Sequence alignment for CL0294

PF07393

Q750R9_ASHGO/111-822---------------FKAIVSNYDALDEKLSS................VTQVVAPLGEKLEKSMRAKNS........Y--
Q6BHS9_DEBHA/103-810---------------VDRITRKFGSLDTKISE................VSNRIDPLGNSLNKITNSRDR........S--
SEC10_ARATH/139-817---------------VDGLFESFARLDGRISS................VGQTAAKIGDHLQSADAQRET........A--
Q2HG63_CHAGB/108-854---------------LDQSMDQFEALDLTLNNPSTTTN...GNSRADGGGNIAVQIGEKLEELDRKRRK........A--
Q7PQN8_ANOGA/88-705---------------HQVSVDYFHQLDEKINS................VAGKVIHLGEQLQNVNMPRSR........A--
A1D556_NEOFI/126-876---------------LNTLSDGFDQIKLTTSVPSEEV.....HELEKDPVLGALKQVRSVRGEARVEYG........K--
Q2URB8_ASPOR/132-879---------------LKTLSDGFDQITLSTPATTGKS.....NELEDDSVLGALQQVRSVRGEARNEYG........K--
A0A023ZK30_YEASX/120-862---------------LHTTLLTFDKLDDRLTN................VTQVVSPLGDKLETAIKKKQN........Y--
Q4RLZ1_TETNG/80-698---------------NQVAFQHFQELDEHISY................VATKVCHLGDQLEGVNTPRQR........A--
Q55N90_CRYNB/170-1008---------------QQWGTSKEQNLLDFEDLPLPSRPTGSSSSHGRTTGFFALTPTMPLPSASFSSHSPGPYYLAYK--
Q0IP77_ORYSJ/117-800---------------VDGLFDSFARLDSRISS................VGQTAAKIGDHLQSAESQRET........A--
A2EZD8_TRIVA/69-728---------------LQETKDRSNELYASTNQ................ISVDFSKVTDQLDFAASLVQR........A--
Q2GXU3_CHAGB/166-960---------------VQEVADGFETMKVGGTTARAPHHPHQDPSTDPEALLRVIKNAKSVRGLARQEYG........K--
Q2TVY5_ASPOR/116-891---------------LKQTIESFQQLDTSLNGTGAGPGP.TGSELSGSTGNMAVETGRKLEELDRQRRR........A--
Q5BGH2_EMENI/123-870---------------VTPISDGFDQINLSASAANDVV......DLDTDPVLGALKLARSIRGEARQEYG........K--
Q6CDC8_YARLI/101-777---------------VQSTVSEYTDMEQLMAE................VSKQTSSLGDKMDRISGQHQK........A--
EXOC5_DROME/89-705---------------HQTAIDVFGQLDEKINS................VAGKIMHLGEQLENVNTPRSR........S--
A1DAY7_NEOFI/117-893---------------LKQTIDSFQQLDTSLNGAGLSG.....GELPGATGNMAVETGRRLEELDRQRRR........A--
EXOC5_CAEEL/46-659---------------NGEAIDKMKQLDHTMQA................VSTKVVHLGDQLESVDQPRSR........A--
Q6FMF7_CANGA/102-810---------------LGKLVDNYNYLDNKLTS................INQMVSPLSEKLQNSIKKKKN........Y--
Q4PHT4_USTMA/134-1026---------------FVAVGNSFNSLEDRISE................VGRTAIRIGEQLETIDKQRNR........A--
SEC10_SCHPO/101-799---------------FAQVLELSRHLEDNVND................MRSGLVDAGQELERAENNRKR........I--
Q5KJ89_CRYNJ/95-875---------------FEAIGKSFSNLESKVTD................VGRTAVRI......................--
Q5AS51_EMENI/111-841---------------LKQAIESFQQLDTSFQSAGPG.......DTALGSGNMAVETGRRLEELDRQRRR........A--
Q6CQC0_KLULA/109-807---------------LKDIVQNYDQLDHKLSA................VTQVVSPLGTKLEKSIKQKNA........Y--
C4YGD5_CANAW/103-782---------------IDEATKKFDILDTQISD................VSTRINPLGNTLNKITNSRDR........S--

PF10191

Q7QA49_ANOGA/2-731DVSAFSGDDFDVSSWINASYERSQKTATGSVGKE.AFVSSLVSKMQLYVQQINVALEQTGGQVLKNIPKVISDANMLQ--
Q29C94_DROPS/2-737DVSALSEATFSPADWINANYKKYIEENGSKDGDATSFIQSYVAKLQLYVQQVNYAVEESSRQVVSSMPRIAKESTTLH--
Q172R1_AEDAE/2-704DLSCFSQDSFDVVQWTNDYFKSNGNADNKEAM.....VSSLVSRLQLYVEQMNYSLEKSSQQLIVTMPHVIKDVKMIQ--
COG7_RAT/2-767DFSKFLADDFDVKDWINAAFRAGPKDGAAGKADG..HAATLVMKLQLFIQEVNHAVEETSLQALQNMPKVLRDVEALK--
Q5FW35_XENTR/2-765DFSRFLADDFEVKDWVNAAFKSVQKD.APAKVDA..HASTLVMKLQLFIQEVNNSVEEISHQALQNMPRVLRDVEAVR--
Q655R9_ORYSJ/5-868DASEFGAEGFDPKRWINAALDARHPSEPLDRF.....LADAEERLRSAADDAAAALERDSADALRRVPLACRDALRLR--
Q9FGN0_ARATH/4-832DLGPFSDEKFDAKRWVNSSCQARHPQDSLEKH.....LVDLEMKLQIASEEIGASLEEQSGGALLRVPRATRDVLRLR--

PF08318

E9CCF3_CAPO3/274-605------------------------------------------------LQEAERVVRVTIAEKFAAAAS--------AVA
B6JXE3_SCHJY/165-484------------------------------------------------LRQATDSLYTLFLREFQRAAR--------E..
COG4_DROME/166-496------------------------------------------------LEDATEKTRVLIAKRFDEAVK--------A..
M3D3E3_SPHMS/178-512------------------------------------------------LNDAAESLKGLFVREFEKAES--------D..
C4QWJ7_PICPG/179-518------------------------------------------------LEVWIKDLSQILTKEFDRAAS--------E..
B8LT52_TALSN/189-530------------------------------------------------LHNAAESLCGLFLREFDKAVK--------E..
S3CMB0_GLAL2/185-536------------------------------------------------IENAKESLCMLFLREFEKAAA--------E..
COG4_SCHPO/163-481------------------------------------------------LKEITESLHTLFWREFHKAAR--------N..
L8FSC8_PSED2/189-538------------------------------------------------LENAKESLCGLFLREFDKAAK--------E..
F0XR72_GROCL/199-557------------------------------------------------LEQARASLCGLFLREFERAAH--------D..
V8NZE8_OPHHA/148-457------------------------------------------------LQEAEQQLKTIVTEKFDVAMK--------Q..
F6TNZ6_XENTR/114-423------------------------------------------------LQEAEQHLKVVVSEKFDAATK--------S..
G8BDV4_CANPC/186-525------------------------------------------------IDNWVKQLTVVFQKQFNEAAS--------K..
C5WWS3_SORBI/192-503------------------------------------------------..DIKRRLEGLARRRLAAVID--------A..
A8X3I7_CAEBR/217-546------------------------------------------------.SSAKDRLSKILKSRLTEAVQ--------K..
U1HW21_ENDPU/187-524------------------------------------------------LENASESLCGLFLREFDKAIK--------D..
J3NYL1_GAGT3/212-567------------------------------------------------LESARESLCGLFLREFDRAAA--------D..
D5GK94_TUBMM/197-545------------------------------------------------LENAAESLCGLFLREFERAAE--------A..
F6I2Y2_VITVI/183-485------------------------------------------------..ASKKQLEGIVRKRLAAAVD--------Q..
T1KVK7_TETUR/162-476------------------------------------------------LHEAEDKLKTLVMRKFDEAVV--------E..
G8BYJ4_TETPH/194-538------------------------------------------------INKWSDELKEIFQKRFMKAAE--------S..
Q4P6N8_USTMA/201-590------------------------------------------------L...RKTMLTAFTDAFIRSTQ--------N..
Q5TNE6_ANOGA/167-491------------------------------------------------LEQATVQMQQMVNQKFDEAVK--------R..
J4GWL1_FIBRA/183-513------------------------------------------------LQAAREELLAIFRQEFDRASQ--------S..
H2VA38_TAKRU/70-376------------------------------------------------LQEAEQKLRVIVAEKLDEAVA--------A..
A3LT54_PICST/195-541------------------------------------------------.NGWIAQLTEIFKKKFNDAAH--------D..
B7QAG5_IXOSC/93-401------------------------------------------------LREAENKLRRIVMKKFSEAVN--------E..
C5LP43_PERM5/114-451------------------------------------------------LED...EVCSLVRKAFDNAII--------S..
G3AM87_SPAPN/194-515------------------------------------------------ISKWIDDLTLVFKDKFNTAAE--------A..
R8BYD5_TOGMI/1157-1500------------------------------------------------LESAKESLCGLFLREFEKAAK--------E..
A5DUI4_LODEL/191-536------------------------------------------------IAKWTDQLAEVFKSQFTEAAK--------A..
F4NT70_BATDJ/197-515------------------------------------------------LESAQATLTNMVMEAFETAAC--------N..
C5GF37_AJEDR/230-568------------------------------------------------LENAAESLCGLFLREFERAVK--------D..
B2AA74_PODAN/219-562------------------------------------------------LESARESLCNLFLREFRKAAE--------D..
N1JE83_BLUG1/191-526------------------------------------------------.SSARESLCSLFIREFEKAAT--------E..
W4ZDW5_STRPU/172-484------------------------------------------------LHEAEHNLKALVRKKLDQAIS--------S..
G0W4A1_NAUDC/213-564------------------------------------------------IDNWCRELTTLFKEKFITAAQ--------K..
Q4DDH2_TRYCC/242-662------------------------------------------------.ASARESAREKLLEKFRVASR--------S..
Q16TS8_AEDAE/167-489------------------------------------------------LEQAATQIRQVVTQKFDEAVK--------K..
E9FQQ8_DAPPU/154-462------------------------------------------------LHEAQAQLCRVLQQKFDEAVR--------D..
C5M6Q7_CANTT/193-537------------------------------------------------IANWTDELTEVFKEQFNDAAK--------E..
V5GSU0_PSEBG/199-579------------------------------------------------L...RKTMLTAFTDAFIRSTQ--------N..
X6MJK6_RETFI/5-348------------------------------------------------..DSKERLQHLVKEKCENALS--------G..
M2R7X1_CERS8/181-514------------------------------------------------LQQAREELLAIFRREFEKASQ--------S..
U6HLQ3_ECHMU/114-419------------------------------------------------.........SRVSASFDNFAT--------V..
D6WJA3_TRICA/162-474------------------------------------------------LQDAASQLQAIVEHKFNEAVK--------C..
G8Y9D0_PICSO/191-527------------------------------------------------LDNWIAILTKRFQQGFNQAAE--------K..
Q57XU9_TRYB2/282-625------------------------------------------------IVNARQTVREKLMKRFYSAKV--------V..
G2Y0X2_BOTF4/187-528------------------------------------------------IEEAKKSLCGLFLREFEKAAE--------E..
E0VZ92_PEDHC/157-456------------------------------------------------LEEVAEHLRVVVAKKFNEAII--------D..
B0CT70_LACBS/161-472------------------------------------------------LQAAREKLLVIFRQNFEQASR--------S..
Q59T37_CANAL/195-551------------------------------------------------IANWIDKLTQVFKEKFTEAAK--------A..
E9QGT9_DANRE/180-489------------------------------------------------LQEAERNLKTLVTTRLEEAVA--------T..
K1WLQ9_TRIAC/267-644------------------------------------------------LDELRQVLLTTFRAEFELAAD--------R..
F9XE54_MYCGM/175-509------------------------------------------------LNSAAESLCGLFLREFEKAAR--------E..
C5DG77_LACTC/179-498------------------------------------------------LKQWINQLAQVFHDNFVKAAR--------E..
K5Y4H4_AGABU/183-506------------------------------------------------LQKAREHLLSVFLQNFEEASR--------S..
I1JS41_SOYBN/186-485------------------------------------------------..AAKKQLEGIVRKKLSAAVD--------Q..
K0KE72_WICCF/171-504------------------------------------------------LEKWIEELTKIFTTEFQKAAE--------S..
K4CGD4_SOLLC/174-477------------------------------------------------..ASKKQLEGIVRRKLAEAVD--------Q..
H2XLC7_CIOIN/111-421------------------------------------------------LKEARVAMSQVVAEQFDLAVL--------N..
S9VWR1_SCHCR/164-482------------------------------------------------LHEVIESLHALFQREFQKAAR--------D..
U9TBS3_RHIID/182-496------------------------------------------------..DAKENLFVIFSREFEAAVY--------N..
E3Q612_COLGM/198-538------------------------------------------------LETAKESLCGLFLREFEKATK--------E..
Q6BTT0_DEBHA/227-568------------------------------------------------VQKWIELLTEEFQKGFNEASK--------N..
K2S8E4_MACPH/175-516------------------------------------------------LENAAESLCGLFLREFEKAAK--------E..
G8JQJ6_ERECY/189-517------------------------------------------------LDDWTIKLSKIFHEQFLHASR--------V..
J3Q132_PUCT1/187-568------------------------------------------------LENLIIQLTETFLKSFNAAAQ--------V..
A9SCH4_PHYPA/154-467------------------------------------------------..ESKQKLEAIFRKKLAAAVE--------S..
Q0UYP7_PHANO/174-513------------------------------------------------LDAAAESLCGLFLREFEKAAK--------E..
M9MH30_PSEA3/203-582------------------------------------------------L...RKTMLTAFTDAFIRSTQ--------N..
I2H5R5_TETBL/205-583------------------------------------------------IDNWCKELTDLFKSKFIDAAR--------S..
A7TT52_VANPO/190-542------------------------------------------------.DRWCDELTQLFKDKFNTAAK--------T..
T1J554_STRMM/179-485------------------------------------------------.RDAQSVLKDTVIRKFDESVR--------D..
J9MJB3_FUSO4/82-414------------------------------------------------IQTTRKSLCGLFLREFNAATE--------Q..
A7RPW3_NEMVE/163-477------------------------------------------------LQEAEEKLKAIVQQEFDQAIS--------K..
B4KHQ6_DROMO/161-491------------------------------------------------LEEATEKIRELISKRFDEAVQ--------Q..
A8NGP6_COPC7/165-479------------------------------------------------LQAQRQTLLEVFKKKFEEASR--------S..
D8QT59_SELML/156-463------------------------------------------------..ESKRKLEEVIKKRFYAAVD--------A..
S8C8S4_DACHA/216-562------------------------------------------------LSNAAESLCGLFLREFDKATK--------A..
N1PMN4_MYCP1/176-511------------------------------------------------LNSAAESLCGLFLREFEKAAR--------D..
V5G2M7_BYSSN/194-532------------------------------------------------LHNAAESLCGLFLREFDKAVK--------D..
F8Q674_SERL3/166-485------------------------------------------------LQTAREQLLKTFQRHFEQASQ--------S..
M3AA99_MYCFI/191-526------------------------------------------------LHTAAESLCGLFLREFDKAAS--------E..
G4MR42_MAGO7/219-567------------------------------------------------LESARESLCNLFLREFDKAAS--------E..
J3KIC8_COCIM/186-524------------------------------------------------LENAAESLCGLFLREFDRAVK--------E..
G4U2Q1_PIRID/161-490------------------------------------------------LEEARKSLLDIFSRQFERASA--------A..
R7YUM9_CONA1/175-511------------------------------------------------LNAAAESLCALFLREFERAAK--------D..
G8ZSF3_TORDC/186-519------------------------------------------------VEKWCNELTEVYKSSFLEAAK--------S..
G0SXA1_RHOG2/160-497------------------------------------------------.AQLRASLLETFVTAFRTAAE--------A..
S3C4S1_OPHP1/236-610------------------------------------------------LEQARESLCGLFLREFERAAK--------E..
D8M8U8_BLAHO/154-504------------------------------------------------.KKSTETLIRALTEQFQSSMT--------K..
C3YFK8_BRAFL/171-477------------------------------------------------LHKAEQELKVIINKEFDEAVA--------N..
Q758T0_ASHGO/188-512------------------------------------------------LKDWTSRLSEVFTEQFQHAAK--------A..
M5C4C1_THACB/161-521------------------------------------------------LADARAALLGVFRKEFDAAAI--------A..
U4L2E9_PYROM/293-612------------------------------------------------.EMAAEGLCKLFLARFEKAVN--------E..
J4KLZ9_BEAB2/1246-1586------------------------------------------------LENAKESLCTLFLREFEKAAA--------D..
G7E1B8_MIXOS/165-515------------------------------------------------.SDYRQSLLETFLKEFEAACQ--------E..
H2KS09_CLOSI/401-723------------------------------------------------LKRIQEHLVVLTEQRFTQALQ--------K..
W1NDY2_AMBTC/181-483------------------------------------------------..ESKRQLESIVRKKLSAAVD--------Q..
COG4_ARATH/176-479------------------------------------------------LHASKEQLEGIAKKKLLAAID--------Q..
H6C9G5_EXODN/179-515------------------------------------------------LENASASLCNLFIREFEKAVK--------D..
H3AVV6_LATCH/187-496------------------------------------------------LEEAEQRLKCIVTEKFDLAIK--------E..
K5V063_PHACS/174-511------------------------------------------------LQDVREQLLRIFREQFEKVST--------S..
B6HSP5_PENCW/191-531------------------------------------------------LDNAAESLCGLFLREFEKAVK--------E..
G3BC56_CANTC/190-528------------------------------------------------IDNLVKQLIEVFKVQFDDAAA--------K..
U6I4L4_HYMMI/106-417------------------------------------------------.RKLHQEVVSKVEVSFEKFVT--------V..
M7NUP8_PNEMU/161-484------------------------------------------------LQDACDALNTICLKGFHQAAE--------I..
U7PW27_SPOS1/225-627------------------------------------------------LEEARASLCGLFLREFERAAQ--------D..
E9EW04_METAR/274-618------------------------------------------------LETARESLCGLFLREFEKAAG--------D..
E6ZNH9_SPORE/195-575------------------------------------------------L...RKTMLTAFTDAFIRSTQ--------N..
G0V8A6_NAUCC/189-534------------------------------------------------LDNWCMELTQLFKEQFIAAAN--------E..
E7QLX6_YEASZ/190-525------------------------------------------------IKNWCKELTSLFQEQFMEATR--------T..
C5DUL4_ZYGRC/172-510------------------------------------------------.NQWCEKCTKVFKTNFLDAAS--------R..
E4UP45_ARTGP/209-548------------------------------------------------.SSAAESLCALFLREFEHAVK--------E..
K1R201_CRAGI/174-481------------------------------------------------LQEAEEKLKSIVNTKFDAAVH--------S..
Q6FTK7_CANGA/185-531------------------------------------------------LQQWCDELTEKFKERFQKATE--------E..
D2V3G5_NAEGR/119-422------------------------------------------------.KKSEKKIKEIVSSKMKEALR--------D..
G5C1P9_HETGA/267-575------------------------------------------------LQEAEQRLKAIVAEKFAIATK--------E..
L8WI47_THACA/987-1357------------------------------------------------LADARTALLGVFRKEFDGAAI--------A..
V2X3Q2_MONRO/169-474------------------------------------------------LQTAREELLRIFLRNFEQASQ--------A..
A7UW80_NEUCR/259-612------------------------------------------------LENARESLCVLFLREFWKAAK--------E..
M2NB58_BAUCO/172-509------------------------------------------------LDAAAESLCGLFLREFEKAAK--------E..
C7ZFK3_NECH7/171-496------------------------------------------------.EIARESLCALFLRQFVSAAE--------D..
K1WSR6_MARBU/231-588------------------------------------------------IENAKESLCGLFLREFEKAAD--------E..
S0E9C5_GIBF5/167-499------------------------------------------------IQTARKSLCALFLREFNAAAA--------Q..
C4XYR0_CLAL4/197-532------------------------------------------------IDKWIAQLKTELQTLFDDAAK--------R..
S2JH92_MUCC1/194-506------------------------------------------------LADAKANLFAIFSSKFDDAVA--------Q..
E9IBA8_SOLIN/158-464------------------------------------------------LQQAAMELRAVVTHKFDEAVK--------S..
I1RAH7_GIBZE/187-527------------------------------------------------LEEAKESLCGLFLREFEKAAE--------E..
G0R6U4_HYPJQ/191-531------------------------------------------------LENARESLCGLFLREFDKAAA--------E..
I2FV21_USTH4/206-592------------------------------------------------L...RKTMLKAFTDAFIKSTQ--------N..
A8NFV8_BRUMA/216-544------------------------------------------------LREAANEMKSIIEKRFNQAVE--------D..
G0SCB4_CHATD/176-523------------------------------------------------LEQARESLCGLFLREFKKAAA--------E..
W1QCQ6_OGAPD/210-555------------------------------------------------LDSWISELNNIFLSEFNEAAA--------K..
Q5AW68_EMENI/201-531------------------------------------------------LDNAAESLCGLFLREFDKAVK--------E..

PF07393

Q750R9_ASHGO/111-822---VKSAELISFYKDFHLEGT.............................SANLESL.RTSSDWREKAQAAIL---VKQL
Q6BHS9_DEBHA/103-810---TETIFLIRAYHGFYTKEK.............................YDPLEKL.RTSKVYEDKIKCAKT---VSNL
SEC10_ARATH/139-817---SQTIDLIKYLMEFNGSPG...............................DLMELSALFSDDSRVAEAASI---AQKL
Q2HG63_CHAGB/108-854---QDANFLIQCWMEVMETGQ.............................LTSLEEI.QRQGGAENKVRCAVI---ARQL
Q7PQN8_ANOGA/88-705---VEAQLLLNHMAEFLTPGP..................................IVNDIYSDKSKLYEAADI---IQKL
A1D556_NEOFI/126-876---VHAA.LAPFYDDIVTSGP..............................SPDNLLFKEYPDP...EHQAQI---LSQL
Q2URB8_ASPOR/132-879---VHAA.LAPFYNDITTEGA..............................SPDNLLFKKYTDP...QHQARI---LFQL
A0A023ZK30_YEASX/120-862---IQSVELIRRYNDFYSMGK.............................SDIVEQL.RLSKNWKLNLKSVKL---MKNL
Q4RLZ1_TETNG/80-698---VEAQRLMTYFNEFLDGD...................................LRSDVFNNPDKIKEAADI---IQKL
Q55N90_CRYNB/170-1008---THHLSLLPFCKHLRSSPS............................PSSTLSLLFPPSPTTALPPSLSHQ---SSVL
Q0IP77_ORYSJ/117-800---SQTIDLIKYLMEFNSTPG...............................DLMELSPLFSDDSRVAEAASI---AQKL
A2EZD8_TRIVA/69-728---EDMSIIITYIQEFNKPLEDPPMVRAPNQPPPDPNNPDNPPQEVLVPAFDPLDILLKSIKFPPTLYQCAEL---CAKL
Q2GXU3_CHAGB/166-960---IYGA.LAPFYFDLVRAKT..............................HTDPLVFKVFRDP...ERQAQM---LANL
Q2TVY5_ASPOR/116-891---LDAHFLLECWDSVSNRGE.............................LTLLENL.RRSGTGEAKVRSAQI---ARQL
Q5BGH2_EMENI/123-870---IHAA.LAPFYDDIATLGP..............................SPENLLFQRYTEP...QQQAQI---LSQL
Q6CDC8_YARLI/101-777---IASHFLINCYLSFVKKSS.............................CLELERMWKDGPSG..QRKCATY---VRQL
EXOC5_DROME/89-705---VEAQKLLNFMSEFLAAGP.................................VIVNDIFADAARLSEAADV---IQKL
A1DAY7_NEOFI/117-893---LDAHFLIQCWDGVSNRGE.............................ITLLENL.RKSGTGEAKVRSAHI---ARQL
EXOC5_CAEEL/46-659---HDAHQLMQHFDEFLSDQP..................................LNSMIFTDPDKLLESADL---VHKL
Q6FMF7_CANGA/102-810---IKSIELIIQYNTFLKNGK.............................SEYVDNM.LNSKKLANRLNAAVL---IKNQ
Q4PHT4_USTMA/134-1026---SEAHDLIEFYY.MFARGD.............................TTKLEHL.RKEGGREGRIKTAVI---ARRL
SEC10_SCHPO/101-799---LSSAELLRYYLE.FRSGK.............................PQTLMDF.FRTNNHDKMLLCAQR---TRQL
Q5KJ89_CRYNJ/95-875---............ATTGEN.............................TSPLEQLFATRTSRQGREKLAVV---LRRL
Q5AS51_EMENI/111-841---LDAHFLLECWDGVSNRGE.............................IILLENL.RRSGSGEAKVRSAHI---ARQL
Q6CQC0_KLULA/109-807---IKSVELISFYASFLEEGD.............................CPELNKL.LESSDKRDICQGALI---LKSL
C4YGD5_CANAW/103-782---LETIFLIRAYHGFFMKEQ.............................YLPLETL.KNSKKLDDKLKCAKT---VRNL

PF10191

Q7QA49_ANOGA/2-731---IESGLLKQRMNQVQREIAHLQTETGDCMVSLERLDDIKQRLQSSKQCLQEADGWGKLAGELDDLLEKSDIDASSGKL
Q29C94_DROPS/2-737---SDVSQLQEKMSAMRQEVAAVQNETGECMATLERLNTLQTKLQAAKESLQESDGWGNLLAELEDGFERNDLKGVCEKL
Q172R1_AEDAE/2-704---TEVATLTDKMRQLQSDISHVNRDTGVYMHQLERLEGVYQKISIAKHGMKESDGWGKLTAELDDLLERNDIFGSKNKF
COG7_RAT/2-767---QEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQLAAESLQEADKWSTLSADIEETFKTQDIAVISAKL
Q5FW35_XENTR/2-765---QEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEMDKVKSRMQLAADSLQEADKWSTLSADIEETFKTQNITVISEKL
Q655R9_ORYSJ/5-868---DDAVSLRSHLASVLQSLSQAEGSSAESITALARIDTVKQRMEAAYATLQDAAGLAQLSQSVEDVFSSGDLPKAAETL
Q9FGN0_ARATH/4-832---DDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDNVKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETL

PF08318

E9CCF3_CAPO3/274-605SGRGSTDEITRFFVLF----------------------------------------------------------------
B6JXE3_SCHJY/165-484...QDQRKITRFFKLF----------------------------------------------------------------
COG4_DROME/166-496...DDLASVERFFKIF----------------------------------------------------------------
M3D3E3_SPHMS/178-512...GDGARITRFFKLF----------------------------------------------------------------
C4QWJ7_PICPG/179-518...RNPDRITYYFKLF----------------------------------------------------------------
B8LT52_TALSN/189-530...NNGAKITRFFKLF----------------------------------------------------------------
S3CMB0_GLAL2/185-536...GDGARITRFFKLF----------------------------------------------------------------
COG4_SCHPO/163-481...QDQKEITRYFKLF----------------------------------------------------------------
L8FSC8_PSED2/189-538...GDGGKVTRFFKLF----------------------------------------------------------------
F0XR72_GROCL/199-557...GDDARVTRFFKLF----------------------------------------------------------------
V8NZE8_OPHHA/148-457...EDLLQVERFFKIF----------------------------------------------------------------
F6TNZ6_XENTR/114-423...GDLPQVERFFKIF----------------------------------------------------------------
G8BDV4_CANPC/186-525...RDVEHLTKYFQLF----------------------------------------------------------------
C5WWS3_SORBI/192-503...QDHPAVLRLVRLF----------------------------------------------------------------
A8X3I7_CAEBR/217-546...GDVAEMQRFVKLF----------------------------------------------------------------
U1HW21_ENDPU/187-524...NDGPKITRFFKLF----------------------------------------------------------------
J3NYL1_GAGT3/212-567...ADGARVTRFFKLF----------------------------------------------------------------
D5GK94_TUBMM/197-545...ADGEKVTRFFKLF----------------------------------------------------------------
F6I2Y2_VITVI/183-485...RDHPTILRFVRLF----------------------------------------------------------------
T1KVK7_TETUR/162-476...KDVASVERFFKIF----------------------------------------------------------------
G8BYJ4_TETPH/194-538...SDTEELTLMFKMF----------------------------------------------------------------
Q4P6N8_USTMA/201-590...KDEKEASRFFKLF----------------------------------------------------------------
Q5TNE6_ANOGA/167-491...DDLASVERFFKIF----------------------------------------------------------------
J4GWL1_FIBRA/183-513...RDAAATSRFFKLF----------------------------------------------------------------
H2VA38_TAKRU/70-376...VDLAQVERFFKIF----------------------------------------------------------------
A3LT54_PICST/195-541...KNVEQLTKYFQLF----------------------------------------------------------------
B7QAG5_IXOSC/93-401...GDIASVERFFKIF----------------------------------------------------------------
C5LP43_PERM5/114-451...GDKDGVSKCGRLF----------------------------------------------------------------
G3AM87_SPAPN/194-515...KDVEQLTKYFQLF----------------------------------------------------------------
R8BYD5_TOGMI/1157-1500...GDGTKVTRFFKLF----------------------------------------------------------------
A5DUI4_LODEL/191-536...RDVERLTKFFQLF----------------------------------------------------------------
F4NT70_BATDJ/197-515...DKPDGIVRCFKLF----------------------------------------------------------------
C5GF37_AJEDR/230-568...NNDAKITRFFKLF----------------------------------------------------------------
B2AA74_PODAN/219-562...GDGARVTRFFKLF----------------------------------------------------------------
N1JE83_BLUG1/191-526...GDGSKVTRFFKLF----------------------------------------------------------------
W4ZDW5_STRPU/172-484...SDRPSVERFFKIF----------------------------------------------------------------
G0W4A1_NAUDC/213-564...KDIDELTLMFQMF----------------------------------------------------------------
Q4DDH2_TRYCC/242-662...NDKLTIMQATRLL----------------------------------------------------------------
Q16TS8_AEDAE/167-489...DDLASVERFFKIF----------------------------------------------------------------
E9FQQ8_DAPPU/154-462...ADAASVERFFKIF----------------------------------------------------------------
C5M6Q7_CANTT/193-537...RNVPQLTKFFQLF----------------------------------------------------------------
V5GSU0_PSEBG/199-579...KDEKEASRFFKLF----------------------------------------------------------------
X6MJK6_RETFI/5-348...NDLKVVLEFARLY----------------------------------------------------------------
M2R7X1_CERS8/181-514...RDAAATSRFFKLF----------------------------------------------------------------
U6HLQ3_ECHMU/114-419...ENTKAIEELFRIF----------------------------------------------------------------
D6WJA3_TRICA/162-474...EDLVAIERFFKIF----------------------------------------------------------------
G8Y9D0_PICSO/191-527...REVPELTKYFQLF----------------------------------------------------------------
Q57XU9_TRYB2/282-625...NDKQTIMDTVRLL----------------------------------------------------------------
G2Y0X2_BOTF4/187-528...GDGVRVTRFFKLF----------------------------------------------------------------
E0VZ92_PEDHC/157-456...EDLASIERFFKIY----------------------------------------------------------------
B0CT70_LACBS/161-472...RDSTATSRFFKLF----------------------------------------------------------------
Q59T37_CANAL/195-551...KNVEQLTKFFQLF----------------------------------------------------------------
E9QGT9_DANRE/180-489...GDLPQVERFFKIL----------------------------------------------------------------
K1WLQ9_TRIAC/267-644...RDEQEISRYFRLW----------------------------------------------------------------
F9XE54_MYCGM/175-509...GDGSKVTRFFKLF----------------------------------------------------------------
C5DG77_LACTC/179-498...QDITQLTAVFQLF----------------------------------------------------------------
K5Y4H4_AGABU/183-506...RDSTATSRFFKLF----------------------------------------------------------------
I1JS41_SOYBN/186-485...RDHPAILRFIRLF----------------------------------------------------------------
K0KE72_WICCF/171-504...KDVEKLTSFFSFF----------------------------------------------------------------
K4CGD4_SOLLC/174-477...RDHSTVLRFIRLY----------------------------------------------------------------
H2XLC7_CIOIN/111-421...NDLTGVERFFKIF----------------------------------------------------------------
S9VWR1_SCHCR/164-482...KDQKEITRYFKLF----------------------------------------------------------------
U9TBS3_RHIID/182-496...RDQENISRFFKLF----------------------------------------------------------------
E3Q612_COLGM/198-538...GDGAKVTRFFKLF----------------------------------------------------------------
Q6BTT0_DEBHA/227-568...RNVSELTKYFQLF----------------------------------------------------------------
K2S8E4_MACPH/175-516...GDGTAVTRFFKLF----------------------------------------------------------------
G8JQJ6_ERECY/189-517...QNMELLTSYFQLF----------------------------------------------------------------
J3Q132_PUCT1/187-568...KDEAATTRFFKLF----------------------------------------------------------------
A9SCH4_PHYPA/154-467...KDHDNVVRFVKLY----------------------------------------------------------------
Q0UYP7_PHANO/174-513...GDGSKVTRFFKLF----------------------------------------------------------------
M9MH30_PSEA3/203-582...KDEKEASRFFKLL----------------------------------------------------------------
I2H5R5_TETBL/205-583...KNIEDLTLMFKMF----------------------------------------------------------------
A7TT52_VANPO/190-542...QDIEELTLMFKMF----------------------------------------------------------------
T1J554_STRMM/179-485...EDLASVERFFKIF----------------------------------------------------------------
J9MJB3_FUSO4/82-414...GDGEEVARFFKLF----------------------------------------------------------------
A7RPW3_NEMVE/163-477...GDRSSVERFFKIF----------------------------------------------------------------
B4KHQ6_DROMO/161-491...DDLASVERFFKIF----------------------------------------------------------------
A8NGP6_COPC7/165-479...RDSTATTRFFKLF----------------------------------------------------------------
D8QT59_SELML/156-463...RDHAGVVRFASLF----------------------------------------------------------------
S8C8S4_DACHA/216-562...GDGEKITRYFKLF----------------------------------------------------------------
N1PMN4_MYCP1/176-511...GDGARVTRFFKLF----------------------------------------------------------------
V5G2M7_BYSSN/194-532...NNGAKITRFFKLF----------------------------------------------------------------
F8Q674_SERL3/166-485...RDATATSRFFKLF----------------------------------------------------------------
M3AA99_MYCFI/191-526...GDGARVTRFFKLF----------------------------------------------------------------
G4MR42_MAGO7/219-567...GDEAKVTRFFKLF----------------------------------------------------------------
J3KIC8_COCIM/186-524...NDGAKITRFFKLF----------------------------------------------------------------
G4U2Q1_PIRID/161-490...RDSANTSRVFKLF----------------------------------------------------------------
R7YUM9_CONA1/175-511...GDGGRVTRFFKLF----------------------------------------------------------------
G8ZSF3_TORDC/186-519...QDIQQLTLIFKTF----------------------------------------------------------------
G0SXA1_RHOG2/160-497...NDTNNINRFFKLF----------------------------------------------------------------
S3C4S1_OPHP1/236-610...SNDAHVTRFFKLF----------------------------------------------------------------
D8M8U8_BLAHO/154-504...NKQTQVYRYCHLL----------------------------------------------------------------
C3YFK8_BRAFL/171-477...KDATAVDRFFKIF----------------------------------------------------------------
Q758T0_ASHGO/188-512...QDVEQLTSYFELF----------------------------------------------------------------
M5C4C1_THACB/161-521...RDPVAISRFFKLF----------------------------------------------------------------
U4L2E9_PYROM/293-612...KDGEGITRFFKLF----------------------------------------------------------------
J4KLZ9_BEAB2/1246-1586...GDGTKVTRFFKLF----------------------------------------------------------------
G7E1B8_MIXOS/165-515...RDEANTSRYFKLF----------------------------------------------------------------
H2KS09_CLOSI/401-723...NDAAAVERFCKLF----------------------------------------------------------------
W1NDY2_AMBTC/181-483...QTHGEILRFVRIF----------------------------------------------------------------
COG4_ARATH/176-479...RDHPTILRFVRLY----------------------------------------------------------------
H6C9G5_EXODN/179-515...NDGARITRFFKLF----------------------------------------------------------------
H3AVV6_LATCH/187-496...GDLPQVERFFKIF----------------------------------------------------------------
K5V063_PHACS/174-511...RDAAATTRFFKLF----------------------------------------------------------------
B6HSP5_PENCW/191-531...NDGAKITRFFKLF----------------------------------------------------------------
G3BC56_CANTC/190-528...KDMQQLTKFFELF----------------------------------------------------------------
U6I4L4_HYMMI/106-417...DDAKSIEELFKIF----------------------------------------------------------------
M7NUP8_PNEMU/161-484...KDEKAMTRFFRLF----------------------------------------------------------------
U7PW27_SPOS1/225-627...GDDARVTRFFKLF----------------------------------------------------------------
E9EW04_METAR/274-618...GDGAKVTRFFKLF----------------------------------------------------------------
E6ZNH9_SPORE/195-575...KDEKEASRFFKLF----------------------------------------------------------------
G0V8A6_NAUCC/189-534...NDVDTLTLVFKMF----------------------------------------------------------------
E7QLX6_YEASZ/190-525...QDIKELTLMFKMF----------------------------------------------------------------
C5DUL4_ZYGRC/172-510...QDVDQLTLTFQMF----------------------------------------------------------------
E4UP45_ARTGP/209-548...NDGAKITRFFKLF----------------------------------------------------------------
K1R201_CRAGI/174-481...GDFASIERFFKIF----------------------------------------------------------------
Q6FTK7_CANGA/185-531...QNIEELTLIFKMF----------------------------------------------------------------
D2V3G5_NAEGR/119-422...ENETQIKRFSKLF----------------------------------------------------------------
G5C1P9_HETGA/267-575...GDLPQVERFFKIF----------------------------------------------------------------
L8WI47_THACA/987-1357...RDPVAISRFFKLF----------------------------------------------------------------
V2X3Q2_MONRO/169-474...KDAAATSRFFKLF----------------------------------------------------------------
A7UW80_NEUCR/259-612...DDPAKITRFFKLF----------------------------------------------------------------
M2NB58_BAUCO/172-509...GDGARVTRFFKLF----------------------------------------------------------------
C7ZFK3_NECH7/171-496...ENVDQLTRFFKLF----------------------------------------------------------------
K1WSR6_MARBU/231-588...GDGSKITRFFKLF----------------------------------------------------------------
S0E9C5_GIBF5/167-499...GDGAKVARFFKLF----------------------------------------------------------------
C4XYR0_CLAL4/197-532...KSVPEISKYFQLF----------------------------------------------------------------
S2JH92_MUCC1/194-506...RNQADITRYFKLF----------------------------------------------------------------
E9IBA8_SOLIN/158-464...EDLASVERFFKIF----------------------------------------------------------------
I1RAH7_GIBZE/187-527...SDGTKVTRFFKLF----------------------------------------------------------------
G0R6U4_HYPJQ/191-531...GDGAKVTRFFKLF----------------------------------------------------------------
I2FV21_USTH4/206-592...KDEKEASRFFKLF----------------------------------------------------------------
A8NFV8_BRUMA/216-544...NDVASIQRFFKLF----------------------------------------------------------------
G0SCB4_CHATD/176-523...GDAAKVTRFFKLF----------------------------------------------------------------
W1QCQ6_OGAPD/210-555...RDVQRLTYFFQLF----------------------------------------------------------------
Q5AW68_EMENI/201-531...SNGAKITRFFKLF----------------------------------------------------------------

PF07393

Q750R9_ASHGO/111-822LVLTRKIDT.......................................KSLPKTIETTSALEEY------------ASAM
Q6BHS9_DEBHA/103-810LTLAKKIAS.......................................PDLPKTDHCVTVIEKF------------SETM
SEC10_ARATH/139-817RSFAEEDIGRQGAS............................AAAGNATPGRGLEVAVANLQDY------------CNEL
Q2HG63_CHAGB/108-854MRISQRLDLASWGQSTNG....................FRGNGVTNGVTGTNRRHNTREALEKF------------SELL
Q7PQN8_ANOGA/88-705FQISQDL..........................................PAQRFANAKKKIESK------------YDDV
A1D556_NEOFI/126-876RLFAQCD..........................................TTEGWRERNARLQSA------------ISMF
Q2URB8_ASPOR/132-879QSFAKCD..........................................LTEGWHERLSHLQEA------------ISMF
A0A023ZK30_YEASX/120-862LILSSKLET.......................................SSIPKTINTKLVIEKY------------SEMM
Q4RLZ1_TETNG/80-698HLIAQEL..........................................PFDRFPDVKAKIASK------------YHDL
Q55N90_CRYNB/170-1008LSLIRFLSPQ.....................................LQPLRDWGFLRQALLAA------------ADRF
Q0IP77_ORYSJ/117-800RSFAEEDVGRHGVP............................SAVGSANASRGLEVAVANLQEY------------CNEL
A2EZD8_TRIVA/69-728FKIVTSA..........................................ERDYLQNARINLIQY------------RERL
Q2GXU3_CHAGB/166-960RTFAKSD..........................................WSQGAQKREEKVDTM------------TGIF
Q2TVY5_ASPOR/116-891LRISQRLDQKSWNNSGGKNNG..............ASGHGAAEEGTVEETGLTRLNTREIIEKF------------SETL
Q5BGH2_EMENI/123-870QAFARCD..........................................TTTGCENRHENLRAA------------VSMF
Q6CDC8_YARLI/101-777LILSSKID.........................................TVEACRRAQSDIEKF------------AEKI
EXOC5_DROME/89-705YAISQDL..........................................PPGNFAESKRKIEKK------------YDEV
A1DAY7_NEOFI/117-893LRISQRLDPRSWDELRAKKDDL............YRNDDISVDEGTRGNINGIHRNTREIIEKF------------SETL
EXOC5_CAEEL/46-659YSISQEL..........................................NKDKFANVQARIGQR------------YKVV
Q6FMF7_CANGA/102-810LLLARKIET.......................................NSIPATKSTTSTIEKY------------AEEM
Q4PHT4_USTMA/134-1026AAISREV..........................................DVAGAEQTRDSIDRY------------CERF
SEC10_SCHPO/101-799LALANEV..........................................DLPDSSETLARIEKF------------SEFL
Q5KJ89_CRYNJ/95-875MAISKDVADNAATLLSDAEAGAVPKEVTNGDGESQEPIVNQKVISKRRMEKEKAEKVRDEIEGY------------CERF
Q5AS51_EMENI/111-841LRISQRLDPKSWNESRSTEPY..............NDGHLAPNSNNMEGTNGFRWNTREIIEKF------------SETL
Q6CQC0_KLULA/109-807LILTKKLDT.......................................KSVPKTQEVTQIIEQL------------ATDF
C4YGD5_CANAW/103-782LNLAKKVSD.......................................EKSPKSMKCITTIEQF------------GETM

PF10191

Q7QA49_ANOGA/2-731LSLQKSLAAQV--------------------------------------GLHGHSERENLVEYF------------KNRL
Q29C94_DROPS/2-737IALQKSLHAQE--------------------------------------QLPGHAERLTQVEDF------------KNRL
Q172R1_AEDAE/2-704IDLKKSISAQE--------------------------------------GLPGQTERTQQFEYF------------TNRM
COG7_RAT/2-767TGMQSSLMMLV--------------------------------------DTPDYSEKCVHLEAL------------KNRL
Q5FW35_XENTR/2-765TSMQVSLTMLV--------------------------------------DTPDYSEKCVYLEAL------------KNRL
Q655R9_ORYSJ/5-868ATMRHCLSAVG--------------------------------------EVAEFANVRKQLEVL------------EERL
Q9FGN0_ARATH/4-832ASMRNCLSAVG--------------------------------------EVAEFANVRKQLEVL------------EDRL

PF08318

E9CCF3_CAPO3/274-605-------------------------------------------------PLIN..LHEDGLEKL............SAFV
B6JXE3_SCHJY/165-484-------------------------------------------------PLIG..KDKEGVDAY............WHIF
COG4_DROME/166-496-------------------------------------------------PLVG..CHRTGIEKF............SLYI
M3D3E3_SPHMS/178-512-------------------------------------------------PLIG..RGDVGLEAY............GRYV
C4QWJ7_PICPG/179-518-------------------------------------------------PLVG..QQSIGIKSY............SSFI
B8LT52_TALSN/189-530-------------------------------------------------PLIG..RSEVGLDVY............GRYV
S3CMB0_GLAL2/185-536-------------------------------------------------PLIG..REDTGLDVY............GKYV
COG4_SCHPO/163-481-------------------------------------------------PLIG..KEKEGLEAY............WHFF
L8FSC8_PSED2/189-538-------------------------------------------------PLIG..RGERGLDVY............GTYV
F0XR72_GROCL/199-557-------------------------------------------------PLIG..RTDVGLDVY............GRYV
V8NZE8_OPHHA/148-457-------------------------------------------------PLLG..LHDEGLSNF............SRYL
F6TNZ6_XENTR/114-423-------------------------------------------------PLLG..LHEEGISKF............SGYL
G8BDV4_CANPC/186-525-------------------------------------------------PLIG..QEEVGLNCY............AKFI
C5WWS3_SORBI/192-503-------------------------------------------------PLLG..LADEGLQVY............VAYL
A8X3I7_CAEBR/217-546-------------------------------------------------PLIH..EADEGLQRY............SVFL
U1HW21_ENDPU/187-524-------------------------------------------------PLIG..RSDVGLDVY............GRYV
J3NYL1_GAGT3/212-567-------------------------------------------------PLIG..RGDVGLDVY............GRYV
D5GK94_TUBMM/197-545-------------------------------------------------PLIG..RTDVGLEVY............GRYV
F6I2Y2_VITVI/183-485-------------------------------------------------SPLN..LEEEGLQMY............VNYL
T1KVK7_TETUR/162-476-------------------------------------------------PLLK..QKDDGLRKF............SNYL
G8BYJ4_TETPH/194-538-------------------------------------------------PMIG..QDKLGLDMY............SKYV
Q4P6N8_USTMA/201-590-------------------------------------------------PQVG..WKKEGLEVY............SSFA
Q5TNE6_ANOGA/167-491-------------------------------------------------PLLG..MHDEGLEKF............MTYI
J4GWL1_FIBRA/183-513-------------------------------------------------PAIG..WEVEGLQAY............AAFV
H2VA38_TAKRU/70-376-------------------------------------------------PLLG..LHQQGLARF............GQYL
A3LT54_PICST/195-541-------------------------------------------------PLIN..QEEIGLNCY............SKFI
B7QAG5_IXOSC/93-401-------------------------------------------------PLLN..QHDEGLHKF............SLYL
C5LP43_PERM5/114-451-------------------------------------------------YPLG..MTTEAVARY............VRFI
G3AM87_SPAPN/194-515-------------------------------------------------PLIG..QEEIGLNCY............SKFI
R8BYD5_TOGMI/1157-1500-------------------------------------------------PLIG..RGDVGLDVY............GRYV
A5DUI4_LODEL/191-536-------------------------------------------------PLIS..QEEIGLTCY............ANFI
F4NT70_BATDJ/197-515-------------------------------------------------PLIG..KVDLGLDLF............SAHI
C5GF37_AJEDR/230-568-------------------------------------------------PLIG..RSAVGLDVY............GRYV
B2AA74_PODAN/219-562-------------------------------------------------PLIG..RGDVGLDVY............GQYV
N1JE83_BLUG1/191-526-------------------------------------------------PLIG..KEETGLEAY............GRYI
W4ZDW5_STRPU/172-484-------------------------------------------------PLLN..LHEEGLTKF............STYL
G0W4A1_NAUDC/213-564-------------------------------------------------PMVG..QDHLGLELY............SKYV
Q4DDH2_TRYCC/242-662-------------------------------------------------TQLG..FSEEGCSLY............CTWL
Q16TS8_AEDAE/167-489-------------------------------------------------PLLG..MHDEGLAKF............MTYI
E9FQQ8_DAPPU/154-462-------------------------------------------------PLLN..MHEEGISKF............GNYL
C5M6Q7_CANTT/193-537-------------------------------------------------PLIN..QEEIGLNCY............SKFI
V5GSU0_PSEBG/199-579-------------------------------------------------PQVG..WKKEGLEVY............SSFA
X6MJK6_RETFI/5-348-------------------------------------------------PYLD..LSKEGLSLY................
M2R7X1_CERS8/181-514-------------------------------------------------PAIG..WEEEGLQAY............ANFV
U6HLQ3_ECHMU/114-419-------------------------------------------------PIIR..KHELGLTKY............GKYI
D6WJA3_TRICA/162-474-------------------------------------------------PLLG..MHEEGIKAL............CTYL
G8Y9D0_PICSO/191-527-------------------------------------------------PLIQ..QEEVGLNCY............AKFI
Q57XU9_TRYB2/282-625-------------------------------------------------TLLG..FRDECCCMY............CSWM
G2Y0X2_BOTF4/187-528-------------------------------------------------PLIG..REEVGLDVY............GKYV
E0VZ92_PEDHC/157-456-------------------------------------------------PLLN..MHDEGLKEY............SLYL
B0CT70_LACBS/161-472-------------------------------------------------PAIG..WETEGLDAY............AAFV
Q59T37_CANAL/195-551-------------------------------------------------PLIN..QEEIGLNCY............SKFI
E9QGT9_DANRE/180-489-------------------------------------------------PLLG..LHEQGLARF............AQYL
K1WLQ9_TRIAC/267-644-------------------------------------------------PGIG..AEDEGLAAY............GDFV
F9XE54_MYCGM/175-509-------------------------------------------------PLIG..RRDVGLDAY............GRYV
C5DG77_LACTC/179-498-------------------------------------------------PLIR..KSDMGLDLY............SKYV
K5Y4H4_AGABU/183-506-------------------------------------------------PAIG..WEAEGLRAY............ADFV
I1JS41_SOYBN/186-485-------------------------------------------------TPLG..VEEEGLQVY............VGYL
K0KE72_WICCF/171-504-------------------------------------------------PMIG..KNHIGLDNY............SKFI
K4CGD4_SOLLC/174-477-------------------------------------------------PPLA..LEEEGLQVY............VMYL
H2XLC7_CIOIN/111-421-------------------------------------------------PLLK..MEDEGLDKF............SHYL
S9VWR1_SCHCR/164-482-------------------------------------------------PLIG..KEKEGLESY............WHFF
U9TBS3_RHIID/182-496-------------------------------------------------PLIG..KETEGLDKY............SKFV
E3Q612_COLGM/198-538-------------------------------------------------PLIG..RGDVGLDVY............GRYV
Q6BTT0_DEBHA/227-568-------------------------------------------------PLIQ..KEEIGLNCY............SKFI
K2S8E4_MACPH/175-516-------------------------------------------------PLIG..RSDVGLDAY............GRYV
G8JQJ6_ERECY/189-517-------------------------------------------------PKIG..NSEMGLDIY............SKHV
J3Q132_PUCT1/187-568-------------------------------------------------PLLGPSASESGLSAY............SDFV
A9SCH4_PHYPA/154-467-------------------------------------------------PPLR..LQEEGLRSY............VAYL
Q0UYP7_PHANO/174-513-------------------------------------------------PLIG..RTNVGLDAY............GRYV
M9MH30_PSEA3/203-582-------------------------------------------------PQIG..WKKEGLEVY............SSFA
I2H5R5_TETBL/205-583-------------------------------------------------PMVG..ENTLGLDLY............SKYI
A7TT52_VANPO/190-542-------------------------------------------------PMVG..QNDLGLELY............SKYV
T1J554_STRMM/179-485-------------------------------------------------PLLN..QHEEGLKKF............SKYL
J9MJB3_FUSO4/82-414-------------------------------------------------PVIGGGAEETGLEAY............GQYI
A7RPW3_NEMVE/163-477-------------------------------------------------PLLN..QHAKGLGKY............SHYL
B4KHQ6_DROMO/161-491-------------------------------------------------PLVG..CHKIGIEKF............CGYI
A8NGP6_COPC7/165-479-------------------------------------------------PAVG..WEEEGLEAY............AAFV
D8QT59_SELML/156-463-------------------------------------------------APLG..LHEEGIKAY............VSYL
S8C8S4_DACHA/216-562-------------------------------------------------PLIG..RSDTGLEVY............GGYV
N1PMN4_MYCP1/176-511-------------------------------------------------PLIG..RSHVGLEAY............GSYV
V5G2M7_BYSSN/194-532-------------------------------------------------PLIG..RSEVGLEVY............GRYV
F8Q674_SERL3/166-485-------------------------------------------------PVID..CQAEGLQAY............SSFV
M3AA99_MYCFI/191-526-------------------------------------------------PLIG..RSHVGLDAY............GRYV
G4MR42_MAGO7/219-567-------------------------------------------------PLIG..RGDVGLDIY............GRFV
J3KIC8_COCIM/186-524-------------------------------------------------PLID..RSAVGLDVY............GRYV
G4U2Q1_PIRID/161-490-------------------------------------------------PEIG..WETEGLELY............ARFV
R7YUM9_CONA1/175-511-------------------------------------------------PLIG..RTDVGLDAY............GRYV
G8ZSF3_TORDC/186-519-------------------------------------------------PLVG..QNTLGLDLY............SKYV
G0SXA1_RHOG2/160-497-------------------------------------------------PMIE..EEEKGLEVY............ADWV
S3C4S1_OPHP1/236-610-------------------------------------------------PLIG..RTDVGLDVY............GRYV
D8M8U8_BLAHO/154-504-------------------------------------------------DSLG..EGRSILQPFLSLSSFELTHRLVQYL
C3YFK8_BRAFL/171-477-------------------------------------------------PLIG..LRDEGLKKF............TAYL
Q758T0_ASHGO/188-512-------------------------------------------------PKIG..YAELGLEVY............SKYV
M5C4C1_THACB/161-521-------------------------------------------------PTIN..CPADGLAAY............SDFV
U4L2E9_PYROM/293-612-------------------------------------------------PLIG..RGDTGLDVY............GRYV
J4KLZ9_BEAB2/1246-1586-------------------------------------------------PLID..RTEVGLDVY............GKYV
G7E1B8_MIXOS/165-515-------------------------------------------------PVIR..AEKEGLDAY............SKFI
H2KS09_CLOSI/401-723-------------------------------------------------PLLG..RREDGLQRF............GGYL
W1NDY2_AMBTC/181-483-------------------------------------------------PMLG..LRAEGLQIY............VSYL
COG4_ARATH/176-479-------------------------------------------------SPLG..METEGLQLY............VGYL
H6C9G5_EXODN/179-515-------------------------------------------------PLIN..RSDVGLDIY............GRYV
H3AVV6_LATCH/187-496-------------------------------------------------PLLG..LHENGLSKF............SEYL
K5V063_PHACS/174-511-------------------------------------------------PAIG..WEEEGLQAY............ASFV
B6HSP5_PENCW/191-531-------------------------------------------------PLIG..RSEVGLDVY............GRYV
G3BC56_CANTC/190-528-------------------------------------------------PLIG..QEEVGLNCY............SKFI
U6I4L4_HYMMI/106-417-------------------------------------------------PIIL..EHDMGLTKY............GTYL
M7NUP8_PNEMU/161-484-------------------------------------------------PIIG..KSKEGLNVY............SEFI
U7PW27_SPOS1/225-627-------------------------------------------------PLIG..RTDVGLDVY............GRYV
E9EW04_METAR/274-618-------------------------------------------------PLIG..RADVGLDVY............GRYV
E6ZNH9_SPORE/195-575-------------------------------------------------PQVG..WKKEGLEVY............SSFA
G0V8A6_NAUCC/189-534-------------------------------------------------PMVG..QDSLGLDLY............SKYV
E7QLX6_YEASZ/190-525-------------------------------------------------PMIG..QDVLGLDLY............SKYV
C5DUL4_ZYGRC/172-510-------------------------------------------------PLIG..QDSLGLDLY............SKYV
E4UP45_ARTGP/209-548-------------------------------------------------PLIG..KSDVGLDVY............GRYV
K1R201_CRAGI/174-481-------------------------------------------------PLIG..LHEEGLTKF............GKFL
Q6FTK7_CANGA/185-531-------------------------------------------------PMVG..QDNLGLDLY............SKYV
D2V3G5_NAEGR/119-422-------------------------------------------------SPLC..MNEDGLSLY................
G5C1P9_HETGA/267-575-------------------------------------------------PLLG..LHEEGLSKF............SEYL
L8WI47_THACA/987-1357-------------------------------------------------PTIN..CPADGLAAY............SDFV
V2X3Q2_MONRO/169-474-------------------------------------------------PAIG..WEKEGLEAY............ASFV
A7UW80_NEUCR/259-612-------------------------------------------------PLIG..RGDVGLDAY............GQYV
M2NB58_BAUCO/172-509-------------------------------------------------PLIG..RRDVGLDAY............GRYV
C7ZFK3_NECH7/171-496-------------------------------------------------PLIG..RAEVGLDVY............ARYI
K1WSR6_MARBU/231-588-------------------------------------------------PLIG..REDTGLEVY............GRYV
S0E9C5_GIBF5/167-499-------------------------------------------------PVIGGGAEETGLEAY............GQYI
C4XYR0_CLAL4/197-532-------------------------------------------------PLID..QEEVGLNCY............SKFI
S2JH92_MUCC1/194-506-------------------------------------------------PLIN..CQTEGLDKY............SRFV
E9IBA8_SOLIN/158-464-------------------------------------------------PLLG..MHLEGLKKF............CSYL
I1RAH7_GIBZE/187-527-------------------------------------------------PLIG..RAEVGLDVY............GRYV
G0R6U4_HYPJQ/191-531-------------------------------------------------PLIG..RADVGLDVY............GKYV
I2FV21_USTH4/206-592-------------------------------------------------PQVG..WKKEGLEVY............SSFA
A8NFV8_BRUMA/216-544-------------------------------------------------PLLN..EHMKGIELI............GNYL
G0SCB4_CHATD/176-523-------------------------------------------------PLIG..RGDVGLDVY............GQYV
W1QCQ6_OGAPD/210-555-------------------------------------------------PLIG..KSDVGLSCY............SRFI
Q5AW68_EMENI/201-531-------------------------------------------------PLIG..RSEVGLDVY............GRYV

PF07393

Q750R9_ASHGO/111-822ETELLDSFNLAYRNND...F-------DKLNEIALI...LKHYNGGV....NVIQSFINQHEYFA.DAELIKQ.NEADVA
Q6BHS9_DEBHA/103-810EKELLKKFDVYYECDE...Y-------DRMKEVASI...LHQFNGGA....TVVQLFLNKHDFML.DTENL.....DDNS
SEC10_ARATH/139-817ENRLLSRFDAASQRRD...L-------STMSECAKI...LSQFNRGT....SAMQHYVATRPMFI.............DV
Q2HG63_CHAGB/108-854EQDLLKQFNNSYRRQN...F-------DDMMECARV...LHDFNGGA....SVIAAFVNQHQFFI.DRDQLI...TDEVT
Q7PQN8_ANOGA/88-705EMQLIEEFATAQKMEN...I-------ERMKELSDI...LSQFKGYT....QVIDVYIEQSQATT...............
A1D556_NEOFI/126-876ETAAMKEFRQGYESED..ID-------GTMRKYAHV...LFTLNGGD....SAIEFFINHNHLIT.QKSDLGR.VADCID
Q2URB8_ASPOR/132-879ETAAIKEFRHGYETED..ID-------NRMRQYAHV...LYTLNGGA....AAVELFIHHNHLVT.RRSDYGK.PGDCID
A0A023ZK30_YEASX/120-862ENELLENFNSAYRENN...F-------TKLNEIAII...LNNFNGGV....NVIQSFINQHDYFI.DTKQIDLENEFENV
Q4RLZ1_TETNG/80-698ERQLIQEFTAAQRRGE...I-------GRMREVAAV...LLHFKGYA....HCVDVYIKQCQEGA...............
Q55N90_CRYNB/170-1008DSTCLVAFEVSDGKKD...E-------EGMKEAAESSWKVWEAGGGDREKWECGRVWVEKREVFY............DTS
Q0IP77_ORYSJ/117-800ENRLLARFDTASQRRE...M-------STMAECAKI...LSQFNRGT....SAMQHYVATRPMFI.............DV
A2EZD8_TRIVA/69-728KDQLLEQFVANSKINK....-------YEQAKCASA...LGLLSHEY....EAMEAFIKSTPIMTDAGKKY.........
Q2GXU3_CHAGB/166-960ESAVLREFEQGYEFWD..VD-------GRMNKYAHV...LALLNGSS....AAVELFIQKHPVFT.DREVLAN.SMDCVN
Q2TVY5_ASPOR/116-891EKDLLKQFDDFYRKAN...F-------EGMKDCATV...LQDFNGGS....SVIALFVNQHQFFI.DRSQLV...TEEVG
Q5BGH2_EMENI/123-870ETAALKEFRHGYETDD..ID-------GRMKNYAHV...LYTLNGGG....SASELFTHHNHIIT.RKAELGQ.TNDCID
Q6CDC8_YARLI/101-777EKDLLDVFDQAYRNAD...M-------LMMKDSADV...LTDFNGGT....NVIMAFVNQHDFFIAQDKVV......AAN
EXOC5_DROME/89-705ERRLIEEFATAQKSED...I-------ERMKTLAQI...LSQFKGYT....QCVDAYIEQSQMQP...............
A1DAY7_NEOFI/117-893EKDLLKQFDDFYRKAN...F-------EGMRDCATV...LQDFSGGA....SVTALFVNQHQFFI.DRSQLV...TEELG
EXOC5_CAEEL/46-659EDLLIEEFVRSQRDEK....-------.KMAEVAKI...LSEFKGYS....GCVDRYVD.....................
Q6FMF7_CANGA/102-810ENEMLTKFNNAYRENN...F-------TQLNEIALI...LNHYNDGI....NVIQSFINQHNFFL.DSDEVNKSMTGESP
Q4PHT4_USTMA/134-1026ERDMLKLFDKFYRRSD...P-------KMMSHIAKV...LQGFNGGA....SCVQIYVNQHDFFI.SKDRV.....GEAN
SEC10_SCHPO/101-799ETNFLKFFNNEYRKPN...W-------KGMASFGTI...LQEFNGGA....SVVREFVNQHEFFI.AADKV.....QSRQ
Q5KJ89_CRYNJ/95-875EKELLKLFDRSYRKGD...P-------RMMAHCAKT...LQEFNGGA....SCIQIYVNQHDFFIKDHSQIE...KDEQD
Q5AS51_EMENI/111-841EKDLLRQFDDFYRKAN...F-------EGMKDCATV...LQDFNGGA....SVVALFVNQHQFFI.DRSQLV...TEEVG
Q6CQC0_KLULA/109-807EVRILQGFNAAYREND...Y-------SRLHQLAWI...LDTFNNGV....NIIKNFTDKHQFFE.ESSNFS...AKESA
C4YGD5_CANAW/103-782EKELLRKFEIASEDEDDIDF-------DMMNQIAQI...LFEYNEGI....NVIQTFVIKNDIVIENEEKS.........

PF10191

Q7QA49_ANOGA/2-731EALVSPSVVVALRSMD---T.......AACRRYVGI---FEGIGRLA----QLKQYYRTVLKTFV---------------
Q29C94_DROPS/2-737EALASPSVVQCFAESN---L.......EQAQHYVQI---FASIQRLP----QLQQYYRAVQKNLW---------------
Q172R1_AEDAE/2-704EALASPSVIQYIQQGD---V.......TQCLKYVEI---FRIIDRLP----QLKQCYRTVHKNAL---------------
COG7_RAT/2-767EALASPQIVAAFTSQS---V.......DQSKVFVKV---FTEIDRMP----QLLAYYYKCHKVQL---------------
Q5FW35_XENTR/2-765EAMCSPQIVAAFNSQS---V.......DQAKMFVKV---FSEIDRMP----QLLAYYYKCHKVQL---------------
Q655R9_ORYSJ/5-868DDMVQPRLVDALSNRK---PTNFGWKVDAVQDLRGI---LIRIGRFK----SLEVQYTKIHVKPL---------------
Q9FGN0_ARATH/4-832EAMVQPRLTDALTYHK---V.......DVAQDLRVI---LIRIGRFK----SLELQYSKVRLKPI---------------

PF08318

E9CCF3_CAPO3/274-605CGQVVQLLDGKFRELS-----------RNENGKL..---........----.........SQVVF---------------
B6JXE3_SCHJY/165-484GGLIAAKARATMDQPV-----------S........---........----.........HVLFF---------------
COG4_DROME/166-496CQKLANKAQKELRNAQ-----------DIAKAESR.---........----.........LQLAY---------------
M3D3E3_SPHMS/178-512CGGIAARARSNMSSTR-----------.........---........----.......ARDGMFY---------------
C4QWJ7_PICPG/179-518CNIIHEQSRLNMKTSQ-----------G........---........----.........TNTSH---------------
B8LT52_TALSN/189-530CQGVASRARANLNAG.-----------.........---PGGSQ...----.......VKDGYFY---------------
S3CMB0_GLAL2/185-536CQGVAGRARGNLKEG.-----------.........---TKGVG...----.......AQDGFFY---------------
COG4_SCHPO/163-481GGIIASKARATLDEPP-----------T........---........----.........HALFF---------------
L8FSC8_PSED2/189-538CGGVSERARATLREA.-----------.........---TGKQIDRD----RAGE...GKDGFFY---------------
F0XR72_GROCL/199-557CQGVAAAARTVMGTEA-----------ASA......---........----.......TPSPFFY---------------
V8NZE8_OPHHA/148-457CKQVANKAEENLQLAL-----------QTDPTDRR.---........----.........YAVLF---------------
F6TNZ6_XENTR/114-423CKQVAKKAEENLQLAL-----------GTEGGERR.---........----.........AALIF---------------
G8BDV4_CANPC/186-525CEIISESSKNLTQTIN-----------SITATDL..---........----.........KPGIF---------------
C5WWS3_SORBI/192-503KKVVALRARADFEHLA-----------ELTSATQPT---S.......----.........ERLDF---------------
A8X3I7_CAEBR/217-546NQKIDKLAEENLAIMR-----------AGGTDDNR.---........----.........RNVLY---------------
U1HW21_ENDPU/187-524CQGVAGRARANLNAG.-----------.........---TGGSQ...----.......SKDGYFY---------------
J3NYL1_GAGT3/212-567CQGVAGTARQTLRDGP-----------PAATTPGGG---GGGGT...----.......TTAGFFY---------------
D5GK94_TUBMM/197-545CQGVAARARDALAAKR-----------QAVADGAG.---........----.......GLGDFFY---------------
F6I2Y2_VITVI/183-485KKVIGMRSRLEYEHLV-----------ELMEQSSGN---Q.......----.........SNVNF---------------
T1KVK7_TETUR/162-476CQQLSQPNATESKSAG-----------LSEVSD...---........----.............H---------------
G8BYJ4_TETPH/194-538CNIIAEESRTLMTING-----------NDNLEQSIK---........----.........RPGFF---------------
Q4P6N8_USTMA/201-590RSMVREKGRSISDSLG-----------SGKAQ....---........----.........HPTHF---------------
Q5TNE6_ANOGA/167-491CGKLQVKAAKELRSSM-----------DIAKAEKR.---........----.........AAVAY---------------
J4GWL1_FIBRA/183-513VDLVKVRAPASAKTS.-----------.........---........----.........SPLYY---------------
H2VA38_TAKRU/70-376CTQIASKAEENLHLAT-----------GGDLGEKR.---........----.........APLVF---------------
A3LT54_PICST/195-541CQIISDTSKNLVTSTS-----------TVNAADL..---........----.........KVGIF---------------
B7QAG5_IXOSC/93-401SAQISETAHKNLKQAQ-----------ATSASDKR.---........----.........ANIIY---------------
C5LP43_PERM5/114-451RQTLAAQCKQKLSSVT-----------ATTTTSNDA---SSSSSSNV----.........INEKY---------------
G3AM87_SPAPN/194-515CEIIKETSRSLISQST-----------SG.......---........----.........KPGIF---------------
R8BYD5_TOGMI/1157-1500CQGVAGTARSTLKEG.-----------.........---TGGHG...----.......RKDGFFY---------------
A5DUI4_LODEL/191-536CEIINESSKNLTSTVN-----------NIHASEL..---........----.........KPGIF---------------
F4NT70_BATDJ/197-515CRTVSRSCQDGIRAAI-----------EAGK.....---........----.........QKMVY---------------
C5GF37_AJEDR/230-568CQGVAARARANLHAG.-----------.........---AGAEQ...----.......RKDGFFY---------------
B2AA74_PODAN/219-562CQGVAGTARTVLKEG.-----------......AST---VGGQG...----.......RKDGFFF---------------
N1JE83_BLUG1/191-526CKGVAARARDSLRED.-----------.........---...SK...----.......GKDALFF---------------
W4ZDW5_STRPU/172-484QAQIVSNAREHLEIAS-----------SVDSSDRR.---........----.........AGVLY---------------
G0W4A1_NAUDC/213-564CDIIANESRKILTFEK-----------KNL......---........----.........SNLYY---------------
Q4DDH2_TRYCC/242-662CEHTIAALKKMVDREL-----------RKMDDPTE.---........----.........AGMSH---------------
Q16TS8_AEDAE/167-489CTKLQAKAQKELRSSM-----------DIAKAEKR.---........----.........TTVAF---------------
E9FQQ8_DAPPU/154-462AGQLRDKTPKTLRPTD-----------GDSNNIR..---........----.........ANVYF---------------
C5M6Q7_CANTT/193-537CEIINETSKNLTKGLE-----------NAHDL....---........----.........KPGIF---------------
V5GSU0_PSEBG/199-579RSMVREKGRSITDSLG-----------SGKAQ....---........----.........NPTHF---------------
X6MJK6_RETFI/5-348CEALKRETMMELENRS-----------LLFDCKEFV---DIKNSKE.----.........EHIPY---------------
M2R7X1_CERS8/181-514VDLIRIRPPASAKTS.-----------.........---........----.........SPLYY---------------
U6HLQ3_ECHMU/114-419ATKIGEKAETQFAVVT-----------STQSFD...---........----.........KPNVH---------------
D6WJA3_TRICA/162-474RTKVAATAEKNLKSAM-----------TTPQSDKR.---........----.........HSVIY---------------
G8Y9D0_PICSO/191-527CGIIIETSRNLITSTH-----------KDSNTEV..---........----.........KSGLY---------------
Q57XU9_TRYB2/282-625CEHTIVALNKMVEREL-----------RKIDDPNE.---........----.........AGMSH---------------
G2Y0X2_BOTF4/187-528CQGVAGTARKNLKEG.-----------.........---AKGER...----.......GKEGFFY---------------
E0VZ92_PEDHC/157-456SSKLRQTAEKNLKVAL-----------DTAKTDLK.---........----.........PNIIF---------------
B0CT70_LACBS/161-472VDLVRVRAPASAKTS.-----------.........---........----.........SPLYY---------------
Q59T37_CANAL/195-551CEIINETSKSLTAGLE-----------NAHDL....---........----.........KPAIF---------------
E9QGT9_DANRE/180-489CSQLASKAEENLILAV-----------GSDLGERR.---........----.........APVIF---------------
K1WLQ9_TRIAC/267-644VELVQSRARKDKDGQR-----------S........---........----.........SPLYY---------------
F9XE54_MYCGM/175-509CGGIASRARSNMSSTQ-----------.........---........----.......PKDGMFY---------------
C5DG77_LACTC/179-498CDMIATQSRKVMTSTT-----------SK.......---........----.........SPGFF---------------
K5Y4H4_AGABU/183-506VHLVRGRAPASANTS.-----------.........---........----.........SPLYY---------------
I1JS41_SOYBN/186-485KKVIAMRSRMEFEQLV-----------EMMDQ....---........----.........QNVNF---------------
K0KE72_WICCF/171-504CNIIANQSRLIITNQS-----------QQD......---........----.........KYGFY---------------
K4CGD4_SOLLC/174-477KKVIAMRSRLEYEQLV-----------EMMSDQQGS---SQ......----.........NQLNF---------------
H2XLC7_CIOIN/111-421CQEIAKSSSENLKQAL-----------QIETGDTR.---........----.........YSLIF---------------
S9VWR1_SCHCR/164-482GGIIASKARATLDEPS-----------S........---........----.........HSFFF---------------
U9TBS3_RHIID/182-496CGIIAGKSQANLAEMA-----------I........---........----.........GTNFY---------------
E3Q612_COLGM/198-538CQGVAGTARSVLKES.-----------.........---PGAQA...----.......RKEGFFY---------------
Q6BTT0_DEBHA/227-568CQIITDTSRSLINSAS-----------GGSNAAT..---........----.........KHGMY---------------
K2S8E4_MACPH/175-516CHGVSSRARTNLNTAV-----------A........---........----.......SRENFFY---------------
G8JQJ6_ERECY/189-517CNILAEQSRKIMMGQI-----------DK.......---........----.........PHMFF---------------
J3Q132_PUCT1/187-568RTLISVPSSITRPTDG-----------A........---........----.........KPASI---------------
A9SCH4_PHYPA/154-467RKVVAMRARGDYEVLI-----------EALGSTDGG---RGA.....----.........GTADF---------------
Q0UYP7_PHANO/174-513CQGVAARARANFNSAP-----------PAQ......---........----.......RKEGFFY---------------
M9MH30_PSEA3/203-582RSMVREKGRAISDSLL-----------PGKAQ....---........----.........HPTHF---------------
I2H5R5_TETBL/205-583CDIIANESRKIITDET-----------NKNSDNGAH---HINPSK..----.........IPGFY---------------
A7TT52_VANPO/190-542CDIIADESRKLMTSSG-----------NNNLEESLK---........----.........RPGFY---------------
T1J554_STRMM/179-485CSQIAETAQKNLKLAL-----------GSAPGDKR.---........----.........ANVIF---------------
J9MJB3_FUSO4/82-414CQGMAETVRSALGGAH-----------KERG.....---........----.......KQNDFFY---------------
A7RPW3_NEMVE/163-477CSMVAATAQQNLEQID-----------ITKDSDRH.---........----.........ANVLF---------------
B4KHQ6_DROMO/161-491CQKLSAKAQKELRNAQ-----------DIAKAERR.---........----.........QHLAY---------------
A8NGP6_COPC7/165-479VDLVRIRTPASAKTS.-----------.........---........----.........SPLYF---------------
D8QT59_SELML/156-463RRSVDHRARDGFAAVK-----------ETP......---........----.........DQADF---------------
S8C8S4_DACHA/216-562CRGVAERMRAVRGRK.-----------.........---........----.......NDGPLFY---------------
N1PMN4_MYCP1/176-511CSGIAARARSNMSSTQ-----------.........---........----.......KREGLFY---------------
V5G2M7_BYSSN/194-532CQGVAARARTNLNAG.-----------.........---AAGSQ...----.........DGFFY---------------
F8Q674_SERL3/166-485VKLIRVQPMVFDQTT.-----------.........---........----.........SSHYF---------------
M3AA99_MYCFI/191-526CSGIASRARSNMSSTR-----------.........---........----.......RRDGIFY---------------
G4MR42_MAGO7/219-567CQGVAGMARQTLRDG.-----------.....PGVT---AAGGQ...----.......QQNTFFF---------------
J3KIC8_COCIM/186-524CQGVASRARANLNTG.-----------.........---TGGAQ...----.......SKDGFFY---------------
G4U2Q1_PIRID/161-490VDLIRARAPAGVKAS.-----------.........---........----.........SPMYY---------------
R7YUM9_CONA1/175-511CQGVASRARTNLNSGA-----------G........---........----.......RKDGFFY---------------
G8ZSF3_TORDC/186-519CDMIAEQSRRLMTMET-----------K........---........----.........KRGVF---------------
G0SXA1_RHOG2/160-497AGIVRAKTGALSTKSQ-----------.........---........----.........SPTHF---------------
S3C4S1_OPHP1/236-610CQGVAQSARNVWKDAG-----------SDPSSTNTS---T.......----.......QRDTRFY---------------
D8M8U8_BLAHO/154-504MTPLVEQTKKDNQLLQ-----------SQRSAHH..---........----.........VGVVV---------------
C3YFK8_BRAFL/171-477CSQIANTSEQNLQIAI-----------GTTSTERR.---........----.........ANVVY---------------
Q758T0_ASHGO/188-512CDIIAGQSRKIMTGST-----------ER.......---........----.........RHMFY---------------
M5C4C1_THACB/161-521LDLVARRAPPSVKAS.-----------.........---........----.........SPVYY---------------
U4L2E9_PYROM/293-612CTGVAGRAREVMNQD.-----------.........---........----.......QKGDFFF---------------
J4KLZ9_BEAB2/1246-1586CQGVAGTARTTLKDG.-----------.........---IGGQT...----.......RKDGFFY---------------
G7E1B8_MIXOS/165-515CSIVHGRSKAALTQKA-----------N........---........----.........SLLYF---------------
H2KS09_CLOSI/401-723CTRITKHCEGLFGLSE-----------LSDDPKTTG---QVK.....----.........RTMIC---------------
W1NDY2_AMBTC/181-483RKVISMRTRMEFDTVK-----------EFIDQSRPP---........----.........SEINF---------------
COG4_ARATH/176-479KKVIALRGRMEYENVV-----------ELMEQGL..---........----.........GQVNF---------------
H6C9G5_EXODN/179-515CQGVAARARANLNAG.-----------.........---TGGNQ...----.......SKDDFFY---------------
H3AVV6_LATCH/187-496CKQIANKAKENLLLAM-----------GSDMTDRR.---........----.........AAVMF---------------
K5V063_PHACS/174-511VDLVKVRAPASAKTS.-----------.........---........----.........SPLYY---------------
B6HSP5_PENCW/191-531CQGVAAKARANLNGA.-----------.........---TGGAQ...----.......TKDGFFY---------------
G3BC56_CANTC/190-528SQVITDTSRSLIQSIS-----------SGSGGEASK---........----.........KIGLY---------------
U6I4L4_HYMMI/106-417ASKIGEKAANQLALAV-----------TGGSLS...---........----.........ESNVH---------------
M7NUP8_PNEMU/161-484SNMVIQNKHKLMSAMG-----------ILDEKSIDT---K.......----.........ISMSY---------------
U7PW27_SPOS1/225-627CQGVAESARNVFRGET-----------PQPAAVPAA---AS......----.......RHDGFFF---------------
E9EW04_METAR/274-618CQGVAGTARATLKDS.-----------.........---VGAHG...----.......RKEGFFY---------------
E6ZNH9_SPORE/195-575RSMVREKGRSISDALG-----------SGKAQ....---........----.........HPTHY---------------
G0V8A6_NAUCC/189-534CDIIAEESRKILTQKI-----------SQST.....---........----.........NTSYY---------------
E7QLX6_YEASZ/190-525CDIIADESRKIMSNSM-----------ENSTK....---........----.........FQGFF---------------
C5DUL4_ZYGRC/172-510CDIVAGQSRKIMTGEN-----------K........---........----.........RPGVF---------------
E4UP45_ARTGP/209-548CQGVAARARSNLNAG.-----------.........---TGGAQ...----.......AKDDFFY---------------
K1R201_CRAGI/174-481SSQIAEKSRGNLMIAE-----------SVTHKDKN.---........----.........ANVIY---------------
Q6FTK7_CANGA/185-531CDIIADESRKLMSSSA-----------NADVDATIT---R.......----.........RSGFF---------------
D2V3G5_NAEGR/119-422VDFLSDKCRKELESLD-----------EVERLTYIR---KQQQ....----.........QYVSF---------------
G5C1P9_HETGA/267-575CKQVASKAEENLLLVL-----------RSDMSDRR.---........----.........AAVIF---------------
L8WI47_THACA/987-1357LDLVARRAPPSVKG..-----------.........---........----...........VVI---------------
V2X3Q2_MONRO/169-474VDLVRVRAPVSAKTS.-----------.........---........----.........SPLYF---------------
A7UW80_NEUCR/259-612CQGVANRARAILKDG.-----------......VGA---VGGAANAN----APPTLRPKKDGIFY---------------
M2NB58_BAUCO/172-509CTGIAARARSSMNTSQ-----------.........---........----.......RREGLFY---------------
C7ZFK3_NECH7/171-496CRGVANAARETLKQAG-----------TS.......---........----.......SRDVFFY---------------
K1WSR6_MARBU/231-588CQGVAARARGGLREG.-----------.........---TKGSA...----.......GQDGFFY---------------
S0E9C5_GIBF5/167-499CQGMAETARSALRRPQ-----------EERG.....---........----.......RQNDLFY---------------
C4XYR0_CLAL4/197-532CSIITDTSRTLINSAM-----------QGDASS...---........----.........KKGIY---------------
S2JH92_MUCC1/194-506CNIIKARCAEELKTGL-----------IA.......---........----.........APTYF---------------
E9IBA8_SOLIN/158-464CTKLHETAQKNLQAAL-----------EIKSNDKR.---........----.........AAVIF---------------
I1RAH7_GIBZE/187-527CQGVAGTARATLKDA.-----------.........---MNGQ....----.......RREGFFY---------------
G0R6U4_HYPJQ/191-531CQGVAGTARATLKDG.-----------.........---MAGQN...----.......RKEGIIY---------------
I2FV21_USTH4/206-592RSMVREKGRAISDSLA-----------SGKAQ....---........----.........HPIHF---------------
A8NFV8_BRUMA/216-544CSEIHQFAERNYKVML-----------AGGIDDTR.---........----.........ISVLY---------------
G0SCB4_CHATD/176-523CQGVAGQARAMLKEG.-----------.....TTGA---AAGQP...----.......RKDGVFF---------------
W1QCQ6_OGAPD/210-555CNIISDQSRTNLRSVQ-----------GKDV.....---........----.........HSSFY---------------
Q5AW68_EMENI/201-531CQGVAAKARSNLNTG.-----------.........---TG......----.......QQDGFFY---------------

PF07393

Q750R9_ASHGO/111-822VFSNSALTEKLTN..AE----------------------EHDMFYPKTLVESLSSMEEIVKAEAEIVRRVF...EERAPV
Q6BHS9_DEBHA/103-810LLDNEAIWNKLSD..PD----------------------FGENIKDESTEALLDGLKISIKGQARIVQQVF....EDATP
SEC10_ARATH/139-817EVMNSDIRLVLGDHGSQ----------------------PSPSNVARGLSALFKEITDTVRKEAATITAVF....PTPNE
Q2HG63_CHAGB/108-854TDG..ETWDQLAD..PD----------------------SDPPGVEPSLQSLVDEVKIVMQEESFIIKRAF....PYYET
Q7PQN8_ANOGA/88-705.................----------------------.......YGGRDVFEGIVPLCHKHYKIIQQVF....NAPDK
A1D556_NEOFI/126-876G..............LN----------------------Q..RVKLEHTQAFFTRLSVAYNEEVSIINRAF....PPSMN
Q2URB8_ASPOR/132-879A..............SS----------------------Q..SVKLDQTQAFFTRLSVAYNEEVAIINRAF....PPSLK
A0A023ZK30_YEASX/120-862FIKNVKFKEQLID..FE----------------------NHSVIIETSMQNLINDVETVIKNESKIVKRVF...EEKATH
Q4RLZ1_TETNG/80-698.................----------------------.......YLRNDVFEDTAILCQRVNKQVGEVF....SSPET
Q55N90_CRYNB/170-1008RWDSLENIIKVQTQSGA----------------------TIRQLDFTPMDAFMSHVLEAFRIDAEIAHSVF....PSKAK
Q0IP77_ORYSJ/117-800DIMSIDIQVVLGEEGPQ----------------------ADHICIAEGLSVLYKEIADTVRREATTIMAVF....PSPNE
A2EZD8_TRIVA/69-728.........HFKEKYLF----------------------EDESILLDHYKGLCSFFVTDCKKSWDLIDVIFTGSQQPKTV
Q2GXU3_CHAGB/166-960Q...............A----------------------LADSITLEPSRRFFEVLTRKVNEQAGIIERIF....PNPVH
Q2TVY5_ASPOR/116-891GDL..EAWEQLAD..PD----------------------SEPLKVEPSLQSLIDEVKVVVQEESAIIKRAF....PYYEQ
Q5BGH2_EMENI/123-870T..............LT----------------------Q..KVKLHQTQAFFTRLSVAFNEEVSIINRAF....PPALQ
Q6CDC8_YARLI/101-777SEPDEAVLKELAD..PN----------------------NSDPQFDHVTEELCSEVVSVVNTETEIIKRVF....KEPVV
EXOC5_DROME/89-705.................----------------------.......YSGKDIFIGIVPLCKHHYEIIQKVF....ANPQQ
A1DAY7_NEOFI/117-893GDL..DSWEQLAD..PD----------------------AEPLKVEPSLQSLVDEVKVVVQEESAIIKRAF....PFYEQ
EXOC5_CAEEL/46-659...............FL----------------------CQSIHPRGDGGEILADCLQLCRTQQPRISAIF....PSPHT
Q6FMF7_CANGA/102-810YLSED.VRDKLMD..PN----------------------YHIIVYSQELVDMLKNIEEVIKNESKIVKRVF...EDSASY
Q4PHT4_USTMA/134-1026GIELSQIWTHMAD..PD----------------------HAPPKSEPSLTALFNEIRQTVEIEAQIISAVF....PNPLV
SEC10_SCHPO/101-799GLEQDPIWLILPD..PT----------------------QKIPPLIQTLSSLFSELCSVIEGDCAVIKRVF....PNPEL
Q5KJ89_CRYNJ/95-875GVRV.DIWATIGN..PD----------------------EPPPTTEPGLEALCKSIRSTISQESQIMKAVF...YPNSSA
Q5AS51_EMENI/111-841GDP..ESWEKLAD..PD----------------------AEPSGVEPSLQSLVDEVRVVVQEESAIIRRAF....PNYEQ
Q6CQC0_KLULA/109-807LFTDDVFKAELMN..PD----------------------SHILKYDEKVVEYIQSVFNAIENESKVVATVF...ENKAPN
C4YGD5_CANAW/103-782..LDEQEWALLAD..SR----------------------RSDFKIDE..QATFDTLKFEIKSRARISKKVF....ADPTP

PF10191

Q7QA49_ANOGA/2-731----QEQWSSAIEGSES..........................GGSDVLKEFYDHLVELLKSHLRWSCQCF----GE.AT
Q29C94_DROPS/2-737----QQQWKQTLELQGTET.....................QPQQQQQFLTLYYDQLLEHCQRQVKWCSNLF----SEEST
Q172R1_AEDAE/2-704----VEKWSKIAEAEDS.........................YDMNSVLSEFNNVILEFLQNQQKWCKQVF----QSHLE
COG7_RAT/2-767----LATWQELCQRD...........................LPLDRQLTGLYHALLGAWHTQTQWATQVF----KNPYE
Q5FW35_XENTR/2-765----VTVWQELCQSD...........................MPLDRQLTEFYDTLLSAWHTQLQWVSQVF----KKPQE
Q655R9_ORYSJ/5-868----KKLWEDFDLKQRAKRVEMEK..........YGGESINSLSFASWLPNFYDETLLYLEQEWKWCLTAF----PEEYK
Q9FGN0_ARATH/4-832----KQLWEDFDTKQRANKLANERSESQRLSSGDEFQSTSSQTSFASWLTSFYDELLLYLEQEWKWCMVAF----PDDYM

PF08318

E9CCF3_CAPO3/274-605---------------------------------------------VDLFVQLFTAVAKTVDQYQPIIEEHY---------
B6JXE3_SCHJY/165-484---------------------------------------------SQAFAGLLEHVSTIINNHLPLVHRYY---------
COG4_DROME/166-496---------------------------------------------ADRLTAILENFARVVEVNQPIIEAFY---------
M3D3E3_SPHMS/178-512---------------------------------------------AHALTKLFEHIAQIVEGHQPLVERHY---------
C4QWJ7_PICPG/179-518---------------------------------------------AFLILKLFETISNILIQHSNVIKKHY---------
B8LT52_TALSN/189-530---------------------------------------------ASALTKLFEHIAQIIDGHGALVERHY---------
S3CMB0_GLAL2/185-536---------------------------------------------ANALTRLFEHIAQIVENHGQLVERHY---------
COG4_SCHPO/163-481---------------------------------------------AQAFTGLVEHVASIIRAHTPLVQKYY---------
L8FSC8_PSED2/189-538---------------------------------------------ANALTKLFEHIAQIVDGHGGLVERHY---------
F0XR72_GROCL/199-557---------------------------------------------PNALAKLFAHISQIVEAHGALVERHY---------
V8NZE8_OPHHA/148-457---------------------------------------------ADTLTLLFEGIARIVETHQPIVETYY---------
F6TNZ6_XENTR/114-423---------------------------------------------ADTLTLLFEGIARIVETHQPILETYY---------
G8BDV4_CANPC/186-525---------------------------------------------DTVAMQLFENVSMMLSQHGPLIKRYY---------
C5WWS3_SORBI/192-503---------------------------------------------VGCLTRLFKDIVLAVEENDAVLRELR---------
A8X3I7_CAEBR/217-546---------------------------------------------ADTLFMFFEGVAEIIESNLPVLEHSY---------
U1HW21_ENDPU/187-524---------------------------------------------ANALTKLFEHIAQIIDGHGSLIERHY---------
J3NYL1_GAGT3/212-567---------------------------------------------AQALTQLFEHIARIVDGHGALVERHY---------
D5GK94_TUBMM/197-545---------------------------------------------ANAVTRLFEHIANIVEQHGKLIERHY---------
F6I2Y2_VITVI/183-485---------------------------------------------VGCLTNLFKDIVLAVQENSEILRSLC---------
T1KVK7_TETUR/162-476---------------------------------------------IGQLTNLFESIAKMIDVHTPLFETYY---------
G8BYJ4_TETPH/194-538---------------------------------------------SQVLLHLFKLVSTVINEHSKVITVSY---------
Q4P6N8_USTMA/201-590---------------------------------------------ALLLTSLFEHLAMLIDMHQPVVDRHY---------
Q5TNE6_ANOGA/167-491---------------------------------------------ADTLTILLENIARVIEVNQAIIENCY---------
J4GWL1_FIBRA/183-513---------------------------------------------VTALTALFESIAMIVDQHQPIVDKYY---------
H2VA38_TAKRU/70-376---------------------------------------------ADTLTLLLEGIARVIETHQPIVETYY---------
A3LT54_PICST/195-541---------------------------------------------STITIQLFESISMMLSQHGPLIKRYY---------
B7QAG5_IXOSC/93-401---------------------------------------------ADTVTLLFEGIARTVEIHQPLVETYY---------
C5LP43_PERM5/114-451---------------------------------------------VNTLTDVFLAVADIIQDHQRNIEEQF---------
G3AM87_SPAPN/194-515---------------------------------------------AEVTIQLFESISMMLSQHGPLIKRYY---------
R8BYD5_TOGMI/1157-1500---------------------------------------------ANALTKLFEHIAQIVEGHGGLVERHY---------
A5DUI4_LODEL/191-536---------------------------------------------STVTMQLFENVSMMLSQHGPLIKRHY---------
F4NT70_BATDJ/197-515---------------------------------------------VDLLTKLFEAIATMIDRQIDLVETYY---------
C5GF37_AJEDR/230-568---------------------------------------------ANALTKLFEHIAQIVDGHGALVERHY---------
B2AA74_PODAN/219-562---------------------------------------------ANALTRLFEHIAHIVDGHGALVEKHY---------
N1JE83_BLUG1/191-526---------------------------------------------ALVLTRLFEHIAQIIEGHGSLVEIHY---------
W4ZDW5_STRPU/172-484---------------------------------------------ADALTNLFEDVGKIIEVHQPLVETYY---------
G0W4A1_NAUDC/213-564---------------------------------------------SNALLHLFKIVSTIINDHSKIISASY---------
Q4DDH2_TRYCC/242-662---------------------------------------------LGLVSTVLDAVVAAFENEEEFIRETF---------
Q16TS8_AEDAE/167-489---------------------------------------------SDTLTVLLENIARVVEVNQAIIENCY---------
E9FQQ8_DAPPU/154-462---------------------------------------------ADTLTVLLESVARIVEIHQPLVETYY---------
C5M6Q7_CANTT/193-537---------------------------------------------ATIIMQLFENISMMLSQHGPLIKRYY---------
V5GSU0_PSEBG/199-579---------------------------------------------ALLLTSLFEHLASLIDMHQPVVDRHY---------
X6MJK6_RETFI/5-348---------------------------------------------VSVLEGLVDALFTVINDNVNNLKQMF---------
M2R7X1_CERS8/181-514---------------------------------------------IAALTALFESIAKIVDQHQPVVEKYY---------
U6HLQ3_ECHMU/114-419---------------------------------------------VDLMTYLLELVAQAIQTNESVIHDSY---------
D6WJA3_TRICA/162-474---------------------------------------------ADTLTLLFEGLARVVDTHQPLIETYY---------
G8Y9D0_PICSO/191-527---------------------------------------------SAMSRKLFENVSTMLVQHIPLIRKYY---------
Q57XU9_TRYB2/282-625---------------------------------------------LALVSAGLDLVVATFENEEEFVLETF---------
G2Y0X2_BOTF4/187-528---------------------------------------------AQALTRLFEHIAQIVEGHGGLVERHY---------
E0VZ92_PEDHC/157-456---------------------------------------------ADTITLLLEGTARVIETHQPLVDTYY---------
B0CT70_LACBS/161-472---------------------------------------------ITALTALFESIAMIVDQHQPVVEKYY---------
Q59T37_CANAL/195-551---------------------------------------------SNVVMQLFENISMMLSQHGPLIKKYY---------
E9QGT9_DANRE/180-489---------------------------------------------ADTLTLLLEGIARIVETHQPIVETYY---------
K1WLQ9_TRIAC/267-644---------------------------------------------LAQLTSLLEAIAHIVDQHQPVIAKYY---------
F9XE54_MYCGM/175-509---------------------------------------------AGALTKLFEHIAQIVDGHEPLVERHY---------
C5DG77_LACTC/179-498---------------------------------------------AQALLHLFKIVSTIINEHSKIIAKYY---------
K5Y4H4_AGABU/183-506---------------------------------------------ITALTSLFESIALIVDQHQPVVEKYY---------
I1JS41_SOYBN/186-485---------------------------------------------VGCLTNLFKDIVLAIEENSEILSGLC---------
K0KE72_WICCF/171-504---------------------------------------------PAALMRLLEIISSMLNQHSTIIAKYY---------
K4CGD4_SOLLC/174-477---------------------------------------------VSCLTNLFKDIVLAIEENDETLRSLC---------
H2XLC7_CIOIN/111-421---------------------------------------------ADVLTLLFEGIARTVEKQQPLVETYY---------
S9VWR1_SCHCR/164-482---------------------------------------------SQAFTGLVEHVASIVRAHTPLVLRYY---------
U9TBS3_RHIID/182-496---------------------------------------------GNVLTKLFENIAHIIDQHQSAVETHY---------
E3Q612_COLGM/198-538---------------------------------------------ANALTRLFDHIARIVEGHGGLVERHY---------
Q6BTT0_DEBHA/227-568---------------------------------------------LTISMKLFENISMMLSQHGPLIKKYY---------
K2S8E4_MACPH/175-516---------------------------------------------ANALTKLFEHIAQIVGGHEPVVERHY---------
G8JQJ6_ERECY/189-517---------------------------------------------SQALLHLFKTVSTIINDHSKIITKSY---------
J3Q132_PUCT1/187-568---------------------------------------------VIQLTSIVEQLALIIDQHQGVVDKYY---------
A9SCH4_PHYPA/154-467---------------------------------------------VGILNNIFKDIAFAVEENEDLLFDLA---------
Q0UYP7_PHANO/174-513---------------------------------------------GNTITKLFEHIAQIVDGHEPLVEQHY---------
M9MH30_PSEA3/203-582---------------------------------------------ALLLTSLFEHLAMLIDMHQPVVDRHY---------
I2H5R5_TETBL/205-583---------------------------------------------AKVILHLFKIVSTVINEHSKIISTSY---------
A7TT52_VANPO/190-542---------------------------------------------SQVLLHLFKIVSTIINEHSKIIAGSY---------
T1J554_STRMM/179-485---------------------------------------------ADTVTLLFEGIARVIEIHQPLVETYY---------
J9MJB3_FUSO4/82-414---------------------------------------------ANNLTRLFEHIVQIINSHSGLVERHY---------
A7RPW3_NEMVE/163-477---------------------------------------------ANTLTMLFEGIARMVEEHQPFVETYY---------
B4KHQ6_DROMO/161-491---------------------------------------------ADRLTSILENFARVVEVNQPIIEAFY---------
A8NGP6_COPC7/165-479---------------------------------------------VTALTSLFESIAMIVDQHQPVVEKYY---------
D8QT59_SELML/156-463---------------------------------------------VAALNNIFKDIAEAIEENEELLKSLN---------
S8C8S4_DACHA/216-562---------------------------------------------AGSLSQLFEYMAGLVERHTPLVEKHY---------
N1PMN4_MYCP1/176-511---------------------------------------------ANALTKLFEHIAQIVGGHEPLVERHY---------
V5G2M7_BYSSN/194-532---------------------------------------------AGALTKLFEHIAQIVEGHGPLVERHY---------
F8Q674_SERL3/166-485---------------------------------------------VAALTALFESIAMIVDQHQSVVEKYY---------
M3AA99_MYCFI/191-526---------------------------------------------ATALTKLFEHIAQIVDGHEPLVERHY---------
G4MR42_MAGO7/219-567---------------------------------------------AAALTKLFEHVARIIEGHGGLVERHY---------
J3KIC8_COCIM/186-524---------------------------------------------ANALTKLFEHIAQIVEGHGGLVERHY---------
G4U2Q1_PIRID/161-490---------------------------------------------IAMVTALFESIAVIVDQHQPIVDKYY---------
R7YUM9_CONA1/175-511---------------------------------------------ANALTKLFEHIAQIVDSHQPLVEQHY---------
G8ZSF3_TORDC/186-519---------------------------------------------AQALLHLFKIVSTIINDHSKVIASCY---------
G0SXA1_RHOG2/160-497---------------------------------------------SALLTTLFEAIALILSQHQPVVEKYY---------
S3C4S1_OPHP1/236-610---------------------------------------------VHSLSKLFAHISQIVEGHGAIVERHY---------
D8M8U8_BLAHO/154-504---------------------------------------------GNLLGGLYQKAVELVDSVEDSFQNCF---------
C3YFK8_BRAFL/171-477---------------------------------------------ADTLTHLFEGIARLVETHQPLVETYY---------
Q758T0_ASHGO/188-512---------------------------------------------SKALLHLFKTVSTIINSHSQVISGCY---------
M5C4C1_THACB/161-521---------------------------------------------TAALTALYESVAGLIDQHQPIVEKYY---------
U4L2E9_PYROM/293-612---------------------------------------------AGAVTGLFEHIATIVEQHGKLVELHY---------
J4KLZ9_BEAB2/1246-1586---------------------------------------------ANALTKLFEHIAQIVEGHGGLVERHY---------
G7E1B8_MIXOS/165-515---------------------------------------------SQILTPLFEQIALIVSQHQPVVEKYY---------
H2KS09_CLOSI/401-723---------------------------------------------LDLLTQIVEFIAETVRDNQVYVETYF---------
W1NDY2_AMBTC/181-483---------------------------------------------VNCLTSLFKDIVLAVEENDAVLRELC---------
COG4_ARATH/176-479---------------------------------------------VGCLTNLFKDIVMAIEENDEILRGLC---------
H6C9G5_EXODN/179-515---------------------------------------------ANALARLFEHIAQIIEGHGGLVERHY---------
H3AVV6_LATCH/187-496---------------------------------------------ADTLTLLFEGIARVVETHQPIVETYY---------
K5V063_PHACS/174-511---------------------------------------------ITALTALYESVAMIVDQHQPVVEKYY---------
B6HSP5_PENCW/191-531---------------------------------------------ANALTRLFEHIAQIIDGHGGLVEHHY---------
G3BC56_CANTC/190-528---------------------------------------------SRSSMQLFENISMMLAQHAPLINRYY---------
U6I4L4_HYMMI/106-417---------------------------------------------VDLMTQLLELVAQAIQANETVIQQSY---------
M7NUP8_PNEMU/161-484---------------------------------------------ALIMQDMFEYVANIMNHHLPVIKKHY---------
U7PW27_SPOS1/225-627---------------------------------------------ANALAKLFTHISQIVEGHGALVERHY---------
E9EW04_METAR/274-618---------------------------------------------ANALTRLFEHIAQIVESHGGLVERHY---------
E6ZNH9_SPORE/195-575---------------------------------------------ALLLTSLFEHLAMLIDMHQPVVDRHY---------
G0V8A6_NAUCC/189-534---------------------------------------------SQALLHLFKIVSTIINDHSKIIATCY---------
E7QLX6_YEASZ/190-525---------------------------------------------SQVLLHLFKIVSTIINDHSKVIATCY---------
C5DUL4_ZYGRC/172-510---------------------------------------------AQALLHLCKIVSTVINNHSQIIAACY---------
E4UP45_ARTGP/209-548---------------------------------------------ANALTRLFEHIAQIVDAHGALVERHY---------
K1R201_CRAGI/174-481---------------------------------------------AETATQLFESIANIIEVRQPLIETYF---------
Q6FTK7_CANGA/185-531---------------------------------------------AQVLLHLFKIVSTIINDHSKIIAASY---------
D2V3G5_NAEGR/119-422---------------------------------------------IDIITQILDIIVSYIEDCEDFVTSNF---------
G5C1P9_HETGA/267-575---------------------------------------------ADTLTLLFEGIARIVETHQPIVETYY---------
L8WI47_THACA/987-1357---------------------------------------------RHILT......AGLIDQHQPIVEKYY---------
V2X3Q2_MONRO/169-474---------------------------------------------ITTLTALFESVAMIVDQHQPVVEKYY---------
A7UW80_NEUCR/259-612---------------------------------------------ANALNLLFGHITQIVDGHGGLVERHY---------
M2NB58_BAUCO/172-509---------------------------------------------ANALTKLFEHIAQIVDGHEPLVERHY---------
C7ZFK3_NECH7/171-496---------------------------------------------ANCLTKLFEHIAQIVNSHSGLVRQHY---------
K1WSR6_MARBU/231-588---------------------------------------------ANALTRLFEHIAQIVDGHGGLVERHY---------
S0E9C5_GIBF5/167-499---------------------------------------------ANNLARLLEHIVQITNSHSGLVERHY---------
C4XYR0_CLAL4/197-532---------------------------------------------ASITKNLFESVSMMLSQHTPLINKHY---------
S2JH92_MUCC1/194-506---------------------------------------------ADALTRLFENIAVIIDQHQPLVEQHY---------
E9IBA8_SOLIN/158-464---------------------------------------------SDTMTLLFEGIARIIEVHQPIIETYY---------
I1RAH7_GIBZE/187-527---------------------------------------------ANALTKLFEHIAQIVEGHGGLVERHY---------
G0R6U4_HYPJQ/191-531---------------------------------------------ANSLTRLFQHIAQIVEGHGGLVERHY---------
I2FV21_USTH4/206-592---------------------------------------------ALLLTSLFEHLAMLIDMHQPVVDRHY---------
A8NFV8_BRUMA/216-544---------------------------------------------ADALTMLFEGIAREIQVYEPLIGSSY---------
G0SCB4_CHATD/176-523---------------------------------------------ANALTKLFDHIARIVEAHGGLVERHY---------
W1QCQ6_OGAPD/210-555---------------------------------------------AQVLFQLYQTIADIVHQHSRIITKYY---------
Q5AW68_EMENI/201-531---------------------------------------------ANTLTKLFEHIAQIIDGHGGLVERHY---------

PF07393

Q750R9_ASHGO/111-822-VMKLFLKQLMAKRVEPKATLFLNTSMT-----------I...............................SNLAY----
Q6BHS9_DEBHA/103-810-VLKIFIQRIYAQIIQNKISTLLQYSLS-----------V...............................STLAH----
SEC10_ARATH/139-817-VMAILVQRVLEQRVTGILDKILAKPSL-----------MSPPP.......................VQEGGLLLY----
Q2HG63_CHAGB/108-854-VLIKFIQRVFQQSIQQRLEMVLDKATT-----------I...............................SSLAF----
Q7PQN8_ANOGA/88-705-VISKFILNIYQLKINQFVQTKLDDRK.-----------................................DENKY----
A1D556_NEOFI/126-876-VGPTFVEKVAQDVLYPFLTAIFDELHR-----------S...............................NLESY----
Q2URB8_ASPOR/132-879-VALPFIAKVGQDVLYPFLTAIFDELHR-----------I...............................NKESY----
A0A023ZK30_YEASX/120-862-VIQLFIQRVFAQKIEPRFEVLLRNSLS-----------I...............................SNLAY----
Q4RLZ1_TETNG/80-698-VMAKLIQNIFENKLQSHVKDRLDGTRH-----------S...............................DVEQY----
Q55N90_CRYNB/170-1008-VVLSFCDRLSNEVIGEYIHPLLSQARA-----------V...............................SQDLF----
Q0IP77_ORYSJ/117-800-VMSILVQRVLEQRVTAILDKLLIKPSL-----------ANLPP.......................IEEGGLLHY----
A2EZD8_TRIVA/69-728-LVTTVFNTVFDAFISRVLNHYLETPS.-----------................................KQNRF----
Q2GXU3_CHAGB/166-960-VFWVFVDKVREDVVMEYATPLFDETHE-----------R...............................SIPSY----
Q2TVY5_ASPOR/116-891-VLGKFLQRVFQQSIQQRLEMVLEKANS-----------I...............................SSLAF----
Q5BGH2_EMENI/123-870-LAQPFVEKVGRDVLYPFLTAIFDELHR-----------S...............................NKEEY----
Q6CDC8_YARLI/101-777-VLQVFLQRVFAQRIQQRIELFLSSAEA-----------M...............................STLAY----
EXOC5_DROME/89-705-VMSKFILNIYQLKLHQYAMTKLEDKK.-----------................................DEEKY----
A1DAY7_NEOFI/117-893-VLGKFLQRVFQQSIQQRLEMVLEKANG-----------I...............................SSLAF----
EXOC5_CAEEL/46-659-VMQKLVLNIFTGRMKETITARLRECKD-----------T..............................DDQEHY----
Q6FMF7_CANGA/102-810-VLQLFIQRTFAQKIEPQLEFLLNSALS-----------F...............................SHLAY----
Q4PHT4_USTMA/134-1026-VMQTFLQRVFAQSVQGFVEVIMDKAAD-----------INAPSFVGAGGNIDTKTAALELNPPSNSQPTTSHLAF----
SEC10_SCHPO/101-799-VLQTFFQRIFGQSIQNRLEEVMEIAKG-----------K...............................SNLAY----
Q5KJ89_CRYNJ/95-875-VMEGFLQRIFAQVIQQHLEGLVQRASS-----------I...............................STLAI----
Q5AS51_EMENI/111-841-VLGKFLQRVFQQSIQQRLEMVLEKANS-----------V...............................SSLAF----
Q6CQC0_KLULA/109-807-VMHLFIEKVFELKLRPLVVFLLNSALS-----------L...............................SSLAY----
C4YGD5_CANAW/103-782-VIKIFIQRMYAQIIRNKVTSLLQKSLS-----------V...............................SPLAH----

PF10191

Q7QA49_ANOGA/2-731.DCVLAVADALENLDPTRESVVRSALKR-----------A-------------------------------TDK......
Q29C94_DROPS/2-737.QPFLVIAELLPALQPTRDAHILQLLKT-----------S-------------------------------NER......
Q172R1_AEDAE/2-704..PLETVVDSLTNLQSLKQAFVMNHLKK-----------S-------------------------------VGK......
COG7_RAT/2-767.VVTVLLIQTLGALVPSLPMCLSEAVER-----------A-------------------------------GPELE....
Q5FW35_XENTR/2-765.VVTVLMIQTLAAMVPSIPVCLSTAMER-----------A-------------------------------SPEDK....
Q655R9_ORYSJ/5-868SLVPKVLVETMSELNSSFVSRVNLATGD-----------A-------------------------------VPETRSVAK
Q9FGN0_ARATH/4-832TLVPKLLVETMGVLGASFVSRLNLATGD-----------A-------------------------------VPETKALAK

PF08318

E9CCF3_CAPO3/274-605-------G..FGYLSV.LLRRLQFECDR...........Q----------------------------------------
B6JXE3_SCHJY/165-484-------K..AENAID.VIGKLQSDCDH...........Q----------------------------------------
COG4_DROME/166-496-------GQASSSLID.MVSILQHECDT...........E----------------------------------------
M3D3E3_SPHMS/178-512-------G..PGSMTK.VIQRIQVEADR...........Q----------------------------------------
C4QWJ7_PICPG/179-518-------E..PRYILD.VMQKIQNECDL...........Q----------------------------------------
B8LT52_TALSN/189-530-------G..SGKMTR.VIERLQVEADV...........Q----------------------------------------
S3CMB0_GLAL2/185-536-------G..VGKMVK.VIERLQVEADV...........Q----------------------------------------
COG4_SCHPO/163-481-------K..AKNTIT.VIEKLQGDCDR...........Q----------------------------------------
L8FSC8_PSED2/189-538-------G..DGRMVR.VVERLQQEADV...........Q----------------------------------------
F0XR72_GROCL/199-557-------G..PGQMGR.VVARLQKEADV...........Q----------------------------------------
V8NZE8_OPHHA/148-457-------G..PGRLYA.LIKHLQAECDQ...........Q----------------------------------------
F6TNZ6_XENTR/114-423-------G..PGRLYM.LIKHLQAECDR...........Q----------------------------------------
G8BDV4_CANPC/186-525-------ASTYSDAMTYVVNKLQREVDL...........Q----------------------------------------
C5WWS3_SORBI/192-503-------G..DDGVAY.AIIELQEECDS...........R----------------------------------------
A8X3I7_CAEBR/217-546-------G..LEKLLD.FMFILQARIDE...........F----------------------------------------
U1HW21_ENDPU/187-524-------G..SGKTIR.VIERLQVEADL...........Q----------------------------------------
J3NYL1_GAGT3/212-567-------G..DGKMVR.VIERLQVEVDV...........Q----------------------------------------
D5GK94_TUBMM/197-545-------G..EGRMGK.VIERLQVEADT...........Q----------------------------------------
F6I2Y2_VITVI/183-485-------G..EDGIVY.AICELQEECDS...........R----------------------------------------
T1KVK7_TETUR/162-476-------G..PGNIIY.CVEVLQRECDR...........Q----------------------------------------
G8BYJ4_TETPH/194-538-------N..LTYMTN.VMEKVEKEAEL...........Q----------------------------------------
Q4P6N8_USTMA/201-590-------G..EGNFAQGVMPGLQEECDR...........L----------------------------------------
Q5TNE6_ANOGA/167-491-------G..PGRLVQ.ICRILQRECDD...........E----------------------------------------
J4GWL1_FIBRA/183-513-------G..PGKMTP.VLERLLLESDR...........V----------------------------------------
H2VA38_TAKRU/70-376-------G..PGHLYT.LITHLQQECDQ...........Q----------------------------------------
A3LT54_PICST/195-541-------SSTYPNALNYVISRIQNEIDT...........Q----------------------------------------
B7QAG5_IXOSC/93-401-------G..HGRLHT.MVEMLQKECDC...........Q----------------------------------------
C5LP43_PERM5/114-451-------G..PINFIM.VLRGLQSEVDI...........Q----------------------------------------
G3AM87_SPAPN/194-515-------SE.YPNALTYVITKIQREIDV...........Q----------------------------------------
R8BYD5_TOGMI/1157-1500-------G..TGKLVK.VIERLQMEADV...........Q----------------------------------------
A5DUI4_LODEL/191-536-------SLTYPDALPFVIRKIQKEIDL...........Q----------------------------------------
F4NT70_BATDJ/197-515-------G..PGRMLP.VMVRLQREADI...........Q----------------------------------------
C5GF37_AJEDR/230-568-------G..PGKMMR.VVERLQVEADV...........Q----------------------------------------
B2AA74_PODAN/219-562-------G..TGKMVK.VIERLQMEADV...........Q----------------------------------------
N1JE83_BLUG1/191-526-------G..KGMMVK.VIEILQEEANV...........Q----------------------------------------
W4ZDW5_STRPU/172-484-------G..PGKLLT.LIESLQKECDR...........Q----------------------------------------
G0W4A1_NAUDC/213-564-------G..KNYMIH.VMENVEKEADL...........Q----------------------------------------
Q4DDH2_TRYCC/242-662-------G..DAGLLK.LLTELHCKSTS...........Q----------------------------------------
Q16TS8_AEDAE/167-489-------G..AGRLVQ.VVAILQRECDD...........E----------------------------------------
E9FQQ8_DAPPU/154-462-------G..PGRLLQ.VVEHLQPECDK...........Q----------------------------------------
C5M6Q7_CANTT/193-537-------SETYPSALSYVISKIQREVDL...........Q----------------------------------------
V5GSU0_PSEBG/199-579-------G..LGNFSHGVMPGLQDECDR...........L----------------------------------------
X6MJK6_RETFI/5-348-------G..EGSELL.LAQKLYGEADR...........E----------------------------------------
M2R7X1_CERS8/181-514-------G..PGKMAR.VLERLLQECDR...........V----------------------------------------
U6HLQ3_ECHMU/114-419-------G..GNSLLN.FICMIQTQCDH...........H----------------------------------------
D6WJA3_TRICA/162-474-------G..PGRLLC.AVSILQKECDI...........Q----------------------------------------
G8Y9D0_PICSO/191-527-------SPTYPKAVHYVLARIQNELDS...........Q----------------------------------------
Q57XU9_TRYB2/282-625-------G..DAGLLL.LLTELHSRSTS...........Q----------------------------------------
G2Y0X2_BOTF4/187-528-------G..AGKMVR.VIERLQAEADV...........Q----------------------------------------
E0VZ92_PEDHC/157-456-------G..QDKMIT.FFKYVQQECDN...........Q----------------------------------------
B0CT70_LACBS/161-472-------G..SGKMEI.VVQRLLEECDR...........V----------------------------------------
Q59T37_CANAL/195-551-------SATYPSALSYVISKIQREIDL...........Q----------------------------------------
E9QGT9_DANRE/180-489-------G..PGRLHT.LLAHLQKECDK...........Q----------------------------------------
K1WLQ9_TRIAC/267-644-------G..RGRMGK.VVARLVRESDR...........V----------------------------------------
F9XE54_MYCGM/175-509-------G..PGSMVK.VIERIQVEADA...........Q----------------------------------------
C5DG77_LACTC/179-498-------G..KQHMVH.IMAKVQREADM...........Q----------------------------------------
K5Y4H4_AGABU/183-506-------G..PGKMSS.VVIRLLEECDR...........V----------------------------------------
I1JS41_SOYBN/186-485-------G..EDGIVY.AICELQEECDS...........R----------------------------------------
K0KE72_WICCF/171-504-------G..ISNMTG.IIERVEREADS...........Q----------------------------------------
K4CGD4_SOLLC/174-477-------G..EDGIVY.AICELQEECDS...........R----------------------------------------
H2XLC7_CIOIN/111-421-------G..PGKLFV.LIKNVQLECDK...........Q----------------------------------------
S9VWR1_SCHCR/164-482-------K..AKNTIT.VIENLQYDCDR...........Q----------------------------------------
U9TBS3_RHIID/182-496-------G..PGKMIR.VIERLQEECDK...........Q----------------------------------------
E3Q612_COLGM/198-538-------G..SGKMVR.VIERLQQEADV...........Q----------------------------------------
Q6BTT0_DEBHA/227-568-------GSTYDNAISYVVTKIQHEIDS...........Q----------------------------------------
K2S8E4_MACPH/175-516-------G..SGMMGK.VIERLQMEADV...........Q----------------------------------------
G8JQJ6_ERECY/189-517-------G..AQNMVY.VMDKIQKEADL...........Q----------------------------------------
J3Q132_PUCT1/187-568-------G..PRSMVT.VALKLNKELDR...........L----------------------------------------
A9SCH4_PHYPA/154-467-------G..EEGVAL.ALVELQEECDA...........R----------------------------------------
Q0UYP7_PHANO/174-513-------G..PGMMAK.VIERLQIEADV...........Q----------------------------------------
M9MH30_PSEA3/203-582-------G..AGNFSHGVMPGLQDECDR...........L----------------------------------------
I2H5R5_TETBL/205-583-------G..NIHMIH.VMEKIEKETDL...........Q----------------------------------------
A7TT52_VANPO/190-542-------G..KHHMSH.IMEKVQKEADL...........Q----------------------------------------
T1J554_STRMM/179-485-------G..HGQLLT.VVEMLQKECDR...........Q----------------------------------------
J9MJB3_FUSO4/82-414-------G..ADKVVK.VIERLQKEAGI...........Q----------------------------------------
A7RPW3_NEMVE/163-477-------G..PGQMPT.LLQILQVECDK...........Q----------------------------------------
B4KHQ6_DROMO/161-491-------GQESTSLVN.MMTILQRECDL...........E----------------------------------------
A8NGP6_COPC7/165-479-------G..QGKMRL.VVQRLLDECDR...........V----------------------------------------
D8QT59_SELML/156-463-------G..EDGLVY.AIRELQEECDS...........R----------------------------------------
S8C8S4_DACHA/216-562-------G..VGRMVK.VIDKLQIEVDT...........Q----------------------------------------
N1PMN4_MYCP1/176-511-------G..PGSMIK.VIERIQVEADA...........Q----------------------------------------
V5G2M7_BYSSN/194-532-------G..AGKMAR.VIERLQVEADV...........Q----------------------------------------
F8Q674_SERL3/166-485-------G..PGRMLV.VLKSLLGECDC...........V----------------------------------------
M3AA99_MYCFI/191-526-------G..QGSMTK.VIERIQVEADS...........Q----------------------------------------
G4MR42_MAGO7/219-567-------G..AGKMVR.VIERLQVEVDV...........Q----------------------------------------
J3KIC8_COCIM/186-524-------G..SGKMTR.VIERLQVEADV...........Q----------------------------------------
G4U2Q1_PIRID/161-490-------G..QGKMLL.VAERLMNECDR...........V----------------------------------------
R7YUM9_CONA1/175-511-------G..NGTMTR.VIERLQNEADV...........Q----------------------------------------
G8ZSF3_TORDC/186-519-------G..TSYMIH.VMEKVEKEADL...........Q----------------------------------------
G0SXA1_RHOG2/160-497-------G..EGKMMS.VAGSLMTETDR...........L----------------------------------------
S3C4S1_OPHP1/236-610-------G..GGQMVK.VIKRLQKEADV...........Q----------------------------------------
D8M8U8_BLAHO/154-504-------VNEQFAYCY.LLRCVFIHCDTQVGFAFLSLFFQ----------------------------------------
C3YFK8_BRAFL/171-477-------G..PGRMLT.LMTELQKECDR...........Q----------------------------------------
Q758T0_ASHGO/188-512-------G..AKYMVH.IMDKVQKEADL...........Q----------------------------------------
M5C4C1_THACB/161-521-------G..SGNMHT.VVARLLRECDR...........V----------------------------------------
U4L2E9_PYROM/293-612-------G..EGKMVK.VVERLQVEADM...........Q----------------------------------------
J4KLZ9_BEAB2/1246-1586-------G..AGKMVR.VIERLQMEADV...........Q----------------------------------------
G7E1B8_MIXOS/165-515-------G..DGKMID.VVARLQTECDL...........Q----------------------------------------
H2KS09_CLOSI/401-723-------G..PGNLLA.IATPIQGVCDE...........F----------------------------------------
W1NDY2_AMBTC/181-483-------M..EDGVVY.AICELQEECDL...........W----------------------------------------
COG4_ARATH/176-479-------G..EDGVAY.AICELQEECDL...........R----------------------------------------
H6C9G5_EXODN/179-515-------G..PGKMAR.VIERLQVEADL...........Q----------------------------------------
H3AVV6_LATCH/187-496-------G..PGRLYT.LIKHLQVECDR...........Q----------------------------------------
K5V063_PHACS/174-511-------G..LGKMTS.VLKRLLQESDR...........V----------------------------------------
B6HSP5_PENCW/191-531-------G..PRKMGR.VIERLQVEADV...........Q----------------------------------------
G3BC56_CANTC/190-528-------ASTYSNALPYVINKIQPEIDS...........Q----------------------------------------
U6I4L4_HYMMI/106-417-------S..PDSLLK.FIQIVQGQCDH...........H----------------------------------------
M7NUP8_PNEMU/161-484-------N..CEDTLF.VIEKIHEKCIE...........Q----------------------------------------
U7PW27_SPOS1/225-627-------G..GGQMIK.VISRLQKEADV...........Q----------------------------------------
E9EW04_METAR/274-618-------G..AGKMVR.VIERLQMEADV...........Q----------------------------------------
E6ZNH9_SPORE/195-575-------G..VGNFGHGVMPGLQEECDR...........L----------------------------------------
G0V8A6_NAUCC/189-534-------G..KKFMIH.VMENVEKEADL...........Q----------------------------------------
E7QLX6_YEASZ/190-525-------G..KKHMVH.VMEKVEKEADL...........Q----------------------------------------
C5DUL4_ZYGRC/172-510-------G..LHHMVH.VMEKVEKEVDL...........Q----------------------------------------
E4UP45_ARTGP/209-548-------G..PGKMGR.VVERLQVEADV...........Q----------------------------------------
K1R201_CRAGI/174-481-------G..SGKLFS.LMKILQKECDR...........Q----------------------------------------
Q6FTK7_CANGA/185-531-------G..VSHMLH.VMGKVQKEADL...........E----------------------------------------
D2V3G5_NAEGR/119-422-------G..GEKCTIYLINSLQHVCDK...........M----------------------------------------
G5C1P9_HETGA/267-575-------G..LGRLYT.LIKYLQVECDR...........Q----------------------------------------
L8WI47_THACA/987-1357-------G..LGNMHT.VVARLLRECDR...........V----------------------------------------
V2X3Q2_MONRO/169-474-------G..TGKMKQ.VVERLLQECDR...........V----------------------------------------
A7UW80_NEUCR/259-612-------G..GGKMIK.VIERLQGEADV...........Q----------------------------------------
M2NB58_BAUCO/172-509-------G..AGSMTK.VIERIQVEADV...........Q----------------------------------------
C7ZFK3_NECH7/171-496-------G..ASQVVK.VIEKLQAEADI...........Q----------------------------------------
K1WSR6_MARBU/231-588-------G..QGKMVK.VIERLQVEADV...........Q----------------------------------------
S0E9C5_GIBF5/167-499-------G..ADKVVK.VIERLQKEADI...........Q----------------------------------------
C4XYR0_CLAL4/197-532-------GDSYPDAVVFVVNKIQRVIDS...........Q----------------------------------------
S2JH92_MUCC1/194-506-------G..KGKMLR.VIQRLQEESDV...........Q----------------------------------------
E9IBA8_SOLIN/158-464-------G..PGRLLM.TISILQKECDR...........Q----------------------------------------
I1RAH7_GIBZE/187-527-------G..TGKMVR.VIERLQMEADV...........Q----------------------------------------
G0R6U4_HYPJQ/191-531-------G..AGKMVR.VIERIQMEADV...........Q----------------------------------------
I2FV21_USTH4/206-592-------G..VGHFGHGVMPGLQEECDR...........L----------------------------------------
A8NFV8_BRUMA/216-544-------G..PDKLVS.LIEILQKECDK...........E----------------------------------------
G0SCB4_CHATD/176-523-------G..TGKMVK.VIERLQMECDV...........Q----------------------------------------
W1QCQ6_OGAPD/210-555-------G...KNVLPKVLSAIQTECDL...........Q----------------------------------------
Q5AW68_EMENI/201-531-------G..PRKMNR.VIERLQLEADV...........Q----------------------------------------

PF07393

Q750R9_ASHGO/111-822--------------------LRTLHSVYSLINQFIK-------------------DLSEF.FIEMNW.............
Q6BHS9_DEBHA/103-810--------------------VRVLHSLYVLVGDFTK-------------------DVKEF.LTTNEL.............
SEC10_ARATH/139-817--------------------LRMLAVAYERTQELAK-------------------DLRAV....................
Q2HG63_CHAGB/108-854--------------------LRSLHSSRAYISALVE-------------------DLKTH.GLTEHP.............
Q7PQN8_ANOGA/88-705--------------------LKTLSELYSRTMKLSA-------------------ELQEFFKGS................
A1D556_NEOFI/126-876--------------------LIAVSGTFAQSLNLSE-------------------ALLPIQNTTDT..............
Q2URB8_ASPOR/132-879--------------------LTAVSSTFAQCMNLSD-------------------TLLPIQSSAVN..............
A0A023ZK30_YEASX/120-862--------------------VRILHGLFTLFGKFTK-------------------SLIDY.FQLLEI.............
Q4RLZ1_TETNG/80-698--------------------LKNLYDLYTRTTALAT-------------------KLTEFNLGSD...............
Q55N90_CRYNB/170-1008--------------------LRAAAATFVQAWKLVD-------------------VAMEVLGDEQNV.............
Q0IP77_ORYSJ/117-800--------------------LRVLAVAYDKTKELAK-------------------ELQSI....................
A2EZD8_TRIVA/69-728--------------------CDMFYKLHNETDEMLK-------------------SIWAL....................
Q2GXU3_CHAGB/166-960--------------------LRAVSGIFEQTLQFLR-------------------TLTPPKGADVD..............
Q2TVY5_ASPOR/116-891--------------------LRSLQSSRSYIGALVE-------------------DLKAH.GLTEHP.............
Q5BGH2_EMENI/123-870--------------------LVSVSSTFAQCMNLCD-------------------NLLPIQNSLDT..............
Q6CDC8_YARLI/101-777--------------------VRSLHLAYNVVSSLVK-------------------KLKDF.FSSENL.............
EXOC5_DROME/89-705--------------------LRTLYELYSRTLKLST-------------------DLQIYMSTI................
A1DAY7_NEOFI/117-893--------------------LRSLQSSRSYISGLVD-------------------DLKAH.GLTEHP.............
EXOC5_CAEEL/46-659--------------------LRDLAYLYSSTLKMCK-------------------ELEKLHISP................
Q6FMF7_CANGA/102-810--------------------VRTLHSLYSLLGKFVK-------------------DLTDY.FQLLEV.............
Q4PHT4_USTMA/134-1026--------------------LRALHMARSSALSLVN-------------------DLKLYDYRGAGIIGPAYASAHTANG
SEC10_SCHPO/101-799--------------------LRTLQTVVSSLRKLVA-------------------DLKTI.LENRGF.............
Q5KJ89_CRYNJ/95-875--------------------LRILHLTHSICSSLVE-------------------DLKTYDSTLTTPPASS.........
Q5AS51_EMENI/111-841--------------------LRSLQSSRSCISTLVD-------------------ELKAH.GLTEHP.............
Q6CQC0_KLULA/109-807--------------------VRSLQSYFSITNNSVK-------------------QLAEF.LSNLKM.............
C4YGD5_CANAW/103-782--------------------VRVLHSLYTLVGDFTE-------------------QIKDY.LTTEEL.............

PF10191

Q7QA49_ANOGA/2-731....................FWTLTQFSKVNVSMGS-------------------LIEGWVRGGPQQDIR----------
Q29C94_DROPS/2-737....................LELLGLFSQVNHSFVL-------------------HLNSLLEQSHITL..----------
Q172R1_AEDAE/2-704....................FEYLALIAASDCQFTN-------------------ALEKILIELPAD...----------
COG7_RAT/2-767....................LTRLLEFYDTTAHFAK-------------------GLEMALLPHLQD...----------
Q5FW35_XENTR/2-765....................LSTLLELYNATGHFAK-------------------SMETAILPNMGE...----------
Q655R9_ORYSJ/5-868GILDVLSGDLPKSTKLQNKHLGALIDLHNMTGTFAR-------------------NIQHLFSE.......----------
Q9FGN0_ARATH/4-832GVMDLLSGDLPKGINIQTKHLEALIELHNVTGSFAR-------------------NIQHLFAE.......----------

PF08318

E9CCF3_CAPO3/274-605--------------------AQKILNVFMTERDFRK...................KVREV--------------------
B6JXE3_SCHJY/165-484--------------------GTLIINTMLEERKTLQ...................LIAQI--------------------
COG4_DROME/166-496--------------------VKNLLMEFNKNRQIQY...................RSKQV--------------------
M3D3E3_SPHMS/178-512--------------------GGLVLDSWSEDRRVHR...................RLTEI--------------------
C4QWJ7_PICPG/179-518--------------------CGLIFDTFWDTQRLDR...................VVNLV--------------------
B8LT52_TALSN/189-530--------------------GGIIIDTWSDERNVDR...................KLTDI--------------------
S3CMB0_GLAL2/185-536--------------------GGIILDTWGDERSVDR...................RLTDV--------------------
COG4_SCHPO/163-481--------------------GSIIVNTMFDVRRIDN...................LVSSI--------------------
L8FSC8_PSED2/189-538--------------------GGILLDTWGDERGIER...................RLTDV--------------------
F0XR72_GROCL/199-557--------------------GGIIIDAWGDRCHVDR...................RLTDA--------------------
V8NZE8_OPHHA/148-457--------------------VEKVVEKFTQQRDYRR...................QFQHV--------------------
F6TNZ6_XENTR/114-423--------------------VEKVVDKFVQHRDYHR...................KFQQV--------------------
G8BDV4_CANPC/186-525--------------------IGVITDTFYDARRLDK...................LFQDI--------------------
C5WWS3_SORBI/192-503--------------------GTQILRRYADYRKLAR...................LASDI--------------------
A8X3I7_CAEBR/217-546--------------------FRRLIEEFDTRRRLSHLNR................QVADV--------------------
U1HW21_ENDPU/187-524--------------------GGIILDAWADERQVDR...................KLTDI--------------------
J3NYL1_GAGT3/212-567--------------------GGIVLDSWSDERAVDR...................KLTDV--------------------
D5GK94_TUBMM/197-545--------------------GGIIIDTFTDERSIGR...................KLTDI--------------------
F6I2Y2_VITVI/183-485--------------------GSSILKKYLDYRKLAR...................LTSEI--------------------
T1KVK7_TETUR/162-476--------------------TKKILEDFVAKKNLSG...................VVSSV--------------------
G8BYJ4_TETPH/194-538--------------------AGLVLDTFAESKKLTR...................TVKEI--------------------
Q4P6N8_USTMA/201-590--------------------GHRIMDSWREDRTVRR...................RLDEV--------------------
Q5TNE6_ANOGA/167-491--------------------VTKCVQEFCRNRQTGR...................RIAQI--------------------
J4GWL1_FIBRA/183-513--------------------VKDLLEGWEEERAMKR...................KISDT--------------------
H2VA38_TAKRU/70-376--------------------ANKIVDKFIQQRGYHN...................KFQIV--------------------
A3LT54_PICST/195-541--------------------IGIVADTFYDVRRLDK...................YFQDI--------------------
B7QAG5_IXOSC/93-401--------------------VKKILEDFKKNKQFKK...................KAQQI--------------------
C5LP43_PERM5/114-451--------------------AIAVIKRLRESRSITT...................IMEHF--------------------
G3AM87_SPAPN/194-515--------------------IGIIADTFYDTRRLDK...................LFQDI--------------------
R8BYD5_TOGMI/1157-1500--------------------GGIILDSWSDERGIDR...................KLTDV--------------------
A5DUI4_LODEL/191-536--------------------IGIIADTFYDARRLDK...................VFQDV--------------------
F4NT70_BATDJ/197-515--------------------SSIILGGLKETLQLER...................KVKEI--------------------
C5GF37_AJEDR/230-568--------------------GGIILESWSDDRHVDR...................KLTDI--------------------
B2AA74_PODAN/219-562--------------------GGIILDSWSDERTVDR...................RLTDV--------------------
N1JE83_BLUG1/191-526--------------------GGIILDTWGDERNIDR...................RLRDM--------------------
W4ZDW5_STRPU/172-484--------------------AQKIIDKFVEQRDFSR...................KSQQV--------------------
G0W4A1_NAUDC/213-564--------------------AGLLLDIFNESRNLDQ...................IVNNI--------------------
Q4DDH2_TRYCC/242-662--------------------CVPVLKDFLKKRQE.....................VLSSV--------------------
Q16TS8_AEDAE/167-489--------------------VVKLVLEFNKNRQIGR...................RVAQI--------------------
E9FQQ8_DAPPU/154-462--------------------AGQILTEFRRSRQLDK...................QIRLV--------------------
C5M6Q7_CANTT/193-537--------------------VGIIADTFYDLRRLDK...................YFQDI--------------------
V5GSU0_PSEBG/199-579--------------------GHRIMDSWREDRSVRR...................RLDEV--------------------
X6MJK6_RETFI/5-348--------------------IHKLLAHYIQHFDLPKLAKFVKLIFILSL......FFSEC--------------------
M2R7X1_CERS8/181-514--------------------VKDLLEGWEEARSMKR...................KLSDI--------------------
U6HLQ3_ECHMU/114-419--------------------AEIIFVDFKEKRDLSV...................ILQRA--------------------
D6WJA3_TRICA/162-474--------------------MKRILTEWARARQINK...................KIQLI--------------------
G8Y9D0_PICSO/191-527--------------------IGLIGDTFYDVRKVDA...................LAFQT--------------------
Q57XU9_TRYB2/282-625--------------------CVPVLKDFLKKRQE.....................VLQAV--------------------
G2Y0X2_BOTF4/187-528--------------------GGIVLDTWGDEKNVDR...................RLTDV--------------------
E0VZ92_PEDHC/157-456--------------------ASKIVNELINHRNLKN...................KIKQV--------------------
B0CT70_LACBS/161-472--------------------TKSLRDGWEEDRSMKR...................KLAEV--------------------
Q59T37_CANAL/195-551--------------------VGIIADTFYDLRRLDK...................HFQDI--------------------
E9QGT9_DANRE/180-489--------------------AQKIVDKFIQQRDYNN...................KFQVV--------------------
K1WLQ9_TRIAC/267-644--------------------VQRLVEGWEEERRVGR...................LIADT--------------------
F9XE54_MYCGM/175-509--------------------GGLILDTWAEERRVSR...................KLTDV--------------------
C5DG77_LACTC/179-498--------------------AGLVLDSFFESRNFKE...................ILQDI--------------------
K5Y4H4_AGABU/183-506--------------------TKSLLEGWEEERGMKR...................KLSEV--------------------
I1JS41_SOYBN/186-485--------------------GSVILNKYMEYRQLAK...................LSSEI--------------------
K0KE72_WICCF/171-504--------------------AGLISDTFYDNRQISR...................LIDEI--------------------
K4CGD4_SOLLC/174-477--------------------GSTIIKKYMEYRKLAK...................VTSEI--------------------
H2XLC7_CIOIN/111-421--------------------TNVVLQKFKEVRSFKG...................TVQRV--------------------
S9VWR1_SCHCR/164-482--------------------GSIIISTMYDVRRITS...................LLNSI--------------------
U9TBS3_RHIID/182-496--------------------SQIILDTFFDERQIQR...................KLLDI--------------------
E3Q612_COLGM/198-538--------------------GGIILDSWSDERDVDR...................RLKDV--------------------
Q6BTT0_DEBHA/227-568--------------------IGLISDTFYDIKRIDK...................VIQDI--------------------
K2S8E4_MACPH/175-516--------------------GGIILDTWRDERNIDR...................KLTDI--------------------
G8JQJ6_ERECY/189-517--------------------AGLIWDTFMDTRRMDK...................LLDGI--------------------
J3Q132_PUCT1/187-568--------------------MVRLLSAWETDQQLNR...................KLLSV--------------------
A9SCH4_PHYPA/154-467--------------------GSLIIKKYIEQRKLLK...................LTKDI--------------------
Q0UYP7_PHANO/174-513--------------------GGIMLDTWHDERNIDR...................KLTDI--------------------
M9MH30_PSEA3/203-582--------------------GHRIMDSWRQDRNVRR...................RLDEV--------------------
I2H5R5_TETBL/205-583--------------------TGLVLDIFLETRKVDR...................ILSEI--------------------
A7TT52_VANPO/190-542--------------------AGLILDIFMETKNLNH...................LVSDI--------------------
T1J554_STRMM/179-485--------------------LRRIIEEFKRVRNFEQ...................KTFLV--------------------
J9MJB3_FUSO4/82-414--------------------GGIILDMWNDERAVTR...................MMADI--------------------
A7RPW3_NEMVE/163-477--------------------ADQILDAFVKRRDLQH...................KIKSV--------------------
B4KHQ6_DROMO/161-491--------------------VKNLLLEFNKNRQIQY...................RIKQV--------------------
A8NGP6_COPC7/165-479--------------------TRGMRESWEEDRGVKR...................KMADI--------------------
D8QT59_SELML/156-463--------------------GSAIVKKYMEFRGLAK...................LEKEI--------------------
S8C8S4_DACHA/216-562--------------------GGIVIDSFWEERSIGR...................KLSDI--------------------
N1PMN4_MYCP1/176-511--------------------GGLILDTWAEERRVNR...................KLTDV--------------------
V5G2M7_BYSSN/194-532--------------------GGIILDTWRDERNIDR...................KLTDI--------------------
F8Q674_SERL3/166-485--------------------VEEFIQGWKSNRYIKQ...................KLADV--------------------
M3AA99_MYCFI/191-526--------------------GALILDTWAEERQLTR...................RLTDV--------------------
G4MR42_MAGO7/219-567--------------------GGIVLDSWSDDRTVDR...................RLKDV--------------------
J3KIC8_COCIM/186-524--------------------GGIILETWSEERHVDR...................KLTDI--------------------
G4U2Q1_PIRID/161-490--------------------IKGLVEGWEEERGVKR...................KTFEL--------------------
R7YUM9_CONA1/175-511--------------------GGIILDTWQDERVIER...................KLTDI--------------------
G8ZSF3_TORDC/186-519--------------------AGLVFDIFNETRKIDR...................VVKDI--------------------
G0SXA1_RHOG2/160-497--------------------GLRVLANWEEERRIRK...................KVADV--------------------
S3C4S1_OPHP1/236-610--------------------GGIIVDAFNDDRGIDR...................KLTEV--------------------
D8M8U8_BLAHO/154-504--------------------AGQLFSTFASLRDLSV...................LFEDS--------------------
C3YFK8_BRAFL/171-477--------------------ARRVVDAFIKNRAYQK...................KAQQV--------------------
Q758T0_ASHGO/188-512--------------------AGIIWDTFMDVRRIEY...................LLAEI--------------------
M5C4C1_THACB/161-521--------------------VNGLYDGWEEERDISR...................KLSDA--------------------
U4L2E9_PYROM/293-612--------------------AGIIIDTFSDEKALER...................KLTDI--------------------
J4KLZ9_BEAB2/1246-1586--------------------GGIILDTWADERSLDR...................KMTDV--------------------
G7E1B8_MIXOS/165-515--------------------ALSVLERWHEERAISK...................KLSES--------------------
H2KS09_CLOSI/401-723--------------------INRIIRRFRTQYRLTE...................LFQVI--------------------
W1NDY2_AMBTC/181-483--------------------GTTIMKKYMEFRKLGK...................ITADI--------------------
COG4_ARATH/176-479--------------------GSLILKKYMDFRKLAI...................LASDI--------------------
H6C9G5_EXODN/179-515--------------------GGIILDTWADDRRIDR...................HLTEI--------------------
H3AVV6_LATCH/187-496--------------------SEELVENFIKQRDYHR...................KFQRV--------------------
K5V063_PHACS/174-511--------------------TKDLIEGWEEERAMKR...................KLADI--------------------
B6HSP5_PENCW/191-531--------------------GGIILDTWSDERHVDR...................KLMDI--------------------
G3BC56_CANTC/190-528--------------------IGLITDTFYDEKRLGK...................IIQDI--------------------
U6I4L4_HYMMI/106-417--------------------AELIFFSFKEKRNLEA...................LLQRA--------------------
M7NUP8_PNEMU/161-484--------------------CSIIIDSFWEERQVEK...................KLSFI--------------------
U7PW27_SPOS1/225-627--------------------GGIVVDAWSDERGVDR...................KLTDV--------------------
E9EW04_METAR/274-618--------------------GGIIMDTWSDERGIDR...................MITDV--------------------
E6ZNH9_SPORE/195-575--------------------GHRIMDSWREDRNVRR...................RLDEV--------------------
G0V8A6_NAUCC/189-534--------------------AGLLLDIFAESRNLDG...................IVKDI--------------------
E7QLX6_YEASZ/190-525--------------------ASLILDIFMETRKIER...................TIHDI--------------------
C5DUL4_ZYGRC/172-510--------------------AGLVLDVFTEVRKLQR...................VVHGV--------------------
E4UP45_ARTGP/209-548--------------------GGIILESWAEERHVDR...................RLTDI--------------------
K1R201_CRAGI/174-481--------------------VRQILEKFKLKRDFDA...................VVQQV--------------------
Q6FTK7_CANGA/185-531--------------------AGLVFDIFSDTRKVKS...................VVREI--------------------
D2V3G5_NAEGR/119-422--------------------VKKVLDVYEKKRELND...................ILTAV--------------------
G5C1P9_HETGA/267-575--------------------VEKVVDKFTKQRDYQQ...................QFRLV--------------------
L8WI47_THACA/987-1357--------------------VNGLYDGWEEERDISRKVSPLHTTSHSLAHPHGVWKLSDA--------------------
V2X3Q2_MONRO/169-474--------------------VKGAIERWEEERSMAR...................KLLDV--------------------
A7UW80_NEUCR/259-612--------------------GGIIVDSWSDERGVDR...................ALTDV--------------------
M2NB58_BAUCO/172-509--------------------GGIILDTWAEERRISR...................KLTDV--------------------
C7ZFK3_NECH7/171-496--------------------GGIILDAWADDRSVDR...................MISDI--------------------
K1WSR6_MARBU/231-588--------------------GGIILDMWGDERSVDR...................RLTDV--------------------
S0E9C5_GIBF5/167-499--------------------GGIILDTWNEERSFAR...................IMADI--------------------
C4XYR0_CLAL4/197-532--------------------IGLITDTFYDVNRIEK...................LLQDI--------------------
S2JH92_MUCC1/194-506--------------------SVIILDRFLKARKLES...................KVRMP--------------------
E9IBA8_SOLIN/158-464--------------------VKKIVTVFTKHRSISK...................NVQMI--------------------
I1RAH7_GIBZE/187-527--------------------GGIIVDTWSDERGIDR...................KLTDV--------------------
G0R6U4_HYPJQ/191-531--------------------GGIILDTWSDERGVDK...................KLTDV--------------------
I2FV21_USTH4/206-592--------------------GHRIMDSWREDRNVRR...................RLDEV--------------------
A8NFV8_BRUMA/216-544--------------------AERIIDAFMKNRQFDS...................KAKMV--------------------
G0SCB4_CHATD/176-523--------------------GGIIVDSWSDERAVDR...................RLTDV--------------------
W1QCQ6_OGAPD/210-555--------------------SGLIFDTFWDAKNLDR...................AISDI--------------------
Q5AW68_EMENI/201-531--------------------GGIVVDTWSDERHIDR...................KLMDI--------------------

PF07393

Q750R9_ASHGO/111-822......................DTNNS..LASALDQC..FTEIFSKIVFDRVKYFDVEKKCLESILIHMTSDFN------
Q6BHS9_DEBHA/103-810......................DMSNE..LCPTLDQC..YYDLFIEYTSE.SIYFNREKKNLEDTIYSIVQKFN------
SEC10_ARATH/139-817.............................GCGDLDVEDLTESLFSSHK...DEYPEHERASLKQLYQAKMEELR------
Q2HG63_CHAGB/108-854......................EPCSA.QISQTLDQQ..LEELFVPYLIG.NSYIDRERRSLEEMYNSLLFKFT------
Q7PQN8_ANOGA/88-705.............................EDDLLQKL..TANIFDRHL...ATYIEVESRTLDAKCQVELKKFY------
A1D556_NEOFI/126-876.............................LDEFLHHI..VAKVYEPHI...DLYLAEELDHFRKNSAAVVDEWD------
Q2URB8_ASPOR/132-879.............................FEEFLEHV..IAKVYEPHM...DLYLAEELDHFRKCSEAAVDEWD------
A0A023ZK30_YEASX/120-862......................DDSNQ.ILSTTLEQC..FADLFSHYLYDRSKYFGIEKRSLEAILVDMTSKFT------
Q4RLZ1_TETNG/80-698.............................KHTFLSKL..IKSIFSTYL...ESYIDMEKEYLRNRGAMILQRYY------
Q55N90_CRYNB/170-1008.....................I.......KKEQVEDS..VFHMFEEHL...DDYLDDETERVKHHLEDICRIWE------
Q0IP77_ORYSJ/117-800.............................SCGDLDIEGLTESIFVSHK...DEYTEFEQASLRQQYQSKMAELR------
A2EZD8_TRIVA/69-728.............................DGQTFSNQNIMENTFHNFQ...TSYETLETQALTNIMLEQVVP..------
Q2GXU3_CHAGB/166-960.............................QEARAKEL..VLKAFEPHL...DLYLQDEIDEFARQAEEEVGEWE------
Q2TVY5_ASPOR/116-891......................DTISA.QTALILDQQ..LEDLFVPYFVG.SSYIEREKKTLEELYTSLLFKFT------
Q5BGH2_EMENI/123-870.............................FEDLLHQT..IAQVYEPHM...DLYLAEELDFFRKGSEASVAEWD------
Q6CDC8_YARLI/101-777......................DTHDS..LAALLDQN..FADIFIPHIDK.NRYFESEKKSLSELISAALWKFA------
EXOC5_DROME/89-705.............................DDDLLQKL..TQQIFIKHL...AGYAEMETKCLTAKCSTELEKFY------
A1DAY7_NEOFI/117-893......................DPVSS.QTALILDQQ..LEDLFVPYFVG.SSYIEREKKSLEELYTSLLFRFT------
EXOC5_CAEEL/46-659.............................DSAFLSTL..TDSIFQRYI...ATYCSEELKYLNDQCSNLLQRFY------
Q6FMF7_CANGA/102-810......................ENEAN..LQAALEQC..YTDFFSRWLFDRSKYFDIEKRSLEIILIEMTSRFN------
Q4PHT4_USTMA/134-1026DGVVSDSIRLLGNDFAAGASQLAGASASPLATMLDQS..VEELFVPYMEG.IRYIDRESRSLADLYAGLLFKFI------
SEC10_SCHPO/101-799......................SVSDNSPLSLALNQY..MEDLLVPFIEV.DDYLKREEHSLRSLFRLSLYKYT------
Q5KJ89_CRYNJ/95-875.................SRAPAPAGSGGSFSAFLDRA..LEEMYVPWLEG.TRYLECESKNLVELYAGLLSRFT------
Q5AS51_EMENI/111-841......................ETISS.QTSLILDQQ..LEDLFVPYFVG.SSYIEREKRTLEELYTSLLFKFT------
Q6CQC0_KLULA/109-807......................DSDGK..VSACLEKC..WKNLFIDILFDRSKYFEVEKRTLENVLVQKASDFN------
C4YGD5_CANAW/103-782......................DKDQE..LSAILDQS..HSDLFVEYIGD.NVYFNREKKNLEETIYGIIHQFN------

PF10191

Q7QA49_ANOGA/2-731-----------------------------CDDETTIDRLANSLFVFFGIFLKEYPTLENSQLEASLQGLTIVGT......
Q29C94_DROPS/2-737-----------------------------SDELHRQ..LGEAVFEYFHKFIQQYPRLEETQLSTQVDRLLSNQS......
Q172R1_AEDAE/2-704-----------------------------.....KAEDLSAALFSYFDVFVEQYPSLERSFSNKMLEEMKMNAA......
COG7_RAT/2-767-----------------------------.HNLVKVVELVDAVYGPYKPYQLKYGDLEESNLLIQISAVPLEHG......
Q5FW35_XENTR/2-765-----------------------------.YNLVKLIELVDAVFGPYKPYQLQYGDLEESNLLIQISAMPLERG......
Q655R9_ORYSJ/5-868-----------------------------.SDLLVLLNTLKAIYSPYETFKARYGQMERALLSAEMAGIDIRGAIARGVG
Q9FGN0_ARATH/4-832-----------------------------.SELRILIDTLKAVYSPFESFKQKYGKMERAILSSEIAVVDLRGAVTRGVG

PF08318

E9CCF3_CAPO3/274-605---------------------------------------QAQMT..............................------
B6JXE3_SCHJY/165-484---------------------------------------RSYTY..............................------
COG4_DROME/166-496---------------------------------------NESTQ..............................------
M3D3E3_SPHMS/178-512---------------------------------------KSYPF........NFFVQSFLPAQKSTLPT.....------
C4QWJ7_PICPG/179-518---------------------------------------REYDY..............................------
B8LT52_TALSN/189-530---------------------------------------KSYAF........TFLVQSFLPAQRA..TGTP...------
S3CMB0_GLAL2/185-536---------------------------------------KSYPF........SFLVNSFIPA............------
COG4_SCHPO/163-481---------------------------------------ASYKY..............................------
L8FSC8_PSED2/189-538---------------------------------------KSYPF........SFLVQSFLPSH.RAAMGTT...------
F0XR72_GROCL/199-557---------------------------------------KSYPF........SFLVQSFLAQQQRGSTSTTSNG------
V8NZE8_OPHHA/148-457---------------------------------------QSSAM..............................------
F6TNZ6_XENTR/114-423---------------------------------------QSCMM..............................------
G8BDV4_CANPC/186-525---------------------------------------KLYKF............................PV------
C5WWS3_SORBI/192-503---------------------------------------NSYTK..............................------
A8X3I7_CAEBR/217-546---------------------------------------VHHKK..............................------
U1HW21_ENDPU/187-524---------------------------------------KSYAY........TFLVQSFLPPQRGN.TGTP...------
J3NYL1_GAGT3/212-567---------------------------------------KSYPF........SFLVQSFLPQQKGGFGGTP...------
D5GK94_TUBMM/197-545---------------------------------------KSYAF........SFLVQSYMPSTRGPMGGPP...------
F6I2Y2_VITVI/183-485---------------------------------------NSYKN..............................------
T1KVK7_TETUR/162-476---------------------------------------QKSSK..............................------
G8BYJ4_TETPH/194-538---------------------------------------KEWQR..............................------
Q4P6N8_USTMA/201-590---------------------------------------RAYRF.....................TGAVVANKT------
Q5TNE6_ANOGA/167-491---------------------------------------NDYIK..............................------
J4GWL1_FIBRA/183-513---------------------------------------ASHPP..............................------
H2VA38_TAKRU/70-376---------------------------------------QSSMM..............................------
A3LT54_PICST/195-541---------------------------------------KLYNF............................PV------
B7QAG5_IXOSC/93-401---------------------------------------RALLC..............................------
C5LP43_PERM5/114-451---------------------------------------QTIAD..............................------
G3AM87_SPAPN/194-515---------------------------------------GLYNF............................PR------
R8BYD5_TOGMI/1157-1500---------------------------------------KSYPF........SFLVQSLLPQQ.RGITGTP...------
A5DUI4_LODEL/191-536---------------------------------------DLYTF............................PV------
F4NT70_BATDJ/197-515---------------------------------------QQYEN..............................------
C5GF37_AJEDR/230-568---------------------------------------KSYAF........TFLVQSFLPAARG..MGTP...------
B2AA74_PODAN/219-562---------------------------------------RSYPF........SFLVQSFVSQPNRGFGGTP...------
N1JE83_BLUG1/191-526---------------------------------------KSNPF........SYLVQSFLSGHKN..ASNS...------
W4ZDW5_STRPU/172-484---------------------------------------QLSLT..............................------
G0W4A1_NAUDC/213-564---------------------------------------KHWNE...................KYQNKDKKNYS------
Q4DDH2_TRYCC/242-662---------------------------------------TSAGG......................INTNSSSS------
Q16TS8_AEDAE/167-489---------------------------------------NDYIK..............................------
E9FQQ8_DAPPU/154-462---------------------------------------SEVLS..............................------
C5M6Q7_CANTT/193-537---------------------------------------KLYSF............................PI------
V5GSU0_PSEBG/199-579---------------------------------------QAYRF.....................TGAATAKHT------
X6MJK6_RETFI/5-348---------------------------------------SYLNF...FACFQENNREYFEKLLQQL........------
M2R7X1_CERS8/181-514---------------------------------------TNVGS..............................------
U6HLQ3_ECHMU/114-419---------------------------------------RHELL..............................------
D6WJA3_TRICA/162-474---------------------------------------TDLSR..............................------
G8Y9D0_PICSO/191-527---------------------------------------DNYSF............................PL------
Q57XU9_TRYB2/282-625---------------------------------------DCTNN..............................------
G2Y0X2_BOTF4/187-528---------------------------------------RSYPF........SFLVQSFLPNQRP..TGIS...------
E0VZ92_PEDHC/157-456---------------------------------------NEYNT..............................------
B0CT70_LACBS/161-472---------------------------------------INNPP..............................------
Q59T37_CANAL/195-551---------------------------------------KLYSF............................PV------
E9QGT9_DANRE/180-489---------------------------------------QSNMM..............................------
K1WLQ9_TRIAC/267-644---------------------------------------ESSTFPLLSNPALLPPLFPSLVSTAGQLSLANLAN------
F9XE54_MYCGM/175-509---------------------------------------KSYPF........NFLVSSFLPTQKPSSHL.....------
C5DG77_LACTC/179-498---------------------------------------RAFKE..............................------
K5Y4H4_AGABU/183-506---------------------------------------QNNPP..............................------
I1JS41_SOYBN/186-485---------------------------------------NAHNT..............................------
K0KE72_WICCF/171-504---------------------------------------QAYKF............................PI------
K4CGD4_SOLLC/174-477---------------------------------------NSYKS..............................------
H2XLC7_CIOIN/111-421---------------------------------------QQSLF..............................------
S9VWR1_SCHCR/164-482---------------------------------------KNYKF..............................------
U9TBS3_RHIID/182-496---------------------------------------QTHYN..............................------
E3Q612_COLGM/198-538---------------------------------------KSYPF........SFLVQSFLPQQ.R..SGTP...------
Q6BTT0_DEBHA/227-568---------------------------------------SLYNF............................PV------
K2S8E4_MACPH/175-516---------------------------------------KSYAF........SFLVRSFLPAPS...GGTP...------
G8JQJ6_ERECY/189-517---------------------------------------KIWDE..............................------
J3Q132_PUCT1/187-568---------------------------------------QRYSF.ATQNQLLAAINNYGSVNPLNSPAALHSSL------
A9SCH4_PHYPA/154-467---------------------------------------AAHSK..............................------
Q0UYP7_PHANO/174-513---------------------------------------KSYAY........SFLVQSFFPTQKPA.GGTP...------
M9MH30_PSEA3/203-582---------------------------------------QAYRF.....................TSAAMDAKT------
I2H5R5_TETBL/205-583---------------------------------------NEWND...LHSLKIKNLNKSLVANTHHTREKSSSP------
A7TT52_VANPO/190-542---------------------------------------NEWNQ........................LQQKIA------
T1J554_STRMM/179-485---------------------------------------QQLLT..............................------
J9MJB3_FUSO4/82-414---------------------------------------KSYPF........YFLSKSMMPVQRGINFALR...------
A7RPW3_NEMVE/163-477---------------------------------------TKSLN..............................------
B4KHQ6_DROMO/161-491---------------------------------------NDSSQ..............................------
A8NGP6_COPC7/165-479---------------------------------------LNNPP..............................------
D8QT59_SELML/156-463---------------------------------------IAQTN..............................------
S8C8S4_DACHA/216-562---------------------------------------KSYAF........SFLVQSFLAGPSSG.GGTP...------
N1PMN4_MYCP1/176-511---------------------------------------KSYPF........NFLVQSFLPSQKSSFNP.....------
V5G2M7_BYSSN/194-532---------------------------------------KSYAF........TFLVQSFLPAQRP..AGTP...------
F8Q674_SERL3/166-485---------------------------------------SRSPL..............................------
M3AA99_MYCFI/191-526---------------------------------------KSYPF........NFLVSSALASQKSALRL.....------
G4MR42_MAGO7/219-567---------------------------------------KSYPF........SFLVQSFLSQQRGGFGGTP...------
J3KIC8_COCIM/186-524---------------------------------------KSYAF........TFLVQSFLPNPRG..GGPQ...------
G4U2Q1_PIRID/161-490---------------------------------------LAYQR..............................------
R7YUM9_CONA1/175-511---------------------------------------RSYAF........SFLVQSFLPAQKPS.AGTP...------
G8ZSF3_TORDC/186-519---------------------------------------QNWNS..............................------
G0SXA1_RHOG2/160-497---------------------------------------RDHRF............................VG------
S3C4S1_OPHP1/236-610---------------------------------------KSYPF........SFLVQSFLNLQRGPGAAAGAAG------
D8M8U8_BLAHO/154-504---------------------------------------KTRLQ..............................------
C3YFK8_BRAFL/171-477---------------------------------------QQCMM..............................------
Q758T0_ASHGO/188-512---------------------------------------REWHE..............................------
M5C4C1_THACB/161-521---------------------------------------RTATF..............................------
U4L2E9_PYROM/293-612---------------------------------------KSYAY........GFLVQSFLAGTKQA........------
J4KLZ9_BEAB2/1246-1586---------------------------------------KSYPF........SFLVQSFLPPQSR..SNTP...------
G7E1B8_MIXOS/165-515---------------------------------------RAYRF................QQLQALSQPAIVPR------
H2KS09_CLOSI/401-723---------------------------------------QNSST..............................------
W1NDY2_AMBTC/181-483---------------------------------------NSYSK..............................------
COG4_ARATH/176-479---------------------------------------NNSPN..............................------
H6C9G5_EXODN/179-515---------------------------------------RSYAF........TFLVQSFMSTQRTA.SGTP...------
H3AVV6_LATCH/187-496---------------------------------------QSSMM..............................------
K5V063_PHACS/174-511---------------------------------------SNPSF..............................------
B6HSP5_PENCW/191-531---------------------------------------KSYAF........TFLVQSFLPAQR...PGPP...------
G3BC56_CANTC/190-528---------------------------------------RLYDF............................PI------
U6I4L4_HYMMI/106-417---------------------------------------RHELM..............................------
M7NUP8_PNEMU/161-484---------------------------------------QMYSF..............................------
U7PW27_SPOS1/225-627---------------------------------------KSYPF........SFLVQSFGMKGAGGSSSNSNAG------
E9EW04_METAR/274-618---------------------------------------KSYPF........SFLVQSFLPQAPR..SGTP...------
E6ZNH9_SPORE/195-575---------------------------------------QAYKF.....................TGAVVASKT------
G0V8A6_NAUCC/189-534---------------------------------------DDWNL..........................RQRK------
E7QLX6_YEASZ/190-525---------------------------------------NEWEH..............................------
C5DUL4_ZYGRC/172-510---------------------------------------NEWNS............................NP------
E4UP45_ARTGP/209-548---------------------------------------KSYAF........TFLVQSFLPGARGA.AGTP...------
K1R201_CRAGI/174-481---------------------------------------QQNAV..............................------
Q6FTK7_CANGA/185-531---------------------------------------SEWNI..............................------
D2V3G5_NAEGR/119-422---------------------------------------SKKPN..............................------
G5C1P9_HETGA/267-575---------------------------------------QNNL...............................------
L8WI47_THACA/987-1357---------------------------------------RTATF..............................------
V2X3Q2_MONRO/169-474---------------------------------------QTASQ..............................------
A7UW80_NEUCR/259-612---------------------------------------KSYPF........SFLVQSFLPQN.RGFGAPP...------
M2NB58_BAUCO/172-509---------------------------------------RSYPF........NFLVQSFLPAQKPTIGSSP...------
C7ZFK3_NECH7/171-496---------------------------------------RSYPF........VFLVQSILAWRQGQGV......------
K1WSR6_MARBU/231-588---------------------------------------KSYPF........SFLVHSFMPAQKN..MGIT...------
S0E9C5_GIBF5/167-499---------------------------------------KNYPF........SFLSKSMVPFQRGISFALR...------
C4XYR0_CLAL4/197-532---------------------------------------KLHSF............................SD------
S2JH92_MUCC1/194-506---------------------------------------SAQSP..............................------
E9IBA8_SOLIN/158-464---------------------------------------NEYLR..............................------
I1RAH7_GIBZE/187-527---------------------------------------RSYPF........SFLVQSFLPQPPR..GGTP...------
G0R6U4_HYPJQ/191-531---------------------------------------KSYPF........SFLVQSFLPQPPR..GGIP...------
I2FV21_USTH4/206-592---------------------------------------QSYRF.....................TGAVVANKT------
A8NFV8_BRUMA/216-544---------------------------------------EKITR..............................------
G0SCB4_CHATD/176-523---------------------------------------KSYPF........TFLVQSFLPQN.RGFGGVQ...------
W1QCQ6_OGAPD/210-555---------------------------------------TNYGY..............................------
Q5AW68_EMENI/201-531---------------------------------------KSYAF........TFLVQSFLPPQR...TATP...------

PF07393

Q750R9_ASHGO/111-822----.TY....HEREIRARHLT.......AKLSASGDVKAELTT.........................YSIQG......
Q6BHS9_DEBHA/103-810----.TY....NEKALSNKYLSTKLENLDNLEYNEKAPQEHHDRF........................SFHFS......
SEC10_ARATH/139-817----.................................................................AESQQ......
Q2HG63_CHAGB/108-854----.IY....HSR..................RKKTPTGFMAAIAQ......................QGTQLI......
Q7PQN8_ANOGA/88-705----.................................................................ETKNH......
A1D556_NEOFI/126-876----RQL....SEQAASTESFLMSN.VNRQADKRDFLTSFKKVIMAPVN...............ILPSFSSSKS......
Q2URB8_ASPOR/132-879----RQL....SEQAASTESFLMSN.INRQADKKDFLTSFKKVIMAPVN...............LLPSFSGTKT......
A0A023ZK30_YEASX/120-862----.VN....YDKEINKRVLL.......DKYKEKLSTNVDAFMHSPRG................NTHSRQDST......
Q4RLZ1_TETNG/80-698----.................................................................DSKNH......
Q55N90_CRYNB/170-1008----QQLGTSDSEQLSKSHTPTFLISANPDQVKRNVLASFKDALLLPVTIVPRTVTFGVNAIVSGGTQAVSGLAMLNPQK
Q0IP77_ORYSJ/117-800----.................................................................AEAKQ......
A2EZD8_TRIVA/69-728----............................................................................
Q2GXU3_CHAGB/166-960----KKL....SEQDASAESFYMANFTNRQADKKDFLTSFKKVVMMPVTVLPTTLTTFSLPGLPLGSPFASKPA......
Q2TVY5_ASPOR/116-891----.TF....HAR..................RKKAATTFMASLSK......................SGTELL......
Q5BGH2_EMENI/123-870----RQL....SEQAASTESFLLSN.VNRQADKRDFLTSFKKVIMAPVN...............ILPSFSNKSS......
Q6CDC8_YARLI/101-777----.EF....HEKKSSHKEGG......LLGR.....................................ITHSL......
EXOC5_DROME/89-705----.................................................................ASKKH......
A1DAY7_NEOFI/117-893----.TF....HAR..................RKRAATTFMASISK......................SGTELL......
EXOC5_CAEEL/46-659----....................................................................ES......
Q6FMF7_CANGA/102-810----.TL....HEKDIRQRLLT.......NKFKASTNDSPETRINE......................LSTTNT......
Q4PHT4_USTMA/134-1026----.SF....HRTSAAAKRDKASGNTIFNRMRNQITATSDASSS........................TSSLG......
SEC10_SCHPO/101-799----.SY....KIR..................LETPEPGLLRSLMTP....................LQGNMVA......
Q5KJ89_CRYNJ/95-875----.RY....HETVLQAKPNSL.....LNKVVHQLASSSSAATTS......................STAQTA......
Q5AS51_EMENI/111-841----.TF....HGR..................RKKAATTFMASLSK......................SGSELL......
Q6CQC0_KLULA/109-807----.IS....FDSDIRPRSLA.......NKLNEVTDFKSSPELK........................ILTSR......
C4YGD5_CANAW/103-782----.TA....NENIIANKSLAARLENLDNVQKPEKDRFSFAS.....................................

PF10191

Q7QA49_ANOGA/2-731....APADSVHNLESANAKIIRWALEAVTRCQDITQNCALLSLGSVL---------------------------------
Q29C94_DROPS/2-737....TPSDAVRHLEESTRKLYEWLKEACERCSAITSDLALCKLITLL---------------------------------
Q172R1_AEDAE/2-704....SVVENVSTLDACNAKVSKWFTDATNRCINITQNKSLPQLVKVF---------------------------------
COG7_RAT/2-767....EVIDCVQELSQSVHKLFGLASAAVDRCAKFTNGLGTCGLLTAL---------------------------------
Q5FW35_XENTR/2-765....EVLDCVQELSHSVSRLFSLASGAMDRCIKFTDGLGLCGLLQAL---------------------------------
Q655R9_ORYSJ/5-868AQGIELSETVRRMEESIPQIIVLLEAAVERCISLTGGSEADELVLAL---------------------------------
Q9FGN0_ARATH/4-832AQGIELSETVRRMEESIPQVVVLLEAAVERCIGFTGGSEADELILAL---------------------------------

PF08318

E9CCF3_CAPO3/274-605--------------------------------------------------------------------------------
B6JXE3_SCHJY/165-484--------------------------------------------------------------------------------
COG4_DROME/166-496--------------------------------------------------------------------------------
M3D3E3_SPHMS/178-512--------------------------------------------------------------------------------
C4QWJ7_PICPG/179-518--------------------------------------------------------------------------------
B8LT52_TALSN/189-530--------------------------------------------------------------------------------
S3CMB0_GLAL2/185-536--------------------------------------------------------------------------------
COG4_SCHPO/163-481--------------------------------------------------------------------------------
L8FSC8_PSED2/189-538--------------------------------------------------------------------------------
F0XR72_GROCL/199-557--------------------------------------------------------------------------------
V8NZE8_OPHHA/148-457--------------------------------------------------------------------------------
F6TNZ6_XENTR/114-423--------------------------------------------------------------------------------
G8BDV4_CANPC/186-525--------------------------------------------------------------------------------
C5WWS3_SORBI/192-503--------------------------------------------------------------------------------
A8X3I7_CAEBR/217-546--------------------------------------------------------------------------------
U1HW21_ENDPU/187-524--------------------------------------------------------------------------------
J3NYL1_GAGT3/212-567--------------------------------------------------------------------------------
D5GK94_TUBMM/197-545--------------------------------------------------------------------------------
F6I2Y2_VITVI/183-485--------------------------------------------------------------------------------
T1KVK7_TETUR/162-476--------------------------------------------------------------------------------
G8BYJ4_TETPH/194-538--------------------------------------------------------------------------------
Q4P6N8_USTMA/201-590--------------------------------------------------------------------------------
Q5TNE6_ANOGA/167-491--------------------------------------------------------------------------------
J4GWL1_FIBRA/183-513--------------------------------------------------------------------------------
H2VA38_TAKRU/70-376--------------------------------------------------------------------------------
A3LT54_PICST/195-541--------------------------------------------------------------------------------
B7QAG5_IXOSC/93-401--------------------------------------------------------------------------------
C5LP43_PERM5/114-451--------------------------------------------------------------------------------
G3AM87_SPAPN/194-515--------------------------------------------------------------------------------
R8BYD5_TOGMI/1157-1500--------------------------------------------------------------------------------
A5DUI4_LODEL/191-536--------------------------------------------------------------------------------
F4NT70_BATDJ/197-515--------------------------------------------------------------------------------
C5GF37_AJEDR/230-568--------------------------------------------------------------------------------
B2AA74_PODAN/219-562--------------------------------------------------------------------------------
N1JE83_BLUG1/191-526--------------------------------------------------------------------------------
W4ZDW5_STRPU/172-484--------------------------------------------------------------------------------
G0W4A1_NAUDC/213-564--------------------------------------------------------------------------------
Q4DDH2_TRYCC/242-662--------------------------------------------------------------------------------
Q16TS8_AEDAE/167-489--------------------------------------------------------------------------------
E9FQQ8_DAPPU/154-462--------------------------------------------------------------------------------
C5M6Q7_CANTT/193-537--------------------------------------------------------------------------------
V5GSU0_PSEBG/199-579--------------------------------------------------------------------------------
X6MJK6_RETFI/5-348--------------------------------------------------------------------------------
M2R7X1_CERS8/181-514--------------------------------------------------------------------------------
U6HLQ3_ECHMU/114-419--------------------------------------------------------------------------------
D6WJA3_TRICA/162-474--------------------------------------------------------------------------------
G8Y9D0_PICSO/191-527--------------------------------------------------------------------------------
Q57XU9_TRYB2/282-625--------------------------------------------------------------------------------
G2Y0X2_BOTF4/187-528--------------------------------------------------------------------------------
E0VZ92_PEDHC/157-456--------------------------------------------------------------------------------
B0CT70_LACBS/161-472--------------------------------------------------------------------------------
Q59T37_CANAL/195-551--------------------------------------------------------------------------------
E9QGT9_DANRE/180-489--------------------------------------------------------------------------------
K1WLQ9_TRIAC/267-644--------------------------------------------------------------------------------
F9XE54_MYCGM/175-509--------------------------------------------------------------------------------
C5DG77_LACTC/179-498--------------------------------------------------------------------------------
K5Y4H4_AGABU/183-506--------------------------------------------------------------------------------
I1JS41_SOYBN/186-485--------------------------------------------------------------------------------
K0KE72_WICCF/171-504--------------------------------------------------------------------------------
K4CGD4_SOLLC/174-477--------------------------------------------------------------------------------
H2XLC7_CIOIN/111-421--------------------------------------------------------------------------------
S9VWR1_SCHCR/164-482--------------------------------------------------------------------------------
U9TBS3_RHIID/182-496--------------------------------------------------------------------------------
E3Q612_COLGM/198-538--------------------------------------------------------------------------------
Q6BTT0_DEBHA/227-568--------------------------------------------------------------------------------
K2S8E4_MACPH/175-516--------------------------------------------------------------------------------
G8JQJ6_ERECY/189-517--------------------------------------------------------------------------------
J3Q132_PUCT1/187-568--------------------------------------------------------------------------------
A9SCH4_PHYPA/154-467--------------------------------------------------------------------------------
Q0UYP7_PHANO/174-513--------------------------------------------------------------------------------
M9MH30_PSEA3/203-582--------------------------------------------------------------------------------
I2H5R5_TETBL/205-583--------------------------------------------------------------------------------
A7TT52_VANPO/190-542--------------------------------------------------------------------------------
T1J554_STRMM/179-485--------------------------------------------------------------------------------
J9MJB3_FUSO4/82-414--------------------------------------------------------------------------------
A7RPW3_NEMVE/163-477--------------------------------------------------------------------------------
B4KHQ6_DROMO/161-491--------------------------------------------------------------------------------
A8NGP6_COPC7/165-479--------------------------------------------------------------------------------
D8QT59_SELML/156-463--------------------------------------------------------------------------------
S8C8S4_DACHA/216-562--------------------------------------------------------------------------------
N1PMN4_MYCP1/176-511--------------------------------------------------------------------------------
V5G2M7_BYSSN/194-532--------------------------------------------------------------------------------
F8Q674_SERL3/166-485--------------------------------------------------------------------------------
M3AA99_MYCFI/191-526--------------------------------------------------------------------------------
G4MR42_MAGO7/219-567--------------------------------------------------------------------------------
J3KIC8_COCIM/186-524--------------------------------------------------------------------------------
G4U2Q1_PIRID/161-490--------------------------------------------------------------------------------
R7YUM9_CONA1/175-511--------------------------------------------------------------------------------
G8ZSF3_TORDC/186-519--------------------------------------------------------------------------------
G0SXA1_RHOG2/160-497--------------------------------------------------------------------------------
S3C4S1_OPHP1/236-610--------------------------------------------------------------------------------
D8M8U8_BLAHO/154-504--------------------------------------------------------------------------------
C3YFK8_BRAFL/171-477--------------------------------------------------------------------------------
Q758T0_ASHGO/188-512--------------------------------------------------------------------------------
M5C4C1_THACB/161-521--------------------------------------------------------------------------------
U4L2E9_PYROM/293-612--------------------------------------------------------------------------------
J4KLZ9_BEAB2/1246-1586--------------------------------------------------------------------------------
G7E1B8_MIXOS/165-515--------------------------------------------------------------------------------
H2KS09_CLOSI/401-723--------------------------------------------------------------------------------
W1NDY2_AMBTC/181-483--------------------------------------------------------------------------------
COG4_ARATH/176-479--------------------------------------------------------------------------------
H6C9G5_EXODN/179-515--------------------------------------------------------------------------------
H3AVV6_LATCH/187-496--------------------------------------------------------------------------------
K5V063_PHACS/174-511--------------------------------------------------------------------------------
B6HSP5_PENCW/191-531--------------------------------------------------------------------------------
G3BC56_CANTC/190-528--------------------------------------------------------------------------------
U6I4L4_HYMMI/106-417--------------------------------------------------------------------------------
M7NUP8_PNEMU/161-484--------------------------------------------------------------------------------
U7PW27_SPOS1/225-627--------------------------------------------------------------------------------
E9EW04_METAR/274-618--------------------------------------------------------------------------------
E6ZNH9_SPORE/195-575--------------------------------------------------------------------------------
G0V8A6_NAUCC/189-534--------------------------------------------------------------------------------
E7QLX6_YEASZ/190-525--------------------------------------------------------------------------------
C5DUL4_ZYGRC/172-510--------------------------------------------------------------------------------
E4UP45_ARTGP/209-548--------------------------------------------------------------------------------
K1R201_CRAGI/174-481--------------------------------------------------------------------------------
Q6FTK7_CANGA/185-531--------------------------------------------------------------------------------
D2V3G5_NAEGR/119-422--------------------------------------------------------------------------------
G5C1P9_HETGA/267-575--------------------------------------------------------------------------------
L8WI47_THACA/987-1357--------------------------------------------------------------------------------
V2X3Q2_MONRO/169-474--------------------------------------------------------------------------------
A7UW80_NEUCR/259-612--------------------------------------------------------------------------------
M2NB58_BAUCO/172-509--------------------------------------------------------------------------------
C7ZFK3_NECH7/171-496--------------------------------------------------------------------------------
K1WSR6_MARBU/231-588--------------------------------------------------------------------------------
S0E9C5_GIBF5/167-499--------------------------------------------------------------------------------
C4XYR0_CLAL4/197-532--------------------------------------------------------------------------------
S2JH92_MUCC1/194-506--------------------------------------------------------------------------------
E9IBA8_SOLIN/158-464--------------------------------------------------------------------------------
I1RAH7_GIBZE/187-527--------------------------------------------------------------------------------
G0R6U4_HYPJQ/191-531--------------------------------------------------------------------------------
I2FV21_USTH4/206-592--------------------------------------------------------------------------------
A8NFV8_BRUMA/216-544--------------------------------------------------------------------------------
G0SCB4_CHATD/176-523--------------------------------------------------------------------------------
W1QCQ6_OGAPD/210-555--------------------------------------------------------------------------------
Q5AW68_EMENI/201-531--------------------------------------------------------------------------------

PF07393

Q750R9_ASHGO/111-822...SNSKLSKVNSFIRSHLERDKKNAA..............RSPPLRQPTDNS...........................
Q6BHS9_DEBHA/103-810...EKKRLNQFTNFMKTHLSERNAR...........................N...........................
SEC10_ARATH/139-817...VSESSGTIGRSKGASISSSLQQ.......................................................
Q2HG63_CHAGB/108-854...ASAKDAYMERLDSSDLTPTQKRIM.............LRVAGVQDNSS.............................
Q7PQN8_ANOGA/88-705...QKKQIERFQELRRDMQALIGSR.......................................................
A1D556_NEOFI/126-876...SETKSDQESIGSEPSS..ALKS..................PNRFSTIASPALTPTVEA............PPTTELA
Q2URB8_ASPOR/132-879...NESKSDEETSAGDAS...ALKG..................QNRFSTISMPTTPVTEA..............PTTELA
A0A023ZK30_YEASX/120-862...SRSKLSQFNSFLKTHLDKDHLSLN..............RTNTLSDSFNNSSSSTQYDVA.........NNSSSLVNS
Q4RLZ1_TETNG/80-698...QKRSIGT..GSIQELKERIRQR.......................................................
Q55N90_CRYNB/170-1008WTGKGGVVKEVKDGEEVVFEVTDVDEKTAEDMTNDDIMEGVRVTENVENVKEALEPSHASSSNDSHARSAAGSLESSHPS
Q0IP77_ORYSJ/117-800...QSESTGTIGRSNGAAVTTSLQQ.......................................................
A2EZD8_TRIVA/69-728...HLKKLRQIIENAKKWLTRKEEV.......................................................
Q2GXU3_CHAGB/166-960...AASANGSIAAADL......SQQ..................DSRAQSPAPSIQAAVDRSSSP.....MPGKAPTDELA
Q2TVY5_ASPOR/116-891...SSARDAYINRLESSDFSPTQRRML.............LQVAGLRDANDLL...........................
Q5BGH2_EMENI/123-870...EQQKPDRDSLAGD.SG..STPR..................ANRFSTISSPGTPPIQE.............APTTELA
Q6CDC8_YARLI/101-777...DNEDNKGIGNFMRNFRDRNERH.......................................................
EXOC5_DROME/89-705...QKTATTK..GFRRNMEVLIATR.......................................................
A1DAY7_NEOFI/117-893...SSARDAYVNRLESSEFTPTQKKML.............LQLAGLKDQSDSM...........................
EXOC5_CAEEL/46-659...KKHVKKQIGGGLHELKRDVAAR.......................................................
Q6FMF7_CANGA/102-810...ANSKLSQITTFMKSRIDKDILPVS..............RSRSVKENENGS...........................
Q4PHT4_USTMA/134-1026...GSSNTAQTSTAASSTVSTSKTSFFKLS.......NLADRVRGTHNTAATSSTLSVTAGSTATA.SAESSVDGQHVAG
SEC10_SCHPO/101-799...PTGVHSQFNTKTEG........FL.............LRIADIQENLIQSG..........................
Q5KJ89_CRYNJ/95-875...AAAISKYANLFTSSTNNPKTGTATPVLPPSFQKPGLAGQMRGA.NGADTATWGTGTSTPVI.....RSVTGQELKGD
Q5AS51_EMENI/111-841...ASAREAYINRLDSSEHSPTQKRVL.............IQVADLKESTDLA...........................
Q6CQC0_KLULA/109-807...SGGRFSQLNLFLKNKFEKRFEH............................E..........................
C4YGD5_CANAW/103-782...EKKRMNQFKQYVTAKLKDRTRN.......................................................

PF10191

Q7QA49_ANOGA/2-731---QNYLLTYLDQYNKVQKQLAASQ-------------------------------------PSQT..............
Q29C94_DROPS/2-737---NGIFKRQLENFGRIQRQLGLSL-------------------------------------GSSSYAAQS.........
Q172R1_AEDAE/2-704---RSFVALYVEKYSTVQKQLMLNQ-------------------------------------NDE...............
COG7_RAT/2-767---KSLFTKYVSHFTNALQSIRKKC-------------------------------------KLDDIPPNSLFQ......
Q5FW35_XENTR/2-765---QSLFKKYVTDFTLTLQSIRKKC-------------------------------------KLDNIPADSLFL......
Q655R9_ORYSJ/5-868---DDIMLQYISNLQETLKSLRIVC-------------------------------------GVDNTAHSDSSKKEAGLE
Q9FGN0_ARATH/4-832---DDIMLQYISMLQETLKSLRVVC-------------------------------------GVDGTGDGVGSKKDASAE

PF08318

E9CCF3_CAPO3/274-605---.....................R-------------------------------------------------------
B6JXE3_SCHJY/165-484---............QSLKARLQGR-------------------------------------------------------
COG4_DROME/166-496---....RSAGGGNLGSNSIQALGH-------------------------------------------------------
M3D3E3_SPHMS/178-512---..........RTASPAPG....-------------------------------------------------------
C4QWJ7_PICPG/179-518---........PVLVEALTTSSEDR-------------------------------------------------------
B8LT52_TALSN/189-530---..........RTGSPATRD...-------------------------------------------------------
S3CMB0_GLAL2/185-536---..........RTNSPAVGGGA.-------------------------------------------------------
COG4_SCHPO/163-481---............ILLHAKLKNR-------------------------------------------------------
L8FSC8_PSED2/189-538---..........RTAGLGVGGDA.-------------------------------------------------------
F0XR72_GROCL/199-557---NTGTSLGTSPRIGSPAVADVDG-------------------------------------------------------
V8NZE8_OPHHA/148-457---......................-------------------------------------------------------
F6TNZ6_XENTR/114-423---......................-------------------------------------------------------
G8BDV4_CANPC/186-525---LSRRLTDLHEH.....TVEQGR-------------------------------------------------------
C5WWS3_SORBI/192-503---...............NLLSAMG-------------------------------------------------------
A8X3I7_CAEBR/217-546---......................-------------------------------------------------------
U1HW21_ENDPU/187-524---..........RSSSPANQP...-------------------------------------------------------
J3NYL1_GAGT3/212-567---..........RVNSPAGGAGTN-------------------------------------------------------
D5GK94_TUBMM/197-545---..........RSGSPAPSGA..-------------------------------------------------------
F6I2Y2_VITVI/183-485---......................-------------------------------------------------------
T1KVK7_TETUR/162-476---......................-------------------------------------------------------
G8BYJ4_TETPH/194-538---...LQMKKNNRKLNGDSSDSED-------------------------------------------------------
Q4P6N8_USTMA/201-590---QQSTFRASFGVPGRTASPAAGS-------------------------------------------------------
Q5TNE6_ANOGA/167-491---.........NAGGGSTMGHYRK-------------------------------------------------------
J4GWL1_FIBRA/183-513---..............SGAGPAAI-------------------------------------------------------
H2VA38_TAKRU/70-376---......................-------------------------------------------------------
A3LT54_PICST/195-541---LARRMNELQEQMNENRLSEE..-------------------------------------------------------
B7QAG5_IXOSC/93-401---......................-------------------------------------------------------
C5LP43_PERM5/114-451---...................ECI-------------------------------------------------------
G3AM87_SPAPN/194-515---LEITDEE...............-------------------------------------------------------
R8BYD5_TOGMI/1157-1500---..........RVNSPALGSGSN-------------------------------------------------------
A5DUI4_LODEL/191-536---LSKRMSDTMLEHEAGLEKQR..-------------------------------------------------------
F4NT70_BATDJ/197-515---...........QNRRKPQKGTS-------------------------------------------------------
C5GF37_AJEDR/230-568---..........RANSPATRDAA.-------------------------------------------------------
B2AA74_PODAN/219-562---..........RVNSPAVGGTN.-------------------------------------------------------
N1JE83_BLUG1/191-526---..........KPGTPVGVG...-------------------------------------------------------
W4ZDW5_STRPU/172-484---.....................R-------------------------------------------------------
G0W4A1_NAUDC/213-564---IKRSISTDELQNDMENKNNNTS-------------------------------------------------------
Q4DDH2_TRYCC/242-662---SSGNARGQFPAGSVEAAAGSPV-------------------------------------------------------
Q16TS8_AEDAE/167-489---.........SSGNPAAMGHYRK-------------------------------------------------------
E9FQQ8_DAPPU/154-462---......................-------------------------------------------------------
C5M6Q7_CANTT/193-537---LTKRLAELKEQMNQDQEGY...-------------------------------------------------------
V5GSU0_PSEBG/199-579---QPSTFKASFGVPGRTASPAAES-------------------------------------------------------
X6MJK6_RETFI/5-348---......................-------------------------------------------------------
M2R7X1_CERS8/181-514---...........QYSLSPAIRKQ-------------------------------------------------------
U6HLQ3_ECHMU/114-419---...........FNNRPSTFASS-------------------------------------------------------
D6WJA3_TRICA/162-474---.....................M-------------------------------------------------------
G8Y9D0_PICSO/191-527---LTGKLDNTQEQLKDA.......-------------------------------------------------------
Q57XU9_TRYB2/282-625---.SPSPRGESNDNSGRSAVTSPR-------------------------------------------------------
G2Y0X2_BOTF4/187-528---..........RTGSPAVGAAA.-------------------------------------------------------
E0VZ92_PEDHC/157-456---......................-------------------------------------------------------
B0CT70_LACBS/161-472---.............IPMFSSGIR-------------------------------------------------------
Q59T37_CANAL/195-551---LTRRLAELKDHPNQDQESR...-------------------------------------------------------
E9QGT9_DANRE/180-489---......................-------------------------------------------------------
K1WLQ9_TRIAC/267-644---TTSNISNALQSYAPRVKGGVTP-------------------------------------------------------
F9XE54_MYCGM/175-509---..........RTGSPAPG....-------------------------------------------------------
C5DG77_LACTC/179-498---....................NV-------------------------------------------------------
K5Y4H4_AGABU/183-506---.............ILMFTTTGR-------------------------------------------------------
I1JS41_SOYBN/186-485---......................-------------------------------------------------------
K0KE72_WICCF/171-504---LTNYSTMTSNSSRGGTPPPRSS-------------------------------------------------------
K4CGD4_SOLLC/174-477---......................-------------------------------------------------------
H2XLC7_CIOIN/111-421---......................-------------------------------------------------------
S9VWR1_SCHCR/164-482---............LLLNAKIKHR-------------------------------------------------------
U9TBS3_RHIID/182-496---.............TQKRFSGLQ-------------------------------------------------------
E3Q612_COLGM/198-538---..........RVNSPAMGAGA.-------------------------------------------------------
Q6BTT0_DEBHA/227-568---LSKRFSDHEDPSGVDQ......-------------------------------------------------------
K2S8E4_MACPH/175-516---..........RSGSPAQRDRL.-------------------------------------------------------
G8JQJ6_ERECY/189-517---........SRGQWNKQQHFQQG-------------------------------------------------------
J3Q132_PUCT1/187-568---RSLAGNVQRTYNLPQSSVSSLN-------------------------------------------------------
A9SCH4_PHYPA/154-467---...............HDMNFDM-------------------------------------------------------
Q0UYP7_PHANO/174-513---..........RSNSPAN.....-------------------------------------------------------
M9MH30_PSEA3/203-582---QHSTFKASFGAPARTASPAAGS-------------------------------------------------------
I2H5R5_TETBL/205-583---SIHGKVSSTEKNLHSRTNSSNE-------------------------------------------------------
A7TT52_VANPO/190-542---QRDSLRRKNLNYNQNDNYQSDD-------------------------------------------------------
T1J554_STRMM/179-485---......................-------------------------------------------------------
J9MJB3_FUSO4/82-414---......................-------------------------------------------------------
A7RPW3_NEMVE/163-477---......................-------------------------------------------------------
B4KHQ6_DROMO/161-491---....RP.NSSSMANSSMQSLGH-------------------------------------------------------
A8NGP6_COPC7/165-479---................ITLASN-------------------------------------------------------
D8QT59_SELML/156-463---............AEKDIVAQSK-------------------------------------------------------
S8C8S4_DACHA/216-562---..........RSGSPRPGGL..-------------------------------------------------------
N1PMN4_MYCP1/176-511---..........RSDSPAPG....-------------------------------------------------------
V5G2M7_BYSSN/194-532---..........RTGSPVNKDGT.-------------------------------------------------------
F8Q674_SERL3/166-485---............STLNTSSQKQ-------------------------------------------------------
M3AA99_MYCFI/191-526---..........RSSSPAPA....-------------------------------------------------------
G4MR42_MAGO7/219-567---..........RVNSPAGGVGTN-------------------------------------------------------
J3KIC8_COCIM/186-524---..........RANSPGIRDGT.-------------------------------------------------------
G4U2Q1_PIRID/161-490---..........ATQVSSTQRTTV-------------------------------------------------------
R7YUM9_CONA1/175-511---..........RSGSPVKRDGAT-------------------------------------------------------
G8ZSF3_TORDC/186-519---.....YRDEQSEENGGELHVNT-------------------------------------------------------
G0SXA1_RHOG2/160-497---AGVLKKAAPKGTSPMTAQTGFE-------------------------------------------------------
S3C4S1_OPHP1/236-610---LDGSLS....RVNSPALGSSGD-------------------------------------------------------
D8M8U8_BLAHO/154-504---....................AY-------------------------------------------------------
C3YFK8_BRAFL/171-477---......................-------------------------------------------------------
Q758T0_ASHGO/188-512---............AQAQANKNHL-------------------------------------------------------
M5C4C1_THACB/161-521---............QTLAPIARAK-------------------------------------------------------
U4L2E9_PYROM/293-612---..........RTGSPAVV....-------------------------------------------------------
J4KLZ9_BEAB2/1246-1586---..........RMSSPAVGTGT.-------------------------------------------------------
G7E1B8_MIXOS/165-515---KTGFNAPFNTAPFRQMTNSPAL-------------------------------------------------------
H2KS09_CLOSI/401-723---............STSSGKSQSV-------------------------------------------------------
W1NDY2_AMBTC/181-483---......................-------------------------------------------------------
COG4_ARATH/176-479---......................-------------------------------------------------------
H6C9G5_EXODN/179-515---..........RAGSPA......-------------------------------------------------------
H3AVV6_LATCH/187-496---......................-------------------------------------------------------
K5V063_PHACS/174-511---..........QSLNTPAPIRRV-------------------------------------------------------
B6HSP5_PENCW/191-531---..........RSQSPAV.....-------------------------------------------------------
G3BC56_CANTC/190-528---LRARLESEPPTRASSEF.....-------------------------------------------------------
U6I4L4_HYMMI/106-417---............VNNRSSISAT-------------------------------------------------------
M7NUP8_PNEMU/161-484---.......EFLIKSFSSTLFQEP-------------------------------------------------------
U7PW27_SPOS1/225-627---GGGGGDGAS.RVNSPALGVD..-------------------------------------------------------
E9EW04_METAR/274-618---..........RVNSPAVG.GG.-------------------------------------------------------
E6ZNH9_SPORE/195-575---QPSTFKASFGVPGRTASPAAGS-------------------------------------------------------
G0V8A6_NAUCC/189-534---HAQRQKQRTINNSMSDHNEVDN-------------------------------------------------------
E7QLX6_YEASZ/190-525---......SQKNEDVNIDSNQSDI-------------------------------------------------------
C5DUL4_ZYGRC/172-510---RHHQPQYQQQQQQLQQQNQQYR-------------------------------------------------------
E4UP45_ARTGP/209-548---..........RSNSPASWDT..-------------------------------------------------------
K1R201_CRAGI/174-481---......................-------------------------------------------------------
Q6FTK7_CANGA/185-531---AQKNKNKTQAYKDSGTDQNASQ-------------------------------------------------------
D2V3G5_NAEGR/119-422---......................-------------------------------------------------------
G5C1P9_HETGA/267-575---......................-------------------------------------------------------
L8WI47_THACA/987-1357---............QTLVPAARAK-------------------------------------------------------
V2X3Q2_MONRO/169-474---...................SRR-------------------------------------------------------
A7UW80_NEUCR/259-612---..........RLNSPAPGT...-------------------------------------------------------
M2NB58_BAUCO/172-509---..........RTGSPAPG....-------------------------------------------------------
C7ZFK3_NECH7/171-496---......................-------------------------------------------------------
K1WSR6_MARBU/231-588---..........RTSSPAIGGGT.-------------------------------------------------------
S0E9C5_GIBF5/167-499---......................-------------------------------------------------------
C4XYR0_CLAL4/197-532---LKNRLTEFPEG...........-------------------------------------------------------
S2JH92_MUCC1/194-506---......................-------------------------------------------------------
E9IBA8_SOLIN/158-464---......................-------------------------------------------------------
I1RAH7_GIBZE/187-527---..........RVNSPAIGQGN.-------------------------------------------------------
G0R6U4_HYPJQ/191-531---..........RMNSPAAGAGN.-------------------------------------------------------
I2FV21_USTH4/206-592---QQPTFKASFGVPGRTASPAAGS-------------------------------------------------------
A8NFV8_BRUMA/216-544---......................-------------------------------------------------------
G0SCB4_CHATD/176-523---..........RVNSPAAGGGTN-------------------------------------------------------
W1QCQ6_OGAPD/210-555---..........PILVGSILRNIQ-------------------------------------------------------
Q5AW68_EMENI/201-531---..........HANSPAT.....-------------------------------------------------------

PF07393

Q750R9_ASHGO/111-822.PPPDYTDLTHDEDPLFTLSCLDTMLKCAVESLARMMELI......PTNSSDFCVELVEVMLLGLISSYVESALE.AAY.
Q6BHS9_DEBHA/103-810STDFEKHEAESEKYSTLNINEVETVIKSAVESVARVLELA......PNKTPEYTLEIIEILLFDFGKLYISAGLE.VAYD
SEC10_ARATH/139-817................ISVTVVTDFVRWNEEAITRCTLFSS....QPATLAANVKAIFTCLLDQV.SVYITEGLERARDS
Q2HG63_CHAGB/108-854...NKNDIEVSEQDGILSVAYAKRMIGWLAESVRRTLEMGS.....ASETPKDVNVLLNLLLTTMGQVYVETALD.AAL.
Q7PQN8_ANOGA/88-705ANINIAQIEDYGGETFLSEELAINLLQQSSHAFERCCLLSK.....ETDLPRNILKLTDTLLRYLLHEHCDYALD.....
A1D556_NEOFI/126-876AKAAVMKSKLEGIRSLFSIEIALSLVHSAKSSLDRAAQFVKIGGETGAAAKQQCEAIFVSLLRILGHQHLIVGFNKAVDH
Q2URB8_ASPOR/132-879AKAAIMKSKMEGIRSLFSIEVALSLVHAAKSGLERAAQFVQIGGDTGALAKQQCEAIFVALVRILGHRHLIVGFNKAVDH
A0A023ZK30_YEASX/120-862SFTASDIDNSPNSPANYSLNDVDSMLKCVVESTARVMELI......PNKAHLYILEILKIMFLGIVDSYMEIALE.VAY.
Q4RLZ1_TETNG/80-698TNLSLGPVIDTHGETFLSPELVVNLLQETRHAFERCHRLSD.....PSDLPKNAFSIFLLLVEHLCVEHIDYALE.....
Q55N90_CRYNB/170-1008TPSPKNNKSFDRLQLLVSLDTALELIQVDRDSLKRAETFVKYPGKVGTKVREAIEEIFIFLLKAVGDRHIAPGFKIATNQ
Q0IP77_ORYSJ/117-800...............QISVTVVTEFVRWNEEAISRCTLLFS....QPATVAANVRSIFACLLDQV.SQYLTEGLDHARES
A2EZD8_TRIVA/69-728.........SYDIFSEFNPQMPITILTNGAAAWERCVVLCD.....PQRKHQVLKSLIDLVIQANLREYLITYLE.....
Q2GXU3_CHAGB/166-960AKAALMTSRLEGIKSLFSIEVALSLVHSAKASLGRVAVFIQLGGQAGGEAREQCEAIFVALLRILGSKHVKPGFDRAVAH
Q2TVY5_ASPOR/116-891...RRTEIKLTEEDGLPSISHAKRMLKWLAEGVSRGLELSV.....SSETPKDMLALLTLLLSIMGEGYIEVCLD.AAL.
Q5BGH2_EMENI/123-870AKAAIMKSKLEGIRSLFSIEVALGLVHAAKSSLERAARFMAIGGETGAAVKQQCEAIFVALLRILGHGHLIKGFDKAVDH
Q6CDC8_YARLI/101-777.STPDSPVPLEPEDGEIKIDVVQMCLKCLAESIQRVLELAH.....QNEINDCVVSLHDLLIESVGKSYIETGLD.....
EXOC5_DROME/89-705ANINIAAIEDYGGETFLSEELAINMLQEAKASLKRCRLLSN.....ETELPGNAIKLNDILLRFLMHEHVDYALE.....
A1DAY7_NEOFI/117-893...KPTEIKLMEKDGLPNITYAKRMLKWLAEAVGRGLELGA.....TSETPKDVSALLSLLLSLMGEGYVEVCLD.AVL.
EXOC5_CAEEL/46-659LMN....VETYGGETFVAEDVAISILQETKNAFGRANQLCD.....KEELPRHVENIVDVLLKYLYGEHLDYAVE.....
Q6FMF7_CANGA/102-810.......PIDHAGDDGYNLETVDAIIKCIVEAIARVMELI......PNKATSCIYEILELASMGIIGSYVKNALE.VAY.
Q4PHT4_USTMA/134-1026G..AHVEDELDDTDGDLSLDIAEKMLRWHAESIGRCVDLSS.....PSEVPKATFALLRVLTSAYIKTYVETALD.SAL.
SEC10_SCHPO/101-799SFITEDYITIEKNHSHLNSEKVYSFIGWHAEALNRASILIS.....SQDLSVVISSLVNLLDKLIREDYVFKELS.SIQ.
Q5KJ89_CRYNJ/95-875LVNKGLEDKVWSTDGILAPTMAERMLKWHAEAVGRAVELSN.....SGDVGKNALALLKVLSEAIGRSFIETALD.STL.
Q5AS51_EMENI/111-841...RPNDLIFTEEDGQPSISYAKRMLKWLAEAVGRGLELNM.....NNETPKDMATFLNLLLSIMGEGYLEVCLD.AAL.
Q6CQC0_KLULA/109-807NPAQLNITSKKIDRDYFTLSYIDLMIKCSVESLARVTELV......PAIADDFTYELVETSLIGVIDSYIESALE.VAH.
C4YGD5_CANAW/103-782....SEPEPTFMECKSLNVGNVETVLKSVIESVARLLELV......PTKSADYALEVLEILIIDFGKLYIGAGLE.VVY.

PF10191

Q7QA49_ANOGA/2-731..............DWNLLQLSVVLLQYLGSFRQAAYEL-------EQTFLQQVLTKHSQL.................--
Q29C94_DROPS/2-737.............ENWSLLQYTMSQLQCLADFQVQLHQF-------EHDLHARMATLAAKL.................--
Q172R1_AEDAE/2-704.............INWSLMQLNLNLLQHLGDFMQIIEQC-------EKKIFVSL........................--
COG7_RAT/2-767.............EDWTAFQNSVRIIATCGELLRQCGDF-------EQQLANRILSTAGKYLSDSYSPRSLAGFQDSI--
Q5FW35_XENTR/2-765.............EDWSAFQNSVRIIGACGELLRQCGDF-------EQQLASRFLSIAGKHLSDTYSPRSLTGIQETS--
Q655R9_ORYSJ/5-868KKEAQRLVDVSEEEEWSIVQGALQILTVADCLTSRTSVF-------EASLRATLARIGTNFSISGFGSSLDKS..TAA--
Q9FGN0_ARATH/4-832KRESSRKMDLTSNEEWSIVQGALQILTVADCLTSRSSVF-------EASLRATLARLNSSLSISLFGTNLDHNLSHLK--

PF08318

E9CCF3_CAPO3/274-605-----VQKASATTNDAIDPRDVDIQLVEIALFSSHTQSY-------NKYMRKHA........................--
B6JXE3_SCHJY/165-484-----VIPIEQREAEAVPLLTLHPVLNEHGSIFSRWNAY-------KQFISQLV........................--
COG4_DROME/166-496-----YRKPSGGSVDKLNPKEIDAIIAEITVMHARVELY-------FRFMRRRL........................--
M3D3E3_SPHMS/178-512-----.SGRNSEDD.SVDMKEIDALLNESAIMLSRWSLY-------TRFLAGKT........................--
C4QWJ7_PICPG/179-518-----SNVDRQPIDERISLSNIGDLLNELALILNRWSMY-------CKFFSSKW........................--
B8LT52_TALSN/189-530-----.GLQEGEDE.GVDMKEIDAILNELGVMLERWSLY-------CRFVGDSC............R...........--
S3CMB0_GLAL2/185-536-----.NGRTSEDE.GVDMKEVDALLNEAAMMLGRWSLY-------SRFLAGKC............R...........--
COG4_SCHPO/163-481-----AFVSDQKELERVSLQTLHPILNEMSAIVSKWNIS-------KIFISRLV........................--
L8FSC8_PSED2/189-538-----.NPRRSEDE.GVDMKEIDGILNETGMMLGRWSLY-------CRFLASRT............K...........--
F0XR72_GROCL/199-557-----VSPRQSEDEGGVNMKEVDGLLSEIAVMLGRWSLY-------SRFLAMKS........................--
V8NZE8_OPHHA/148-457-----....RSLAGEKIEPRELDPILTEVTLMNARSELY-------LRFIRRRI........................--
F6TNZ6_XENTR/114-423-----....RGSSTDKIEPRDLDPILSEVTLMSARTELY-------LRFIKRRV........................--
G8BDV4_CANPC/186-525-----VSEDYEGLDDLVPIRYVGDLILELSLILHSWALY-------CKFVTIKY........................--
C5WWS3_SORBI/192-503-----SMASAAGGNEGPDPREIELYLEEILALTQLGEDY-------TEFMVNKI........................--
A8X3I7_CAEBR/217-546-----.FTAPEGLEDVPDALEVDAIASEICMMNTSVEMY-------WRFVSRRI........................--
U1HW21_ENDPU/187-524-----.NSRSSEDE.GVDMKEIDALLNEMAVMMGKWSLY-------VRFITDKC............K...........--
J3NYL1_GAGT3/212-567-----SNPRASEDE.GVNMKEVDGLLAEIADMLGKWSLY-------TRFLAAKC............K...........--
D5GK94_TUBMM/197-545-----.THRNSEDE.GVDVREVDMLLSEIGVMLGRWSLY-------CRFLARKC........................--
F6I2Y2_VITVI/183-485-----..RLSVGAAEGPDPREIELYLEEILSLMQLGEDY-------TEFMVSTI........................--
T1KVK7_TETUR/162-476-----.STATANSINKVDPREIVGLLNDLMKINSRSETY-------FKFIRERT........................--
G8BYJ4_TETPH/194-538-----SDAESMDGVQMISVNNISLLINEFSQILQNWSMY-------TRFFSVRW........................--
Q4P6N8_USTMA/201-590-----TANSSFDEPAGPDGREVDRLLTELAAMSSRWGLY-------QRFLQSRLAPEQQDAAGGQTNRQKALKDEREA--
Q5TNE6_ANOGA/167-491-----PSGGGGGSIDKLNAKDIDSLIGEITIMHSRAELY-------VKFIKRRC........................--
J4GWL1_FIBRA/183-513-----RRQTVGEEEDPVDPRDIDRVLTEAAGMGGRWSLF-------RRFMYDRL........................--
H2VA38_TAKRU/70-376-----....RSMPAEKMEPRELDPVLTEVTLMNARAELY-------LRFLRRRI........................--
A3LT54_PICST/195-541-----.NVDLNSTNDLVSIVQVGDLINELATILHHWSLY-------CKFITVKY........................--
B7QAG5_IXOSC/93-401-----....SSKQADKLDPRDLDVLLAEVALLNSRAELY-------IRFIGRRV........................--
C5LP43_PERM5/114-451-----DNNDASSIVDEIDLGEKDAVIDEICIIAQRCNQF-------DHYIHNIS........................--
G3AM87_SPAPN/194-515-----.DTVVPIDDDLIPIRQVGDIISEMASIFHHWSLY-------CKFITAKY........................--
R8BYD5_TOGMI/1157-1500-----.NQRDSEDE.GVNMKEVDGLLSEIAVMLGRWSLY-------SRFLAGKC............K...........--
A5DUI4_LODEL/191-536-----.PYDETITDEILPIKSIGDLILELSSIIQSWSLY-------CKFVTIKY........................--
F4NT70_BATDJ/197-515-----NLTDTQQMQPPVDPRELDLILGEITTVCQKAYYF-------DRFLRMRA........................--
C5GF37_AJEDR/230-568-----.SQRSSEDE.GVDMKEIDGLLNEMAVMLGRWSLY-------SRFLADKC............S...........--
B2AA74_PODAN/219-562-----.NGRQSEDE.GVDMKEVNALLSEIAVMLGRWSLY-------SRFLAGKC............R...........--
N1JE83_BLUG1/191-526-----.NSNIHEEE.GISMKETDEILGEISMMLSRWSLY-------SRFLGGKC............R...........--
W4ZDW5_STRPU/172-484-----TTYKSSNVHDKLDPRDLDVLLAECTLLNTRTELY-------LRFIRRRV........................--
G0W4A1_NAUDC/213-564-----TIDNSSNKDIMIPMNQLSTLINEFSQILQNWSMY-------SRFFSVRW........................--
Q4DDH2_TRYCC/242-662-----FPTTSSAVAATVDPRRTDQILEEMSHLVSCCHLY-------WTFAQSKQ........................--
Q16TS8_AEDAE/167-489-----AS..GGGSVDKLNAKDIDALIGEITIIHSRAELY-------IKFIKRRC........................--
E9FQQ8_DAPPU/154-462-----..TGGKVLHEKCDPRILDAVLAELTLLSSRTELY-------LRFLRRRI........................--
C5M6Q7_CANTT/193-537-----.RSSFESSDDLLPIRNIGDLIQELSSILENWSLY-------CKFITVKY........................--
V5GSU0_PSEBG/199-579-----TANSSFDEPSGPDGREVSKILTELAAMSSRWGYY-------RRFLQSRL...SSGPDAGGGNRPKTLEDERAA--
X6MJK6_RETFI/5-348-----..........GFPLDKLDELLQEIAHVCSELESF-------DATMRSYM........................--
M2R7X1_CERS8/181-514-----PSQTGVIDEDIIDPREIDKVLTEIAGMSGRWALF-------RKFMYGRL........................--
U6HLQ3_ECHMU/114-419-----GAGQNKQSLLWDYCLSTESLISDSVLFNARIELY-------LNFLRRRL........................--
D6WJA3_TRICA/162-474-----STSSSFGKLEKIDPKDLDISIGEITLMHFRTELY-------IRFIQRKV........................--
G8Y9D0_PICSO/191-527-----.DGNEVETAGDISVIEIGDLVNEFSSILYNWILY-------CKFITVQF........................--
Q57XU9_TRYB2/282-625-----QPRALQSRGTTLDPRRTDQILEEMSHLVSCYHLY-------WTFAQSKQ........................--
G2Y0X2_BOTF4/187-528-----.NGRASEDE.GVDMKEVDGLLNEMAVMLGRWSLY-------ARFLSGKC............R...........--
E0VZ92_PEDHC/157-456-----....HVKSLEKIDPKSLDILLGELTLMHYKVDLY-------FKFVKRKL........................--
B0CT70_LACBS/161-472-----RQQTMVADEAVIDPRDIDKVLSEIAGMMSRWNLF-------KKFLSEAL........................--
Q59T37_CANAL/195-551-----.RTSFDTSDDLLPIRLIGDLIQELSSIFENWTLY-------CRFITVKY........................--
E9QGT9_DANRE/180-489-----....RGMTTDKIEPRDLDPVLCEVTLMNSRAELY-------FRFLRRRI........................--
K1WLQ9_TRIAC/267-644-----AATPIPEEDTGPDARDVDRILGELVALGGRWALF-------RRFIFARL........................--
F9XE54_MYCGM/175-509-----.SGRASEDE.SVDMKEVDALLNESAVMLGRWSLY-------TRFLASKT........................--
C5DG77_LACTC/179-498-----SPEEEGLTSNAPSMSEVSGIINESSSILQNWSMY-------CRFFALKW........................--
K5Y4H4_AGABU/183-506-----RQPTQGNEEPVVDPREIDKVLSETASMLGRWAMF-------KKFLLEAL........................--
I1JS41_SOYBN/186-485-----NLLAVGGGPEGPDPREVELYLEEILNLMQLGEDY-------TEFMISKI........................--
K0KE72_WICCF/171-504-----FDGTPRTSEDNLSVVHIGDVTTEFSAFLKYWSLY-------CRFVAVKW........................--
K4CGD4_SOLLC/174-477-----..DLLSVGIEGPDPRDIEVYLEEILSLTQLGEDY-------TGYMISKI........................--
H2XLC7_CIOIN/111-421-----.SSKKPENEQKVDPRDLEPLLTEVTIISSRTELY-------LRFIKRRV........................--
S9VWR1_SCHCR/164-482-----NLPSDQHEMERVSLQNLHPLLSEITSIITKWNMY-------KVFISRFI........................--
U9TBS3_RHIID/182-496-----KPGQLKEVDIIPDPRELDVILSELAMISARTHLY-------YRFLESRT........................--
E3Q612_COLGM/198-538-----.DQRDSEDE.GVNMKEVDALLSEIAIMLGRWSLY-------SRFLAGKT............Q...........--
Q6BTT0_DEBHA/227-568-----.ANVNPEEDELVSIVEIGDLVSELAGILHNWALY-------CKFITLKY........................--
K2S8E4_MACPH/175-516-----.TGRASEDE.GVDMKEVDGLLGETAVMLRKWSLY-------TRFLATKT........................--
G8JQJ6_ERECY/189-517-----SGHYSAEQDLPCTLNELSLLVSEYSAILQNWSMY-------CRFFALMW........................--
J3Q132_PUCT1/187-568-----STAVVSHEEDTEDPREIDFLIAELAGMSSRWQTY-------RRFLCGRF.......................G--
A9SCH4_PHYPA/154-467-----NLLAVAAPPEGPDPREIEVCLEEMMLLSQTSEDY-------FHFMSTKM........................--
Q0UYP7_PHANO/174-513-----.AVRTSEDE.GVNMKEVDGLLGESALMLGRWALY-------SRFISDKC........................--
M9MH30_PSEA3/203-582-----TANSSFDEPAGPDGREVDRILTELAAMSSRWGLY-------RRFLQGRL.ADGEESDKPDVERQSSLDDQRAS--
I2H5R5_TETBL/205-583-----NNIQDLDSVVSFSINDLSLLIDEFSQILQNWSMY-------ARFFSIRW........................--
A7TT52_VANPO/190-542-----DLANEISDIPDISINDISILINEFSQILQNWSMY-------SRFYSVRW........................--
T1J554_STRMM/179-485-----.HSFQYRTTERVEPRELDVLLGELTLLNARAELY-------LRFIRRRL........................--
J9MJB3_FUSO4/82-414-----.GNELDKDEFDLDVKNVEGLFGEMTTMLRSWSLY-------ERFIASQC........................--
A7RPW3_NEMVE/163-477-----.IKGSSEKSERYDPRDMEVLLGEVVLMNTRTEMY-------LRFLEKKI........................--
B4KHQ6_DROMO/161-491-----YRKPSGGSIDKLNPKDIDAIIAEITVMHSRIELY-------FRFMRRRL........................--
A8NGP6_COPC7/165-479-----RKPPPPNEDLAIDPREIDKVLSELSGMIGRWNLF-------RKFLLDAL........................--
D8QT59_SELML/156-463-----LLMSAGGAAEGPDLRSIEMFLEEILLLIQTSEDY-------TQYMIGRV........................--
S8C8S4_DACHA/216-562-----.GPRNSEDD.GIDVKEIDSLLNELSLMISRWSLY-------SRFIARKC............M...........--
N1PMN4_MYCP1/176-511-----.SGRVSEDE.GVDMKEIDALLNESATMLGRWSLY-------ARFLASKT........................--
V5G2M7_BYSSN/194-532-----.QGDQMEEE.GVDMKEVDAILNEMAVMLERWSLY-------SRFLADKC........................--
F8Q674_SERL3/166-485-----AFHQVSVEDEVIDPREIDKASTEIAGMAGRWSLF-------RRFLIEQL........................--
M3AA99_MYCFI/191-526-----.SGRPSEDE.SVDTKDVDALLNESAIMLGRWSLY-------TRFLATKT........................--
G4MR42_MAGO7/219-567-----.DPRQSEDE.GVNMKEVDGLLAEIAVMLGKWSFY-------MRFLAVKC............R...........--
J3KIC8_COCIM/186-524-----.SNRASEDE.GVDMKEIDGILNEMSLMLGRWSLY-------SRFLADKC............G...........--
G4U2Q1_PIRID/161-490-----QLSAAESEEEASNAREVDKIVSEIAGLAGRWGLF-------RRFLLERL........................--
R7YUM9_CONA1/175-511-----.AGRSSEDE.GVDMKEVDGLLGEAAVMLGRWALY-------GRFIASKA........................--
G8ZSF3_TORDC/186-519-----SVEWDTKKPDTLSLGDLSDLVNEFSSMLQNWSMY-------SRFFSVRW........................--
G0SXA1_RHOG2/160-497-----GANGAAQAEGDINPREIDAVLTELTMMSGRWELL-------RRFLYGTL........................--
S3C4S1_OPHP1/236-610-----.PSAPDDDEGGVSMPQVNTLISEMASLLSLWAFY-------TRFLAGKC........................--
D8M8U8_BLAHO/154-504-----ISNEQGVEDAALDA..LNPVLNEISLILQHAESF-------SRYLTGKM........................--
C3YFK8_BRAFL/171-477-----....GRTGTEKPDPKELDTLLAEVTLINSRAELY-------LRFFRRRV........................--
Q758T0_ASHGO/188-512-----HGAKPNSRPPPSSINELTMLISEYSAIFQHWSMY-------CRFFALKW........................--
M5C4C1_THACB/161-521-----PGQTSAIDDSGPDPREIDRVLGELATMAGRWALF-------RRFLVDRL..EDDMTPSAPPTPDGTTLLLRPT--
U4L2E9_PYROM/293-612-----....VDNEEETIDIKTVDLLLSEIGVMLSRWSMY-------CRFLGRKC........................--
J4KLZ9_BEAB2/1246-1586-----.DGRGSEDE.GVNMKEVDALLSEIAVMLGRWSLY-------TRFISGKC............V...........--
G7E1B8_MIXOS/165-515-----TASQSAQDDDSLDPRTIDALLSEVAQISNRWQLY-------RKFIYSRL........................--
H2KS09_CLOSI/401-723-----ASTGSQEGLQFERVLSLEPIISEVVLLNTRTELY-------MRFMRRHV........................--
W1NDY2_AMBTC/181-483-----.NLLSVGVLEGPDPREIEMYLEEILALTQLGEDY-------TEFMVSKI........................--
COG4_ARATH/176-479-----LNILPGGASEGPDPREVELYVEEILSLMQLGEDY-------TEFMVSKI........................--
H6C9G5_EXODN/179-515-----.PGRTSEDE.SVDMKQVDALLNEMTIMLGKWSLY-------TRFVAAKC............H...........--
H3AVV6_LATCH/187-496-----....RGAITDKIESRELDTVLSEVTLMNARAELY-------LRFIKRRI........................--
K5V063_PHACS/174-511-----ASHAGAVDEDQVDAREIDRVLTEVAGMAGRWSLF-------RKFLYERL........................--
B6HSP5_PENCW/191-531-----.GASTATDEEGVDMKEIDGVLNEMAIMLGRWSLY-------CRFLADTC........................--
G3BC56_CANTC/190-528-----.SRSSFEDNELVTIVEAGDLFSEFANIFNYWSLY-------CKFISTRY........................--
U6I4L4_HYMMI/106-417-----SNGHGKEKSLYEYCLSTESVISDTVLFNARIELY-------LNFLRRRL........................--
M7NUP8_PNEMU/161-484-----NSSLLSQENKAIDIKNIDLLVEEISSILNHWSLY-------HRFISVKC........................--
U7PW27_SPOS1/225-627-----.SPRRSEDEGGVNMREIDGLLNEIAIMLSRWSLY-------SRFLANKC............RDDEAEAAAQAE--
E9EW04_METAR/274-618-----.NPRSSEDE.GVNMKEVDGLLNEIALMLGRWSLY-------TRFLSGKC............M...........--
E6ZNH9_SPORE/195-575-----TANSSFDEPAGPDGREVDRILTELAAMSSRWGLY-------RRFLQSRLASEHDAAEAGKG....TLEDERAA--
G0V8A6_NAUCC/189-534-----DDGGDDSSMMNFSMNQLVVLVNEFSQILQNWSMY-------ARFFSVRW........................--
E7QLX6_YEASZ/190-525-----ETDGETEKSSIISIHDLALLIMEFSQILQNWSMY-------SRFYSVKW........................--
C5DUL4_ZYGRC/172-510-----EGSNEEAINEPITVAELSSLMTEFSQILQNWSMY-------SLFFSVRW........................--
E4UP45_ARTGP/209-548-----.PQRNSEDE.GVDMKEIDSILNEISVMLGRWSLY-------GRFLASKC........................--
K1R201_CRAGI/174-481-----..FHRPSATEKFDPKVLDVLLSEVVLLNTRTELF-------LRFFRRRA........................--
Q6FTK7_CANGA/185-531-----ERKSMDNKLPSISTGDLSGLIGEFSQILQNWSMY-------LKFFSVRW........................--
D2V3G5_NAEGR/119-422-----.TLPIKKDLNTNDPRVLDLILEEIAEISSNIEVY-------KQFIAGKC........................--
G5C1P9_HETGA/267-575-----....RNSAPEKIEPRELDPILTEVTLMNARSELY-------LRFLRKRI........................--
L8WI47_THACA/987-1357-----PGQLSAIDDSGPDPREIDRVLGELATMAGRWALF-------RRFLVDRL..EDDMTPSAPPTPDGTTLLFKPT--
V2X3Q2_MONRO/169-474-----QNPNLLPDEDLMDPREVDKLLIEMSGMVGRWSLF-------KRFLLDSQ........................--
A7UW80_NEUCR/259-612-----.DGRNSEDE.GVNMREVDALLSEIAIMLSRWSAY-------SHLLAQKC............T...........--
M2NB58_BAUCO/172-509-----.SGRASEDE.GVDMKEVDALLGESAVMLGRWSLY-------IRFLATKT........................--
C7ZFK3_NECH7/171-496-----.KVETEADQTSIDMRMMDELVSEMTAMLQQWSLY-------SRFIARQS........................--
K1WSR6_MARBU/231-588-----.NGVESEDE.GVDMKEIDGLLNETAMMLGRWSMY-------SRFLAGKC............R...........--
S0E9C5_GIBF5/167-499-----.GNETNKAKVNLDVKKVEELFGEMTSMLKSWSLY-------KRFVTSRC........................--
C4XYR0_CLAL4/197-532-----.DSNDANDVDLVSIVEVGDLIHEFSAILHHWALY-------CKFIVVKY........................--
S2JH92_MUCC1/194-506-----.QAETESTNPLVEPRQLDANLYELSLLSQRSVLF-------NSFMNERA........................--
E9IBA8_SOLIN/158-464-----.....KPSPERLDPKELDLLLGEITIMHSRAELY-------IRFIKRRV........................--
I1RAH7_GIBZE/187-527-----.NPRESEDE.GVNMREVDGLLSEIAVMLGRWSLY-------TRFLAGKC............K...........--
G0R6U4_HYPJQ/191-531-----.NPRNSEDE.GVNMKEVDGLLHEISVMLAQWSFY-------TRFISVKS............M...........--
I2FV21_USTH4/206-592-----TANSSFDEPSGPDGREIDRILTELAGMSSRWGLY-------RRFLQSRLAPEQDDGDAAKGNRQRTLEDERAT--
A8NFV8_BRUMA/216-544-----..NSDKYPLDKIDVLELDVLLSEVTLMHTRTHLY-------WRYLKRRL.......................N--
G0SCB4_CHATD/176-523-----.DGRNSEDE.GVNMKEIDALLFEIAAMLEKWSVY-------SRFIATKC............K...........--
W1QCQ6_OGAPD/210-555-----TDEELQDDNVVISLAEVSSLIDELSAMLNHWAMY-------CKFFVVSW........................--
Q5AW68_EMENI/201-531-----.QQSAAEDE.GVDMKEIDGLLNEMTVMLSRWSLY-------TRFLAETC............N...........--

PF07393

Q750R9_ASHGO/111-822.......................SQLISSDPAQTTN.LNLS.YMKYVSKTTEMLSLISASIKA-----------------
Q6BHS9_DEBHA/103-810T....................LKQESSNSKINSNQP.IDLS.YLSTFKLTSEILYLLSSCIKK-----------------
SEC10_ARATH/139-817LSEAAALRE....RFVLGRRVAAAAASAAEAAAAAGESSFKSFMVAVQRCGSSVAIVQQYFAN-----------------
Q2HG63_CHAGB/108-854.......................DQATSQE.NAKNE.PDLS.YLPNLRPAVTITNLMSRFITT-----------------
Q7PQN8_ANOGA/88-705.......................LGLQAIPIAECKSVPQIY.FFDVAQKCNAIVHLLEKTYNA-----------------
A1D556_NEOFI/126-876L....................SNYRPREQGERDQAGVEPLVTFLELVNVGDLILQMMDVFYEQ-----------------
Q2URB8_ASPOR/132-879L....................SNYRPREQGERDQSGVEPLVTFLELVNVGDLILQMIDVFYEQ-----------------
A0A023ZK30_YEASX/120-862.......................WKICKVDINKTAGVVNLN.FLKFISMSTEILDLLSISIKS-----------------
Q4RLZ1_TETNG/80-698.......................IGLSAIPSSDAKN.ANLY.FLDVVQQANSIFHLFDKQFHD-----------------
Q55N90_CRYNB/170-1008M....................STYKPAEHE..ETTSVAPLLQFFELVHIGDTIQSMVQVYFDK-----------------
Q0IP77_ORYSJ/117-800LNHAATQRDRYVIGTSVSRRVATAAANAAEAAAAAGESSFRSFMIAVQRCASSVAILQQYFSN-----------------
A2EZD8_TRIVA/69-728.........................ACRICMMKENDINTVPRFLAITSVINMSILTIEAKYSQ-----------------
Q2GXU3_CHAGB/166-960L....................SQYNPREVSEHDKGGVAPLVTFIELVNVGDLISQMIDVFYEQ-----------------
Q2TVY5_ASPOR/116-891.......................ETATSQE.LGKTE.PDFA.YLPAVRSAIGIANLMVMCINT-----------------
Q5BGH2_EMENI/123-870L....................SDYRPREQGDRDQSGVEPLVTFLELVNVGDLILQMIDVFYEQ-----------------
Q6CDC8_YARLI/101-777.......................DAIVSRDMKTISFV.....HLKTIRRVLTAIRLMSVVINS-----------------
EXOC5_DROME/89-705.......................LGLQAVPLAEGRVFPQLY.FFDVVQKTNIIVHLLDKLCHT-----------------
A1DAY7_NEOFI/117-893.......................ESATSQE.SARAE.PDFG.YLTVVKSIVSITNLMVMCIQT-----------------
EXOC5_CAEEL/46-659.......................TGLAGISLAESKTEPPAY.FFSVVAKCTSVILLMIKQFED-----------------
Q6FMF7_CANGA/102-810.......................CSISKPEQNKVDE.IDLS.SMKYISITTEILSLLSTLIKS-----------------
Q4PHT4_USTMA/134-1026.......................AAVTAQDIRGAVM.PDPSAAMSVVRSVELLISLWQHYVNT-----------------
SEC10_SCHPO/101-799.......................SYISSHD...KSKNLDLH.YLVDIRECKKIMGYFSAYLMS-----------------
Q5KJ89_CRYNJ/95-875.......................ARLEQQD..NKTE.PDLQ.PLAVLKPADQICHLWQRYTTT-----------------
Q5AS51_EMENI/111-841.......................EAAATQE.SGRTE.PDFA.FLRAVRDSISIANLM......-----------------
Q6CQC0_KLULA/109-807.......................AQLNSIDIHRETS.IELK.FLKYISTATEMISIVSAYIKS-----------------
C4YGD5_CANAW/103-782...............................DECKKNASLD.YLSSFNTISELLFLMSSCIKR-----------------

PF10191

Q7QA49_ANOGA/2-731-----------------------...TAGSARARF.EYRLNTKGEFNELHKLATTFQQPSSES.................
Q29C94_DROPS/2-737-----------------------...TKQSSRGNITIFQTCDHAARTQLLNAIADYQQKKAEA.................
Q172R1_AEDAE/2-704-----------------------......EPREVDSGNSTICNQRIIRHNTKARDLLAPSVDA.................
COG7_RAT/2-767-----------------------LTDKKSPAKNPWQEYNYLQKDNPAEYANLMEILYTLKEKG.................
Q5FW35_XENTR/2-765-----------------------YSDRKSS.RNPWHDYNYLQKGDPAQYANLMETLYMLKEKG.................
Q655R9_ORYSJ/5-868-----------------------NGDENAEVPITGRAALDIAAIRLTDLPDKSKKLFTVLEQASYIFLNYLASVTTLELS
Q9FGN0_ARATH/4-832-----------------------SEQTAGDLSMAGRASMDVAAIRLVDVPEKAHKLLNLLEQS.................

PF08318

E9CCF3_CAPO3/274-605-----------------------..........EDDTRAFTDASAAESATLSSQNGPLLPSIA-----------------
B6JXE3_SCHJY/165-484-----------------------.................WQLGRDEYKPGAPIT.....IPE-----------------
COG4_DROME/166-496-----------------------................QVHVETCVPEKEQF..........-----------------
M3D3E3_SPHMS/178-512-----------------------............................SAED.....HNL-----------------
C4QWJ7_PICPG/179-518-----------------------........................NEFKNEGE.....PGK-----------------
B8LT52_TALSN/189-530-----------------------......................PVEEN..........GNA-----------------
S3CMB0_GLAL2/185-536-----------------------.......VSPPTGVLQQAISKLSQDPE..........ADA-----------------
COG4_SCHPO/163-481-----------------------....................LRLSQSDGTSND.....PSV-----------------
L8FSC8_PSED2/189-538-----------------------........................EPG..........TSE-----------------
F0XR72_GROCL/199-557-----------------------.............................RPP.....DDT-----------------
V8NZE8_OPHHA/148-457-----------------------................TSDFEVGDSVASEEVK.......Q-----------------
F6TNZ6_XENTR/114-423-----------------------................VSDFEVGDSMATEEVK.......Q-----------------
G8BDV4_CANPC/186-525-----------------------..............................FH.....QSD-----------------
C5WWS3_SORBI/192-503-----------------------...........................RGLRD.....VKP-----------------
A8X3I7_CAEBR/217-546-----------------------.......GKNDADLARSPSGDGDEEEDEEARLERQRLRKE-----------------
U1HW21_ENDPU/187-524-----------------------.....................................PSN-----------------
J3NYL1_GAGT3/212-567-----------------------........................EPE..........TPD-----------------
D5GK94_TUBMM/197-545-----------------------...........................LVGAK.....TDI-----------------
F6I2Y2_VITVI/183-485-----------------------...........................KGLSS.....VDP-----------------
T1KVK7_TETUR/162-476-----------------------................KKDIDSSINEDDDNL......SVE-----------------
G8BYJ4_TETPH/194-538-----------------------...........................NEFND.....IK.-----------------
Q4P6N8_USTMA/201-590-----------------------QADEPLKDFRRTSVDRRSSIASSVSAALPNGADQNDDDDA-----------------
Q5TNE6_ANOGA/167-491-----------------------................ANDLEKSSLPAEVKQ.........-----------------
J4GWL1_FIBRA/183-513-----------------------..KEEFSDSEDDEEDRPPASPRPKPERNQKVD.....EDA-----------------
H2VA38_TAKRU/70-376-----------------------................LSDFEVGDV...QSIT.......Q-----------------
A3LT54_PICST/195-541-----------------------............................FKDE.....STD-----------------
B7QAG5_IXOSC/93-401-----------------------................ASDFEVAYQEPAVRAG.......K-----------------
C5LP43_PERM5/114-451-----------------------RQVVAELGNDDKRRLMYGEVAPDEKDYNEDHH.....HHK-----------------
G3AM87_SPAPN/194-515-----------------------...............................F.....PTP-----------------
R8BYD5_TOGMI/1157-1500-----------------------........................EPD..........APE-----------------
A5DUI4_LODEL/191-536-----------------------............................FDTR.....QTP-----------------
F4NT70_BATDJ/197-515-----------------------.........................SDQVNTLKANASSDS-----------------
C5GF37_AJEDR/230-568-----------------------.....................................NDN-----------------
B2AA74_PODAN/219-562-----------------------.....................................SPD-----------------
N1JE83_BLUG1/191-526-----------------------........................DPH..........QSP-----------------
W4ZDW5_STRPU/172-484-----------------------................TSDIEVCDEDGPAKE.........-----------------
G0W4A1_NAUDC/213-564-----------------------...........................NEFSD.....IK.-----------------
Q4DDH2_TRYCC/242-662-----------------------........................QEYMHGVEATGKQHEQ-----------------
Q16TS8_AEDAE/167-489-----------------------................LNDLEKSTLETEAKD.........-----------------
E9FQQ8_DAPPU/154-462-----------------------................ASDLEVGIPDENSRQ.........-----------------
C5M6Q7_CANTT/193-537-----------------------.........................LENPSTD.....PSK-----------------
V5GSU0_PSEBG/199-579-----------------------QADEALKDFRRTSVDRRSSIASSANAPPIDA......EQD-----------------
X6MJK6_RETFI/5-348-----------------------......................SDAKQMIEQS.....NNS-----------------
M2R7X1_CERS8/181-514-----------------------...QDYASDDEGDEDGDINGQRNGSADASELP.....LSP-----------------
U6HLQ3_ECHMU/114-419-----------------------.......................STGTLQKSE.....KEH-----------------
D6WJA3_TRICA/162-474-----------------------................VSDLDVGVQDEDEKP.........-----------------
G8Y9D0_PICSO/191-527-----------------------..........................FRDDAG.....NDD-----------------
Q57XU9_TRYB2/282-625-----------------------......................QECTQRVREKEGGAREQN-----------------
G2Y0X2_BOTF4/187-528-----------------------........................DPE..........ASP-----------------
E0VZ92_PEDHC/157-456-----------------------............................SKNS.....KDP-----------------
B0CT70_LACBS/161-472-----------------------.......................KKESTEEPE.....NLT-----------------
Q59T37_CANAL/195-551-----------------------.............LQEPKHRQNGKEVVTGKSP.....TED-----------------
E9QGT9_DANRE/180-489-----------------------................VADFEVADAMADEAVI.......Q-----------------
K1WLQ9_TRIAC/267-644-----------------------...REDAEPDAATSDPSKRAEGADGAEDSGEG.....EVS-----------------
F9XE54_MYCGM/175-509-----------------------.............................APT.....QED-----------------
C5DG77_LACTC/179-498-----------------------...........................REFSD.....QSS-----------------
K5Y4H4_AGABU/183-506-----------------------...........SGSTLPDETGGNNDEGESEQT.....RTN-----------------
I1JS41_SOYBN/186-485-----------------------...........................KALTS.....VDP-----------------
K0KE72_WICCF/171-504-----------------------............................NEYQ.....GLK-----------------
K4CGD4_SOLLC/174-477-----------------------...........................RGLSS.....VDP-----------------
H2XLC7_CIOIN/111-421-----------------------................QADIEIVFPTKEIKQ.........-----------------
S9VWR1_SCHCR/164-482-----------------------....................HRLLNPDPSTLK.....SPD-----------------
U9TBS3_RHIID/182-496-----------------------....................KLEVEAMQVNGTDVSLLEKD-----------------
E3Q612_COLGM/198-538-----------------------........................DPS..........SPE-----------------
Q6BTT0_DEBHA/227-568-----------------------..........................YQSNDG.....TDN-----------------
K2S8E4_MACPH/175-516-----------------------........................APEPEFPD.....GTD-----------------
G8JQJ6_ERECY/189-517-----------------------...........................NEFSE.....KQ.-----------------
J3Q132_PUCT1/187-568-----------------------EFNLNETQNILERPDEPQSPISPSTVPKEQHA.....SPP-----------------
A9SCH4_PHYPA/154-467-----------------------...........................KEAGA.....TSG-----------------
Q0UYP7_PHANO/174-513-----------------------..........................ASSQPE.....ERI-----------------
M9MH30_PSEA3/203-582-----------------------QADEPLKDFRRSSVDRRDSVAGSLGDAD.........AAT-----------------
I2H5R5_TETBL/205-583-----------------------...........................NEFSD.....IK.-----------------
A7TT52_VANPO/190-542-----------------------...........................NEFND.....IE.-----------------
T1J554_STRMM/179-485-----------------------................MNDIEVLDKGQA............-----------------
J9MJB3_FUSO4/82-414-----------------------.............................KGL.....LDQ-----------------
A7RPW3_NEMVE/163-477-----------------------................QADYENLPDEDVQECA........-----------------
B4KHQ6_DROMO/161-491-----------------------................QANAETCLQDKDAQN.........-----------------
A8NGP6_COPC7/165-479-----------------------.................KDDDADADVVLDDAG.....EKT-----------------
D8QT59_SELML/156-463-----------------------...........................REAGS.....SGA-----------------
S8C8S4_DACHA/216-562-----------------------...............PALPPTTPTTNG..........FPK-----------------
N1PMN4_MYCP1/176-511-----------------------...........................ASPKD.....GNL-----------------
V5G2M7_BYSSN/194-532-----------------------.............................KDP.....EDN-----------------
F8Q674_SERL3/166-485-----------------------................TDNSAIDEDRDEISVK.....TQS-----------------
M3AA99_MYCFI/191-526-----------------------...........................AKSSD.....DTP-----------------
G4MR42_MAGO7/219-567-----------------------........................DNS..........TPE-----------------
J3KIC8_COCIM/186-524-----------------------.....................................NDD-----------------
G4U2Q1_PIRID/161-490-----------------------.......KADDTSTPVSPTEQRMSRDDKPAAE.....PRT-----------------
R7YUM9_CONA1/175-511-----------------------.....................................VTE-----------------
G8ZSF3_TORDC/186-519-----------------------...........................YEFLG.....STE-----------------
G0SXA1_RHOG2/160-497-----------------------.....KTPPATAPAPSTTATATLEADPNARAP.....EAA-----------------
S3C4S1_OPHP1/236-610-----------------------..............GEQPAASTGEANGSQQLQ.....QPA-----------------
D8M8U8_BLAHO/154-504-----------------------...............NDAVLAASQRVPPDSEMLTHYPSTA-----------------
C3YFK8_BRAFL/171-477-----------------------................TADFEVQYQEEDRRK.........-----------------
Q758T0_ASHGO/188-512-----------------------...........................DEFSQ.....NT.-----------------
M5C4C1_THACB/161-521-----------------------TPGPATPGFGLKLLTPANASFQKPIEPEPEKE.....PEL-----------------
U4L2E9_PYROM/293-612-----------------------............................QPTS.....TSP-----------------
J4KLZ9_BEAB2/1246-1586-----------------------........................VPD..........S.D-----------------
G7E1B8_MIXOS/165-515-----------------------..........VHSKIPMDEDSVRQSDTLLESL.....AFT-----------------
H2KS09_CLOSI/401-723-----------------------.........................VADAQSVALSETELQ-----------------
W1NDY2_AMBTC/181-483-----------------------...........................GGMAA.....LDP-----------------
COG4_ARATH/176-479-----------------------...........................KSLTS.....VDP-----------------
H6C9G5_EXODN/179-515-----------------------.........................GA..........TVD-----------------
H3AVV6_LATCH/187-496-----------------------................SSDFEVGDATASDEVK.......Q-----------------
K5V063_PHACS/174-511-----------------------KDSEDEDEDQSNDRSRPQTPQPPPTARSQAFE.....PVD-----------------
B6HSP5_PENCW/191-531-----------------------.........................NSSGEDD.....ADD-----------------
G3BC56_CANTC/190-528-----------------------...............................L.....NAS-----------------
U6I4L4_HYMMI/106-417-----------------------.......................LPNVTQENG.....KDH-----------------
M7NUP8_PNEMU/161-484-----------------------...........................MEQKQ.....NKL-----------------
U7PW27_SPOS1/225-627-----------------------ADAKDTKKEKSGKDGQDGQDSKDSSTERATAA.....TPD-----------------
E9EW04_METAR/274-618-----------------------.......GLAL.............QVP..........SDE-----------------
E6ZNH9_SPORE/195-575-----------------------QADEPLKDFRRTSLDRRSSIASSINAPHDPTA.....IDS-----------------
G0V8A6_NAUCC/189-534-----------------------...........................NEFSD.....LEP-----------------
E7QLX6_YEASZ/190-525-----------------------...........................NEFSD.....LH.-----------------
C5DUL4_ZYGRC/172-510-----------------------...........................YEFRN.....ET.-----------------
E4UP45_ARTGP/209-548-----------------------.............................RED.....GAD-----------------
K1R201_CRAGI/174-481-----------------------................VGDMESAYSNDDLK..........-----------------
Q6FTK7_CANGA/185-531-----------------------...........................NEFSN.....EN.-----------------
D2V3G5_NAEGR/119-422-----------------------...................................INIKT-----------------
G5C1P9_HETGA/267-575-----------------------................SSDFEVGDSMASEEVK.......Q-----------------
L8WI47_THACA/987-1357-----------------------TPGPATPGFGLKLLTPANTSFQKSIEPEPEKE.....PEL-----------------
V2X3Q2_MONRO/169-474-----------------------.......................DTTVQGGVE.....DEV-----------------
A7UW80_NEUCR/259-612-----------------------........................EPG..........VSE-----------------
M2NB58_BAUCO/172-509-----------------------...........................AAESE.....DGE-----------------
C7ZFK3_NECH7/171-496-----------------------............................QDAD.....LPD-----------------
K1WSR6_MARBU/231-588-----------------------.......VSRP.DILLQAISKISQDHH..........ESP-----------------
S0E9C5_GIBF5/167-499-----------------------.............................KGV.....LDQ-----------------
C4XYR0_CLAL4/197-532-----------------------..........................FNPKMP.....SPP-----------------
S2JH92_MUCC1/194-506-----------------------..................SDEMDVLESDENEKELVMKGKD-----------------
E9IBA8_SOLIN/158-464-----------------------................KNDIEISTTDEAQRT.........-----------------
I1RAH7_GIBZE/187-527-----------------------........................DAE..........TPD-----------------
G0R6U4_HYPJQ/191-531-----------------------........................DPE..........V.Q-----------------
I2FV21_USTH4/206-592-----------------------QADEPLKDFRRTSIDRRISIASSVNGPFPNDGMA...DEH-----------------
A8NFV8_BRUMA/216-544-----------------------MANMKTDEQPREFDEDQMNDENKRLSEELRAK.....QKR-----------------
G0SCB4_CHATD/176-523-----------------------........................DPT..........TPD-----------------
W1QCQ6_OGAPD/210-555-----------------------...........................NDASD.....TAN-----------------
Q5AW68_EMENI/201-531-----------------------.....................................ANE-----------------

PF07393

Q750R9_ASHGO/111-822------------------IIL.PLLNNSPQAKKDIIK---LANAYLKRAELAINIILEDTVQMVDQRFTIVLL.KQNKKD
Q6BHS9_DEBHA/103-810------------------IML.PCAVNSPTIKNRMSS---LSNSYISRCEISLNIIIGDTIAMICNRVAYLLT.RQKKKD
SEC10_ARATH/139-817------------------SIS.RLLLPVDGAHAASCE---EMSTALSKAEAAAYKGLQQCIETVMAEVDRLLSSEQKSTD
Q2HG63_CHAGB/108-854------------------VLI.RLAEANTTVRRSMEA---QSKMAIEATERKANAVIKSTLDVAVNWTTKLLA.QQKKAD
Q7PQN8_ANOGA/88-705------------------SVI.PNVIGTPQYT.DCIQ---KKRSYLETVENKIETGLERTLNAIFGWVKTYLSSEQKKSD
A1D556_NEOFI/126-876------------------ELVGAKITDRNDFLDPAVK---EKKKFEQILDERVAAGLNKGIDVLMEEVDYILATRQQATD
Q2URB8_ASPOR/132-879------------------ELIGKKLTDRNDFVDPAVK---EKKKFEQNLDERVAAGLNKGIDVLMEEVDYILATRQLATD
A0A023ZK30_YEASX/120-862------------------IFL.PLLNNSPEIKAQIIE---MTNSQIQKMEILINIILQETITVISTKFSAILC.KQKKKD
Q4RLZ1_TETNG/80-698------------------QLM.PLISSSPKLA.ECLH---KKKEVIEQMEVKLDTGIDRTINCMVGQMKYILATEQKKTD
Q55N90_CRYNB/170-1008------------------ELS.PYV.DKTDFLNAVMR---EKKRFESVLDDAVAAGLNAGIEVLMNQVEHIILVKTGPRE
Q0IP77_ORYSJ/117-800------------------TIS.RLLLPVDGAHPSACE---DMGSAVSVVEAAAHKGLLQCIDTVMSEVERLLSSEQKATD
A2EZD8_TRIVA/69-728------------------ILK.PHLMQKPQYHEMFLR---DRESLISSLEDGITKNLQICINIITDRVKSIVATKNFKNS
Q2GXU3_CHAGB/166-960------------------QLAGPKIADRNDFLDPAGL---AKKKFEQMLDESVAAGLNKGIDVLMDEVEYLCATTQLPTD
Q2TVY5_ASPOR/116-891------------------LLI.PLATGSITVRREMEK---KTNLTTMRIEEKVNTIEQKIIDASLVWINKLLS.GQRKND
Q5BGH2_EMENI/123-870------------------EMIGSNITDRNDFLDPAVK---EKKKFEQNLDERVAAGLNKGIDVLMEEVDYILATRQLATD
Q6CDC8_YARLI/101-777------------------VIV.PLTDSHGQGRRYIVM---QTNNFFTKCEEKINSILQVTLDIVSARVTVLLS.KQKKRD
EXOC5_DROME/89-705------------------SVI.PCVSNTPKYS.DYVF---KKRILMEQIETKLDQGLDRSISAVIGWVKVYLQYEQKKTD
A1DAY7_NEOFI/117-893------------------LLI.PLATPSITIRREMEK---KTNTATLRIEDKINAIEQKVIDTALMWISRLLS.GQKKND
EXOC5_CAEEL/46-659------------------PIF.PIIKETIVEP.SVAK---KWQQSLRSLESKMSLGLERQLNSIVGYVKFLFS.EQKKTD
Q6FMF7_CANGA/102-810------------------VCL.PLLSNYPDVKKKVII---ATNSQVKNCEVMINLIMEEVFQQFSNKFIASLS.KQKRKD
Q4PHT4_USTMA/134-1026------------------ALL.PLASTSVTSRREMMI---FNNHNLLRVEGKCDALMQKIADNVVGFLSNRLS.TQRKND
SEC10_SCHPO/101-799------------------IVI.PFTGVTASSRRETVN---ILSSSISVIECAVNDVFYATVHALGDHLEIILS.PYRQIS
Q5KJ89_CRYNJ/95-875------------------ALF.PLAGSNVPIRREMTT---LNTHNVVRMEGKANNVIQKAIDNVIGWLSYLLT.KQKKND
Q5AS51_EMENI/111-841------------------...................---................QQGALPFVERWKRRPTWQLQKKND
Q6CQC0_KLULA/109-807------------------IVL.PLLQNCPSIKRKVIA---LSNAYFKKCELLMNLLIVETSKLLNQKFTLILS.KQKRKD
C4YGD5_CANAW/103-782------------------IIL.PIATNIPSIKTRMSN---MVNGFVAQCEISLNVILNDTLDHFRVKLQSQLA.KQKKRD

PF10191

Q7QA49_ANOGA/2-731.........................GRE..YFSEFHQ---RMKRTCEDIHDTMLQIAFSPITKHFKQIEPAATGPTGAAG
Q29C94_DROPS/2-737.........................TESLGIFPQIYA---ALKLQFSETHDITLNILLQPIETHLAHIRPAAETHPSTGI
Q172R1_AEDAE/2-704...........................GNSVFSKELQ---TLQKVAIEIHDCVLKHIFVYIEAQFKQMEFTIKQHSE...
COG7_RAT/2-767.........................SSNHNLLSVSRT---ALTRLNQQAHQLAFDSVFLRIKQQLLLV.SRMDSWNTAGI
Q5FW35_XENTR/2-765.........................AVSTSLLAASRS---AFTRQNQVAHQLAFDSVFLHIKQQLLLV.PKMESWSCEGS
Q655R9_ORYSJ/5-868HVSLICLNSLIANLGGSIKLDYLSKDPRFHALPLTSQ---RVAAFSDTVNELVYDVLISKVRQRLNEV.ARLPIWSS..V
Q9FGN0_ARATH/4-832........................KDPRFHALPLASQ---RVAAFADTVNELVYDVLISKVRQRLGEV.SRLPIWSS..V

PF08318

E9CCF3_CAPO3/274-605----------------------SARLNFERFMDA.CE...LNKLM............HELVGNYIVMEEFYMKHSVLKAI
B6JXE3_SCHJY/165-484----------------------GTKVPLAPLFAK.SR...IEECL.A..........QRLLSMQIEMERYYFRHSVEIAL
COG4_DROME/166-496----------------------DIMERYEKIMKN.SD...LRRQM............QEILSTYLLLERYFMEESVLKAI
M3D3E3_SPHMS/178-512----------------------DDDLHLPSFLTH.ST...LQKKV.S..........ELLIEPFNAMATFFFRRSVEKSF
C4QWJ7_PICPG/179-518----------------------TEITSLPEALFN.SA...FMSKI.K..........ERINPVFDTLSTFYLRRSLEKAY
B8LT52_TALSN/189-530----------------------EAPLELPEFLVE.ST...LSKKI.R..........DRMIGPFNAMTTFFLRRSVEKAF
S3CMB0_GLAL2/185-536----------------------EEPLVMPDLLHK.SA...LIRKI.S..........NRLIDPFNQLTGFFFRRSVEKAF
COG4_SCHPO/163-481----------------------QDNLICASIFNS.SK...MELLL.K..........KQLLPSLLQLETYYFRRSIETSL
L8FSC8_PSED2/189-538----------------------NAPLSMPPFLTK.SA...LSRKI.S..........SRLTTPFDILSTFFFRRSVEKAF
F0XR72_GROCL/199-557----------------------SDFPPLPPVIAQ.SV...LQRKV.A..........ARLITPYNLLSTFFFRRSVEKAF
V8NZE8_OPHHA/148-457----------------------EHQKCLDKLLHN.CF...LSCAM............QELIGYYITMEEYFMRETVNKAV
F6TNZ6_XENTR/114-423----------------------EHLQNLDKLIKH.CL...LSCSV............QELIGYYITMEEFYMRESVNKAV
G8BDV4_CANPC/186-525----------------------SSELTMPMIITK.SN...FSRKI.N..........EKLLPAFEAMYQFYFRRSLEKSI
C5WWS3_SORBI/192-503----------------------ELGPRAMKAFRN.GN...FNKME............QDLTGFYVIFEEFFMVENVRKAI
A8X3I7_CAEBR/217-546----------------------AKEQKMDQLLNR.SR...VGTKM............QELIGHYCLLEHFYMMKSVQKAI
U1HW21_ENDPU/187-524----------------------DIDWDVPTFLTS.SA...LARKV.T..........GRLISPFNAMTTFFFRRSVEKAF
J3NYL1_GAGT3/212-567----------------------DSPLVIPPVIKN.SN...LHRKV.N..........TKLTAPYNVMSTFYFRRSVEKAF
D5GK94_TUBMM/197-545----------------------LPPLAAPPIITN.SA...LYRKV.Q..........GRLIVPFNAMMTFFCRRSVEKAF
F6I2Y2_VITVI/183-485----------------------ELGPRATKAFRN.GN...FSRSI............QDITGYYVILEGFFMVENVRKAI
T1KVK7_TETUR/162-476----------------------EKLKKVDSLIRN.CT...LSHMI............QELNGAYVLLEEYFARESCLKAI
G8BYJ4_TETPH/194-538----------------------YTKLDYAPSLLE.SN...FKNKLVN..........EGFISTFDTLVLYHLHKSFNNSI
Q4P6N8_USTMA/201-590----------------------AAAAEPIDHAAT.SK...LGQEV.L..........ESMKTTYVPMETWYLRNSLEKAF
Q5TNE6_ANOGA/167-491----------------------ERLAELQTLLQK.SR...LNTQM............QELLSTYLLFERYFMEESVLKAI
J4GWL1_FIBRA/183-513----------------------GTLPGGIQAVES.CA...SRQLM.E..........DMLTNYYVPLETWYTRTIIDKAH
H2VA38_TAKRU/70-376----------------------EHQQNVEKLLKH.CL...LSRKM............QELIGYYIPMEEYYMRESVNKAV
A3LT54_PICST/195-541----------------------GKELKLPDLILN.SN...FTKKI.H..........NKYLPSFENLYIFYFRRSLEKAI
B7QAG5_IXOSC/93-401----------------------HQAGYFSEALD..SE...LCKCM............QEIVSSYIMMEEYFLLESVRKAI
C5LP43_PERM5/114-451----------------------SRNTYGEDGLPIMTD...LTELV............QELMGEYVLYERSFIIVSTIKAI
G3AM87_SPAPN/194-515----------------------QPPLKLSELIVK.SN...FTRKI.N..........DKLLPAFEILYKFYFRRSLEKAI
R8BYD5_TOGMI/1157-1500----------------------DAPLVTPEVLTK.AN...LSRKV.S..........GKLTEPYNTMTTFFCRRSVEKAF
A5DUI4_LODEL/191-536----------------------QSELQVPELILN.SH...FTKKV.K..........EKLLPSFKKLYDFYFRRSLEKCI
F4NT70_BATDJ/197-515----------------------LSENGKDGLMPT.SS...LNEQI............HIFIGYYISIEDYFIRQSIEKAL
C5GF37_AJEDR/230-568----------------------HEELELPDFIIQ.SA...LCQKV.S..........DRLIHPFNSMTTFFLRRSVEKAF
B2AA74_PODAN/219-562----------------------DAPLTMPEVLTK.SN...LGRKV.S..........GKLVSPYNELTKFFFRRSVEKAF
N1JE83_BLUG1/191-526----------------------EIPLQMPKLLLD.ST...LHQKV.S..........NLLITSFNSMTTFFFRRSVEKAF
W4ZDW5_STRPU/172-484----------------------ERLSSLDRMLRD.CA...LSRRM............QEIIGNYIVMEEYFMRETVMKAV
G0W4A1_NAUDC/213-564----------------------TTVLTPPKPIGD.SK...FRTKLVN..........DSYLESFEILIMYHLQKSFNNSI
Q4DDH2_TRYCC/242-662----------------------QEVVVSVDSLWS.SRDNPLMNTV............QEILGVFVPLQTLYFEAAFEQAL
Q16TS8_AEDAE/167-489----------------------AKLKQLDDLIKK.SR...LSTQM............QEVLGTYLLFERYFMEESVLKAI
E9FQQ8_DAPPU/154-462----------------------LRMNEFEKLLQSKIG...INRAV............QELLGHYIMLERYFLSESVSKAV
C5M6Q7_CANTT/193-537----------------------EVTLNLPDLIRK.ST...FTKKI.N..........EKLLPSFEKLNNFYFRRSLEKAI
V5GSU0_PSEBG/199-579----------------------EELADSIDHATQ.SK...LGQEV.L..........ESMSTLYIPMETWFLRNSLEKAF
X6MJK6_RETFI/5-348----------------------LLEQEVPKNFPA.ET...KINTI.R..........HQYISYYIILEQFNMQYKLYRVL
M2R7X1_CERS8/181-514----------------------AKSADSFQVLEK.SS...SQKRF.D..........DILSTYYVPLEVWYARTIIDKAH
U6HLQ3_ECHMU/114-419----------------------ENSTEIRQFFNQ.CG...LSKIS............QEIVDAYLPLEQLFLRELVNKAI
D6WJA3_TRICA/162-474----------------------KVLKSLENLIKT.SD...LTHSK............HELLLHYLKLEQYFMEESVAKAV
G8Y9D0_PICSO/191-527----------------------DDESKLPQLLSD.SV...FAQKI.I..........NRYLPAYEKLYAFYFRRSLEKAI
Q57XU9_TRYB2/282-625----------------------DGMNQSADSLWS.SRDNPLMTAV............QEILAIFVPLQTHYFEAAFHQVL
G2Y0X2_BOTF4/187-528----------------------DEPLIMPELLDK.SA...LSRKI.S..........NRLKDPFNVMTTFFFRRSVEKAF
E0VZ92_PEDHC/157-456----------------------ELLNKIETLMKC.CN...LNCKM............QEVLDYYVQLERYFTEESVFKAV
B0CT70_LACBS/161-472----------------------SQHLSETRLVDD.TS...SNGVF.E..........DLVTAYYIPLEIWYTRTIIDKAH
Q59T37_CANAL/195-551----------------------KDALLLPDLIRK.ST...FTRKI.N..........EKLLPSFETLYKFYFRRSIEKSI
E9QGT9_DANRE/180-489----------------------EHQQSLEQLLKN.CQ...LSRTM............QELIGYYIPMEEYYMRESVNKAV
K1WLQ9_TRIAC/267-644----------------------AKTADVDESILT.SS...LSQRAME..........NLLRTYYLPLEEWYLRTAVEKAH
F9XE54_MYCGM/175-509----------------------DAKLHLPAFILH.ST...LQKRI.N..........DLLIEPFNLMTTFFFRRSVEKSF
C5DG77_LACTC/179-498----------------------EDPLTLPAPICD.GI...FYSKIHS..........SGFLSDLKKLNEFYLNRSFKKSL
K5Y4H4_AGABU/183-506----------------------NRMEESSLQLEE.TS...SEKLF.Q..........HTIFTYFIPLEIWYTRTIVDKAH
I1JS41_SOYBN/186-485----------------------ELLPRATKAFRS.GS...FSKVA............QDLTGFYVILEGFFMVENVRKAI
K0KE72_WICCF/171-504----------------------QDELKLPKPILE.SK...FGKKI.Q..........TKLLPSFEVLLTFYIRRSLEQAL
K4CGD4_SOLLC/174-477----------------------ELGPRATKAFRS.GN...FSKVV............QDITGYYVILEGYFMVENVRKAI
H2XLC7_CIOIN/111-421----------------------ERQKELQAWITN.CE...LSHCI............QEVIGYYIIMEEYYMRESIAKAI
S9VWR1_SCHCR/164-482----------------------ERSFECANVFLS.SK...VEQDI.S..........NQLIPSLLHLETYYLKHSMETAF
U9TBS3_RHIID/182-496----------------------ANKYDSSVIIKN.SG...LLKQV............KSLMNDFVVIEEYFLKKSIEKAM
E3Q612_COLGM/198-538----------------------NALLSMPEVVVK.SN...LKRKV.S..........DKLTSPYNTMMTFFFRRSVEKAF
Q6BTT0_DEBHA/227-568----------------------DEGLKLPKLIMD.SN...FTGKI.H..........KKFLPAFESLYSYYFRRSLEKAI
K2S8E4_MACPH/175-516----------------------TVPLTMPDFLSS.SN...LAKKV.N..........GHLLEPYNIMATFFFRRSVEKAF
G8JQJ6_ERECY/189-517----------------------VESLEIPDILST.GK...FNEKV............INSLGQFEILVKHHLYRSFSKAV
J3Q132_PUCT1/187-568----------------------AHISKQFEQLGQ.TE...LSQKL.N..........ENLERFYLPLEAWYLRINIEKAH
A9SCH4_PHYPA/154-467----------------------QLSPRESNSFKA.GS...FGLSV............QELVGYYIILEEYFMSENVKKAI
Q0UYP7_PHANO/174-513----------------------DHGLVMPEFLAT.SN...LQKKV.S..........SHLVEPFNVMTQFFFRRSVEKAF
M9MH30_PSEA3/203-582----------------------ETPPDSIDHAAE.SK...LGQEV.L..........ETMKGSYMPLETWYLRSSLEKAF
I2H5R5_TETBL/205-583----------------------FNILQPPPPIAN.SQ...F<