGNRPKTLEDER
X6MJK6_RETFI/5-348-.........GFPLDKLDELLQEIAHVCSELESFDA-------------------TMRSYM...................
M2R7X1_CERS8/181-514-SQTGVIDEDIIDPREIDKVLTEIAGMSGRWALFRK-------------------FMYGRLQDYASDDEG..........
A0A068Y5W7_ECHMU/114-419-AGQNKQSLLWDYCLSTESLISDSVLFNARIELYLN-------------------FLRRRL...................
D6WJA3_TRICA/162-474-TSSSFGKLEKIDPKDLDISIGEITLMHFRTELYIR-------------------FIQRKVVSD................
G8Y9D0_PICSO/191-527-DGNEVETAGDISVIEIGDLVNEFSSILYNWILYCK-------------------FITVQF...................
Q57XU9_TRYB2/282-625-PRALQSRGTTLDPRRTDQILEEMSHLVSCYHLYWT-------------------FAQSKQ...................
G2Y0X2_BOTF4/187-528-NGRASEDE.GVDMKEVDGLLNEMAVMLGRWSLYAR-------------------FLSGKC...................
E0VZ92_PEDHC/157-456-...HVKSLEKIDPKSLDILLGELTLMHYKVDLYFK-------------------FVKRKL...................
B0CT70_LACBS/161-472-QQTMVADEAVIDPRDIDKVLSEIAGMMSRWNLFKK-------------------FLSEAL...................
Q59T37_CANAL/195-551-RTSFDTSDDLLPIRLIGDLIQELSSIFENWTLYCR-------------------FITVKYLQEP...............
E9QGT9_DANRE/180-489-...RGMTTDKIEPRDLDPVLCEVTLMNSRAELYFR-------------------FLRRRIVAD................
K1WLQ9_TRIAC/267-644-ATPIPEEDTGPDARDVDRILGELVALGGRWALFRR-------------------FIFARLREDAEPDAA..........
F9XE54_ZYMTI/175-509-SGRASEDE.SVDMKEVDALLNESAVMLGRWSLYTR-------------------FLASKT...................
C5DG77_LACTC/179-498-PEEEGLTSNAPSMSEVSGIINESSSILQNWSMYCR-------------------FFALKW...................
K5Y4H4_AGABU/183-506-QPTQGNEEPVVDPREIDKVLSETASMLGRWAMFKK-------------------FLLEALSGSTL..............
I1JS41_SOYBN/186-485-LLAVGGGPEGPDPREVELYLEEILNLMQLGEDYTE-------------------FMISKI...................
K0KE72_WICCF/171-504-DGTPRTSEDNLSVVHIGDVTTEFSAFLKYWSLYCR-------------------FVAVKW...................
K4CGD4_SOLLC/174-477-.DLLSVGIEGPDPRDIEVYLEEILSLTQLGEDYTG-------------------YMISKI...................
H2XLC7_CIOIN/111-421-SSKKPENEQKVDPRDLEPLLTEVTIISSRTELYLR-------------------FIKRRVQAD................
S9VWR1_SCHCR/164-482-LPSDQHEMERVSLQNLHPLLSEITSIITKWNMYKV-------------------FISRFIH..................
U9TBS3_RHIID/182-496-PGQLKEVDIIPDPRELDVILSELAMISARTHLYYR-------------------FLESRTK..................
E3Q612_COLGM/198-538-DQRDSEDE.GVNMKEVDALLSEIAIMLGRWSLYSR-------------------FLAGKT...................
Q6BTT0_DEBHA/227-568-ANVNPEEDELVSIVEIGDLVSELAGILHNWALYCK-------------------FITLKY...................
K2S8E4_MACPH/175-516-TGRASEDE.GVDMKEVDGLLGETAVMLRKWSLYTR-------------------FLATKT...................
G8JQJ6_ERECY/189-517-GHYSAEQDLPCTLNELSLLVSEYSAILQNWSMYCR-------------------FFALMW...................
A0A0C4EWA8_PUCT1/187-568-TAVVSHEEDTEDPREIDFLIAELAGMSSRWQTYRR-------------------FLCGRFGEFNLNETQNI........
A9SCH4_PHYPA/154-467-LLAVAAPPEGPDPREIEVCLEEMMLLSQTSEDYFH-------------------FMSTKM...................
Q0UYP7_PHANO/174-513-AVRTSEDE.GVNMKEVDGLLGESALMLGRWALYSR-------------------FISDKC...................
M9MH30_PSEA3/203-582-ANSSFDEPAGPDGREVDRILTELAAMSSRWGLYRR-------------------FLQGRLADGEESDKPDVERQSSLDD
I2H5R5_TETBL/205-583-NIQDLDSVVSFSINDLSLLIDEFSQILQNWSMYAR-------------------FFSIRW...................
A7TT52_VANPO/190-542-LANEISDIPDISINDISILINEFSQILQNWSMYSR-------------------FYSVRW...................
T1J554_STRMM/179-485-HSFQYRTTERVEPRELDVLLGELTLLNARAELYLR-------------------FIRRRLMND................
A0A0D2XGD5_FUSO4/82-414-GNELDKDEFDLDVKNVEGLFGEMTTMLRSWSLYER-------------------FIASQC...................
A7RPW3_NEMVE/163-477-IKGSSEKSERYDPRDMEVLLGEVVLMNTRTEMYLR-------------------FLEKKIQAD................
B4KHQ6_DROMO/161-491-RKPSGGSIDKLNPKDIDAIIAEITVMHSRIELYFR-------------------FMRRRLQAN................
A8NGP6_COPC7/165-479-KPPPPNEDLAIDPREIDKVLSELSGMIGRWNLFRK-------------------FLLDALKD.................
D8QT59_SELML/156-463-LMSAGGAAEGPDLRSIEMFLEEILLLIQTSEDYTQ-------------------YMIGRV...................
S8C8S4_DACHA/216-562-GPRNSEDD.GIDVKEIDSLLNELSLMISRWSLYSR-------------------FIARKCMPAL...............
N1PMN4_DOTSN/176-511-SGRVSEDE.GVDMKEIDALLNESATMLGRWSLYAR-------------------FLASKT...................
V5G2M7_BYSSN/194-532-QGDQMEEE.GVDMKEVDAILNEMAVMLERWSLYSR-------------------FLADKC...................
F8Q674_SERL3/166-485-FHQVSVEDEVIDPREIDKASTEIAGMAGRWSLFRR-------------------FLIEQLTDN................
M3AA99_PSEFD/191-526-SGRPSEDE.SVDTKDVDALLNESAIMLGRWSLYTR-------------------FLATKT...................
G4MR42_MAGO7/219-567-DPRQSEDE.GVNMKEVDGLLAEIAVMLGKWSFYMR-------------------FLAVKC...................
J3KI74_COCIM/186-524-SNRASEDE.GVDMKEIDGILNEMSLMLGRWSLYSR-------------------FLADKC...................
G4U2Q1_PIRID/161-490-LSAAESEEEASNAREVDKIVSEIAGLAGRWGLFRR-------------------FLLERLKADDTST............
R7YUM9_CONA1/175-511-AGRSSEDE.GVDMKEVDGLLGEAAVMLGRWALYGR-------------------FIASKA...................
G8ZSF3_TORDC/186-519-VEWDTKKPDTLSLGDLSDLVNEFSSMLQNWSMYSR-------------------FFSVRW...................
G0SXA1_RHOG2/160-497-ANGAAQAEGDINPREIDAVLTELTMMSGRWELLRR-------------------FLYGTLKTPPATAP...........
S3C4S1_OPHP1/236-610-PSAPDDDEGGVSMPQVNTLISEMASLLSLWAFYTR-------------------FLAGKCGEQP...............
D8M8U8_BLAHO/154-504-SNEQGVEDAALDA..LNPVLNEISLILQHAESFSR-------------------YLTGKMNDA................
C3YFK8_BRAFL/171-477-...GRTGTEKPDPKELDTLLAEVTLINSRAELYLR-------------------FFRRRVTAD................
Q758T0_ASHGO/188-512-GAKPNSRPPPSSINELTMLISEYSAIFQHWSMYCR-------------------FFALKW...................
M5C4C1_THACB/161-521-GQTSAIDDSGPDPREIDRVLGELATMAGRWALFRR-------------------FLVDRLEDDMTPSAPPTPDGTTLLL
U4L2E9_PYROM/293-612-...VDNEEETIDIKTVDLLLSEIGVMLSRWSMYCR-------------------FLGRKC...................
J4KLZ9_BEAB2/1246-1586-DGRGSEDE.GVNMKEVDALLSEIAVMLGRWSLYTR-------------------FISGKC...................
G7E1B8_MIXOS/165-515-ASQSAQDDDSLDPRTIDALLSEVAQISNRWQLYRK-------------------FIYSRLVHSKIP.............
H2KS09_CLOSI/401-723-STGSQEGLQFERVLSLEPIISEVVLLNTRTELYMR-------------------FMRRHV...................
W1NDY2_AMBTC/181-483-NLLSVGVLEGPDPREIEMYLEEILALTQLGEDYTE-------------------FMVSKI...................
COG4_ARATH/176-479-NILPGGASEGPDPREVELYVEEILSLMQLGEDYTE-------------------FMVSKI...................
H6C9G5_EXODN/179-515-PGRTSEDE.SVDMKQVDALLNEMTIMLGKWSLYTR-------------------FVAAKC...................
H3AVV6_LATCH/187-496-...RGAITDKIESRELDTVLSEVTLMNARAELYLR-------------------FIKRRISSD................
K5V063_PHACS/174-511-SHAGAVDEDQVDAREIDRVLTEVAGMAGRWSLFRK-------------------FLYERLKDSEDEDEDQS........
B6HSP5_PENCW/191-531-GASTATDEEGVDMKEIDGVLNEMAIMLGRWSLYCR-------------------FLADTC...................
G3BC56_CANTC/190-528-SRSSFEDNELVTIVEAGDLFSEFANIFNYWSLYCK-------------------FISTRY...................
A0A068X7X6_HYMMI/106-417-NGHGKEKSLYEYCLSTESVISDTVLFNARIELYLN-------------------FLRRRL...................
M7NUP8_PNEMU/161-484-SSLLSQENKAIDIKNIDLLVEEISSILNHWSLYHR-------------------FISVKC...................
U7PW27_SPOS1/225-627-SPRRSEDEGGVNMREIDGLLNEIAIMLSRWSLYSR-------------------FLANKCRDDEAEAAAQAEADAKD..
E6ZNH9_SPORE/195-575-ANSSFDEPAGPDGREVDRILTELAAMSSRWGLYRR-------------------FLQSRLASEHDAAEAGKGTLEDERA
G0V8A6_NAUCC/189-534-DGGDDSSMMNFSMNQLVVLVNEFSQILQNWSMYAR-------------------FFSVRW...................
E7QLX6_YEASZ/190-525-TDGETEKSSIISIHDLALLIMEFSQILQNWSMYSR-------------------FYSVKW...................
C5DUL4_ZYGRC/172-510-GSNEEAINEPITVAELSSLMTEFSQILQNWSMYSL-------------------FFSVRW...................
E4UP45_ARTGP/209-548-PQRNSEDE.GVDMKEIDSILNEISVMLGRWSLYGR-------------------FLASKC...................
K1R201_CRAGI/174-481-.FHRPSATEKFDPKVLDVLLSEVVLLNTRTELFLR-------------------FFRRRAVGD................
Q6FTK7_CANGA/185-531-RKSMDNKLPSISTGDLSGLIGEFSQILQNWSMYLK-------------------FFSVRW...................
D2V3G5_NAEGR/119-422-TLPIKKDLNTNDPRVLDLILEEIAEISSNIEVYKQ-------------------FIAGKC...................
G5C1P9_HETGA/267-575-...RNSAPEKIEPRELDPILTEVTLMNARSELYLR-------------------FLRKRISSD................
L8WI47_THACA/987-1357-GQLSAIDDSGPDPREIDRVLGELATMAGRWALFRR-------------------FLVDRLEDDMTPSAPPTPDGTTLLF
V2X3Q2_MONRO/169-474-NPNLLPDEDLMDPREVDKLLIEMSGMVGRWSLFKR-------------------FLLDSQ...................
A7UW80_NEUCR/259-612-DGRNSEDE.GVNMREVDALLSEIAIMLSRWSAYSH-------------------LLAQKC...................
M2NB58_BAUCO/172-509-SGRASEDE.GVDMKEVDALLGESAVMLGRWSLYIR-------------------FLATKT...................
C7ZFK3_NECH7/171-496-KVETEADQTSIDMRMMDELVSEMTAMLQQWSLYSR-------------------FIARQS...................
K1WSR6_MARBU/231-588-NGVESEDE.GVDMKEIDGLLNETAMMLGRWSMYSR-------------------FLAGKCRVSRPDI............
S0E9C5_GIBF5/167-499-GNETNKAKVNLDVKKVEELFGEMTSMLKSWSLYKR-------------------FVTSRC...................
C4XYR0_CLAL4/197-532-DSNDANDVDLVSIVEVGDLIHEFSAILHHWALYCK-------------------FIVVKY...................
S2JH92_MUCC1/194-506-QAETESTNPLVEPRQLDANLYELSLLSQRSVLFNS-------------------FMNERASD.................
E9IBA8_SOLIN/158-464-....KPSPERLDPKELDLLLGEITIMHSRAELYIR-------------------FIKRRVKND................
A0A016PRI6_GIBZA/187-527-NPRESEDE.GVNMREVDGLLSEIAVMLGRWSLYTR-------------------FLAGKC...................
G0R6U4_HYPJQ/191-531-NPRNSEDE.GVNMKEVDGLLHEISVMLAQWSFYTR-------------------FISVKS...................
I2FV21_USTH4/206-592-ANSSFDEPSGPDGREIDRILTELAGMSSRWGLYRR-------------------FLQSRLAPEQDDGDAAKGNRQRTLE
A8NFV8_BRUMA/216-544-.NSDKYPLDKIDVLELDVLLSEVTLMHTRTHLYWR-------------------YLKRRLNMANMKTDEQP........
G0SCB4_CHATD/176-523-DGRNSEDE.GVNMKEIDALLFEIAAMLEKWSVYSR-------------------FIATKC...................
W1QCQ6_OGAPD/210-555-DEELQDDNVVISLAEVSSLIDELSAMLNHWAMYCK-------------------FFVVSW...................
Q5AW68_EMENI/201-531-QQSAAEDE.GVDMKEIDGLLNEMTVMLSRWSLYTR-------------------FLAETC...................

PF07393

Q750R9_ASHGO/111-822..................SQLISSDPAQTTN.LNLS.YMKYVSKTTEMLSLISASIK-A---------------------
Q6BHS9_DEBHA/103-810................LKQESSNSKINSNQP.IDLS.YLSTFKLTSEILYLLSSCIK-K---------------------
SEC10_ARATH/139-817ALRE....RFVLGRRVAAAAASAAEAAAAAGESSFKSFMVAVQRCGSSVAIVQQYFA-N---------------------
Q2HG63_CHAGB/108-854..................DQATSQE.NAKNE.PDLS.YLPNLRPAVTITNLMSRFIT-T---------------------
Q7PQN8_ANOGA/88-705..................LGLQAIPIAECKSVPQIY.FFDVAQKCNAIVHLLEKTYN-A---------------------
A1D556_NEOFI/126-876................SNYRPREQGERDQAGVEPLVTFLELVNVGDLILQMMDVFYE-Q---------------------
Q2URB8_ASPOR/132-879................SNYRPREQGERDQSGVEPLVTFLELVNVGDLILQMIDVFYE-Q---------------------
E7KRR3_YEASL/120-862..................WKICKVDINKTAGVVNLN.FLKFISMSTEILDLLSISIK-S---------------------
Q4RLZ1_TETNG/80-698..................IGLSAIPSSDAKN.ANLY.FLDVVQQANSIFHLFDKQFH-D---------------------
Q55N90_CRYNB/170-1008................STYKPAEHE..ETTSVAPLLQFFELVHIGDTIQSMVQVYFD-K---------------------
Q0IP77_ORYSJ/117-800TQRDRYVIGTSVSRRVATAAANAAEAAAAAGESSFRSFMIAVQRCASSVAILQQYFS-N---------------------
A2EZD8_TRIVA/69-728....................ACRICMMKENDINTVPRFLAITSVINMSILTIEAKYS-Q---------------------
Q2GXU3_CHAGB/166-960................SQYNPREVSEHDKGGVAPLVTFIELVNVGDLISQMIDVFYE-Q---------------------
Q2TVY5_ASPOR/116-891..................ETATSQE.LGKTE.PDFA.YLPAVRSAIGIANLMVMCIN-T---------------------
Q5BGH2_EMENI/123-870................SDYRPREQGDRDQSGVEPLVTFLELVNVGDLILQMIDVFYE-Q---------------------
Q6CDC8_YARLI/101-777..................DAIVSRDMKTISFV.....HLKTIRRVLTAIRLMSVVIN-S---------------------
EXOC5_DROME/89-705..................LGLQAVPLAEGRVFPQLY.FFDVVQKTNIIVHLLDKLCH-T---------------------
A1DAY7_NEOFI/117-893..................ESATSQE.SARAE.PDFG.YLTVVKSIVSITNLMVMCIQ-T---------------------
EXOC5_CAEEL/46-659..................TGLAGISLAESKTEPPAY.FFSVVAKCTSVILLMIKQFE-D---------------------
Q6FMF7_CANGA/102-810..................CSISKPEQNKVDE.IDLS.SMKYISITTEILSLLSTLIK-S---------------------
A0A0D1E7P5_USTMA/134-1026..................AAVTAQDIRGAVM.PDPSAAMSVVRSVELLISLWQHYVN-T---------------------
SEC10_SCHPO/101-799..................SYISSHD...KSKNLDLH.YLVDIRECKKIMGYFSAYLM-S---------------------
Q5KJ89_CRYNJ/95-875..................ARLEQQD..NKTE.PDLQ.PLAVLKPADQICHLWQRYTT-T---------------------
Q5AS51_EMENI/111-841..................EAAATQE.SGRTE.PDFA.FLRAVRDSISIANLM.....-.---------------------
Q6CQC0_KLULA/109-807..................AQLNSIDIHRETS.IELK.FLKYISTATEMISIVSAYIK-S---------------------
C4YGD5_CANAW/103-782..........................DECKKNASLD.YLSSFNTISELLFLMSSCIK-R---------------------

PF10191

Q7QA49_ANOGA/2-731------------------...TAGSARARF.EYRLNTKGEFNELHKLATTFQQPSSE-S.....................
Q29C94_DROPS/2-737------------------...TKQSSRGNITIFQTCDHAARTQLLNAIADYQQKKAE-A.....................
Q172R1_AEDAE/2-704------------------......EPREVDSGNSTICNQRIIRHNTKARDLLAPSVD-A.....................
COG7_RAT/2-767------------------LTDKKSPAKNPWQEYNYLQKDNPAEYANLMEILYTLKEK-G.....................
Q5FW35_XENTR/2-765------------------YSDRKSS.RNPWHDYNYLQKGDPAQYANLMETLYMLKEK-G.....................
Q655R9_ORYSJ/5-868------------------NGDENAEVPITGRAALDIAAIRLTDLPDKSKKLFTVLEQ-ASYIFLNYLASVTTLELSHVSL
Q9FGN0_ARATH/4-832------------------SEQTAGDLSMAGRASMDVAAIRLVDVPEKAHKLLNLLEQ-S.....................

PF08318

E9EW04_METRA/274-613..................................MVP.....SDEDALLVLPELLIK.S---------------------
B6JXE3_SCHJY/165-484........................LGRDEYKPGAPIT.....IPEGTKVPLAPLFAK.S---------------------
COG4_DROME/166-496........................VETCVPEKEQF..........DIMERYEKIMKN.S---------------------
M3D3E3_SPHMS/178-512.................................SAED.....HNLDDDLHLPSFLTH.S---------------------
C4QWJ7_PICPG/179-518.............................NEFKNEGE.....PGKTEITSLPEALFN.S---------------------
B8LT52_TALSN/189-530..........................RPVEEN..........GNAEAPLELPEFLVE.S---------------------
S3CMB0_GLAL2/185-536...................LQQAISKLSQDPE..........ADAEEPLVMPDLLHK.S---------------------
COG4_SCHPO/163-481..........................RLSQSDGTSND.....PSVQDNLICASIFNS.S---------------------
L8FSC8_PSED2/189-538..........................K..EPG..........TSENAPLSMPPFLTK.S---------------------
F0XR72_GROCL/199-557..................................RPP.....DDTSDFPPLPPVIAQ.S---------------------
V8NZE8_OPHHA/148-457........................FEVGDSVASEEVK.......QEHQKCLDKLLHN.C---------------------
F6TNZ6_XENTR/114-423........................FEVGDSMATEEVK.......QEHLQNLDKLIKH.C---------------------
G8BDV4_CANPC/186-525...................................FH.....QSDSSELTMPMIITK.S---------------------
C5WWS3_SORBI/192-503................................RGLRD.....VKPELGPRAMKAFRN.G---------------------
A8X3I7_CAEBR/217-546...................ARSPSGDGDEEEDEEARLERQRLRKEAKEQKMDQLLNR.S---------------------
U1HW21_ENDPU/187-524..........................K...............PSNDIDWDVPTFLTS.S---------------------
J3NYL1_GAGT3/212-567..........................K..EPE..........TPDDSPLVIPPVIKN.S---------------------
D5GK94_TUBMM/197-545................................LVGAK.....TDILPPLAAPPIITN.S---------------------
F6I2Y2_VITVI/183-485................................KGLSS.....VDPELGPRATKAFRN.G---------------------
T1KVK7_TETUR/162-476........................IDSSINEDDDNL......SVEEKLKKVDSLIRN.C---------------------
G8BYJ4_TETPH/194-538................................NEFND.....IK.YTKLDYAPSLLE.S---------------------
Q5TNE6_ANOGA/167-491........................LEKSSLPAEVKQ.........ERLAELQTLLQK.S---------------------
J4GWL1_FIBRA/183-513.................EEDRPPASPRPKPERNQKVD.....EDAGTLPGGIQAVES.C---------------------
H2VA38_TAKRU/70-376........................FEVGDV...QSIT.......QEHQQNVEKLLKH.C---------------------
A3LT54_PICST/195-541.................................FKDE.....STDGKELKLPDLILN.S---------------------
B7QAG5_IXOSC/93-401........................FEVAYQEPAVRAG.......KHQAGYFSEALD..S---------------------
C5LP43_PERM5/114-451................KRRLMYGEVAPDEKDYNEDHH.....HHKSRNTYGEDGLPIMT---------------------
G3AM87_SPAPN/194-515....................................F.....PTPQPPLKLSELIVK.S---------------------
R8BYD5_TOGMI/1157-1500..........................K..EPD..........APEDAPLVTPEVLTK.A---------------------
A5DUI4_LODEL/191-536.................................FDTR.....QTPQSELQVPELILN.S---------------------
F4NT70_BATDJ/197-515..............................SDQVNTLKANASSDSLSENGKDGLMPT.S---------------------
C5GF37_AJEDR/230-568..........................S...............NDNHEELELPDFIIQ.S---------------------
B2AA74_PODAN/219-562..........................R...............SPDDAPLTMPEVLTK.S---------------------
N1JE83_BLUG1/191-526..........................R..DPH..........QSPEIPLQMPKLLLD.S---------------------
W4ZDW5_STRPU/172-484........................IEVCDEDGPAKE.........ERLSSLDRMLRD.C---------------------
G0W4A1_NAUDC/213-564................................NEFSD.....IK.TTVLTPPKPIGD.S---------------------
Q4DDH2_TRYCC/242-662.............................QEYMHGVEATGKQHEQQEVVVSVDSLWS.S---------------------
Q16TS8_AEDAE/167-489........................LEKSTLETEAKD.........AKLKQLDDLIKK.S---------------------
E9FQQ8_DAPPU/154-462........................LEVGIPDENSRQ.........LRMNEFEKLLQSKI---------------------
C5M6Q7_CANTT/193-537..............................LENPSTD.....PSKEVTLNLPDLIRK.S---------------------
V5GSU0_PSEBG/199-579AA...QADEALKDFRRTSVDRRSSIASSANAPPIDA......EQDEELADSIDHATQ.S---------------------
X6MJK6_RETFI/5-348...........................SDAKQMIEQS.....NNSLLEQEVPKNFPA.E---------------------
M2R7X1_CERS8/181-514.................DEDGDINGQRNGSADASELP.....LSPAKSADSFQVLEK.S---------------------
A0A068Y5W7_ECHMU/114-419............................STGTLQKSE.....KEHENSTEIRQFFNQ.C---------------------
D6WJA3_TRICA/162-474........................LDVGVQDEDEKP.........KVLKSLENLIKT.S---------------------
G8Y9D0_PICSO/191-527...............................FRDDAG.....NDDDDESKLPQLLSD.S---------------------
Q57XU9_TRYB2/282-625...........................QECTQRVREKEGGAREQNDGMNQSADSLWS.S---------------------
G2Y0X2_BOTF4/187-528..........................R..DPE..........ASPDEPLIMPELLDK.S---------------------
E0VZ92_PEDHC/157-456.................................SKNS.....KDPELLNKIETLMKC.C---------------------
B0CT70_LACBS/161-472............................KKESTEEPE.....NLTSQHLSETRLVDD.T---------------------
Q59T37_CANAL/195-551......................KHRQNGKEVVTGKSP.....TEDKDALLLPDLIRK.S---------------------
E9QGT9_DANRE/180-489........................FEVADAMADEAVI.......QEHQQSLEQLLKN.C---------------------
K1WLQ9_TRIAC/267-644.................TSDPSKRAEGADGAEDSGEG.....EVSAKTADVDESILT.S---------------------
F9XE54_ZYMTI/175-509..................................APT.....QEDDAKLHLPAFILH.S---------------------
C5DG77_LACTC/179-498................................REFSD.....QSSEDPLTLPAPICD.G---------------------
K5Y4H4_AGABU/183-506.....................PDETGGNNDEGESEQT.....RTNNRMEESSLQLEE.T---------------------
I1JS41_SOYBN/186-485................................KALTS.....VDPELLPRATKAFRS.G---------------------
K0KE72_WICCF/171-504.................................NEYQ.....GLKQDELKLPKPILE.S---------------------
K4CGD4_SOLLC/174-477................................RGLSS.....VDPELGPRATKAFRS.G---------------------
H2XLC7_CIOIN/111-421........................IEIVFPTKEIKQ.........ERQKELQAWITN.C---------------------
S9VWR1_SCHCR/164-482..........................RLLNPDPSTLK.....SPDERSFECANVFLS.S---------------------
U9TBS3_RHIID/182-496..........................LEVEAMQVNGTDVSLLEKDANKYDSSVIIKN.S---------------------
E3Q612_COLGM/198-538..........................Q..DPS..........SPENALLSMPEVVVK.S---------------------
Q6BTT0_DEBHA/227-568...............................YQSNDG.....TDNDEGLKLPKLIMD.S---------------------
K2S8E4_MACPH/175-516.............................APEPEFPD.....GTDTVPLTMPDFLSS.S---------------------
G8JQJ6_ERECY/189-517................................NEFSE.....KQ.VESLEIPDILST.G---------------------
A0A0C4EWA8_PUCT1/187-568...............LERPDEPQSPISPSTVPKEQHA.....SPPAHISKQFEQLGQ.T---------------------
A9SCH4_PHYPA/154-467................................KEAGA.....TSGQLSPRESNSFKA.G---------------------
Q0UYP7_PHANO/174-513...............................ASSQPE.....ERIDHGLVMPEFLAT.S---------------------
M9MH30_PSEA3/203-582QRA.SQADEPLKDFRRSSVDRRDSVAGSLGDAD.........AATETPPDSIDHAAE.S---------------------
I2H5R5_TETBL/205-583................................NEFSD.....IK.FNILQPPPPIAN.S---------------------
A7TT52_VANPO/190-542................................NEFND.....IE.TIVLTIPPSISE.G---------------------
T1J554_STRMM/179-485........................IEVLDKGQA............DLVNKMEKVLKD.C---------------------
A0A0D2XGD5_FUSO4/82-414..................................KGL.....LDQEEKLPLPKFLDQ.C---------------------
A7RPW3_NEMVE/163-477........................YENLPDEDVQECA........DVNKVLDKLINN.S---------------------
B4KHQ6_DROMO/161-491........................AETCLQDKDAQN.........MVLKEYERVVKH.C---------------------
A8NGP6_COPC7/165-479........................DDADADVVLDDAG.....EKTDATIPDTKLLDN.T---------------------
D8QT59_SELML/156-463................................REAGS.....SGAQLSPRSTTSFKV.G---------------------
S8C8S4_DACHA/216-562.......................PPTTPTTNG..........FPKEPALILPPVITK.S---------------------
N1PMN4_DOTSN/176-511................................ASPKD.....GNLDDKLHLPPYLTH.S---------------------
V5G2M7_BYSSN/194-532..................................KDP.....EDNEDAFTLPEFVAE.S---------------------
F8Q674_SERL3/166-485........................SAIDEDRDEISVK.....TQSQVTSDGTEVIQA.T---------------------
M3AA99_PSEFD/191-526................................AKSSD.....DTPDSKLHVPAFIVH.S---------------------
G4MR42_MAGO7/219-567..........................R..DNS..........TPEDTPLVTPPVIRN.S---------------------
J3KI74_COCIM/186-524..........................G...............NDDSEEFLLPNFLLE.S---------------------
G4U2Q1_PIRID/161-490...................PVSPTEQRMSRDDKPAAE.....PRTIADGPEVAMIRA.A---------------------
R7YUM9_CONA1/175-511..........................................VTESTVLSMPQFLAN.S---------------------
G8ZSF3_TORDC/186-519................................YEFLG.....STEMSTLKCPPPIAD.S---------------------
G0SXA1_RHOG2/160-497..................APSTTATATLEADPNARAP.....EAALSDEADLEVAEN.S---------------------
S3C4S1_OPHP1/236-610.......................AASTGEANGSQQLQ.....QPATPTLVYPSVLAQ.S---------------------
D8M8U8_BLAHO/154-504.......................VLAASQRVPPDSEMLTHYPSTANVPADVVAALRS.A---------------------
C3YFK8_BRAFL/171-477........................FEVQYQEEDRRK.........DKLSELDRLVRT.C---------------------
Q758T0_ASHGO/188-512................................DEFSQ.....NT.ATELELPSLISE.G---------------------
M5C4C1_THACB/161-521RPT..TPGPATPGFGLKLLTPANASFQKPIEPEPEKE.....PELSAHEKALDLVSQ.T---------------------
U4L2E9_PYROM/293-612.................................QPTS.....TSPDALLSLPPVISN.S---------------------
J4KLZ9_BEAB2/1246-1586..........................V..VPD..........S.DDSTLPTAEVIIR.S---------------------
G7E1B8_MIXOS/165-515.....................MDEDSVRQSDTLLESL.....AFTVSTDALIDLIEK.S---------------------
H2KS09_CLOSI/401-723..............................VADAQSVALSETELQNKFKEITAVFDN.C---------------------
W1NDY2_AMBTC/181-483................................GGMAA.....LDPQLAPRATKAFRS.G---------------------
COG4_ARATH/176-479................................KSLTS.....VDPELLPTATKAFRN.K---------------------
H6C9G5_EXODN/179-515..........................H...GA..........TVDDEPQKMPPFLVN.S---------------------
H3AVV6_LATCH/187-496........................FEVGDATASDEVK.......QEHQKALDKLLNH.C---------------------
K5V063_PHACS/174-511................NDRSRPQTPQPPPTARSQAFE.....PVDTGVSDALEAIEA.S---------------------
B6HSP5_PENCW/191-531..............................NSSGEDD.....ADDDKRFELPSFLRE.S---------------------
G3BC56_CANTC/190-528....................................L.....NASASPKLVPKLLVD.S---------------------
A0A068X7X6_HYMMI/106-417............................LPNVTQENG.....KDHEVSSEIRRFFNQ.C---------------------
M7NUP8_PNEMU/161-484................................MEQKQ.....NKLEEIAIKPDSMIL.A---------------------
U7PW27_SPOS1/225-627..........TKKEKSGKDGQDGQDSKDSSTERATAA.....TPDERPLVIPSVLAQ.S---------------------
E6ZNH9_SPORE/195-575AQ....ADEPLKDFRRTSLDRRSSIASSINAPHDPTA.....IDSTLPTTPIDHASA.S---------------------
G0V8A6_NAUCC/189-534................................NEFSD.....LEPANILIAPTPISN.S---------------------
E7QLX6_YEASZ/190-525................................NEFSD.....LH.PHVLQPPPPIAD.G---------------------
C5DUL4_ZYGRC/172-510................................YEFRN.....ET.KSPLQPPSPILN.G---------------------
E4UP45_ARTGP/209-548..................................RED.....GADDDDLELPSFLTG.S---------------------
K1R201_CRAGI/174-481........................MESAYSNDDLK..........EKIKEIDKFISN.C---------------------
Q6FTK7_CANGA/185-531................................NEFSN.....EN.PSVLTLPSSLET.S---------------------
D2V3G5_NAEGR/119-422.....................................I...NIKTDGKNEMYTLTKE.P---------------------
G5C1P9_HETGA/267-575........................FEVGDSMASEEVK.......QEHQKCLDKLLNN.C---------------------
L8WI47_THACA/987-1357KPT..TPGPATPGFGLKLLTPANTSFQKSIEPEPEKE.....PELSPHKKALEIVTQ.T---------------------
V2X3Q2_MONRO/169-474............................DTTVQGGVE.....DEVAPAVVELALLES.T---------------------
A7UW80_NEUCR/259-612..........................T..EPG..........VSEDAPLTMPEVLTK.S---------------------
M2NB58_BAUCO/172-509................................AAESE.....DGEDVKLTIPSFLTH.S---------------------
C7ZFK3_NECH7/171-496.................................QDAD.....LPDDGSLAIPEFLAS.C---------------------
K1WSR6_MARBU/231-588...................LLQAISKISQDHH..........ESPEEPLVMPELLLK.S---------------------
S0E9C5_GIBF5/167-499..................................KGV.....LDQEEKQPPPKFLDQ.C---------------------
C4XYR0_CLAL4/197-532...............................FNPKMP.....SPPDEGLKAPDLLIE.S---------------------
S2JH92_MUCC1/194-506.........................EMDVLESDENEKELVMKGKDSKFYGANGLLLS.S---------------------
E9IBA8_SOLIN/158-464........................IEISTTDEAQRT.........ELLNEFEMTVNN.S---------------------
A0A016PRI6_GIBZA/187-527..........................K..DAE..........TPDEAPLVIPDVLVK.S---------------------
G0R6U4_HYPJQ/191-531..........................M..DPE..........V.QDAPLRLADLLVK.S---------------------
I2FV21_USTH4/206-592DERATQADEPLKDFRRTSIDRRISIASSVNGPFPNDGM...ADEHALPFEPVDLAAE.S---------------------
A8NFV8_BRUMA/216-544...............REFDEDQMNDENKRLSEELRAK.....QKRERNNKLDDLVLR.S---------------------
G0SCB4_CHATD/176-523..........................K..DPT..........TPDDAPLTMPELLIK.S---------------------
W1QCQ6_OGAPD/210-555................................NDASD.....TANHADAVYPQPLLL.S---------------------
Q5AW68_EMENI/201-531..........................N...............ANEEQKFELPQFLKE.S---------------------

PF07393

Q750R9_ASHGO/111-822--------------IIL.P---LLNNS------------PQAKKDIIKLANAYLKRAELAINIILEDTVQMVDQRFTIVL
Q6BHS9_DEBHA/103-810--------------IML.P---CAVNS------------PTIKNRMSSLSNSYISRCEISLNIIIGDTIAMICNRVAYLL
SEC10_ARATH/139-817--------------SIS.R---LLLPV------------DGAHAASCEEMSTALSKAEAAAYKGLQQCIETVMAEVDRLL
Q2HG63_CHAGB/108-854--------------VLI.R---LAEAN------------TTVRRSMEAQSKMAIEATERKANAVIKSTLDVAVNWTTKLL
Q7PQN8_ANOGA/88-705--------------SVI.P---NVIGT------------PQYT.DCIQKKRSYLETVENKIETGLERTLNAIFGWVKTYL
A1D556_NEOFI/126-876--------------ELVGA---KITDR------------NDFLDPAVKEKKKFEQILDERVAAGLNKGIDVLMEEVDYIL
Q2URB8_ASPOR/132-879--------------ELIGK---KLTDR------------NDFVDPAVKEKKKFEQNLDERVAAGLNKGIDVLMEEVDYIL
E7KRR3_YEASL/120-862--------------IFL.P---LLNNS------------PEIKAQIIEMTNSQIQKMEILINIILQETITVISTKFSAIL
Q4RLZ1_TETNG/80-698--------------QLM.P---LISSS------------PKLA.ECLHKKKEVIEQMEVKLDTGIDRTINCMVGQMKYIL
Q55N90_CRYNB/170-1008--------------ELS.P---YV.DK------------TDFLNAVMREKKRFESVLDDAVAAGLNAGIEVLMNQVEHII
Q0IP77_ORYSJ/117-800--------------TIS.R---LLLPV------------DGAHPSACEDMGSAVSVVEAAAHKGLLQCIDTVMSEVERLL
A2EZD8_TRIVA/69-728--------------ILK.P---HLMQK------------PQYHEMFLRDRESLISSLEDGITKNLQICINIITDRVKSIV
Q2GXU3_CHAGB/166-960--------------QLAGP---KIADR------------NDFLDPAGLAKKKFEQMLDESVAAGLNKGIDVLMDEVEYLC
Q2TVY5_ASPOR/116-891--------------LLI.P---LATGS------------ITVRREMEKKTNLTTMRIEEKVNTIEQKIIDASLVWINKLL
Q5BGH2_EMENI/123-870--------------EMIGS---NITDR------------NDFLDPAVKEKKKFEQNLDERVAAGLNKGIDVLMEEVDYIL
Q6CDC8_YARLI/101-777--------------VIV.P---LTDSH------------GQGRRYIVMQTNNFFTKCEEKINSILQVTLDIVSARVTVLL
EXOC5_DROME/89-705--------------SVI.P---CVSNT------------PKYS.DYVFKKRILMEQIETKLDQGLDRSISAVIGWVKVYL
A1DAY7_NEOFI/117-893--------------LLI.P---LATPS------------ITIRREMEKKTNTATLRIEDKINAIEQKVIDTALMWISRLL
EXOC5_CAEEL/46-659--------------PIF.P---IIKET------------IVEP.SVAKKWQQSLRSLESKMSLGLERQLNSIVGYVKFLF
Q6FMF7_CANGA/102-810--------------VCL.P---LLSNY------------PDVKKKVIIATNSQVKNCEVMINLIMEEVFQQFSNKFIASL
A0A0D1E7P5_USTMA/134-1026--------------ALL.P---LASTS------------VTSRREMMIFNNHNLLRVEGKCDALMQKIADNVVGFLSNRL
SEC10_SCHPO/101-799--------------IVI.P---FTGVT------------ASSRRETVNILSSSISVIECAVNDVFYATVHALGDHLEIIL
Q5KJ89_CRYNJ/95-875--------------ALF.P---LAGSN------------VPIRREMTTLNTHNVVRMEGKANNVIQKAIDNVIGWLSYLL
Q5AS51_EMENI/111-841--------------.....---.....------------.........................QQGALPFVERWKRRPT
Q6CQC0_KLULA/109-807--------------IVL.P---LLQNC------------PSIKRKVIALSNAYFKKCELLMNLLIVETSKLLNQKFTLIL
C4YGD5_CANAW/103-782--------------IIL.P---IATNI------------PSIKTRMSNMVNGFVAQCEISLNVILNDTLDHFRVKLQSQL

PF10191

Q7QA49_ANOGA/2-731...................---..GRE------------..YFSEFHQRMKRTCEDIHDTMLQIAFSPITKHFKQIEPAA
Q29C94_DROPS/2-737...................---..TES------------LGIFPQIYAALKLQFSETHDITLNILLQPIETHLAHIRPAA
Q172R1_AEDAE/2-704...................---....G------------NSVFSKELQTLQKVAIEIHDCVLKHIFVYIEAQFKQMEFTI
COG7_RAT/2-767...................---..SSN------------HNLLSVSRTALTRLNQQAHQLAFDSVFLRIKQQLLLV.SRM
Q5FW35_XENTR/2-765...................---..AVS------------TSLLAASRSAFTRQNQVAHQLAFDSVFLHIKQQLLLV.PKM
Q655R9_ORYSJ/5-868ICLNSLIANLGGSIKLDYL---SKDPR------------FHALPLTSQRVAAFSDTVNELVYDVLISKVRQRLNEV.ARL
Q9FGN0_ARATH/4-832...................---.KDPR------------FHALPLASQRVAAFADTVNELVYDVLISKVRQRLGEV.SRL

PF08318

E9EW04_METRA/274-613------------------N...LYRKV.S..........AKLTTPYNVMTTFFFRRSVEKAF...QLDEYPTGLSLR...
B6JXE3_SCHJY/165-484------------------R...IEECL.A..........QRLLSMQIEMERYYFRHSVEIAL...EMEEMDW........
COG4_DROME/166-496------------------D...LRRQM............QEILSTYLLLERYFMEESVLKAI...GLDTYE.........
M3D3E3_SPHMS/178-512------------------T...LQKKV.S..........ELLIEPFNAMATFFFRRSVEKSF...RIDEPPSDLTLNP..
C4QWJ7_PICPG/179-518------------------A...FMSKI.K..........ERINPVFDTLSTFYLRRSLEKAY...EIEEFPNITKNLNQS
B8LT52_TALSN/189-530------------------T...LSKKI.R..........DRMIGPFNAMTTFFLRRSVEKAF...QLDEQPTGLTLSL..
S3CMB0_GLAL2/185-536------------------A...LIRKI.S..........NRLIDPFNQLTGFFFRRSVEKAF...QLDEAPTGLSLNM..
COG4_SCHPO/163-481------------------K...MELLL.K..........KQLLPSLLQLETYYFRRSIETSL...ELEEYYT........
L8FSC8_PSED2/189-538------------------A...LSRKI.S..........SRLTTPFDILSTFFFRRSVEKAF...QLDETPSGLSLNP..
F0XR72_GROCL/199-557------------------V...LQRKV.A..........ARLITPYNLLSTFFFRRSVEKAF...QLEEMPAGLTLSM..
V8NZE8_OPHHA/148-457------------------F...LSCAM............QELIGYYITMEEYFMRETVNKAV...AMDTCE.........
F6TNZ6_XENTR/114-423------------------L...LSCSV............QELIGYYITMEEFYMRESVNKAV...AMDTCE.........
G8BDV4_CANPC/186-525------------------N...FSRKI.N..........EKLLPAFEAMYQFYFRRSLEKSI...TIEELPSLESYLR..
C5WWS3_SORBI/192-503------------------N...FNKME............QDLTGFYVIFEEFFMVENVRKAI...RIDEPI.........
A8X3I7_CAEBR/217-546------------------R...VGTKM............QELIGHYCLLEHFYMMKSVQKAI...KSDAKED........
U1HW21_ENDPU/187-524------------------A...LARKV.T..........GRLISPFNAMTTFFFRRSVEKAF...QLDEQPPNLSLNP..
J3NYL1_GAGT3/212-567------------------N...LHRKV.N..........TKLTAPYNVMSTFYFRRSVEKAF...QLDESPSGLTLSI..
D5GK94_TUBMM/197-545------------------A...LYRKV.Q..........GRLIVPFNAMMTFFCRRSVEKAF...QLDESPSDLSLSL..
F6I2Y2_VITVI/183-485------------------N...FSRSI............QDITGYYVILEGFFMVENVRKAI...NIDEHV.........
T1KVK7_TETUR/162-476------------------T...LSHMI............QELNGAYVLLEEYFARESCLKAI...QGDDIETSAT.....
G8BYJ4_TETPH/194-538------------------N...FKNKLVN..........EGFISTFDTLVLYHLHKSFNNSI...ELEEMPDINNLVTLR
Q5TNE6_ANOGA/167-491------------------R...LNTQM............QELLSTYLLFERYFMEESVLKAI...GLDKLE.........
J4GWL1_FIBRA/183-513------------------A...SRQLM.E..........DMLTNYYVPLETWYTRTIIDKAH...RLSNSDM........
H2VA38_TAKRU/70-376------------------L...LSRKM............QELIGYYIPMEEYYMRESVNKAV...AMDTFE.........
A3LT54_PICST/195-541------------------N...FTKKI.H..........NKYLPSFENLYIFYFRRSLEKAI...TIEELPSLETFLLYN
B7QAG5_IXOSC/93-401------------------E...LCKCM............QEIVSSYIMMEEYFLLESVRKAI...EVDTIE.........
C5LP43_PERM5/114-451------------------D...LTELV............QELMGEYVLYERSFIIVSTIKAIHEDRIDMDD.........
G3AM87_SPAPN/194-515------------------N...FTRKI.N..........DKLLPAFEILYKFYFRRSLEKAI...TIEELPSLEPYLK..
R8BYD5_TOGMI/1157-1500------------------N...LSRKV.S..........GKLTEPYNTMTTFFCRRSVEKAF...QLDEPPTGLSLNM..
A5DUI4_LODEL/191-536------------------H...FTKKV.K..........EKLLPSFKKLYDFYFRRSLEKCI...VIEEMPSLEPYLHA.
F4NT70_BATDJ/197-515------------------S...LNEQI............HIFIGYYISIEDYFIRQSIEKAL...KIDEHD.........
C5GF37_AJEDR/230-568------------------A...LCQKV.S..........DRLIHPFNSMTTFFLRRSVEKAF...QLDEGPPELTLNR..
B2AA74_PODAN/219-562------------------N...LGRKV.S..........GKLVSPYNELTKFFFRRSVEKAF...QLDEFPSGLTLRQ..
N1JE83_BLUG1/191-526------------------T...LHQKV.S..........NLLITSFNSMTTFFFRRSVEKAF...QLDESPSGLSLNI..
W4ZDW5_STRPU/172-484------------------A...LSRRM............QEIIGNYIVMEEYFMRETVMKAV...SMDIIE.........
G0W4A1_NAUDC/213-564------------------K...FRTKLVN..........DSYLESFEILIMYHLQKSFNNSI...ALEELPSLNELIQL.
Q4DDH2_TRYCC/242-662------------------RDNPLMNTV............QEILGVFVPLQTLYFEAAFEQALR.LQMDALHAAAREALMS
Q16TS8_AEDAE/167-489------------------R...LSTQM............QEVLGTYLLFERYFMEESVLKAI...ALDNLE.........
E9FQQ8_DAPPU/154-462------------------G...INRAV............QELLGHYIMLERYFLSESVSKAV...AMDTAV.........
C5M6Q7_CANTT/193-537------------------T...FTKKI.N..........EKLLPSFEKLNNFYFRRSLEKAI...TIEELASLEQYLSM.
V5GSU0_PSEBG/199-579------------------K...LGQEV.L..........ESMSTLYIPMETWFLRNSLEKAF...RIDQPDT........
X6MJK6_RETFI/5-348------------------T...KINTI.R..........HQYISYYIILEQFNMQYKLYRVL...TTK....FFFLSLI.
M2R7X1_CERS8/181-514------------------S...SQKRF.D..........DILSTYYVPLEVWYARTIIDKAH...RFSNPDV........
A0A068Y5W7_ECHMU/114-419------------------G...LSKIS............QEIVDAYLPLEQLFLRELVNKAI...TMDELD.........
D6WJA3_TRICA/162-474------------------D...LTHSK............HELLLHYLKLEQYFMEESVAKAV...SMDSIE.........
G8Y9D0_PICSO/191-527------------------V...FAQKI.I..........NRYLPAYEKLYAFYFRRSLEKAI...SIEELPSVQEYLQ..
Q57XU9_TRYB2/282-625------------------RDNPLMTAV............QEILAIFVPLQTHYFEAAFHQVLQ.IQLDAINASSHEHP..
G2Y0X2_BOTF4/187-528------------------A...LSRKI.S..........NRLKDPFNVMTTFFFRRSVEKAF...QLDESPTGLSLNL..
E0VZ92_PEDHC/157-456------------------N...LNCKM............QEVLDYYVQLERYFTEESVFKAV...AMDALL.........
B0CT70_LACBS/161-472------------------S...SNGVF.E..........DLVTAYYIPLEIWYTRTIIDKAH...RLSSTDL........
Q59T37_CANAL/195-551------------------T...FTRKI.N..........EKLLPSFETLYKFYFRRSIEKSI...TIEELPSLDAYLVL.
E9QGT9_DANRE/180-489------------------Q...LSRTM............QELIGYYIPMEEYYMRESVNKAV...AMDTAE.........
K1WLQ9_TRIAC/267-644------------------S...LSQRAME..........NLLRTYYLPLEEWYLRTAVEKAH...KLDQADA........
F9XE54_ZYMTI/175-509------------------T...LQKRI.N..........DLLIEPFNLMTTFFFRRSVEKSF...QQDESPAGDLTLS..
C5DG77_LACTC/179-498------------------I...FYSKIHS..........SGFLSDLKKLNEFYLNRSFKKSL...ELEELPSLNEQISK.
K5Y4H4_AGABU/183-506------------------S...SEKLF.Q..........HTIFTYFIPLEIWYTRTIVDKAH...RTSSPDV........
I1JS41_SOYBN/186-485------------------S...FSKVA............QDLTGFYVILEG