Sequence alignment for CL0295

PF09763

Q75AA6_ASHGO/631-1297DG...............SDVVLERLL---------------LKVAEAEYQF.NKQLMSLPKKASDLKL------------
A5DBH0_PICGU/582-1282AEVEEILDDINWSTSDNGDILIKKLS---------------HELSALKYNN.VKQLVTLDFGHNSISK------------
A3GH85_PICST/625-1329PEVEELFDDLKWSITDDSDSLIKKLT---------------RELNNVKQQN.VRELIGLNFGSSNVSK------------
Q6FRC5_CANGA/652-1329DD...............ADTLLEKVN---------------TNLSKTEYMF.NTSLLTLSKLSNNLQP------------
A6QQU0_BOVIN/176-464QDIEIMMEG.CEYAISNAEAFAERLS---------------RELQVLDGAN.IQSIMASEKQVNILMK------------
Q2UK85_ASPOR/702-1427KK...............IEDLEADIR---------------REIGRVEATSWLGNLEQQEGKIDQLAK------------
A7TSV5_VANPO/776-1455ED...............ADKLVERLD---------------YKLAETEYDF.NNDLLLLENLQTTLSG------------
Q6CQX3_KLULA/540-1218DD...............SSSLLEKLH---------------SRLADVDYQL.NKNLLFLPKSLGELNP------------
Q57ZX4_TRYB2/198-1064DD...............IRATEKLLS---------------THQKKAELLS.VNDLVISACAWEEVRE------------
EXOC1_DROME/186-866NELGKLFSE.CDFAIKDAEQFIEQLS---------------RELHDLDGAN.MQSVLASEQKVLKMME------------
A7E4X8_SCLS1/708-1443KV...............IDGLKDDVE---------------RELNKVQAGGWLNRLEEEDERVEAIKR------------
Q4RKW7_TETNG/106-846QDIESMMET.CEYAISNAEAFTEQLS---------------RELQVLDGAN.IQSIMASEKQVNILMQ------------
Q6C0U5_YARLI/751-1484KD...............AKELEADIN---------------RELAQLEESN.ISHVIDLDTKFGDLTT------------
Q2GRZ6_CHAGB/575-1334RN...............FDEMRTDLD---------------RELSKAQAGGWLARFQEEDERVEAIKR------------
Q5K9I2_CRYNJ/475-1177MSAGGLGIS.GEGKKKGADVIENRLL---------------DELTALDSAI.IHAFLESDDRTAQVLA------------
Q7T2A6_DANRE/169-869QDIEGMMEV.CEYAISNAEAFAEKLS---------------RELQVLDGAN.IQSIMASEKQVNTLMQ------------
A7RVQ5_NEMVE/151-846QDLEHMMSQ.TENAISNIETFTDQLS---------------KDLSVLDGAN.IYSIMASEDQVTSLMD------------
Q5TMX8_ANOGA/189-872AHLSKLVAE.CDYAISNAELFMDDLS---------------HNLLQLDGAN.IQSVLESEKQVQMLME------------
Q10GJ4_ORYSJ/212-854EDMEALLDT.YVMGIGEADAFSERLK---------------QELVALEAAN.VYQLLQSEPLIDEVLQ------------
Q4PFK6_USTMA/462-1173RNASAKGYG.IASGKGTADMIEARLL---------------DELSALEAAN.IFAIIESDDRVALVVK------------
A6ZQV5_YEAS7/640-1316DD...............ADSMIERID---------------LRLAETEYLF.NQNLLSLQKIGPNIRP------------
Q7S5W6_NEUCR/694-1488RN...............FDEMRIDVD---------------RELSKAQAGGWLARFQEEDERVDAIKK------------
A5E4P0_LODEL/994-1796MN...............TEVLLKGLT---------------KELNKAKRET.VKRLVSVDL.TKTLAQ------------
EXOC1_DICDI/95-855EDLENVINN.YLSFEKDVDILTERLG---------------KTLSTLETEM.IVGVLDSGVGVNEVIS------------

PF04129

VPS52_YEAST/47-607NK---------------DQSPFAKLK.........................-........SLQETHSN------------
VPS52_SCHPO/1-508MQ---------------RASTQDVYD.........................-.........GSGDDLN------------
Q9VMQ8_DROME/42-546VE---------------NKSIEDYIA.........................-......ESQNIANLHN------------
Q9FVV3_ARATH/83-615VE---------------LDSIEVVILYLCYIVALVVFYFLCTSVYKFGNFF-DIDYIKESDNLVSLHD------------
VPS52_RAT/94-601IE---------------QKSIRDYIQ.........................-......ESENIASLHN------------

PF15278

B6K1Q5_SCHJY/526-611---GKHLFELDWSGEDAFEKNQQELL---------------NSLNESMREN-VEELFRQKMQAKEVQD------------
YD6C_SCHPO/520-605---ISRLSTLKWNEGTTIKDVLKQTE---------------FSFDGAIISS-VENLAEEEIELQNIKS------------

PF06419

COG6_CRYNJ/69-690DTLPKRRTLKGQSAAIARKYLKQDIE---------------TCLATGSTKF-LEAFAEVDQKLNVLRE------------
COG6_EMENI/58-693DALETLSLRGVHNTAEVRRQLRLDVQ---------------KEVVDCNAEI-VRDFGNVAEQLKRIGS------------
COG6_ASPFU/55-708DALETLSLRGVHNTAETRRQLRLDVQ---------------KEVVECNAEI-VRDFGKVAEQLQRIGT------------
COG6_PICGU/131-737DS...ILEPGALGSM.SRRKLRGEIE---------------RTLIRNQTQT-LKEYQPVIKNLRKLEE------------
COG6_DEBHA/132-759ENIAALVEPGITGSN.SRKKLRGEIE---------------NDLIKTQGLM-LKEYQPVIKNLSNLEN------------
COG6_HUMAN/55-656EALKALSTFFVENSLRTRRNLRGDIE---------------RKSLAINEEF-VSIFKEVKEELESISE------------
COG6_CANGA/175-819SE.EKLISPDYIGTL.ARKSLRTDLE---------------TQLLKDHVTV-LEDFKPIVRRIKRLAA------------
Q6C1G5_YARLI/25-595DALVALDDRITDNTASIRRSLRANTE---------------AEVIKANGEA-LKKFAPLVAQIQASGN------------
COG6_ASPNC/57-685DALETLSLRGIHNTAEVRRQLRLDVQ---------------KEVVDSNAEI-VRDFGLVAEQLKRIGT------------
COG6_YEAST/181-824DE.QKLMNPEYVGTL.ARRALRTDLE---------------SQLLKEHITV-LEEFKPIIRRIKRLSS------------
COG6_PHANO/54-693DALETLDTRGVRNTAETRRQIRLDVQ---------------KEVIECNGEI-VKDFGQVAEQLKRIGT------------
COG6_ASPOR/121-774DALETLSLRDIHNTPEVRRQLRLDVQ---------------KEVVDCNAEI-VRDFGKVAEQLKRIGT------------
COG6_CHAGB/46-689EALALLDERGVQNTAETRRQLRLDLQ---------------KEVIDSNGEI-IDEFAKVAEQLRRIGT------------
COG6_COCIM/32-673DSLETLDKRGLQNTAETRRTLRLDIQ---------------KEVIDSNGSI-IQDFGKVAEQLSRIGA------------
COG6_SCHPO/43-650AALEQLSERKFKNEREARKQLPFEVF---------------SDLIWTNGSI-IKELSELSSQTLSVQS------------
Q17KR7_AEDAE/31-620DALADLSQFYTENTLQSRRNLRSQIE---------------RRSLAINENF-LSSFREVKLALDDICA------------
COG6_ASHGO/158-791DG.SKLVRPDFLGSL.SRKTLRSQLE---------------KELLKDHLAT-LENFQPIARRIMRLRQ------------
COG6_PICST/153-782DSIDELIEPGVVGSM.SRKKLRGKVE---------------NELIKNQSLV-LKEYQPVIKQLKVVED------------
Q7QJN1_ANOGA/31-623DALSDLSTFFKENTLQSRRNLRSQIE---------------KRSLEINQNF-LSAFKEVKEALDGICD------------
A7SZM3_NEMVE/34-607EALKALSTFFTENTLRSRRNLRGDIE---------------KRSLLISENF-EQAFGVLKEHLDKVYS------------
COG6_CANAL/144-758D....LIESGIVGSM.SRKKFKGRIE---------------SELIRNQSNI-LKQYQPIVKQLKQIEV------------
COG6_MAGO7/53-703DALSLLDSRGIQNTAEARRRLRLDLH---------------REVIDSNGEI-IDEFGRVADQLRRIGN------------
COG6_KLULA/138-763NF.NQLVASDFVGTL.NRKSLRSKLE---------------NSMLNSHSDI-LSNFQSIARRIKRLSG------------
COG6_SCLS1/52-643DALSLLDKRGIQNTAETRRQLRLDVH---------------REVIESNGDI-IREFGHVAE.......------------
COG6_DROME/34-627DALSGLSTFFTENTLQNRRNLRSQIE---------------HRSVGINENF-LKAFRQVKLSLDAVCE------------
COG6_CAEEL/37-623DFITPLVEDMNLDSN.VDRKLHNKLE---------------RYELRLNKEY-LSEFEKINNIVQKFDE------------
COG6_ASPTN/56-707DALETLSLRGIHNTAEVRRQLRLDVQ---------------KEVVDSNAEI-VRDFGKVAEQLKRIGT------------
COG6_NEUCR/63-712EALFLLDERGLQNVAENRRKLRLDLQ---------------KEVIDSNGEI-IHEFGKVAEQLKRIGY------------
Q00T18_OSTTA/85-728ALSDILSSQHKTTTPCASVNVRAAVE---------------RRGLALNESF-LDASLMAQTKLSQVEA------------

PF03081

Q5Z4V4_ORYSJ/278-638-----------------VEHWGRHLE--------------------------FAVRHLLEAER.KLCV------------
EXOC7_DICDI/436-836-----------------GSHPLISYV--------------------------QETLRLYQIEY.DLAS------------
EXO70_DEBHA/215-612-----------------GSNGINRYN--------------------------NEMIKAIKGEI.GLLN------------
A5DE46_PICGU/207-601-----------------GTNGINRYN--------------------------NELIESIKLEI.ALAA------------
A2QCL9_ASPNC/266-651-----------------GTNGIGIYS--------------------------NALESFIYAEH.DILV------------
Q5KMS6_CRYNJ/297-673-----------------MSIWEAIMH--------------------------AAEQ...QGET.MLAE------------
Q9SF51_ARATH/232-603-----------------IRSWLKAVK--------------------------VSMETLFKGEK.ILCD------------
Q5QLT4_ORYSJ/188-532-----------------IMCWIPAIR--------------------------VVFHILIPSER.HLCD------------
Q7XPT9_ORYSJ/273-640-----------------IAEWTQFSR--------------------------ITVKLLFGAER.ILCD------------
EXO70_YARLI/227-601-----------------QSNGIHIYA--------------------------EALLKMLQAEH.DNLR------------
Q9LZD3_ARATH/267-627-----------------IGNWIHFMR--------------------------IAVKLLFAGER.QVCD------------
Q5ZIN3_CHICK/309-677-----------------EIDAYIHCV--------------------------SAFVKLAQSEY.QLLT------------
A2WY31_ORYSI/215-549-----------------IKRWSLATH--------------------------LVGKALVVMQR.QL..------------
A2YJD7_ORYSI/54-381-----------------IGTWIQRAE--------------------------LQMLQLFGKELVALID------------
Q6ES92_ORYSJ/191-595-----------------MERWIRALL--------------------------TMVQVLCITQL.ELRA------------
Q9SIB0_ARATH/209-553-----------------IRKWLRTTT--------------------------RAVNTLFSGEQ.ILSD------------
A5C6J8_VITVI/270-630-----------------IKKWIRAMK--------------------------IIVRVYLASEK.RLCD------------
Q9LQP9_ARATH/237-588-----------------IKIWVIVAR--------------------------VAITTLFNGER.ILSD------------
EXO70_CANAL/229-666-----------------GTNGITKYT--------------------------DVLSGEIEQEL.IILN------------
A5E7C7_LODEL/212-655-----------------MQFKYNKFT--------------------------EVVDQALHNEY.SVLK------------
EXO70_GIBZE/245-630-----------------GTNGMGTYA--------------------------QAMEGLFISEY.DNVC------------
EXO70_ASHGO/230-612-----------------GSSGFNSYT--------------------------EAFITFVSGVS.VLID------------
A2YJD9_ORYSI/318-664-----------------MTEWLHELR--------------------------YVCTIVLSAHK.QLMQ------------
A2XSN9_ORYSI/302-674-----------------MKKWVHGVK--------------------------TVVRSLLTGER.RICD------------
A6SNP3_BOTFB/246-636-----------------GTNGIGTYA--------------------------MGMEGAFLAEY.DNIC------------
Q6Z5V5_ORYSJ/162-505-----------------TIKWIYLLE--------------------------YIHKIVSVSLK.QIQE------------
Q0WPK8_ARATH/246-618-----------------IRRWIRAAK--------------------------ICVRVVFASEK.LLCE------------
A2DS47_TRIVA/251-594-----------------KEHPIHTFG--------------------------YLISFFFKREK.EFAK------------
Q9FY95_ARATH/272-641-----------------IASWISIVR--------------------------RCSTVLFPGEL.SLCN------------
Q9M3D4_ARATH/241-604-----------------IKNWIKAAK--------------------------IGIATLFRGEK.LLCD------------
A2YSN5_ORYSI/155-523-----------------IKRWIRALL--------------------------TMVQVLNITLL.ELPL------------
Q9FNR3_ARATH/272-623-----------------MRKWTKVVK--------------------------IITQVYLASEK.QLCD------------
A7TQI9_VANPO/236-622-----------------GSSGILGYT--------------------------EALLGFISNEQ.SLVD------------
EXO70_SCHPO/244-610-----------------GKEDVSINL--------------------------VALSRLLPAVA.SELL------------
A2YXE5_ORYSI/221-597-----------------IRRWSHAVR--------------------------AVVKTLLAGER.RLCD------------
Q4PDG8_USTMA/293-725-----------------GQAGAVELF--------------------------EAYYGMLDNDY.RILQ------------
A5BYE5_VITVI/322-667-----------------TALWIQHFE--------------------------LAVKTVLVSEK.KLCK------------
Q2QX89_ORYSJ/323-687-----------------IATWTKAFR--------------------------HTINVGLSTEH.DLCA------------
Q9SF50_ARATH/227-599-----------------MNRWIEAVK--------------------------VSMKTLFNGEK.TLCD------------
EXO70_CANGA/234-621-----------------GSSGFINYT--------------------------EAVLGFIANER.SLID------------
Q0U449_PHANO/246-624-----------------GTNGIGTYV--------------------------AAIEGIFVAEY.DNIT------------
Q6Z5U7_ORYSJ/196-558-----------------TTRWLHTLE--------------------------YVRCVAAVMHR.GGQA------------
Q5TQS7_ANOGA/314-704-----------------ELEKYLVLL--------------------------LGLQKLLVWER.QLLN------------
Q0WPV2_ARATH/303-668-----------------MKKWIQAVK--------------------------ITVRVLLVGEK.KICD------------
A8XF23_CAEBR/258-601-----------------DVDSCHVMC--------------------------SALLSLLELEE.KLMV------------
A3LWD2_PICST/217-612-----------------GSNGITSFT--------------------------TTFMNVIENEL.RLLK------------
EXO70_KLULA/233-617-----------------GSSGVNSYT--------------------------EAMLGFIANEN.SLIQ------------
Q9LMJ4_ARATH/246-593-----------------IDRWIKAVT--------------------------LIFHVFFPSER.LLCD------------
Q9C8H6_ARATH/253-624-----------------IDQWRLHME--------------------------IAVKEIYEFES.KLCY------------
A3BAD3_ORYSJ/211-560-----------------MEIWIQALR--------------------------VIIGTVLPEER.QACT------------
Q60EX4_ORYSJ/153-510-----------------VQRWTRGFT--------------------------VMAEALSATQR.HLQE------------
Q69JW6_ORYSJ/345-697-----------------VNAWVRAMR--------------------------ITLNVLTEMRR.QLHK------------
Q6YZW7_ORYSJ/295-656-----------------MALWGPHFH--------------------------VAISGVLAAER.WLCA------------
Q9LIA2_ARATH/265-644-----------------IKKWVRVMR--------------------------DIVQVYLLSEK.SLDN------------
Q8H150_ARATH/227-595-----------------IKTWLKAVK--------------------------LAVRKLFFGER.ILAD------------
A2WYH2_ORYSI/258-597-----------------IINIRGGHH--------------------------MAAASQWHMAQ.REID------------
B9FJQ2_ORYSJ/298-655-----------------IARWIPAFN--------------------------MVFRILIPSER.RLCD------------
A2YA16_ORYSI/142-483-----------------VRVWAQALS--------------------------TMDRVFRLRHR.....------------

PF15469

A4RXA7_OSTLU/41-217-----------------------------------------------------------RASTRMSAA------------
A6ZYC4_YEAS7/144-361-----------------------------------------------------------SIHLKQLVG------------
A7TRG2_VANPO/143-342-----------------------------------------------------------SDELKILVQ------------
A8IS87_CHLRE/340-518-----------------------------------------------------------TGQLKLLIR------------
A8PCF2_COPC7/122-323-----------------------------------------------------------SEALRVLVE------------
A8PUN7_MALGO/110-314-----------------------------------------------------------SEALKVLVD------------
A8QHB2_BRUMA/204-382-----------------------------------------------------------EKSSSDLHR------------
A8WPA7_CAEBR/200-378-----------------------------------------------------------AKRSEEMHK------------
A9RNH0_PHYPA/252-430-----------------------------------------------------------KENLMKLVK------------
A9S1F4_PHYPA/259-437-----------------------------------------------------------KEQLKKLVK------------
B0ET40_ENTDS/59-222-----------------------------------------------------------ETEIQTICN------------
B0W3D0_CULQU/193-383-----------------------------------------------------------KEGQLSFLK------------
B2RBE6_HUMAN/198-377-----------------------------------------------------------SEGSLAYVK------------
B3MVG4_DROAN/193-383-----------------------------------------------------------KEGQLSFLK------------
B6K5G3_SCHJY/147-340-----------------------------------------------------------SEMLVSLIN------------
B7PR09_IXOSC/148-326-----------------------------------------------------------QEGPSSFLK------------
B8ATQ6_ORYSI/262-452-----------------------------------------------------------TQQKKQLVK------------
B8BR17_THAPS/466-647-----------------------------------------------------------VERLQNLVR------------
B8P2C9_POSPM/114-312-----------------------------------------------------------SEAVRVLVE------------
C3XUC7_BRAFL/191-370-----------------------------------------------------------SEGPLAFMK------------
C4M2W7_ENTHI/111-299-----------------------------------------------------------NKEIMHLVE------------
C4R5S5_PICPG/139-344-----------------------------------------------------------NKDLQLQIE------------
C4YAI9_CLAL4/138-372-----------------------------------------------------------TSQLKSVLD------------
C5DMT2_LACTC/144-330-----------------------------------------------------------SEDLKQLVQ------------
C5DYM3_ZYGRC/146-354-----------------------------------------------------------SDELKDLVQ------------
C5MH42_CANTT/104-348-----------------------------------------------------------SENLRMAIE------------
D0MT24_PHYIT/66-241-----------------------------------------------------------TEQLKALVS------------
D5GNN2_TUBMM/147-347-----------------------------------------------------------SGSLKLLVE------------
D6W674_TRICA/193-371-----------------------------------------------------------KEGQLSFLK------------
D7KJZ0_ARALL/260-438-----------------------------------------------------------NLQRKQLVK------------
D8QDB4_SCHCM/114-323-----------------------------------------------------------SEAVRILVE------------
D8RD25_SELML/239-417-----------------------------------------------------------KQQLKLLVK------------
E0S9H6_ENCIT/50-261-----------------------------------------------------------KVRNKQLVK------------
E0VQL4_PEDHC/200-377-----------------------------------------------------------KEGQLSFLK------------
E2AW35_CAMFO/194-372-----------------------------------------------------------KEGQLSFLK------------
E3K655_PUCGT/121-321-----------------------------------------------------------SEALKILVE------------
E4XNP2_OIKDI/201-392-----------------------------------------------------------QSASMSHIK------------
E6QYJ0_CRYGW/114-305-----------------------------------------------------------SEAVRILVE------------
E6ZLD0_SPORE/109-315-----------------------------------------------------------SEALKVLVE------------
E7R2N5_PICAD/151-341-----------------------------------------------------------KPRLQRLIG------------
E9C1C0_CAPO3/243-420-----------------------------------------------------------GEAQNKWMK------------
E9G6B5_DAPPU/193-371-----------------------------------------------------------KEGQISFLK------------
F0W4R3_9STRA/41-214-----------------------------------------------------------THQLKTLVT------------
F0ZXN2_DICPU/132-311-----------------------------------------------------------ALEIKFLVK------------
F2UAY3_SALS5/207-386-----------------------------------------------------------DRNLKQLIN------------
F4PCT9_BATDJ/225-428-----------------------------------------------------------NEIIKGLVK------------
F4PGL2_DICFS/126-305-----------------------------------------------------------DLEIKYLVK------------
F4Q787_DICFS/187-364-----------------------------------------------------------NSDIEKICG------------
F4RSS6_MELLP/56-255-----------------------------------------------------------SEALKILVE------------
F6Q8U3_CIOIN/201-380-----------------------------------------------------------NNAPLNHVK------------
F6YQX0_XENTR/198-380-----------------------------------------------------------NEGNVAYVK------------
F8NGV0_SERL9/40-233-----------------------------------------------------------SEAIRVLVE------------
G0VBU0_NAUCC/150-340-----------------------------------------------------------SGDMKNLVE------------
G0WGP4_NAUDC/153-350-----------------------------------------------------------SNDLKSLVQ------------
G1XK06_ARTOA/190-398-----------------------------------------------------------SSALKLLVS------------
G3AUN6_SPAPN/128-368-----------------------------------------------------------TSELKRAID------------
G4TT08_PIRID/115-310-----------------------------------------------------------SEAVRILVE------------
G4VNQ3_SCHMA/214-394-----------------------------------------------------------PGEPVNVIR------------
G6D800_DANPL/194-372-----------------------------------------------------------KEGQLSFLK------------
G7DSD2_MIXOS/124-323-----------------------------------------------------------SEALRILVE------------
G7IVK4_MEDTR/51-227-----------------------------------------------------------TEQRKQLVK------------
G8BGG9_CANPC/145-407-----------------------------------------------------------TRDLQSSLD------------
G8BMU6_TETPH/145-338-----------------------------------------------------------SKELRMLIQ------------
G8JTD1_ERECY/120-302-----------------------------------------------------------SNHLKELVQ------------
G8XZB2_PICSO/148-394-----------------------------------------------------------TAQLKSVVN------------
G8ZXE8_TORDC/144-345-----------------------------------------------------------SEELKELVQ------------
H2AR86_KAZAF/151-365-----------------------------------------------------------EDNLKHLVQ------------
H2KP67_CLOSI/214-393-----------------------------------------------------------LDEPVNVIR------------
H2ZFP8_CIOSA/151-287-----------------------------------------------------------NNAPLNHVK------------
H3ERJ1_PRIPA/197-373-----------------------------------------------------------EKKSEEMHR------------
I0ZAT9_9CHLO/267-451-----------------------------------------------------------TGQLKALVK------------
I1GNJ4_BRADI/14-163-----------------------------------------------------------IVGMETSME------------
I1NBC3_SOYBN/28-188-----------------------------------------------------------DKNLFENME------------
SEC5_SCHPO/139-329-----------------------------------------------------------THQLLSLME------------
Q019K9_OSTTA/44-232-----------------------------------------------------------DSRRKMLAA------------
Q232N2_TETTS/349-532-----------------------------------------------------------LTLNKSLVY------------
Q6CGI4_YARLI/146-334-----------------------------------------------------------SSALQTLVD------------
Q6CQH1_KLULA/148-350-----------------------------------------------------------SYELKQLVQ------------
Q6FVL5_CANGA/149-372-----------------------------------------------------------AGDLQHLVQ------------
Q750U7_ASHGO/122-304-----------------------------------------------------------GNDLKNLVQ------------

PF04124

COG8_MOUSE/56-394------LRELSGSGLDRLRR...EPE------------------------RLAEERAQRLQQTRDLAF------------
COG8_SCHPO/15-354------VRDLTMKPYAELEK...RKA------------------------ELHAQKLKLVQKRQQLLR------------
COG8_YEAST/28-381------ILQSNTKDYESYFSSRAVPG------------------------SITEDIAEIDAELSALDR------------
COG8_CAEEL/10-353------GDDIRNMGLEEMRR...QKV------------------------LLASELKAIDAQISDLAF------------
Q9LYH5_ARATH/29-412------VSELLSFTLDRLHK...EPE------------------------LLRVDAERIQRQMQEVAV------------
COG8_DROME/37-379------LAKLGTCKVEQLKK...EQT------------------------RLAEEARTILEQTQDLAI------------
Q9P3N9_NEUCS/31-347------LTSLSSQPLTALET..TEPQ------------------------ALAQTSHGLLLSIQALSK------------

PF08700

COG5_MOUSE/37-120-----------------------------------------------------------------FLN------------
EXO84_CRYNJ/142-228-----------------------------------------------------------------LSN------------
Q6BJZ0_DEBHA/76-158-----------------------------------------------------------------IIN------------
Q0U0Z3_PHANO/76-170-----------------------------------------------------------------LDA------------
Q0WQ75_ARATH/43-129-----------------------------------------------------------------INS------------
Q5KJF4_CRYNJ/98-180-----------------------------------------------------------------EDW------------
Q173I8_AEDAE/5-87-----------------------------------------------------------------GNL------------
A2D783_TRIVA/6-88-----------------------------------------------------------------NVN------------
Q7Q6Z6_ANOGA/11-97-----------------------------------------------------------------MDG------------
Q2UQ54_ASPOR/108-197-----------------------------------------------------------------LDS------------
Q7S488_NEUCR/247-341-----------------------------------------------------------------LDS------------
VPS51_YEAST/84-163-----------------------------------------------------------------LKE------------
A2E266_TRIVA/29-115-----------------------------------------------------------------IDG------------
Q2U987_ASPOR/1-88-----------------------------------------------------------------MAL------------
Q6FRQ2_CANGA/66-146-----------------------------------------------------------------DSD------------
Q6CSC3_KLULA/100-179-----------------------------------------------------------------IRL------------
Q4SXW2_TETNG/10-92-----------------------------------------------------------------RVS------------
EXO84_GIBZE/128-214-----------------------------------------------------------------LRD------------
Q75HJ9_ORYSJ/40-126-----------------------------------------------------------------FKT------------
EXOC8_MOUSE/13-100-----------------------------------------------------------------LES------------
Q4P2N5_USTMA/76-162-----------------------------------------------------------------AID------------
Q4PEG0_USTMA/79-161-----------------------------------------------------------------FDP------------
Q8I2A9_PLAF7/116-202-----------------------------------------------------------------MNC------------
Q6CG64_YARLI/77-166-----------------------------------------------------------------FEA------------
Q4E335_TRYCC/3-85-----------------------------------------------------------------SEE------------
EXO84_YARLI/121-207-----------------------------------------------------------------LLK------------
Q4MZL9_THEPA/63-149-----------------------------------------------------------------FLS------------
COG1_SCHPO/7-89-----------------------------------------------------------------MSS------------
Q59L27_CANAL/17-99-----------------------------------------------------------------DTN------------
Q2UHE7_ASPOR/121-207-----------------------------------------------------------------LRD------------
Q7RZT4_NEUCR/9-91-----------------------------------------------------------------LST------------
Q8SWU0_DROME/4-91-----------------------------------------------------------------FDD------------
E9AC89_LEIMA/3-81-----------------------------------------------------------------MEE------------
A2GBI6_TRIVA/24-110-----------------------------------------------------------------IDS------------
Q4Y221_PLACH/14-100-----------------------------------------------------------------KKS------------
EXO84_ASHGO/127-213-----------------------------------------------------------------LSN------------
Q8LCN9_ARATH/18-103-----------------------------------------------------------------LSL------------
FFR_DICDI/178-264-----------------------------------------------------------------IDG------------
YEWA_SCHPO/52-138-----------------------------------------------------------------FSD------------
Q9FFF3_ARATH/21-103-----------------------------------------------------------------NGG------------
Q4P6W6_USTMA/184-270-----------------------------------------------------------------LSQ------------
Q1WMT0_COPDI/48-130-----------------------------------------------------------------FGF------------
COG1_DICDI/113-195-----------------------------------------------------------------TKQ------------
A2FRD0_TRIVA/32-118-----------------------------------------------------------------INS------------
A0C9R8_PARTE/6-92-----------------------------------------------------------------IDS------------
Q00XX6_OSTTA/568-650-----------------------------------------------------------------WGK------------
EXO84_CANGA/190-276-----------------------------------------------------------------LSD------------
Q754G8_ASHGO/53-137-----------------------------------------------------------------AEG------------
FFR_CHICK/57-143-----------------------------------------------------------------ING------------
Q55VT5_CRYNB/54-140-----------------------------------------------------------------IDS------------
Q95Q35_CAEEL/9-99-----------------------------------------------------------------FQT------------
Q6C0N6_YARLI/24-102-----------------------------------------------------------------MAL------------
Q5DTY3_MOUSE/20-102-----------------------------------------------------------------KRL------------
Q5CPU5_CRYPI/48-125-----------------------------------------------------------------FSQ------------
Q4DYG1_TRYCC/45-131-----------------------------------------------------------------LDS------------
Q5ZAZ1_ORYSJ/7-89-----------------------------------------------------------------SGG------------

PF06148

Q0TYI9_PHANO/26-159----------------------------------------------------------APLQRNDFLA............
Q29BE0_DROPS/22-154----------------------------------------------------------LCFDKNEFMK............
Q7QFV1_ANOGA/25-157----------------------------------------------------------LCFDKNEFMK............
Q84LH7_ORYSJ/24-156----------------------------------------------------------PWFKPDSFLR............
Q9ASS9_ARATH/31-163----------------------------------------------------------LWFKPSLFLS............
Q01CT5_OSTTA/52-184----------------------------------------------------------TWFDPRAFEG............
Q5K8I4_CRYNJ/34-165----------------------------------------------------------LSHDHPLLTA............
Q4P841_USTMA/85-240----------------------------------------------------------LTPLSHDLTLLSP.........
A1C4Y0_ASPCL/32-165----------------------------------------------------------EPLSRSSFLA............
Q2UA29_ASPOR/27-160----------------------------------------------------------EPLSRSSFLA............
COG2_HUMAN/15-147----------------------------------------------------------LCFDKDEFMK............
Q0C728_AEDAE/17-149----------------------------------------------------------LCFDKNEFMK............
Q5BZC0_SCHJA/41-174----------------------------------------------------------FCFDRELFLN............
A8WN13_CAEBR/23-155----------------------------------------------------------LCFNKTHFNR............
Q383M1_TRYB2/46-232----------------------------------------------------------LCFGEHEFGVVLDSDNTTEHDT
Q4DNE3_TRYCC/72-246----------------------------------------------------------LCFGEHEFGVALDKDVTDERDE
Q4Q0F6_LEIMA/80-262----------------------------------------------------------LCFAEHEFGIIVDENNPTDSRS
A0CKT7_PARTE/12-141----------------------------------------------------------SEFDVREFIL............
COG2_DICDI/53-185----------------------------------------------------------LCFSKDVFTS............

PF10392

COG5_HUMAN/66-189---------------------------------------------------------------SDFLN------------
Q6BT79_DEBHA/15-147---------------------------------------------------------------EAFLE------------
Q5B379_EMENI/829-961---------------------------------------------------------------EAFLD------------
Q5APN5_CANAL/17-149---------------------------------------------------------------EAFLE------------
COG5_SCHPO/8-139---------------------------------------------------------------SDYKK------------
COG5_YEAST/14-146---------------------------------------------------------------ESLLE------------
Q9C9V9_ARATH/57-180---------------------------------------------------------------SPFLS------------
Q0U7T7_PHANO/13-145---------------------------------------------------------------EAFLD------------
Q2HI55_CHAGB/25-157---------------------------------------------------------------EAFLD------------
Q5KKM0_CRYNJ/10-154---------------------------------------------------------------KPFLS------------
Q6CLE2_KLULA/11-144---------------------------------------------------------------EDFLE------------
COG5_DICDI/63-186---------------------------------------------------------------NQFLG------------
Q6C2T6_YARLI/5-136---------------------------------------------------------------DQFLD------------
Q75B18_ASHGO/11-144---------------------------------------------------------------EVLLE------------
Q6FTM6_CANGA/9-140---------------------------------------------------------------EELID------------
Q65XH1_ORYSJ/52-175---------------------------------------------------------------SAFLS------------

PF04100

VPS53_CAEEL/29-391------------------------------------------------------------------KP------------
VPS53_HUMAN/39-453------------------------------------------------------------------RA------------
Q9VQY8_DROME/42-434------------------------------------------------------------------AP------------
Q9C6Q3_ARATH/1-444------------------------------------------------------------------MD------------
YDLF_SCHPO/16-394------------------------------------------------------------------NN------------
VPS53_YEAST/5-369------------------------------------------------------------------TV------------
Q9C6I3_ARATH/1-331------------------------------------------------------------------MD------------

PF10475

Q7QF78_ANOGA/99-388------------------------------------------------------------------LE------------
Q336V4_ORYSJ/131-419------------------------------------------------------------------VD------------
Q012F3_OSTTA/52-350------------------------------------------------------------------VA------------
Q54MU4_DICDI/72-370------------------------------------------------------------------LK------------
Q6JJ34_IPOTF/130-420------------------------------------------------------------------LD------------
CC132_CHICK/54-327------------------------------------------------------------------IN------------
Q16RR9_AEDAE/70-360------------------------------------------------------------------LE------------
A1ZAY8_DROME/75-362------------------------------------------------------------------LE------------
Q54NV0_DICDI/113-401------------------------------------------------------------------ID------------
Q8RXC2_ARATH/132-421------------------------------------------------------------------VE------------
Q18602_CAEEL/76-363------------------------------------------------------------------IN------------
A8XSD2_CAEBR/80-367------------------------------------------------------------------ID------------

PF04048

Q7PY10_ANOGA/23-144----------------------------------------------------------------LLVS------------
EXOC4_DROME/25-146----------------------------------------------------------------FLVN------------
EXOC4_HUMAN/23-144----------------------------------------------------------------LLIS------------
Q541W5_ARATH/15-151----------------------------------------------------------------YLRE------------
Q69PQ1_ORYSJ/22-158----------------------------------------------------------------YLKE------------
Q59NP0_CANAL/27-168----------------------------------------------------------------SLKE------------
A5E514_LODEL/26-167----------------------------------------------------------------DLKM------------
Q6BLA3_DEBHA/30-171----------------------------------------------------------------ELKE------------
A5DKL1_PICGU/29-170----------------------------------------------------------------ELKE------------
A3LUX9_PICST/29-170----------------------------------------------------------------ELKE------------
Q75B87_ASHGO/33-174----------------------------------------------------------------KLQN------------
Q6CNM5_KLULA/34-175----------------------------------------------------------------KLQA------------
A7TRV6_VANPO/35-176----------------------------------------------------------------NLDM------------
A6ZWU4_YEAS7/34-175----------------------------------------------------------------HLQN------------
Q6FWA6_CANGA/35-176----------------------------------------------------------------NLRD------------
Q6C3L8_YARLI/34-175----------------------------------------------------------------KIDE------------
Q4WUD2_ASPFU/134-275----------------------------------------------------------------AMED------------
Q0CDB2_ASPTN/131-272----------------------------------------------------------------ERCE------------
Q2U7S6_ASPOR/137-278----------------------------------------------------------------AVEE------------
SEC8_NEUCR/82-223----------------------------------------------------------------QIGN------------
SEC8_SCHPO/51-191----------------------------------------------------------------DLEN------------
Q4PBF9_USTMA/441-580----------------------------------------------------------------SINA------------

PF06248

Q7QA24_ANOGA/4-537M.........................------------------------EQIQLE.NVTFNVPEVLS------------
ZW10_DROPS/10-571LPE..................MFQSN------------------------GCASLE.DTKSTVSKVQT------------
ZW10_ARATH/1-584MPEIDALFESINVRDLLAGHDLNDPT------------------------TPLSAP.DLRLLINRLES------------
Q6ING5_XENLA/6-615L......................ANS------------------------GRLEKE.DLGTKISRLSR------------
A7SSG2_NEMVE/20-670L......................QKT------------------------GQLEQE.DFNKCATKMLK------------
A8XRG3_CAEBR/1-605M.........................------------------------.....P.SSEGSYRDLEK------------
Q4SPW6_TETNG/9-605L......................ASS------------------------GKLEKE.DLSGKISKMSR------------
ZW10_DROGR/1-567MAETQVL.........LETYQGQGNN------------------------NATNIE.ATKAAIKKMLV------------
ZW10_HUMAN/9-621L......................AHS------------------------GRLEKE.DLGTRISRLTR------------
Q16R15_AEDAE/1-545MATL................DETMEV------------------------EILKQDLDARKQISRIVS------------
Q803G9_DANRE/9-612L......................ASS------------------------GKLEKD.DLACKISKLSR------------
Q98TG8_CHICK/1-595M.........................------------------------..............SVSV------------

PF06046

Q4WPU5_ASPFU/183-757-------------------------------------------------------FQGLDSVIDWFDE------------
EX3L4_HUMAN/179-709-------------------------------------------------------AMDVCLLYDGLAA------------
EX3L1_DANRE/206-763-------------------------------------------------------FSGVGRLVDALAK------------
A3LNE6_PICST/180-819-------------------------------------------------------IDPIKRTIGNFQE------------
A4RYX1_OSTLU/92-690-------------------------------------------------------FERVDAAWTTFEG------------
A5DIA8_PICGU/180-832-------------------------------------------------------VLPLQEVVKNFDL------------
A5DY39_LODEL/293-930-------------------------------------------------------TIPTAKLIANFDA------------
A6RAW7_AJECN/390-965-------------------------------------------------------FQRLDSVIEWFDD------------
A7F9Q6_SCLS1/177-755-------------------------------------------------------FARLDDTIDWFDE------------
SEC6_SCHPO/159-721-------------------------------------------------------FSNLNTLSDNFDR------------
Q016Y9_OSTTA/124-721-------------------------------------------------------FERVDQARATFEA------------
TNAP2_HUMAN/122-651-------------------------------------------------------QSKVEALYELLRD------------
Q0TXU6_PHANO/187-762-------------------------------------------------------FTRLDDVVEWFDK------------
EX3L1_BOVIN/188-722-------------------------------------------------------FEGLGPLAEALGQ------------
Q16I77_AEDAE/179-730-------------------------------------------------------FEKVETVSATLEK------------
Q28ZN5_DROPS/179-731-------------------------------------------------------FEKVDTVSQALEK------------
Q3SE84_PARTE/186-671-------------------------------------------------------FKCLSEFENKFYD------------
TNAP2_MOUSE/157-688-------------------------------------------------------QSKVEALYVLLCD------------
Q4P8D1_USTMA/258-828-------------------------------------------------------FAPLDGLIRAFDD------------
Q4RJ08_TETNG/178-739-------------------------------------------------------FEDVQGLSDELAK------------
EXOC3_DICDI/183-774-------------------------------------------------------FSSVPELSHRFEN------------
Q5A7K3_CANAL/180-812-------------------------------------------------------VSPIKTTIKLFDE------------
Q5BBU2_EMENI/183-758-------------------------------------------------------FQGLDAVIDWFDD------------
Q5K9B3_CRYNJ/179-740-------------------------------------------------------FEKVDKVAADFEA------------
Q5RG40_DANRE/163-694-------------------------------------------------------..KLLRDSEIFRE------------
Q69YP2_HUMAN/105-661-------------------------------------------------------FGSTQGLSDELAK------------
Q6BJB6_DEBHA/180-833-------------------------------------------------------VLPVKKTIKKFDD------------
Q6C9T6_YARLI/183-804-------------------------------------------------------FAPLDPLIAKFDR------------
Q6CU40_KLULA/178-794-------------------------------------------------------FQRVPGCIEKFNK------------
EX3L4_MOUSE/181-708-------------------------------------------------------AMDLCLHYDGMAA------------
Q6DJR6_XENTR/177-732-------------------------------------------------------FGKVHPLSEELAK------------
Q6FPK2_CANGA/177-798-------------------------------------------------------FSKVSGLVDKFDQ------------
E9P8I5_YEASX/178-798-------------------------------------------------------FSRLSGIISKFDK------------
Q873E6_NEUCS/175-753-------------------------------------------------------FSRLDKYIEWFDV------------
EX3L1_MOUSE/189-722-------------------------------------------------------FQGLGLLAEALGQ------------
Q8NAC4_HUMAN/132-655-------------------------------------------------------FQGLDLLFEALGQ------------
Q8SU74_ENCCU/160-687-------------------------------------------------------LNTIEKNSLDFTA------------
Q9M9G4_ARATH/172-724-------------------------------------------------------FEDVDRTWETFEK------------

PF04091

Q4WDM8_ASPFU/443-722----------------------------------------------------------------EYDK------------
EXOC6_ARATH/442-755----------------------------------------------------------------DYEN------------
Q753S5_ASHGO/493-835----------------------------------------------------------------FYEK------------
Q6BHQ3_DEBHA/493-827----------------------------------------------------------------DYEN------------
A5DMM0_PICGU/481-812----------------------------------------------------------------DYEN------------
A8XM86_CAEBR/483-791----------------------------------------------------------------EFRA------------
Q6CYE5_KLULA/488-829----------------------------------------------------------------LYEK------------
Q8S5T3_ORYSJ/441-754----------------------------------------------------------------EYNM------------
EXOC6_DROME/427-731----------------------------------------------------------------EYEC------------
Q17EP0_AEDAE/418-723----------------------------------------------------------------EYDA------------
EXOC6_RAT/455-763----------------------------------------------------------------EYKM------------
A7TQS9_VANPO/505-846----------------------------------------------------------------LYEK------------
Q6C1W0_YARLI/479-794----------------------------------------------------------------RYEK------------
Q560L3_CRYNB/479-787----------------------------------------------------------------EFDQ------------
A6RZT9_BOTFB/417-719----------------------------------------------------------------DFDK------------
A3LS60_PICST/479-812----------------------------------------------------------------DYEN------------
SEC15_SCHPO/435-740----------------------------------------------------------------EYDH------------
Q7RYL2_NEUCR/450-733----------------------------------------------------------------EYEK------------
Q0CL01_ASPTN/446-728----------------------------------------------------------------EFDK------------
A7E4G0_SCLS1/408-698----------------------------------------------------------------TLDA------------
O81298_ARATH/430-736----------------------------------------------------------------EYSM------------
Q0UFZ1_PHANO/442-734----------------------------------------------------------------EYDK------------
A6R9C0_AJECN/443-746----------------------------------------------------------------EYDK------------
Q4P319_USTMA/445-765----------------------------------------------------------------ELQK------------
Q7XEN0_ORYSJ/441-754----------------------------------------------------------------EYHM------------
A5BA73_VITVI/441-754----------------------------------------------------------------DYTM------------
SEC15_YEAST/520-865----------------------------------------------------------------LYEK------------
Q4SZ84_TETNG/313-614----------------------------------------------------------------EYKY------------
Q6FRK2_CANGA/500-842----------------------------------------------------------------FYEK------------
A5E457_LODEL/495-827----------------------------------------------------------------DYDT------------
EXOC6_DICDI/691-995----------------------------------------------------------------EDDK------------

PF09763

Q75AA6_ASHGO/631-1297------------------------------------YK.AKTVQECDRMDPTLSLFTMELSSISKDIEYVERQ-SNGLQV
A5DBH0_PICGU/582-1282------------------------------------DM.TDSLNELSNLSTVFKRAELGFKFLSHEINSIEND-SKGLQV
A3GH85_PICST/625-1329------------------------------------DV.GTSINEVENLSHIFKKMEIDFKFLSSEVDTIENN-SQGLQV
Q6FRC5_CANGA/652-1329------------------------------------YE.TNVNKACDNINPTFSLFLMEMSNCSEDIDYVESQ-NNGLQI
A6QQU0_BOVIN/176-464------------------------------------LL.DEALKEVDQIELKLSSYEEMLQSVKEQMDQISES-NHLIHL
Q2UK85_ASPOR/702-1427------------------------------------LI.DKTIEECEELDNLLTLYSHELNTLHDDVSYIETQ-SQGLQV
A7TSV5_VANPO/776-1455------------------------------------YE.QNVSKECEKINPTFSLFLMEMNNLLDDIEYVERQ-NNGLQV
Q6CQX3_KLULA/540-1218------------------------------------YK.DLVFKECDKLDPTLSLFTMELSSVSNDIEFVESQ-QNGLQV
Q57ZX4_TRYB2/198-1064------------------------------------HI.SSIMEDVGEMEARIAQYSKCILSQKEQLQRIEHQ-HNTLQR
EXOC1_DROME/186-866------------------------------------HI.DNAISEADKFENRLDSYEDILGHVKETMEKIGGK-NAMIEI
A7E4X8_SCLS1/708-1443------------------------------------GL.DTCMDECDELDGLLTLYLVELGTLNEDIAYIEAQ-SQGLQV
Q4RKW7_TETNG/106-846------------------------------------LL.DEALAEVDTIEGKLSSYEEMLQSVKDQMDQISQS-NHLIQI
Q6C0U5_YARLI/751-1484------------------------------------DL.DQAIAQCDELDAILTFFSVELGGLGSDIDYIESQ-GHGLQV
Q2GRZ6_CHAGB/575-1334------------------------------------GI.DLSISECDELDNLLTLYSVELSTLSDDIAYIEAQ-GHGLQV
Q5K9I2_CRYNJ/475-1177------------------------------------HI.DEALMELDDIDLQITGYRMQLNAVSDDISYIESQ-GKGLQV
Q7T2A6_DANRE/169-869------------------------------------LL.DQALAEVDTIEGKLLSYEEMLQSVKEQMDQISQS-NRLIQI
A7RVQ5_NEMVE/151-846------------------------------------LL.EAALVELDKLDTRLTHYDDKLRTVREHMEQMEDK-DRHMET
Q5TMX8_ANOGA/189-872------------------------------------RI.EEAIKEAEKVEKRLDDYDEILCHVRDTMEKMGEK-NQMIEI
Q10GJ4_ORYSJ/212-854------------------------------------GL.DAASATVDDMDEWLRIFNMKLRHMREDIASIESR-NNGLEM
Q4PFK6_USTMA/462-1173------------------------------------HM.EEALADLDMMDSMIAGFKVQLNARADDISHIESQ-NRGLQV
A6ZQV5_YEAS7/640-1316------------------------------------YE.DKVNDECHRIIPTLSLFLMEMSNFSNDIENVESQ-DNGLQV
Q7S5W6_NEUCR/694-1488------------------------------------GI.DVALAECDELDNLLTLYSVELSTLSDDIAYIEAQ-GQGLQV
A5E4P0_LODEL/994-1796------------------------------------DV.ETASGEIDNMLRVFQRMDYNLKTLTNDVNAIDEK-SKGLQL
EXOC1_DICDI/95-855------------------------------------QLGDKDGTHLTGVTAWIEYYNKQLQDMKKYIEHIEGK-NNKMEI

PF04129

VPS52_YEAST/47-607------------------------------------NE-AAINIIIPQLIDYLTEFTNRLSNYTQDLDFIKKK-SNELQS
VPS52_SCHPO/1-508------------------------------------KL-DSLKSVLNDVLSSLERFQVDLDVATSDIYKVSER-SNKIQV
Q9VMQ8_DROME/42-546------------------------------------QI-NDCDDVLERMENMLMSFQSVLNNISTEITQLQRK-SVSMSL
Q9FVV3_ARATH/83-615------------------------------------QI-RDCDSILSQMETLLSGFQEEIGSISSDIKILQEK-SMDMGL
VPS52_RAT/94-601------------------------------------QI-TACDAVLERMEQMLGAFQSDLSSISCEIRTLQEQ-SGAMNI

PF15278

B6K1Q5_SCHJY/526-611------------------------------------IL-NDSIAGCDTLFSTLNLYSMSLSGVLGDVINMEQQ-Q-----
YD6C_SCHPO/520-605------------------------------------QL-QDCALGCESINSTINLFSLELSTALNGVINIEQQ-P-----

PF06419

COG6_CRYNJ/69-690------------------------------------HM-QEMQVRCDQVQSELDQANSGTKFLLERADVLRSQ.RDSAQL
COG6_EMENI/58-693------------------------------------VI-SSLKETCDEMRKHIVLAKQDTTPVLEEASALMIQ.KQEAET
COG6_ASPFU/55-708------------------------------------VI-SSLNQTCEEMRQHIVRAKQDTAPVIEEASALMNQ.KKESET
COG6_PICGU/131-737------------------------------------NV-DALRSASMGVVDSVNNDFESSEIFNSKMENLHRK.KTAVVV
COG6_DEBHA/132-759------------------------------------DL-KNLNGLRDSITEKVNKDFQSTKDLNGEVKNLNDT.KSLINL
COG6_HUMAN/55-656------------------------------------DV-QAMSNCCQDMTSRLQAAKEQTQDLIVKTTKLQSE.SQKLEI
COG6_CANGA/175-819------------------------------------PV-QQIENIGEEIL..KNDKETFSQKYISDIDDCRNH.LLKLEI
Q6C1G5_YARLI/25-595------------------------------------TI-ADLNHKFTLMQQLVNTCKNDTRHVVSEGSELMAQ.QENISK
COG6_ASPNC/57-685------------------------------------VI-TNLNQTCDEMRKHIVSARQETTPVLEEASALMKQ.RKEAET
COG6_YEAST/181-824------------------------------------SV-EKIQRTSEKLLSNETNEVPTNNVVLQEIDQYRLK.AEQLKL
COG6_PHANO/54-693------------------------------------AI-SSLNSYCADMRSHIAAANKETGPVLEEATGLINQ.RKQVES
COG6_ASPOR/121-774------------------------------------VI-TSLNQTCDEMRKHISLARQDTAPVLEEASTLMNQ.KKEAET
COG6_CHAGB/46-689------------------------------------TI-GRLNETFNEMKTQIGSAQKTTSSTLIEASQLMIQ.RRQVEQ
COG6_COCIM/32-673------------------------------------AI-SHLNTICEDMRQHITSARQETEPVLEEAAALLSQ.KQEVET
COG6_SCHPO/43-650------------------------------------QL-LKVKNSIDSYKNEWSKKTNDAQILLNSYETFCEE.EALIEE
Q17KR7_AEDAE/31-620------------------------------------DI-AAIGQSVEGMKAQLSNTEAQQKELIQQANTLQEE.NNKLLL
COG6_ASHGO/158-791------------------------------------PV-KNIQEISEKVLDA.QEAQNKSPLQDPLVSEVREK.LEMLKL
COG6_PICST/153-782------------------------------------RL-SKLNDLNKVTNDNIENKFKYSSEFNTKVKELNSE.KRLINL
Q7QJN1_ANOGA/31-623------------------------------------DI-NSMSQSVDSMKSQLRNTEAQTKDLILQANTLQEE.NAKLQI
A7SZM3_NEMVE/34-607------------------------------------DV-HDMNKCCEDMTKRLQN....TRDLIRSTGFMGVKISQKIQM
COG6_CANAL/144-758------------------------------------KL-NKLNELSVQTNDKINKNFDFSNKLNLEIKDLNDN.KRLIGL
COG6_MAGO7/53-703------------------------------------TL-EKLNNSYAEMKTQVTKAHECTSPVLQEASTLIAQ.KRQVEI
COG6_KLULA/138-763------------------------------------PL-ERINNAM.......QNFKDTTESIDFEFEHVKDR.LDQLKA
COG6_SCLS1/52-643------------------------------------..-..........................EASELMKQ.QEQMQA
COG6_DROME/34-627------------------------------------DL-DTMATSVETMKSDLETSKALTKDLIKQTNTMQRE.RDRLEV
COG6_CAEEL/37-623------------------------------------LC-VKMNSTCTNLSKQMETVKFKSVDLVQKTASLKEK.KASIES
COG6_ASPTN/56-707------------------------------------VI-SSLNQTCEEMKKHIVLAKQDTTPVLEEAASLMNQ.KREAET
COG6_NEUCR/63-712------------------------------------TI-GKLNESYNDMRTQIHAAHASTASTLGEASQLMTQ.KRQIES
Q00T18_OSTTA/85-728------------------------------------TL-AALDGARERMQRALDGSKQKTSALLREAERASED.LRSIES

PF03081

Q5Z4V4_ORYSJ/278-638------------------------------------AV-................FERR..PEA.....ASSC-FAEIAS
EXOC7_DICDI/436-836------------------------------------EL-................FGNQ..........YQLI-LDEII.
EXO70_DEBHA/215-612------------------------------------EV-GAK.........INLNASAK..DMF.....VLDI-VRKVV.
A5DE46_PICGU/207-601------------------------------------EI-................NQNI..AIDHH.KIVSSI-VARVV.
A2QCL9_ASPNC/266-651------------------------------------RV-................FTGD..Q.......RGLA-LQATC.
Q5KMS6_CRYNJ/297-673------------------------------------SL-................FPNH..PPQTILTQTLAS-PITLA.
Q9SF51_ARATH/232-603------------------------------------HV-................FESS..DAI.....RESC-FSDIS.
Q5QLT4_ORYSJ/188-532------------------------------------SI-................FEGF..TSY.....SDVA-FVTAC.
Q7XPT9_ORYSJ/273-640------------------------------------QV-................FEGK..YTW.....KDHC-FAEVT.
EXO70_YARLI/227-601------------------------------------CA-................FPKD..EAR.....VKQY-FTQLA.
Q9LZD3_ARATH/267-627------------------------------------QI-................FRGF..DSL.....SDQC-FAEVT.
Q5ZIN3_CHICK/309-677------------------------------------EI-................VPEH..H.......QKKT-FDSLI.
A2WY31_ORYSI/215-549------------------------------------..-................YTHN..SPGAFDALKDEY-FLAIT.
A2YJD7_ORYSI/54-381------------------------------------RS-................IQE...........INRE-HGQARG
Q6ES92_ORYSJ/191-595------------------------------------KK-PTVAGVRRAIQFFLLRRDSK..TAHADYVQQVVQ-FARFA.
Q9SIB0_ARATH/209-553------------------------------------HV-................FSSS..SST....IRESA-FAEIT.
A5C6J8_VITVI/270-630------------------------------------HI-................LGDF..GSI.....NPIC-FVETS.
Q9LQP9_ARATH/237-588------------------------------------HI-................FSSS..V.......AESC-FVDIT.
EXO70_CANAL/229-666------------------------------------EC-.........................Q...LSTHL-IGPIV.
A5E7C7_LODEL/212-655------------------------------------QC-................L.............LSTL-FINPIL
EXO70_GIBZE/245-630------------------------------------SV-................FSRE..D.......WGVI-FLSTC.
EXO70_ASHGO/230-612------------------------------------DV-................FVKL..PDR.....RPAV-FCKIV.
A2YJD9_ORYSI/318-664------------------------------------WH-................LAVH..DSL.....ALDE-LSKAV.
A2XSN9_ORYSI/302-674------------------------------------QV-................LAVS..DEL.....RDEC-FVEST.
A6SNP3_BOTFB/246-636------------------------------------AL-................FTRD..E.......WGKV-FNLTC.
Q6Z5V5_ORYSJ/162-505------------------------------------QH-................DGAS..SGL.....TLEG-LSDAA.
Q0WPK8_ARATH/246-618------------------------------------HV-................FESVGAVNI.....HEAC-FMETV.
A2DS47_TRIVA/251-594------------------------------------KV-................FGDK..........YKSP-FQ....
Q9FY95_ARATH/272-641------------------------------------AV-................FPDQDHSSV.....RKRL-FTGLV.
Q9M3D4_ARATH/241-604------------------------------------HV-................FSAS..NST.....RESC-FYEIA.
A2YSN5_ORYSI/155-523------------------------------------PV-................AGST..ERMAA.AADHAQ-FTGFA.
Q9FNR3_ARATH/272-623------------------------------------QI-................LGDF..ESI.....STAC-FIEIS.
A7TQI9_VANPO/236-622------------------------------------DL-................YVQQ..PDF.....KPHI-LSSIV.
EXO70_SCHPO/244-610------------------------------------LL-................FDQV..T.......AKAL-YPKIV.
A2YXE5_ORYSI/221-597------------------------------------EV-................FASD..EEL.....GHEC-FADVA.
Q4PDG8_USTMA/293-725------------------------------------GL-................MTSA..ELDKQTLLLAST-FSQLA.
A5BYE5_VITVI/322-667------------------------------------QV-................LSGI..MEGL...IWTEC-FVKIA.
Q2QX89_ORYSJ/323-687------------------------------------RV-................FAGR.HAAV.....GRGM-FADLA.
Q9SF50_ARATH/227-599------------------------------------EI-................FESS..VSL.....REFC-FRDIS.
EXO70_CANGA/234-621------------------------------------DV-................FSQF..AEI.....KPRV-LRNIL.
Q0U449_PHANO/246-624------------------------------------NI-................FPRE..E.......WSSV-CEATC.
Q6Z5U7_ORYSJ/196-558------------------------------------RA-................................RA-LSAAA.
Q5TQS7_ANOGA/314-704------------------------------------DI-................VPPS..R.......HNEV-FSRLS.
Q0WPV2_ARATH/303-668------------------------------------EI-................FSSS..ESS.....KEVC-FNETT.
A8XF23_CAEBR/258-601------------------------------------RA-................IPDT..SK......RAQV-FRELV.
A3LWD2_PICST/217-612------------------------------------EL-.........................N..LPRSEV-VGPIV.
EXO70_KLULA/233-617------------------------------------DL-................YSKE..TSR.....QPVI-YAKLC.
Q9LMJ4_ARATH/246-593------------------------------------RV-................FSDLPVSSV.....TDLS-FMEVC.
Q9C8H6_ARATH/253-624------------------------------------DV-................FEDI..GED....VPLRC-FGEIAS
A3BAD3_ORYSJ/211-560------------------------------------QI-................FGSD..SKV.....EEDC-FARAT.
Q60EX4_ORYSJ/153-510------------------------------------EG-................RSTA..QVDR...DDDLR-LVRFV.
Q69JW6_ORYSJ/345-697------------------------------------QN-................FGAF..NSF.....KHDY-FMVIA.
Q6YZW7_ORYSJ/295-656------------------------------------RV-................LAPL..PPA....VWPEC-FAKIA.
Q9LIA2_ARATH/265-644------------------------------------QI-................FGDL..NEI.....GLTC-FVDTV.
Q8H150_ARATH/227-595------------------------------------HV-................FSSS..GLI.....VESS-FTEIT.
A2WYH2_ORYSI/258-597------------------------------------AM-..............................VKEI-HSKAGR
B9FJQ2_ORYSJ/298-655------------------------------------RV-................FDGL..APF.....GDLA-FVAAV.
A2YA16_ORYSI/142-483------------------------------------..-................EARN..PANEAAAAQLAA-LGELA.

PF15469

A4RXA7_OSTLU/41-217------------------------------------EE------------------------------------LPTVLA
A6ZYC4_YEAS7/144-361------------------------------------KN------------------------------------FTKYVK
A7TRG2_VANPO/143-342------------------------------------DN------------------------------------FTKYVK
A8IS87_CHLRE/340-518------------------------------------NN------------------------------------FDRFIN
A8PCF2_COPC7/122-323------------------------------------DN------------------------------------FDRFVA
A8PUN7_MALGO/110-314------------------------------------QN------------------------------------FDRFVT
A8QHB2_BRUMA/204-382------------------------------------AN------------------------------------LYSLIN
A8WPA7_CAEBR/200-378------------------------------------AN------------------------------------LYSLIN
A9RNH0_PHYPA/252-430------------------------------------EN------------------------------------FDCFIS
A9S1F4_PHYPA/259-437------------------------------------EN------------------------------------FDCFIS
B0ET40_ENTDS/59-222------------------------------------DQ------------------------------------FQKFIG
B0W3D0_CULQU/193-383------------------------------------SN------------------------------------AGSVMD
B2RBE6_HUMAN/198-377------------------------------------GG------------------------------------LSTFFE
B3MVG4_DROAN/193-383------------------------------------SN------------------------------------AGSVID
B6K5G3_SCHJY/147-340------------------------------------TR------------------------------------FHAFVA
B7PR09_IXOSC/148-326------------------------------------SN------------------------------------VNAIVI
B8ATQ6_ORYSI/262-452------------------------------------EN------------------------------------FDCFVS
B8BR17_THAPS/466-647------------------------------------DN------------------------------------FALFIK
B8P2C9_POSPM/114-312------------------------------------EN------------------------------------FNRFVA
C3XUC7_BRAFL/191-370------------------------------------GN------------------------------------LTSIMD
C4M2W7_ENTHI/111-299------------------------------------SH------------------------------------FDQFIN
C4R5S5_PICPG/139-344------------------------------------SE------------------------------------FLVYIK
C4YAI9_CLAL4/138-372------------------------------------EN------------------------------------FEHFVS
C5DMT2_LACTC/144-330------------------------------------RN------------------------------------FVKYVR
C5DYM3_ZYGRC/146-354------------------------------------TN------------------------------------FTKYVR
C5MH42_CANTT/104-348------------------------------------SN------------------------------------FIHFIN
D0MT24_PHYIT/66-241------------------------------------AH------------------------------------FDQYLS
D5GNN2_TUBMM/147-347------------------------------------SN------------------------------------FDRFVA
D6W674_TRICA/193-371------------------------------------AN------------------------------------IGSVMD
D7KJZ0_ARALL/260-438------------------------------------DN------------------------------------FDCFVS
D8QDB4_SCHCM/114-323------------------------------------DN------------------------------------FDRFVA
D8RD25_SELML/239-417------------------------------------EN------------------------------------FECFVS
E0S9H6_ENCIT/50-261------------------------------------QH------------------------------------FGKFVQ
E0VQL4_PEDHC/200-377------------------------------------SN------------------------------------VGSVID
E2AW35_CAMFO/194-372------------------------------------AN------------------------------------VGAVME
E3K655_PUCGT/121-321------------------------------------SE------------------------------------FDRFVA
E4XNP2_OIKDI/201-392------------------------------------DS------------------------------------LPIFFE
E6QYJ0_CRYGW/114-305------------------------------------DN------------------------------------FDRFVA
E6ZLD0_SPORE/109-315------------------------------------DN------------------------------------FDRFVA
E7R2N5_PICAD/151-341------------------------------------EN------------------------------------FQKAID
E9C1C0_CAPO3/243-420------------------------------------HN------------------------------------FDDFIL
E9G6B5_DAPPU/193-371------------------------------------TH------------------------------------AGSVIE
F0W4R3_9STRA/41-214------------------------------------TH------------------------------------FDQYLA
F0ZXN2_DICPU/132-311------------------------------------EN------------------------------------FEHFVK
F2UAY3_SALS5/207-386------------------------------------VS------------------------------------SSTFVS
F4PCT9_BATDJ/225-428------------------------------------KH------------------------------------FAKFVS
F4PGL2_DICFS/126-305------------------------------------DN------------------------------------FEHFVK
F4Q787_DICFS/187-364------------------------------------DN------------------------------------HEGFIN
F4RSS6_MELLP/56-255------------------------------------SE------------------------------------FDRFVA
F6Q8U3_CIOIN/201-380------------------------------------DS------------------------------------LPVFFE
F6YQX0_XENTR/198-380------------------------------------GG------------------------------------LSTFFE
F8NGV0_SERL9/40-233------------------------------------DN------------------------------------FDRFVA
G0VBU0_NAUCC/150-340------------------------------------EN------------------------------------FTKYVR
G0WGP4_NAUDC/153-350------------------------------------LN------------------------------------FTKYVK
G1XK06_ARTOA/190-398------------------------------------NN------------------------------------FERFVL
G3AUN6_SPAPN/128-368------------------------------------DN------------------------------------FLKVIN
G4TT08_PIRID/115-310------------------------------------EN------------------------------------FDRFVA
G4VNQ3_SCHMA/214-394------------------------------------TN------------------------------------LVLIFR
G6D800_DANPL/194-372------------------------------------AN------------------------------------TGAVMD
G7DSD2_MIXOS/124-323------------------------------------EE------------------------------------FDRFVS
G7IVK4_MEDTR/51-227------------------------------------DH------------------------------------FNCFVS
G8BGG9_CANPC/145-407------------------------------------AN------------------------------------ITHALN
G8BMU6_TETPH/145-338------------------------------------DN------------------------------------FTKYVK
G8JTD1_ERECY/120-302------------------------------------KN------------------------------------FVRYVR
G8XZB2_PICSO/148-394------------------------------------EN------------------------------------FSGFVG
G8ZXE8_TORDC/144-345------------------------------------TN------------------------------------FTRYVR
H2AR86_KAZAF/151-365------------------------------------SN------------------------------------FTKYVK
H2KP67_CLOSI/214-393------------------------------------TN------------------------------------LLLIFR
H2ZFP8_CIOSA/151-287------------------------------------DS------------------------------------LPVFFE
H3ERJ1_PRIPA/197-373------------------------------------AH------------------------------------LYSLIN
I0ZAT9_9CHLO/267-451------------------------------------EN------------------------------------FDHFIS
I1GNJ4_BRADI/14-163------------------------------------QL------------------------------------LAKITS
I1NBC3_SOYBN/28-188------------------------------------QF------------------------------------LEKIT.
SEC5_SCHPO/139-329------------------------------------TN------------------------------------FNKFIA
Q019K9_OSTTA/44-232------------------------------------EC------------------------------------LPAYLA
Q232N2_TETTS/349-532------------------------------------YY------------------------------------LDQFLE
Q6CGI4_YARLI/146-334------------------------------------RN------------------------------------FDKFVK
Q6CQH1_KLULA/148-350------------------------------------TN------------------------------------FAKYVR
Q6FVL5_CANGA/149-372------------------------------------TN------------------------------------FTKYVK
Q750U7_ASHGO/122-304------------------------------------TN------------------------------------FVRYVR

PF04124

COG8_MOUSE/56-394------------------------------------AN------------------------------------YKTFIR
COG8_SCHPO/15-354------------------------------------DN------------------------------------YNVLVD
COG8_YEAST/28-381------------------------------------KI------------------------------------RKTLLD
COG8_CAEEL/10-353------------------------------------NN------------------------------------YGTYAD
Q9LYH5_ARATH/29-412------------------------------------GN------------------------------------YRAFIT
COG8_DROME/37-379------------------------------------SN------------------------------------YRTFIT
Q9P3N9_NEUCS/31-347------------------------------------KS------------------------------------HKQVIE

PF08700

COG5_MOUSE/37-120------------------------------------ED------------------------------------FDVKTY
EXO84_CRYNJ/142-228------------------------------------EK------------------------------------VDAQAY
Q6BJZ0_DEBHA/76-158------------------------------------ED------------------------------------TSIDDI
Q0U0Z3_PHANO/76-170------------------------------------AD------------------------------------FDAEAF
Q0WQ75_ARATH/43-129------------------------------------TS------------------------------------FDADQY
Q5KJF4_CRYNJ/98-180------------------------------------AD------------------------------------IEPDEV
Q173I8_AEDAE/5-87------------------------------------LN------------------------------------INVDKL
A2D783_TRIVA/6-88------------------------------------IN------------------------------------EDPRLL
Q7Q6Z6_ANOGA/11-97------------------------------------SS------------------------------------FDADRY
Q2UQ54_ASPOR/108-197------------------------------------PD------------------------------------FDAQRY
Q7S488_NEUCR/247-341------------------------------------PD------------------------------------FSAQPY
VPS51_YEAST/84-163------------------------------------GS------------------------------------EDAEEE
A2E266_TRIVA/29-115------------------------------------NA------------------------------------FEAEPY
Q2U987_ASPOR/1-88------------------------------------DG------------------------------------PDPQSL
Q6FRQ2_CANGA/66-146------------------------------------SQ------------------------------------PNVDRP
Q6CSC3_KLULA/100-179------------------------------------EL------------------------------------EKGDID
Q4SXW2_TETNG/10-92------------------------------------EI------------------------------------KDSAVL
EXO84_GIBZE/128-214------------------------------------PK------------------------------------LKPDRY
Q75HJ9_ORYSJ/40-126------------------------------------DN------------------------------------FDPDAY
EXOC8_MOUSE/13-100------------------------------------GG------------------------------------FEARLY
Q4P2N5_USTMA/76-162------------------------------------HS------------------------------------TLPKVD
Q4PEG0_USTMA/79-161------------------------------------FG------------------------------------TEPDTL
Q8I2A9_PLAF7/116-202------------------------------------SN------------------------------------FNVNNY
Q6CG64_YARLI/77-166------------------------------------GS------------------------------------FDAEEI
Q4E335_TRYCC/3-85------------------------------------AV------------------------------------QEVRRI
EXO84_YARLI/121-207------------------------------------ED------------------------------------LDAHTF
Q4MZL9_THEPA/63-149------------------------------------HS------------------------------------FDVEHH
COG1_SCHPO/7-89------------------------------------HS------------------------------------SNWKEI
Q59L27_CANAL/17-99------------------------------------LY------------------------------------SDVDEI
Q2UHE7_ASPOR/121-207------------------------------------PS------------------------------------LPVDRY
Q7RZT4_NEUCR/9-91------------------------------------LL------------------------------------SSAQIF
Q8SWU0_DROME/4-91------------------------------------FN------------------------------------FSVEKY
E9AC89_LEIMA/3-81------------------------------------AA------------------------------------QEVRRI
A2GBI6_TRIVA/24-110------------------------------------PN------------------------------------FNSDKY
Q4Y221_PLACH/14-100------------------------------------SE------------------------------------FNADIY
EXO84_ASHGO/127-213------------------------------------PQ------------------------------------FQAKRF
Q8LCN9_ARATH/18-103------------------------------------AS------------------------------------ATQQPY
FFR_DICDI/178-264------------------------------------PS------------------------------------FNLNSY
YEWA_SCHPO/52-138------------------------------------PN------------------------------------FDSNAY
Q9FFF3_ARATH/21-103------------------------------------GQ------------------------------------RDAESL
Q4P6W6_USTMA/184-270------------------------------------SD------------------------------------FDPQAY
Q1WMT0_COPDI/48-130------------------------------------DT------------------------------------PNPDDL
COG1_DICDI/113-195------------------------------------YE------------------------------------SDVKIL
A2FRD0_TRIVA/32-118------------------------------------SI------------------------------------FNAKLL
A0C9R8_PARTE/6-92------------------------------------SK------------------------------------FDCQKY
Q00XX6_OSTTA/568-650------------------------------------VR------------------------------------RNAEAL
EXO84_CANGA/190-276------------------------------------PQ------------------------------------FSAKKF
Q754G8_ASHGO/53-137------------------------------------GA------------------------------------GDMAVE
FFR_CHICK/57-143------------------------------------PH------------------------------------FDPEVF
Q55VT5_CRYNB/54-140------------------------------------PT------------------------------------FKPAAY
Q95Q35_CAEEL/9-99------------------------------------DA------------------------------------FSPSDY
Q6C0N6_YARLI/24-102------------------------------------GL------------------------------------SSWQST
Q5DTY3_MOUSE/20-102------------------------------------DL------------------------------------RDPNAL
Q5CPU5_CRYPI/48-125------------------------------------KD------------------------------------IDVDKI
Q4DYG1_TRYCC/45-131------------------------------------EF------------------------------------FNVSKY
Q5ZAZ1_ORYSJ/7-89------------------------------------GA------------------------------------ADAEEL

PF06148

Q0TYI9_PHANO/26-159....................................PD------------------------------------FSPSTY
Q29BE0_DROPS/22-154....................................EN------------------------------------FSVDEF
Q7QFV1_ANOGA/25-157....................................KT------------------------------------FSVDEF
Q84LH7_ORYSJ/24-156....................................PD------------------------------------FDPDAY
Q9ASS9_ARATH/31-163....................................PN------------------------------------FDSESY
Q01CT5_OSTTA/52-184....................................DD------------------------------------FDPWAY
Q5K8I4_CRYNJ/34-165....................................PT------------------------------------FDPDAF
Q4P841_USTMA/85-240.................................IHTPT------------------------------------FSVDDF
A1C4Y0_ASPCL/32-165....................................PN------------------------------------FDPAVY
Q2UA29_ASPOR/27-160....................................PD------------------------------------FDPAKY
COG2_HUMAN/15-147....................................ED------------------------------------FDVDHF
Q0C728_AEDAE/17-149....................................KT------------------------------------FSVDEF
Q5BZC0_SCHJA/41-174....................................DD------------------------------------FNSDDF
A8WN13_CAEBR/23-155....................................DD------------------------------------FNVERF
Q383M1_TRYB2/46-232EGECISAGANYVNASDDAEQMDFEHHNEPGETMLAAFE------------------------------------FDPVQF
Q4DNE3_TRYCC/72-246KHDGVG............SDLLRQRNKTHQNGVVIAFD------------------------------------FDPIQF
Q4Q0F6_LEIMA/80-262ISSSSDASSL....SSSFDSVNGHDGPQRRRGQRGLPA------------------------------------YDPLSF
A0CKT7_PARTE/12-141....................................KN------------------------------------FVQANF
COG2_DICDI/53-185....................................NT------------------------------------FEVDQF

PF10392

COG5_HUMAN/66-189------------------------------------ED------------------------------------FDVKTY
Q6BT79_DEBHA/15-147------------------------------------TS------------------------------------FQPLQF
Q5B379_EMENI/829-961------------------------------------PA------------------------------------FSPAAF
Q5APN5_CANAL/17-149------------------------------------TN------------------------------------FDPQQF
COG5_SCHPO/8-139------------------------------------SD------------------------------------FDPKAQ
COG5_YEAST/14-146------------------------------------PD------------------------------------FDAKQF
Q9C9V9_ARATH/57-180------------------------------------SS------------------------------------FSSASF
Q0U7T7_PHANO/13-145------------------------------------PD------------------------------------FSATSF
Q2HI55_CHAGB/25-157------------------------------------PS------------------------------------FTPSSF
Q5KKM0_CRYNJ/10-154------------------------------------DS------------------------------------FDVHSY
Q6CLE2_KLULA/11-144------------------------------------AD------------------------------------FQPLRF
COG5_DICDI/63-186------------------------------------ED------------------------------------FNVVHY
Q6C2T6_YARLI/5-136------------------------------------AE------------------------------------FDPVAY
Q75B18_ASHGO/11-144------------------------------------DN------------------------------------FNHSQF
Q6FTM6_CANGA/9-140------------------------------------PE------------------------------------FDSKSY
Q65XH1_ORYSJ/52-175------------------------------------PS------------------------------------FSPSDF

PF04100

VPS53_CAEEL/29-391--------------------------------------------------------------------------------
VPS53_HUMAN/39-453--------------------------------------------------------------------------------
Q9VQY8_DROME/42-434--------------------------------------------------------------------------------
Q9C6Q3_ARATH/1-444--------------------------------------------------------------------------------
YDLF_SCHPO/16-394--------------------------------------------------------------------------------
VPS53_YEAST/5-369--------------------------------------------------------------------------------
Q9C6I3_ARATH/1-331--------------------------------------------------------------------------------

PF10475

Q7QF78_ANOGA/99-388------------------------------------ST------------------------------------EAIYFD
Q336V4_ORYSJ/131-419------------------------------------EL------------------------------------EEVFFQ
Q012F3_OSTTA/52-350------------------------------------GV------------------------------------ERGYFD
Q54MU4_DICDI/72-370------------------------------------IT------------------------------------PAGFFD
Q6JJ34_IPOTF/130-420------------------------------------DL------------------------------------EEEFYE
CC132_CHICK/54-327------------------------------------SI------------------------------------EEVYFS
Q16RR9_AEDAE/70-360------------------------------------ST------------------------------------EAIYFD
A1ZAY8_DROME/75-362------------------------------------SI------------------------------------EQCYYN
Q54NV0_DICDI/113-401------------------------------------SL------------------------------------DEVYFK
Q8RXC2_ARATH/132-421------------------------------------EL------------------------------------EEGFYE
Q18602_CAEEL/76-363------------------------------------SI------------------------------------DAAYFI
A8XSD2_CAEBR/80-367------------------------------------SI------------------------------------DASYFI

PF04048

Q7PY10_ANOGA/23-144------------------------------------VI------------------------------------KTLDAS
EXOC4_DROME/25-146------------------------------------VI------------------------------------KSLGFS
EXOC4_HUMAN/23-144------------------------------------VI------------------------------------RTLSTS
Q541W5_ARATH/15-151------------------------------------EL------------------------------------ARIDES
Q69PQ1_ORYSJ/22-158------------------------------------GL------------------------------------SRIDEG
Q59NP0_CANAL/27-168------------------------------------VY------------------------------------NTIKYD
A5E514_LODEL/26-167------------------------------------IH------------------------------------NEIKYD
Q6BLA3_DEBHA/30-171------------------------------------VQ------------------------------------TTLRYE
A5DKL1_PICGU/29-170------------------------------------VT------------------------------------NYLKYE
A3LUX9_PICST/29-170------------------------------------VH------------------------------------NTIKYD
Q75B87_ASHGO/33-174------------------------------------DL------------------------------------SRIESS
Q6CNM5_KLULA/34-175------------------------------------DI------------------------------------ALLGTE
A7TRV6_VANPO/35-176------------------------------------DL------------------------------------AQVQSQ
A6ZWU4_YEAS7/34-175------------------------------------DL------------------------------------NRINLQ
Q6FWA6_CANGA/35-176------------------------------------DL------------------------------------SLVKSQ
Q6C3L8_YARLI/34-175------------------------------------LC------------------------------------RKVDYE
Q4WUD2_ASPFU/134-275------------------------------------IL------------------------------------QAIQRD
Q0CDB2_ASPTN/131-272------------------------------------VL------------------------------------QSVQRD
Q2U7S6_ASPOR/137-278------------------------------------VL------------------------------------QSIQQE
SEC8_NEUCR/82-223------------------------------------VL------------------------------------DLIKRE
SEC8_SCHPO/51-191------------------------------------LV------------------------------------NEIEDE
Q4PBF9_USTMA/441-580------------------------------------VL------------------------------------RKVQVE

PF06248

Q7QA24_ANOGA/4-537------------------------------------CI------------------------------------SKYQEH
ZW10_DROPS/10-571------------------------------------RT------------------------------------ERFQER
ZW10_ARATH/1-584------------------------------------HS------------------------------------LRIKSK
Q6ING5_XENLA/6-615------------------------------------RV------------------------------------DELKGE
A7SSG2_NEMVE/20-670------------------------------------KA------------------------------------EEVKAE
A8XRG3_CAEBR/1-605------------------------------------KL------------------------------------KDGLTS
Q4SPW6_TETNG/9-605------------------------------------KV------------------------------------EETKEE
ZW10_DROGR/1-567------------------------------------RI------------------------------------ERFQTR
ZW10_HUMAN/9-621------------------------------------RV------------------------------------EEIKGE
Q16R15_AEDAE/1-545------------------------------------KI------------------------------------KDYQDK
Q803G9_DANRE/9-612------------------------------------KV------------------------------------EETKEE
Q98TG8_CHICK/1-595------------------------------------TV------------------------------------ISPQGE

PF06046

Q4WPU5_ASPFU/183-757------------------------------------HL------------------------------------GTACMN
EX3L4_HUMAN/179-709------------------------------------EI------------------------------------GAIVRE
EX3L1_DANRE/206-763------------------------------------EL------------------------------------WAVVGS
A3LNE6_PICST/180-819------------------------------------LL------------------------------------GEAIIS
A4RYX1_OSTLU/92-690------------------------------------VL------------------------------------WNSVRQ
A5DIA8_PICGU/180-832------------------------------------LL------------------------------------AEIIYS
A5DY39_LODEL/293-930------------------------------------LL------------------------------------VEVINS
A6RAW7_AJECN/390-965------------------------------------HV------------------------------------GTAIMN
A7F9Q6_SCLS1/177-755------------------------------------NI------------------------------------GKVALN
SEC6_SCHPO/159-721------------------------------------LV------------------------------------LNFCRN
Q016Y9_OSTTA/124-721------------------------------------TL------------------------------------WNGVRQ
TNAP2_HUMAN/122-651------------------------------------QV------------------------------------LGVLRR
Q0TXU6_PHANO/187-762------------------------------------HI------------------------------------GETCIN
EX3L1_BOVIN/188-722------------------------------------AV------------------------------------EAAAGA
Q16I77_AEDAE/179-730------------------------------------KI------------------------------------RLILQR
Q28ZN5_DROPS/179-731------------------------------------KL------------------------------------RLILSR
Q3SE84_PARTE/186-671------------------------------------KI------------------------------------YEIFLT
TNAP2_MOUSE/157-688------------------------------------QV------------------------------------LGVLRR
Q4P8D1_USTMA/258-828------------------------------------YI------------------------------------MSLAER
Q4RJ08_TETNG/178-739------------------------------------QL------------------------------------WMVLQR
EXOC3_DICDI/183-774------------------------------------KI------------------------------------WNIVSN
Q5A7K3_CANAL/180-812------------------------------------LL------------------------------------NEGIQS
Q5BBU2_EMENI/183-758------------------------------------HL------------------------------------GTLCMN
Q5K9B3_CRYNJ/179-740------------------------------------WL------------------------------------WEIAGS
Q5RG40_DANRE/163-694------------------------------------RL------------------------------------KFAILD
Q69YP2_HUMAN/105-661------------------------------------QL------------------------------------WMVLQR
Q6BJB6_DEBHA/180-833------------------------------------LL------------------------------------GEIIIS
Q6C9T6_YARLI/183-804------------------------------------VV------------------------------------EDVGGN
Q6CU40_KLULA/178-794------------------------------------LL------------------------------------RDITYD
EX3L4_MOUSE/181-708------------------------------------EI------------------------------------GAIVRE
Q6DJR6_XENTR/177-732------------------------------------QL------------------------------------WMVIQR
Q6FPK2_CANGA/177-798------------------------------------LL------------------------------------ESLIYD
E9P8I5_YEASX/178-798------------------------------------LL------------------------------------DGLTYD
Q873E6_NEUCS/175-753------------------------------------NI------------------------------------TLVAMS
EX3L1_MOUSE/189-722------------------------------------AV------------------------------------EAAAGA
Q8NAC4_HUMAN/132-655------------------------------------AV------------------------------------EAAAGA
Q8SU74_ENCCU/160-687------------------------------------KV------------------------------------LEISEE
Q9M9G4_ARATH/172-724------------------------------------TL------------------------------------WGHVSN

PF04091

Q4WDM8_ASPFU/443-722------------------------------------.V------------------------------------LNVSWY
EXOC6_ARATH/442-755------------------------------------NV------------------------------------LSFNL.
Q753S5_ASHGO/493-835------------------------------------.V------------------------------------MKLCWM
Q6BHQ3_DEBHA/493-827------------------------------------.V------------------------------------MKICWY
A5DMM0_PICGU/481-812------------------------------------.V------------------------------------MKVCWY
A8XM86_CAEBR/483-791------------------------------------.V------------------------------------IRQFPF
Q6CYE5_KLULA/488-829------------------------------------.I------------------------------------LKICWL
Q8S5T3_ORYSJ/441-754------------------------------------NV------------------------------------TAFHF.
EXOC6_DROME/427-731------------------------------------.I------------------------------------IERFPF
Q17EP0_AEDAE/418-723------------------------------------.V------------------------------------LERFPF
EXOC6_RAT/455-763------------------------------------.V------------------------------------ISKFPF
A7TQS9_VANPO/505-846------------------------------------.V------------------------------------IKICWM
Q6C1W0_YARLI/479-794------------------------------------.I------------------------------------TRACWW
Q560L3_CRYNB/479-787------------------------------------.V------------------------------------AGVCWL
A6RZT9_BOTFB/417-719------------------------------------.I------------------------------------IQVSWY
A3LS60_PICST/479-812------------------------------------.I------------------------------------MRICWY
SEC15_SCHPO/435-740------------------------------------.Y------------------------------------IAPYWN
Q7RYL2_NEUCR/450-733------------------------------------.V------------------------------------LKVSWY
Q0CL01_ASPTN/446-728------------------------------------.V------------------------------------LNVSWY
A7E4G0_SCLS1/408-698------------------------------------YV------------------------------------LKLFYR
O81298_ARATH/430-736------------------------------------NV------------------------------------LSFQL.
Q0UFZ1_PHANO/442-734------------------------------------.V------------------------------------VTVSWY
A6R9C0_AJECN/443-746------------------------------------.V------------------------------------LNVSWY
Q4P319_USTMA/445-765------------------------------------.V------------------------------------LSVCWL
Q7XEN0_ORYSJ/441-754------------------------------------NV------------------------------------SAFQL.
A5BA73_VITVI/441-754------------------------------------NV------------------------------------LSFHL.
SEC15_YEAST/520-865------------------------------------.V------------------------------------LKICWM
Q4SZ84_TETNG/313-614------------------------------------.Y------------------------------------TSQFPL
Q6FRK2_CANGA/500-842------------------------------------.V------------------------------------IKICWM
A5E457_LODEL/495-827------------------------------------.I------------------------------------MKRIFY
EXOC6_DICDI/691-995------------------------------------.I------------------------------------SKR...

PF09763

Q75AA6_ASHGO/631-1297NCVNKKLLSKDLSGILDSVSLAESSLEELLN.LSLVE--KN.LDKI..ESLLLGLHKAIGAIKGGKK.............
A5DBH0_PICGU/582-1282KSINKKLLYNDLKGVLSKISINADDLRDIESFTQFDR--LNLLEPL..EEKLLDLHYALGAIRNDFEE............
A3GH85_PICST/625-1329KSINRKLLYNDLRGILSKVSVNSDDLRIIEGFTEFDR--LNKLENL..ELALLDLFNALSTIKHDPT.............
Q6FRC5_CANGA/652-1329ESANKKQLWSTLDNLLKIVSLDEETLNKLLN.CPIRE--KN.LPWI..EEQLDAMCKAYNAIEGAKN.............
A6QQU0_BOVIN/176-464SNTNNVKLLSEIEFLVNHMDLAKGHIKALQE.GDLSS--SRGIEAC..TNAADALLQCMNV...................
Q2UK85_ASPOR/702-1427QTANQKLLHNELQNLLKTLSISSVELRSLKE.ASLSN--PDGLRDT..ETALSTLYKAMLMIDSDI.LQNKRRLADAAGD
A7TSV5_VANPO/776-1455ESANKKLLWSLLTDLLNTVSLDENALNELLS.STISE--RS.LPRI..EIQLEGLFNAIKAIKGETK.............
Q6CQX3_KLULA/540-1218RVANRKLLWKELNEILNSVSIDEKSLHELLR.LPMSK--TS.IERM..EVLLVELYAALKAIDGSKDQF...........
Q57ZX4_TRYB2/198-1064KQQNLHKLQEQLQVVRGQLNLPPQVTALLQRVGEARS--EDLEEFLSNESNVRRLSDAVGLITSLLQN............
EXOC1_DROME/186-866ANNNNIKLMKELNKVISQLDLPHSQQQALDE.PDLKT--ANGRKAA..IAAAQCLQQAMNS...................
A7E4X8_SCLS1/708-1443QTANQKLLQAELQSLLDTISISSSQLESLKT.ASLER--PHDLELV..EKSLVVLFKAMVTIDPSLSISVPRRSEDGSVH
Q4RKW7_TETNG/106-846SNTNNGKLLDEIQFLVNYMDLSKGHIRALLE.GDLSS--PKGIEAC..INASEALLQCISV...................
Q6C0U5_YARLI/751-1484QTTNQKILWEELNSILDTMSVPQREMEIIRR.VRLDS--AQDVAYA..EAALVDLFAALASVRKMGSN............
Q2GRZ6_CHAGB/575-1334QAANQKLLRKELESLLETCAISESDLDALKM.APLET--AAGVEDI..EASLVTLFKAMIKIDPTLGNSESRKSE...DM
Q5K9I2_CRYNJ/475-1177QTSNQQVLLNELRQLLQIVEVPADDLHTLIK.EPPSS--EQGVKAL..ERAAASLYKALQA...................
Q7T2A6_DANRE/169-869SNTNNGKLLDEIQFLVNYMDLSKGHIKALQE.GDLSS--PKGIEAC..INASEALSQCMNV...................
A7RVQ5_NEMVE/151-846ESTNRQKLLKQVEFLVNTLDIPERHIIALQE.GDLSK--GLAVKEC..TNAAMAVLEALQA...................
Q5TMX8_ANOGA/189-872ANTNNVRLLLELEKVVTQLDLPHVHQLALTD.TDL.T--PKGLPAA..IAAGKALQMAMNS...................
Q10GJ4_ORYSJ/212-854QSVNNKGLVEELEKLLDRLRIPQEFAASLTG.GSFEE--SRMLKNV..E.ACEWLTGAIRSLEVP...............
Q4PFK6_USTMA/462-1173QTSNQRTLMAEIEMLINTINVDEDAIHSLTA.GRLES--PEGVAQL..EMAAASLYKSMLQARR................
A6ZQV5_YEAS7/640-1316ESANKKLLWNTLDELLKTVSLDEISLNQLLE.CPIRE--KN.LPWM..ENQLNLLLKAFQAIGSDGN.............
Q7S5W6_NEUCR/694-1488QAANQKLLKKELESLLATCAISESDLAALKV.APLET--ATGVEEI..ESALVALFKAMTKIDPAMGAIEGRRSE...DG
A5E4P0_LODEL/994-1796KFVNEKLLYNDLHEILSKVSINTSHLQEIGSFKEFSN--LNRIEDL..ENKLSSLYNAIVTINADDPQN...........
EXOC1_DICDI/95-855VSRNQKLLYSELNNLIGLMTLSDNTISTLTA.PQFND--TKGLKMA..IEAAEDLKRALTT...................

PF04129

VPS52_YEAST/47-607LLEYNSTKLAHISPMVNDLMIPPELIDDIIK-GKINESWQDNITFI---ADKEEIYNKYRSNNLDQD-------------
VPS52_SCHPO/1-508NLNNLKAVESALGAEIDGAILPPDLIKTIST-GDMDH......PSW---NSALEKLTSFLEGGEDDS-------------
Q9VMQ8_DROME/42-546QLTNRQSVKAQLSQFIEDMAVSEEMINIIME-TPVTE......RDF---STQLNVLNHKLSLVKELS-------------
Q9FVV3_ARATH/83-615RLKNRRVAESKLAKFVEDIIVPPKMIDVIVD-GEVNE......EYM---KTLEILSKKLKFVEADQA-------------
VPS52_RAT/94-601RLRNRQAVRGKLGELVDGLVVPSALVTAILE-APVTE......PRF---LEQLQELDAKAAAVREQE-------------

PF15278

B6K1Q5_SCHJY/526-611--------------------------------------------------------------------------------
YD6C_SCHPO/520-605--------------------------------------------------------------------------------

PF06419

COG6_CRYNJ/69-690RAHLITLFLSRFTLSNSELTALTSREV......TIGQ------PLFDALDHVEKIRTDCEVLL-----------------
COG6_EMENI/58-693KQRLLDAFTKHFIVSEEELLALTSIEE......PIDD------EFFDVLARVKQVHRDCEALL-----------------
COG6_ASPFU/55-708KQQLLDAFVKHFIVSEDDLLVLTSAEE......PIDD------RFFNVLDRVKQVHHDCEVLL-----------------
COG6_PICGU/131-737KKQLLSAFRAKFTLNEYEEYTLENG........DISD------EFFTVLAKAEQVDQNCSILL-----------------
COG6_DEBHA/132-759KKGLLISFQNKFALDVYEEYVLQNG........EIND------EFFQVLIKCEKIHENCSILL-----------------
COG6_HUMAN/55-656RAQVADAFLSKFQLTSDEMSLLRGTRE.....GPITE------DFFKALGRVKQIHNDVKVLL-----------------
COG6_CANGA/175-819KKKILKALQSKFTLNQLEDDLIENG........PLKE------EIFDIVDKLTKMKEHATYLL-----------------
Q6C1G5_YARLI/25-595KRDLLKRYTDAFVLTEREMDILKGNDE......VPFE------TFKQVFIKAQKIHKDSEILL-----------------
COG6_ASPNC/57-685KQELLEAFTQHFIVPDEDLLILTHAEE......PIDD------HFFEILARVKQVYRDCEALL-----------------
COG6_YEAST/181-824KKKILLSIRDRFTLNQVEDDVITNG........TIDN------IFFEVVKKVINIKDESSFLL-----------------
COG6_PHANO/54-693KQQILQAFNSHFLISDEEATVLTSTAE......PVNE------EFFQVLTRVKKIHHDCQVLL-----------------
COG6_ASPOR/121-774KQQLLDAFTKHFVVPDDDILVLTSLED......PIND------QFFEVLARVKQVHRDCEALL-----------------
COG6_CHAGB/46-689KQALLGAFNTNFVLSEDETAALTLTSE......PVDD------LFFAVLAKAKRISKDCEILL-----------------
COG6_COCIM/32-673KQHLLDAFNKHFVLSSDDISILTSTAE......PVDD------RFFQILSRQKRIHKDCEVLL-----------------
COG6_SCHPO/43-650KLKNIEIFEKNFVIMDDDLIHLTSST.......DVDD------RFYLILDKAQEIHDSSDSLF-----------------
Q17KR7_AEDAE/31-620QQRIASGFLSRFQLSVAEHQTLYGVTRD....DPITA------EFFNVLDHVQMIHSDCKTLL-----------------
COG6_ASHGO/158-791KKRVLVGIRESLTLNQLEDEQLRNG........EIED------SYLDVLDKMMEIKERSTYLI-----------------
COG6_PICST/153-782KKNLLINFKAKFTLNEYEEFVLDSG........DIND------EFFTVLKKAEEINANCSILL-----------------
Q7QJN1_ANOGA/31-623QQKIASGFLSRFQLSVAEHQMLYGAKRD....APITA------EFFQVLDRVQRIHTDCRTLM-----------------
A7SZM3_NEMVE/34-607MEKVADAFLSRFQLKQEEVEALRGARN.....TPVTE------EFFQALARVREIHQDCKALL-----------------
COG6_CANAL/144-758KKNLLISFKEKFTLNEYEEFVLNSG........DLNN------EFFTTLARAERINENCSILL-----------------
COG6_MAGO7/53-703KQRLLKSFSGHFLLPEDEVAILTLTSE......PVDD------RFFNVLAKARRIRKDCEILL-----------------
COG6_KLULA/138-763RRQVIIKLRDSLTLTQLELDHLQNG........TIND------LFFQILNKINFIKEKATYLL-----------------
COG6_SCLS1/52-643KQELLNAFNAHFVMSDDDIAMLTSTAE......PVND------RFFSILSRAKKIQNDCEILL-----------------
COG6_DROME/34-627HKQIAQAFLARFQLSGAEHQLLYGAAKD....APIVA------DFFRVLDRVQSIHADCRLLM-----------------
COG6_CAEEL/37-623RCNMINEFLENYSLSSEELRELDECEQS....GHLSE------FFFKVLERCHEIRENCRNMV-----------------
COG6_ASPTN/56-707KQQLLDAFTKHFIVSEEDLLILTSAEE......PIDE------RFFDLLSRVKQVHRDCEVLL-----------------
COG6_NEUCR/63-712KQKLLSTFKTHFILTQDEVDALTLTSE......PVDD------LFFTVLAKAKKISRDCEVLL-----------------
Q00T18_OSTTA/85-728RRELVKSFAVDFQITKAQVDALTTVEDDSAASVDLPA------AFFPALERVKVIQSNCSRLT-----------------

PF03081

Q5Z4V4_ORYSJ/278-638RAGIL.....DFLKFGRAIC...................DARKDPI.KLLRLLDVFDSLSKL.-----------------
EXOC7_DICDI/436-836DPAHE.....LLLETTEPIIK................VRKTPGDKIFSIFPLLDLFDTFTKL.-----------------
EXO70_DEBHA/215-612NESYA.....EVIGNFNKVFG.................QSKILHNDLLILETIENLNHFEKFL-----------------
A5DE46_PICGU/207-601NDSYT.....SVVDTLNEFVS.................SQGVLDNDIMLLEVIENLDHFSKF.-----------------
A2QCL9_ASPNC/266-651RSALT.....EYAQTLRELNQ...............YIRANFMTDCFLAFEIIEIVTAMSYR.-----------------
Q5KMS6_CRYNJ/297-673NKALS.....PTLS.........................TLKKYLSRHTFTALDLYASVSRL.-----------------
Q9SF51_ARATH/232-603RDGAL.....LLFGFPEIINT...............KTSKKHSPPE.KVFRLLDMYTAIAGN.-----------------
Q5QLT4_ORYSJ/188-532.HPFL.....QLLSFGNFIA...................AAGKNPE.CLFRIVDMYDAVRDI.-----------------
Q7XPT9_ORYSJ/273-640AKSLS.....ILLSFGDAVV...................QSQILPD.KLYILLDMYKATLEL.-----------------
EXO70_YARLI/227-601QTPLQ.....TYQAAGEEISN...............HVQRNISTDALLIFELIEGTVALKRG.-----------------
Q9LZD3_ARATH/267-627VSSVS.....MLLSFGDAIA...................RSKRSPE.KLFVLLDMYEIMREL.-----------------
Q5ZIN3_CHICK/309-677QESLD.....NLIMEGDNIVSA..............ARKAIIRHDYSAVLTIFPILKHLKQM.-----------------
A2WY31_ORYSI/215-549KNRIL.....NLLKFADDF....................TSITSHE.KLIYILGMYQALSEA.-----------------
A2YJD7_ORYSI/54-381ASEMR.....RLLKLAVVIT...................MLPTSPD.LLPVILRLYATLGTF.-----------------
Q6ES92_ORYSJ/191-595EESIL.....RMLAFVDAATLAV...........VEEDDDDHRVAE.ALPGMLQVYACISEA.-----------------
Q9SIB0_ARATH/209-553SQTAL.....ALFTFPEKMA...................KCRKSPE.KIFLTLDVYQTIVDL.-----------------
A5C6J8_VITVI/270-630KVSML.....RLLNFGEAVA...................IGQHLPE.KLFSLLNMYEALADL.-----------------
Q9LQP9_ARATH/237-588LQSAL.....NLFIFSLTVA...................KSRKTAE.KIFPTLDVYQTILQL.-----------------
EXO70_CANAL/229-666EESISR..YNGIINKYNQVYF...............KTPQEIVDNVILILEVLNNLIDFKVKL-----------------
A5E7C7_LODEL/212-655EYAITEY.NQTIISLSQQLQSQQQ..........VTAQENTRNKSIFVTLEVLDNLLLLESS.-----------------
EXO70_GIBZE/245-630QTALA.....EQARCLRELNA...............HIKSHLNTDCYLAYEITEIISALSGK.-----------------
EXO70_ASHGO/230-612APILH.....NYTKILRYNID...............LVKDDINNYGLFSFELSENINRVHQL.-----------------
A2YJD9_ORYSI/318-664KEPIT.....QLLTFASTVS...................KMHGSPE.KFFHMLHMHQALTEA.-----------------
A2XSN9_ORYSI/302-674KGCIM.....QILNFGDAVA...................VCSRSPE.KLSRILDMYEALAEV.-----------------
A6SNP3_BOTFB/246-636QGAIA.....ELSRTLRELNN...............HIKSNLTTDCYLAYEIVEIVSNLSSN.-----------------
Q6Z5V5_ORYSJ/162-505TKPIN.....RLLTFASTVS...................KVNGSPE.KLFHTLQMHKALSEA.-----------------
Q0WPK8_ARATH/246-618KGPAI.....QLFNFAEAIS...................ISRRSPE.KLFKILDLHDALIEL.-----------------
A2DS47_TRIVA/251-594.NSFQ.....PLFQHFKKTCV...............NVSDPDLKSHVDVLFDVDIVSTIVDV.-----------------
Q9FY95_ARATH/272-641SAVTI.....RFLDFSGAVV...................LTKRSSE.KLFKFLDMYETLRDL.-----------------
Q9M3D4_ARATH/241-604NEAAT.....NLFKFPEFVA...................KEKKSHE.RIFPLMDLQAAISDL.-----------------
A2YSN5_ORYSI/155-523EESIL.....RMLAFVDAVTLSAL..........NVNDDHRHRTPE.LLPGMLQLYACVSEA.-----------------
Q9FNR3_ARATH/272-623KDAIL.....SLLNFGEAVV...................LRSCKPE.MLERFLSMYEVSAEI.-----------------
A7TQI9_VANPO/236-622KPLLN.....AYVRLFNINIS...............MIKNNLENAGVFSFELIDSINEVKRS.-----------------
EXO70_SCHPO/244-610KPAIN.....TVTNATRQLEG...............VYEKRGAAENFVLLSLIDCIVVTRQN.-----------------
A2YXE5_ORYSI/221-597RGCLL.....QLIGFADAVA...................MSTPATE.KLYRMLGMYEALTAV.-----------------
Q4PDG8_USTMA/293-725SQPLT.....ALIESLGTVQS...............HVRRHLATHTSFLLDLIGALSGIVLTG-----------------
A5BYE5_VITVI/322-667DKIMA.....VFFRFGEGVA...................RSNKEPQ.KLFKLLDMFDSLEKL.-----------------
Q2QX89_ORYSJ/323-687RCVML.....HMLNFTEAVT...................MTKRAAE.KLFKVLDMYEATRDA.-----------------
Q9SF50_ARATH/227-599KEGAL.....LLFGFPETITL................RDKKNPHPE.KIFPLLDMYCTITDN.-----------------
EXO70_CANGA/234-621DPIVA.....AFCKVLMSDLI...............FVKSNIDNAGLFSFELTECISGVQKS.-----------------
Q0U449_PHANO/246-624QEPLG.....EFSKTLRELNG...............HIQKNLLTDCFLGYEICGMVRRLSIR.-----------------
Q6Z5U7_ORYSJ/196-558EKPVE.....TLLEFATAVS...................RVSGSPE.KLFHMLHMHKALAHA.-----------------
Q5TQS7_ANOGA/314-704QPSIE.....MVVKDAEQITSK..............VMRSIGRKEWSAALGIFSALKHVQIL.-----------------
Q0WPV2_ARATH/303-668KSCVM.....QLLNFGEAVA...................IGRRSSE.KLFRILDMYDALANV.-----------------
A8XF23_CAEBR/258-601SRPLA.....YVVLQTQ......................KVVNEKDIGIIPLLPLLHLLSQN.-----------------
A3LWD2_PICST/217-612ERSVGEIYNHGIINRFSHFFN................SSSAIIQNDILLLEFIDNLLQFQEF.-----------------
EXO70_KLULA/233-617SPIIQ.....NYLKIIRHNRQ...............LLKDNRENIGLFSFELSDKVNDVLRS.-----------------
Q9LMJ4_ARATH/246-593RGTTT.....QLLNFADAIA...................LGSRLPE.RLFKVVDLYEAMQDL.-----------------
Q9C8H6_ARATH/253-624NSVIL.....QLLRFGSRIS...................KCKREPP.KLIKLLDCFSTMDNF.-----------------
A3BAD3_ORYSJ/211-560MRFIQ.....QLFAFGSLIA..................NVKDEQYE.KVPLLVQMLEEFLKL.-----------------
Q60EX4_ORYSJ/153-510EATVC.....KMLAFANSLVA................VADKTWNPMNKLSGLMNVRSCISHA.-----------------
Q69JW6_ORYSJ/345-697TQSIK.....KLVACGSSMCSWQQNSQDDPSTQSCAARESTKHTTQ.MILNLVMMYRALNYA.-----------------
Q6YZW7_ORYSJ/295-656ARIAA.....AFFRFADGVA..................AAAAREPQ.RLFRLLDMLDAVARE.-----------------
Q9LIA2_ARATH/265-644KAPMM.....QLLNFGEAVS...................LGPRQPE.KLLRILEMYELASEL.-----------------
Q8H150_ARATH/227-595QEGAL.....ILFTFPEYAS..................KIKKLTPE.KMFRFLDMYEALANL.-----------------
A2WYH2_ORYSI/258-597QHALVWSYKLRLLAFADEIT...................KLQLSPD.KLFVVLRLLKVL....-----------------
B9FJQ2_ORYSJ/298-655RTQAL.....QLISFGDAIS...................SSSRAPE.RLFRVVDMYEAVRDL.-----------------
A2YA16_ORYSI/142-483SASAG.....AMLRLATAVA...................ALGASPS.ALLAALDVYVPVSEA.-----------------

PF15469

A4RXA7_OSTLU/41-217CL-----------------DAMEDARGVL..............RR...GREE.AGEF.......................
A6ZYC4_YEAS7/144-361IK-----------------NKLDQIYKEF..............DEKTNEKNQCDSPKENQ....................
A7TRG2_VANPO/143-342VK-----------------NRLDQIYENF..............ASSSSTSNSNKNNDFNNR...................
A8IS87_CHLRE/340-518CK-----------------DAIDDIHAKL..............RK...MLVR.GAGPSTGPGAQSAAAAAAAAQQA....
A8PCF2_COPC7/122-323VK-----------------ASTDALHAEM..............KD...GILA.PSTE.......................
A8PUN7_MALGO/110-314VK-----------------ATNDSVFREM..............SESMGGPFG.SAPD.......................
A8QHB2_BRUMA/204-382CV-----------------DTLATLYDKM..............QL...ERNV.CGWP.......................
A8WPA7_CAEBR/200-378CV-----------------DTLANLHQAL..............EK...GQNA.DHFA.......................
A9RNH0_PHYPA/252-430CK-----------------NTIDDIHSKL...................EQIECAKEG.......................
A9S1F4_PHYPA/259-437CK-----------------NTIDDIHLKL...................QQIESPKEG.......................
B0ET40_ENTDS/59-222CT-----------------EQLGTVKEKM...................IKTQ............................
B0W3D0_CULQU/193-383QL-----------------DTLMALRDRV..............SQ...DTKL.YGKD.......................
B2RBE6_HUMAN/198-377AQ-----------------DALSAIHQKL..............EA...DGTE.KVEG.......................
B3MVG4_DROAN/193-383QL-----------------DTLMNIRDKL..............QE...DVKL.HGNE.......................
B6K5G3_SCHJY/147-340AK-----------------EVIDKVYQEMV.............NH...LESS.NDQN.......................
B7PR09_IXOSC/148-326CL-----------------DVLHELQKAM..............EK...DKQE.MGSD.......................
B8ATQ6_ORYSI/262-452CK-----------------TTIDDIESKL...................RQIEEDPEG.......................
B8BR17_THAPS/466-647CS-----------------EGIDVFAEQS..............DL...QDSN.SGMR.......................
B8P2C9_POSPM/114-312VK-----------------ASTDALYAEM..............QE...GLLA.GQTE.......................
C3XUC7_BRAFL/191-370CQ-----------------DALAAMHQDL..............LK...DEST.SEGG.......................
C4M2W7_ENTHI/111-299CK-----------------DTLDKMQVII..............NS...AKAE.AVKN.......................
C4R5S5_PICPG/139-344SK-----------------NSLDRIFKQF..............DN...MKLI.GKGD.......................
C4YAI9_CLAL4/138-372CK-----------------KTIDEILVAF..............RN...SKSQ.AQQD..................REKSK
C5DMT2_LACTC/144-330SK-----------------NNLDRIYEQF..............NK...FSLG.ESRD.......................
C5DYM3_ZYGRC/146-354VK-----------------NRLDQIYEQF..............SMRYTPSLAPGSIDANGGQ..................
C5MH42_CANTT/104-348TK-----------------SKIDDSLIDF..............MR...SKTK.AQQD..................RSNSR
D0MT24_PHYIT/66-241CH-----------------EAVRTLAADV..............SA...HQQD.TEA........................
D5GNN2_TUBMM/147-347AK-----------------GTIEGVYKEMKGDSFLDKDR...............ESE.......................
D6W674_TRICA/193-371QI-----------------DTLVNLKEKI..............EG...DVAK.FGTE.......................
D7KJZ0_ARALL/260-438CK-----------------TTIDDIESKL...................KRIEDDPDG.......................
D8QDB4_SCHCM/114-323VK-----------------NSTDALHAEM..............KE...GLLA.PASD.......................
D8RD25_SELML/239-417CK-----------------NTIDDIHSKL...................QQIESDAEG.......................
E0S9H6_ENCIT/50-261CR-----------------TVLEEIWVDI..............KQ...KGYD.K..........................
E0VQL4_PEDHC/200-377QI-----------------DMLAKFKEKL..............EG...DLK...GKD.......................
E2AW35_CAMFO/194-372QL-----------------DTIMSLKDQF..............EA...DMKS.YGSD.......................
E3K655_PUCGT/121-321VK-----------------VANEAVYEQM..............KA...GPLR.SECD.......................
E4XNP2_OIKDI/201-392VH-----------------EALNSIHGQMSKGGQS........SG...MQNA.QQVK.......................
E6QYJ0_CRYGW/114-305VK-----------------ASSDVVYRDM..............KE...GFLA.DESD.......................
E6ZLD0_SPORE/109-315VK-----------------ATTDGVYREM..............RDTESGPLQ.PQAD.......................
E7R2N5_PICAD/151-341NK-----------------KLLDEVYSEY..............SM...SNLS............................
E9C1C0_CAPO3/243-420CQ-----------------KALDDLRGAI..............IK...SEKA.ADG........................
E9G6B5_DAPPU/193-371QM-----------------DTLMTLKKVV..............EE...NKTK.YGPD.......................
F0W4R3_9STRA/41-214CH-----------------EAVRSLSDAI..............RL...HFDD.LES........................
F0ZXN2_DICPU/132-311CK-----------------DTVDQVYDLI...................SKSK.ILED.......................
F2UAY3_SALS5/207-386AF-----------------DAVLNANRRI..............KF...HKRT.LNSA.......................
F4PCT9_BATDJ/225-428AK-----------------GTIDTFYREM..............CQ...KNLV.SSSN.......................
F4PGL2_DICFS/126-305CK-----------------DTVDEVYNLI...................TSSK.MLDD.......................
F4Q787_DICFS/187-364SV-----------------TAFLALKQDN...................TSLK............................
F4RSS6_MELLP/56-255VK-----------------AATETVYEQM..............KN...GPLR.PEED.......................
F6Q8U3_CIOIN/201-380VH-----------------ETLSGIHHKM..............QR...DEGG.RKNG.......................
F6YQX0_XENTR/198-380AQ-----------------DALAAIHQKL..............EA...DGTE.KVEG.......................
F8NGV0_SERL9/40-233VK-----------------ASTDA.YAII..............TI...NLFI.AIAH.......................
G0VBU0_NAUCC/150-340IK-----------------NRLDKIYNQF..............GEMKGNES.............................
G0WGP4_NAUDC/153-350IK-----------------NRLDQIYNQF..............ST...TTTQTNDNEDYTEDPV................
G1XK06_ARTOA/190-398AK-----------------STIDSVYKEMRAGSTTINYEGEEEAT...FRLI.KEEE.......................
G3AUN6_SPAPN/128-368SK-----------------KSIDDVLVEF..............KQ...QKSK.AQAD..................KESSK
G4TT08_PIRID/115-310VK-----------------ASTDALYQDM..............KD...GLLA.EDSE.......................
G4VNQ3_SCHMA/214-394CL-----------------DGMDSLRRRL..............DN...EKKS.IETN.......................
G6D800_DANPL/194-372QL-----------------DRLVLLKNMY..............ED...DQRK.NGKE.......................
G7DSD2_MIXOS/124-323IK-----------------GSTAAVYDDM..............RA...GLLV.DDRE.......................
G7IVK4_MEDTR/51-227CK-----------------TTIDDIESKL...................RRIEDEPEG.......................
G8BGG9_CANPC/145-407VK-----------------AEMDGTLQAF..............SQ...SKTK.SQED..................KETSK
G8BMU6_TETPH/145-338VK-----------------NRVDQIYENF..............SS...QDRSNSRNS.......................
G8JTD1_ERECY/120-302CK-----------------SNLDQIYDQF..............NK...RMNG.SDNF.......................
G8XZB2_PICSO/148-394CK-----------------KSIDDVLSWF..............KE...QKTH.SQKV..................MESST
G8ZXE8_TORDC/144-345IK-----------------NRLDEIYEQF..............SE...KSNTGALNDDDNQ...................
H2AR86_KAZAF/151-365IK-----------------NRLDLIYKQF..............SE...SNN.............................
H2KP67_CLOSI/214-393CL-----------------EGMDALKNKF..............LY...EKIS.SSGR.......................
H2ZFP8_CIOSA/151-287VQ-----------------ETLSGIHHKM..............MK...DGSG.RNNA.......................
H3ERJ1_PRIPA/197-373CV-----------------STLATLHQQL..............EE...HKGEM...........................
I0ZAT9_9CHLO/267-451CK-----------------TTIDDIHKRL..............RD...AETG.HAGGNSSY...................
I1GNJ4_BRADI/14-163..-----------------.............................................................
I1NBC3_SOYBN/28-188..-----------------.............................................................
SEC5_SCHPO/139-329AK-----------------ETIDNVYAQII.............ST...LSHA.G..........................
Q019K9_OSTTA/44-232GV-----------------DAAADAREAL..............VR...AREEGEDGF.......................
Q232N2_TETTS/349-532VH-----------------RGVIRTHQNF...................IQVE.AQSHG......................
Q6CGI4_YARLI/146-334SK-----------------SYLDSVFKQF..............KS...SGFT.QENE.......................
Q6CQH1_KLULA/148-350SK-----------------SNLDHIYKRF..............DTLMNSADAETYDEDE.....................
Q6FVL5_CANGA/149-372IK-----------------SRLDQIYSNF..............SE...GGEQENQNI.......................
Q750U7_ASHGO/122-304CK-----------------SNLDQIYDQF..............NK...RMSG.NENF.......................

PF04124

COG8_MOUSE/56-394GA-----------------ECTERIHRLF-------------------GDVE----------------------------
COG8_SCHPO/15-354YA-----------------RNQDAFYQLL-------------------ENSR----------------------------
COG8_YEAST/28-381NT-----------------SQIIGNILEN-------------------DD.R----------------------------
COG8_CAEEL/10-353AG-----------------RATHDCSKTF-------------------GEMR----------------------------
Q9LYH5_ARATH/29-412AA-----------------DALLAIRQEV-------------------SSID----------------------------
COG8_DROME/37-379TA-----------------ENSRSIFSEF-------------------LRSE----------------------------
Q9P3N9_NEUCS/31-347SA-----------------THHSTLRTSL-------------------PALA----------------------------

PF08700

COG5_MOUSE/37-120TS.QSI-------------HQAV......-------------------....----------------------------
EXO84_CRYNJ/142-228VK.KVL-------------TGAD.....E-------------------....----------------------------
Q6BJZ0_DEBHA/76-158FT....-------------.HLT.....I-------------------....----------------------------
Q0U0Z3_PHANO/76-170VN.SLL-------------AREG.....L-------------------....----------------------------
Q0WQ75_ARATH/43-129MD.LMI-------------KKSN.....L-------------------....----------------------------
Q5KJF4_CRYNJ/98-180FR....-------------.RLP.....V-------------------....----------------------------
Q173I8_AEDAE/5-87FE....-------------.QNS.....I-------------------....----------------------------
A2D783_TRIVA/6-88FE....-------------.KYD.....V-------------------....----------------------------
Q7Q6Z6_ANOGA/11-97LQ.KLL-------------KECS.....L-------------------....----------------------------
Q2UQ54_ASPOR/108-197VN.HLL-------------ATSS.....L-------------------....----------------------------
Q7S488_NEUCR/247-341LA.ELL-------------QSST.....L-------------------....----------------------------
VPS51_YEAST/84-163IK....-------------.NLP.....F-------------------....----------------------------
A2E266_TRIVA/29-115YK.NLI-------------NNQS.....L-------------------....----------------------------
Q2U987_ASPOR/1-88NSWQDA-------------FQYP.....I-------------------....----------------------------
Q6FRQ2_CANGA/66-146IN....-------------.EQT.....L-------------------....----------------------------
Q6CSC3_KLULA/100-179VT....-------------.KKS.....L-------------------....----------------------------
Q4SXW2_TETNG/10-92FE....-------------.RYN.....T-------------------....----------------------------
EXO84_GIBZE/128-214VQ.AAL-------------SDAT.....E-------------------....----------------------------
Q75HJ9_ORYSJ/40-126VQ.SKC-------------HAMN.....E-------------------....----------------------------
EXOC8_MOUSE/13-100VK.Q.L-------------SQQS.....D-------------------G..D----------------------------
Q4P2N5_USTMA/76-162LP.SLL-------------RSNN.....L-------------------....----------------------------
Q4PEG0_USTMA/79-161FL....-------------.SLT.....V-------------------....----------------------------
Q8I2A9_PLAF7/116-202FK.ELL-------------EKSS.....M-------------------....----------------------------
Q6CG64_YARLI/77-166AR.DIL-------------SSRGSGSRVL-------------------....----------------------------
Q4E335_TRYCC/3-85FT....-------------.NNT.....V-------------------....----------------------------
EXO84_YARLI/121-207VT.QQL-------------ATSN.....A-------------------....----------------------------
Q4MZL9_THEPA/63-149FD.QIL-------------RNNS.....I-------------------....----------------------------
COG1_SCHPO/7-89FR....-------------.THS.....I-------------------....----------------------------
Q59L27_CANAL/17-99FT....-------------.KLD.....I-------------------....----------------------------
Q2UHE7_ASPOR/121-207VA.NLL-------------ANAT.....E-------------------....----------------------------
Q7RZT4_NEUCR/9-91SS....-------------.NYP.....L-------------------....----------------------------
Q8SWU0_DROME/4-91TK.D.L-------------TREC.....V-------------------G..G----------------------------
E9AC89_LEIMA/3-81LC....-------------.QND.....V-------------------....----------------------------
A2GBI6_TRIVA/24-110FA.ENT-------------KNES.....I-------------------....----------------------------
Q4Y221_PLACH/14-100FR.RLL-------------EKST.....L-------------------....----------------------------
EXO84_ASHGO/127-213VH.EKL-------------GDAT.....A-------------------....----------------------------
Q8LCN9_ARATH/18-103VS.ELL-------------SFTL......-------------------....----------------------------
FFR_DICDI/178-264FD.SIV-------------KSST.....L-------------------....----------------------------
YEWA_SCHPO/52-138VS.KFM-------------EKAT.....P-------------------....----------------------------
Q9FFF3_ARATH/21-103FR....-------------.TKP.....M-------------------....----------------------------
Q4P6W6_USTMA/184-270LR.AKL-------------SHHS.....E-------------------....----------------------------
Q1WMT0_COPDI/48-130FS....-------------.RYT.....V-------------------....----------------------------
COG1_DICDI/113-195FE....-------------.RNT.....P-------------------....----------------------------
A2FRD0_TRIVA/32-118FD.KST-------------KTLS.....I-------------------....----------------------------
A0C9R8_PARTE/6-92VS.EFL-------------KNHS.....V-------------------....----------------------------
Q00XX6_OSTTA/568-650FA....-------------.DRS.....L-------------------....----------------------------
EXO84_CANGA/190-276IH.ERL-------------SEAS.....A-------------------....----------------------------
Q754G8_ASHGO/53-137VP.EKL-------------AEST.....L-------------------....----------------------------
FFR_CHICK/57-143LT.KVR-------------SECR.....L-------------------....----------------------------
Q55VT5_CRYNB/54-140YE.DLI-------------AKST.....L-------------------....----------------------------
Q95Q35_CAEEL/9-99IR.DRL-------------KGVK.....I-------------------GDET----------------------------
Q6C0N6_YARLI/24-102MS....-------------.KYS.....I-------------------....----------------------------
Q5DTY3_MOUSE/20-102FE....-------------.THG.....A-------------------....----------------------------
Q5CPU5_CRYPI/48-125FN.DIL-------------ETKT.....I-------------------....----------------------------
Q4DYG1_TRYCC/45-131VT.DLL-------------RRES.....L-------------------....----------------------------
Q5ZAZ1_ORYSJ/7-89FR....-------------.TRR.....I-------------------....----------------------------

PF06148

Q0TYI9_PHANO/26-159LS--TL-------------SNRH---------------------------------------------------------
Q29BE0_DROPS/22-154LH--K.-------------NRNA---------------------------------------------------------
Q7QFV1_ANOGA/25-157LH--E.-------------NRNA---------------------------------------------------------
Q84LH7_ORYSJ/24-156VA--D.-------------LRSY---------------------------------------------------------
Q9ASS9_ARATH/31-163IS--E.-------------LRTF---------------------------------------------------------
Q01CT5_OSTTA/52-184VE--E.-------------TSSF---------------------------------------------------------
Q5K8I4_CRYNJ/34-165LL--S.-------------.RIH---------------------------------------------------------
Q4P841_USTMA/85-240LV--S.-------------RTKA---------------------------------------------------------
A1C4Y0_ASPCL/32-165LS--SL-------------TNRH---------------------------------------------------------
Q2UA29_ASPOR/27-160LS--SL-------------TNRH---------------------------------------------------------
COG2_HUMAN/15-147VS--D.-------------CRKR---------------------------------------------------------
Q0C728_AEDAE/17-149LH--E.-------------NRKA---------------------------------------------------------
Q5BZC0_SCHJA/41-174IL--EQ-------------HRRG---------------------------------------------------------
A8WN13_CAEBR/23-155MN--L.-------------ARQK---------------------------------------------------------
Q383M1_TRYB2/46-232VQ--NK-------------LSHG---------------------------------------------------------
Q4DNE3_TRYCC/72-246VQ--EK-------------LDHG---------------------------------------------------------
Q4Q0F6_LEIMA/80-262VK--GK-------------VQHG---------------------------------------------------------
A0CKT7_PARTE/12-141..--..-------------EINY---------------------------------------------------------
COG2_DICDI/53-185IS--D.-------------CRKR---------------------------------------------------------

PF10392

COG5_HUMAN/66-189TSQSIH.................-----.-------------------...Q----------------------------
Q6BT79_DEBHA/15-147ANDLLL.............ATND-----K-------------------NGSE----------------------------
Q5B379_EMENI/829-961ANSLVV.............ATNN-----A-------------------TDTP----------------------------
Q5APN5_CANAL/17-149ANELLL.............ATNG-----Q-------------------ENPH----------------------------
COG5_SCHPO/8-139AERVLI.............SVHA-----D-------------------SDVN----------------------------
COG5_YEAST/14-146GNDLLK.............ATNN-----N-------------------DTTI----------------------------
Q9C9V9_ARATH/57-180SSAALA.................-----.-------------------...S----------------------------
Q0U7T7_PHANO/13-145ANTLVL.............STNN-----P-------------------SDTP----------------------------
Q2HI55_CHAGB/25-157ANTLVL.............ATNN-----A-------------------ADTP----------------------------
Q5KKM0_CRYNJ/10-154TNAILQGRQYTPDQSQQNNNKED-----N-------------------DKAD----------------------------
Q6CLE2_KLULA/11-144ANDLLK............VTNNG-----T-------------------DTDV----------------------------
COG5_DICDI/63-186TSNALK.................-----.-------------------...V----------------------------
Q6C2T6_YARLI/5-136ANQLVL.............QTSS-----S-------------------RDED----------------------------
Q75B18_ASHGO/11-144ARELIR............AINNK-----F-------------------DTTK----------------------------
Q6FTM6_CANGA/9-140SNSMLK..............AMN-----T-------------------TSNE----------------------------
Q65XH1_ORYSJ/52-175SSAALS.................-----.-------------------...S----------------------------

PF04100

VPS53_CAEEL/29-391------------------------N-MSL-------------------MAQI----------------------------
VPS53_HUMAN/39-453------------------------D-FNA-------------------VEYI----------------------------
Q9VQY8_DROME/42-434------------------------D-FNT-------------------VDYI----------------------------
Q9C6Q3_ARATH/1-444------------------------K-SSA-------------------LEYI----------------------------
YDLF_SCHPO/16-394------------------------E-FKF-------------------VETL----------------------------
VPS53_YEAST/5-369------------------------D-YDP-------------------LEDI----------------------------
Q9C6I3_ARATH/1-331------------------------K-SSG-------------------LDFI----------------------------

PF10475

Q7QF78_ANOGA/99-388G.-----------------.....G-SNT-------------------GLHE----------------------------
Q336V4_ORYSJ/131-419E.-----------------.....E-FDP-------------------IKYI----------------------------
Q012F3_OSTTA/52-350EP-----------------STSEPT-FDP-------------------VLVS----------------------------
Q54MU4_DICDI/72-370P.-----------------.....K-FDT-------------------TQFI----------------------------
Q6JJ34_IPOTF/130-420E.-----------------.....D-FDP-------------------VRHV----------------------------
CC132_CHICK/54-327N.-----------------....DA-FDI-------------------VKYE----------------------------
Q16RR9_AEDAE/70-360S.-----------------.....G-SNT-------------------GLHE----------------------------
A1ZAY8_DROME/75-362P.-----------------.....D-SNP-------------------QLYE----------------------------
Q54NV0_DICDI/113-401E.-----------------.....D-FDP-------------------A.FI----------------------------
Q8RXC2_ARATH/132-421E.-----------------.....D-FDP-------------------VRHI----------------------------
Q18602_CAEEL/76-363DN-----------------....DE-FDA-------------------IDYE----------------------------
A8XSD2_CAEBR/80-367DN-----------------....DE-FDA-------------------IDYE----------------------------

PF04048

Q7PY10_ANOGA/23-144..-----------------......-...-------------------....----------------------------
EXOC4_DROME/25-146..-----------------......-...-------------------....----------------------------
EXOC4_HUMAN/23-144..-----------------......-...-------------------....----------------------------
Q541W5_ARATH/15-151WA-----------------AARFDS-LPH-------------------VVHI----------------------------
Q69PQ1_ORYSJ/22-158WA-----------------AARFDS-LPH-------------------VVHI----------------------------
Q59NP0_CANAL/27-168WP-----------------QMLRED-ANP-------------------IEMA----------------------------
A5E514_LODEL/26-167WP-----------------QILQSN-ANP-------------------IEVA----------------------------
Q6BLA3_DEBHA/30-171WP-----------------QCLQEN-ANP-------------------IEMA----------------------------
A5DKL1_PICGU/29-170WP-----------------QLLDSK-TNP-------------------IDLA----------------------------
A3LUX9_PICST/29-170WP-----------------QFLVED-ANP-------------------IEVA----------------------------
Q75B87_ASHGO/33-174WN-----------------KVITKD-ANP-------------------LELA----------------------------
Q6CNM5_KLULA/34-175WN-----------------RIINKD-TNP-------------------LELA----------------------------
A7TRV6_VANPO/35-176WH-----------------RIISND-SNP-------------------LELA----------------------------
A6ZWU4_YEAS7/34-175WN-----------------RILSDN-TNP-------------------LELA----------------------------
Q6FWA6_CANGA/35-176WN-----------------RVLTED-SNP-------------------LELA----------------------------
Q6C3L8_YARLI/34-175WP-----------------ELGRDN-ANI-------------------LEVS----------------------------
Q4WUD2_ASPFU/134-275WG-----------------FVASDD-CVP-------------------VQVA----------------------------
Q0CDB2_ASPTN/131-272WD-----------------FVASDD-CVP-------------------VQVA----------------------------
Q2U7S6_ASPOR/137-278WG-----------------LVASDE-CVP-------------------VQVA----------------------------
SEC8_NEUCR/82-223WP-----------------AMVETD-CIP-------------------VQLA----------------------------
SEC8_SCHPO/51-191WK-----------------DLGRED-YQP-------------------ISTA----------------------------
Q4PBF9_USTMA/441-580WP-----------------FVANDQ-FNS-------------------VALA----------------------------

PF06248

Q7QA24_ANOGA/4-537VR-----------------DIVNSN-YV.-------------------.DFL----------------------------
ZW10_DROPS/10-571VR-----------------KHIDEN-YS.-------------------.EFM----------------------------
ZW10_ARATH/1-584VQ-----------------SYLVAH-HS.-------------------.DFS----------------------------
Q6ING5_XENLA/6-615VC-----------------DMINKK-YD.-------------------.EFL----------------------------
A7SSG2_NEMVE/20-670VF-----------------NTIYKE-YSY-------------------AGFQ----------------------------
A8XRG3_CAEBR/1-605IS-----------------ADIVDK-YGN-------------------LKVA----------------------------
Q4SPW6_TETNG/9-605LY-----------------EMINKR-YA.-------------------.DFL----------------------------
ZW10_DROGR/1-567VR-----------------KHIDEN-YV.-------------------.DFM----------------------------
ZW10_HUMAN/9-621VC-----------------NMISKK-YS.-------------------.EFL----------------------------
Q16R15_AEDAE/1-545VK-----------------EIVSSY-YV.-------------------.DFL----------------------------
Q803G9_DANRE/9-612VT-----------------DMINKK-YI.-------------------.EFI----------------------------
Q98TG8_CHICK/1-595VC-----------------TMITKK-YS.-------------------.EFL----------------------------

PF06046

Q4WPU5_ASPFU/183-757LI-----------------PLVQSDNRSM-------------------VVRL----------------------------
EX3L4_HUMAN/179-709TL-----------------DSDGVD.AAA-------------------LAEL----------------------------
EX3L1_DANRE/206-763GL-----------------SLAHQN.PTP-------------------FVSA----------------------------
A3LNE6_PICST/180-819LT-----------------EVVKDGNVQL-------------------VHRV----------------------------
A4RYX1_OSTLU/92-690GI-----------------LAGESG.SVG-------------------LVRA----------------------------
A5DIA8_PICGU/180-832IT-----------------EAAKEGNYTL-------------------AFKI----------------------------
A5DY39_LODEL/293-930LT-----------------ESAKDNNLEI-------------------LFKL----------------------------
A6RAW7_AJECN/390-965LI-----------------PLVQTDNRSM-------------------VVRL----------------------------
A7F9Q6_SCLS1/177-755LI-----------------EVVVQGNSSL-------------------VVRL----------------------------
SEC6_SCHPO/159-721IF-----------------QLVKSGHIKT-------------------IVQI----------------------------
Q016Y9_OSTTA/124-721GI-----------------LTGESG.AEG-------------------LVRA----------------------------
TNAP2_HUMAN/122-651PL-----------------EAP....PER-------------------LRQA----------------------------
Q0TXU6_PHANO/187-762LI-----------------DLVQSGNDGL-------------------VVRL----------------------------
EX3L1_BOVIN/188-722AG-----------------QLAREN.PAL-------------------LVAA----------------------------
Q16I77_AEDAE/179-730TL-----------------NTVRKE.PTV-------------------IVTA----------------------------
Q28ZN5_DROPS/179-731TL-----------------NTVRKK.PTV-------------------IVTA----------------------------
Q3SE84_PARTE/186-671TV-----------------EASIKK.PQQ-------------------LIKA----------------------------
TNAP2_MOUSE/157-688PL-----------------EAA....PER-------------------LSQA----------------------------
Q4P8D1_USTMA/258-828TM-----------------DLVREGRHAV-------------------VVKL----------------------------
Q4RJ08_TETNG/178-739SM-----------------VTVRRD.PTM-------------------LVSV----------------------------
EXOC3_DICDI/183-774SI-----------------DIAQIK.PAV-------------------LVKV----------------------------
Q5A7K3_CANAL/180-812LT-----------------EVTKEGNFEC-------------------FFNI----------------------------
Q5BBU2_EMENI/183-758LI-----------------PLVQSDNPSM-------------------VVRL----------------------------
Q5K9B3_CRYNJ/179-740VV-----------------ELLRKGNGGT-------------------VVRL----------------------------
Q5RG40_DANRE/163-694SF-----------------NEEN...QET-------------------LKSA----------------------------
Q69YP2_HUMAN/105-661SL-----------------VTVRRD.PTL-------------------LVSV----------------------------
Q6BJB6_DEBHA/180-833LT-----------------EALKEGNVEL-------------------VFKL----------------------------
Q6C9T6_YARLI/183-804LL-----------------EFIRSGNTSL-------------------VVRL----------------------------
Q6CU40_KLULA/178-794II-----------------EAVRTENQSL-------------------LIRL----------------------------
EX3L4_MOUSE/181-708AL-----------------SSEGVD.RDA-------------------LAEL----------------------------
Q6DJR6_XENTR/177-732SI-----------------VTVRRD.PTL-------------------LVSV----------------------------
Q6FPK2_CANGA/177-798IV-----------------EMIRAENYSL-------------------VVRL----------------------------
E9P8I5_YEASX/178-798IV-----------------EMARAEQISL-------------------AIRL----------------------------
Q873E6_NEUCS/175-753LI-----------------NLVIADNNSL-------------------VVRF----------------------------
EX3L1_MOUSE/189-722AG-----------------RLARED.PAL-------------------LVAA----------------------------
Q8NAC4_HUMAN/132-655AG-----------------KLARED.PAL-------------------LVAA----------------------------
Q8SU74_ENCCU/160-687FI-----------------EN.....HEA-------------------MDKI----------------------------
Q9M9G4_ARATH/172-724YY-----------------KLSKES.PQT-------------------LVRA----------------------------

PF04091

Q4WDM8_ASPFU/443-722NP-----------------EK....PREE-------------------QV..----------------------------
EXOC6_ARATH/442-755..-----------------......QTSD-------------------IMPA----------------------------
Q753S5_ASHGO/493-835KP-----------------DSV.PIVTQD-------------------DANG----------------------------
Q6BHQ3_DEBHA/493-827KS-----------------DA...PFAPQ-------------------NVHS----------------------------
A5DMM0_PICGU/481-812HP-----------------.EV..SFAAH-------------------KVKK----------------------------
A8XM86_CAEBR/483-791Y.-----------------......KRSM-------------------EQEP----------------------------
Q6CYE5_KLULA/488-829AD-----------------..QGSDTSNT-------------------TNDN----------------------------
Q8S5T3_ORYSJ/441-754..-----------------......EPDD-------------------VVPE----------------------------
EXOC6_DROME/427-731H.-----------------......SEQL-------------------ENAP----------------------------
Q17EP0_AEDAE/418-723H.-----------------......SEQL-------------------EAQQ----------------------------
EXOC6_RAT/455-763Q.-----------------......DPDL-------------------EKQS----------------------------
A7TQS9_VANPO/505-846KE-----------------.DDEVLSDNQ-------------------NLSE----------------------------
Q6C1W0_YARLI/479-794TP-----------------ADDEAAGGKP-------------------GAAT----------------------------
Q560L3_CRYNB/479-787AK-----------------GE....AESL-------------------AMQG----------------------------
A6RZT9_BOTFB/417-719VP-----------------DR....PKEE-------------------YT..----------------------------
A3LS60_PICST/479-812RE-----------------DA...PFAPK-------------------NVTK----------------------------
SEC15_SCHPO/435-740FP-----------------SE........-------------------...P----------------------------
Q7RYL2_NEUCR/450-733TE-----------------EK....APEE-------------------LT..----------------------------
Q0CL01_ASPTN/446-728NP-----------------ER....PREE-------------------QT..----------------------------
A7E4G0_SCLS1/408-698YA-----------------DL....LKRK-------------------FSTD----------------------------
O81298_ARATH/430-736..-----------------......QTSE-------------------IVPA----------------------------
Q0UFZ1_PHANO/442-734SP-----------------DK....TREV-------------------AH..----------------------------
A6R9C0_AJECN/443-746NP-----------------EK....SREQ-------------------QT..----------------------------
Q4P319_USTMA/445-765KP-----------------GD....DAML-------------------RSSG----------------------------
Q7XEN0_ORYSJ/441-754..-----------------......EPIG-------------------VVPD----------------------------
A5BA73_VITVI/441-754..-----------------......QTSD-------------------IMPA----------------------------
SEC15_YEAST/520-865KE-----------------GEHLSLPDPT-------------------NGEP----------------------------
Q4SZ84_TETNG/313-614Q.-----------------......DPEL-------------------EKLP----------------------------
Q6FRK2_CANGA/500-842KE-----------------..NHQIIDDM-------------------DDEN----------------------------
A5E457_LODEL/495-827ES-----------------NA...SFAPR-------------------NVKS----------------------------
EXOC6_DICDI/691-995..-----------------..........-------------------....----------------------------

PF09763

Q75AA6_ASHGO/631-1297......DEQSDLGEIRALKDRR---QAYERITDSFLKKLVSQM---DAKFKKM.......................QVCS
A5DBH0_PICGU/582-1282.....DSKPTGLGTMKALTQYQ---SKYESVTTRFTKHFLKFM---ESQFDLLFEQLNSASD..............KFYP
A3GH85_PICST/625-1329......EDDFYLSSMRALKQFD---ATYERVTSSFIKNFIFFA---KSQFKMLIEQASSDLI..............RFKP
Q6FRC5_CANGA/652-1329......NDESNLRDLEALRQRR---EFYERVTKLLIDRMVDEL---GRRFSNLHNS....................STSS
A6QQU0_BOVIN/176-464......ALRPGHDMLLAVEQQQ---QRFSDLRENFARRLASHL---NNVF....VQQGHDQSS......TLAQHSVELTL
Q2UK85_ASPOR/702-1427HGSVGVYADTEIGQMRAIKEKK---EEYRSQSRLFLQRLKQFM---AIAYKVA...EQKRVDTA....TNSSKDPMKLDS
A7TSV5_VANPO/776-1455......TETGDLGKIHALAPRR---QAYEKVTKVFLDRVVQEL---GRRFANFQSD....................VTSD
Q6CQX3_KLULA/540-1218....VQDSEDDLSDMRALSERR---HAYEKVTELFIERIVEQM---SLKFKEI.......................EKST
Q57ZX4_TRYB2/198-1064.....TKLESDY.PIALVAARR---AFFAEQRRAIAHRTKTYI---LDAISRHEKLYLTDPR........RFSTKNQLIW
EXOC1_DROME/186-866......DIDPALLRLEAVQDQR---KRFEKWKQKFSATVSRFM---NNLF....IHLGNEIG.......DMQVTSTELTL
A7E4X8_SCLS1/708-1443SGRTGGFGNSEIGSMRVLQEKK---DVYRATSVEFLQRLYSFL---QMKFRSAIDETRKALDREKGGNIARTAGKGKLDP
Q4RKW7_TETNG/106-846......ALRPGHDKLTAVKQQQ---DLFSDLRDKFARRLTNHL---NNVF....IHQGHDQSS......TLSQHAAELTL
Q6C0U5_YARLI/751-1484....SRDEEVFIGGMRALQERR---SLYEQAAVDFIARAQVSL---QEKVRDAVVSSSTQLS..........AASASPTI
Q2GRZ6_CHAGB/575-1334NGDQSLGLDSDYGKMRIVQEKK---EMYLAESSQFMRRLVIFM---ERHFSEAFRETKMALDGA....LAK.....KADA
Q5K9I2_CRYNJ/475-1177......GMDTANAEVAATIARM---QEYREQSSKFCKRMSDYL---DITFQYQADSTLSEFR.........KNFKKTMAL
Q7T2A6_DANRE/169-869......ALKPGHDKLMAIKQQQ---HLFSELRDTFARRLTNHL---NNVF....VHQGHDQSS......TLAQHTAELTL
A7RVQ5_NEMVE/151-846......DLPKGLQEMSAVKEQQ---ERYKKVCQGFALRLKHHL---LGIF....PQHGLDSE.......TPVRYSSEMHL
Q5TMX8_ANOGA/189-872......DIDPALLRLTAVQDQR---KRFEKWKAKFSQTISRHL---NNLF....IHLGNLGD.......SQTPFTNELSL
Q10GJ4_ORYSJ/212-854......NLDPCYVNMRAVREKR---AELEKLKTTFVRRASEFL---RNYFSSLVDFMISDKS........YFSQRGQLKR
Q4PFK6_USTMA/462-1173......DGDGGGADMAAAAERL---ADHEAISSRFCKRVLDYL---NVTFHAETQRLLADPSR......QMALQPPHPSL
A6ZQV5_YEAS7/640-1316......EVEYNLREISGLKQRL---QFYEKVTKIFLNRIVEEM---QKKFSNIRGQ....................DISH
Q7S5W6_NEUCR/694-1488SGGQAMALNSDYGNMRIVQEKR---EMYMAESTLFMRRLTEFM---ARRFEDAFRATKMALDNA....LSK.....KVDP
A5E4P0_LODEL/994-1796....HKNENNDLSSLRALKEHQ---ARFKTVNDRFLRHAFDFM---SKRIDSIGARLVNEID..............KLNL
EXOC1_DICDI/95-855......KLKSGMDNMMAVKDQR---KVFETYKISFARKVAALV---ENIFKTTDKEIGKHVIT......TTSQTPGEEKF

PF04129

VPS52_YEAST/47-607------NKDAENSAMLAPKDFDKLCQLLDILKNVILERSKRLI---ISKIKTLRS---------------------HNPV
VPS52_SCHPO/1-508------SLGNMFNSLQINKDQK...KLVDKLRDKAIERIRNYI---VVTIKMFRQ---------------------AF.V
Q9VMQ8_DROME/42-546------.....FKESKSTSDVS...DVLQKLRLKAMAKIRSYL---LEQIYKFRK---------------------PM.T
Q9FVV3_ARATH/83-615------.....VKSSKALKDVE...PELEKLRQKAISKVYDFI---VQKLIALRK---------------------PK.T
VPS52_RAT/94-601------.....ARGTAACADVR...GVLDRLRVKAVTKIREFI---LQKIYSFRK---------------------PM.T

PF15278

B6K1Q5_SCHJY/526-611--------------------------------------------------------------------------------
YD6C_SCHPO/520-605--------------------------------------------------------------------------------

PF06419

COG6_CRYNJ/69-690------..SGEEGKAQAGLDIM---SLTSEQLESGYSKIHRYC...QFEFRQF..---------------------..TR
COG6_EMENI/58-693------..GAE..HERLGLELM---EKSSRSLNSAYQKLYRWI...QKEFKSL..---------------------...N
COG6_ASPFU/55-708------..GGE..NQRLGLELM---EKSSRNLNSAYQKLFRWI...QKKFKSL..---------------------...N
COG6_PICGU/131-737------..SID..NSQLGVKTM---ARVNRLVTRASEKVVAYA...NRTLGNL..---------------------..YA
COG6_DEBHA/132-759------..SVD..NPQLGLKIM---SKFNQLINKSVERIINFT...NKTLNNL..---------------------..YS
COG6_HUMAN/55-656------..RTN..QQTAGLEIM---EQMALLQETAYERLYRWA...QSECRTL..---------------------...T
COG6_CANGA/175-819------..ALP..NSKAGEVLI---KQTNITLDTINKKISNYLIDYMYTFESNSN---------------------MGTK
Q6C1G5_YARLI/25-595------..AND..DTRAGQITM---YKANQALENANNTLIRDTETSLINYAQL..---------------------..GE
COG6_ASPNC/57-685------..GGE..NERLGLELM---EKSSRSLNSAYQKLYRWI...QKEFRSL..---------------------...N
COG6_YEAST/181-824------..TLP..NLNAGNALI---MGVNEILEKTNKKIFNYLIDFLYSFESSSN---------------------LLND
COG6_PHANO/54-693------..GTE..DQRLGLEIL---EQSSKQLNAAFQKLYRWI...QREFKTL..---------------------...D
COG6_ASPOR/121-774------..GGE..NQRLGLELM---DKSSRNLNSAYQKLYRWI...QKEFKSL..---------------------...N
COG6_CHAGB/46-689------..GFE..NQTLGLEIM---EQTSKNLNLGFQKLYKWV...QREFKTL..---------------------...N
COG6_COCIM/32-673------..GGE..NQRLGLEIM---EQSSKNLNSAFMKLYKWI...QKEFKSS..---------------------...N
COG6_SCHPO/43-650------ASLSGFVEYSSFEEIV---KKMSRYIEAAFEKLFRCV...QTELS....---------------------...D
Q17KR7_AEDAE/31-620------..QSG..YQTAALDIM---EEMTLHQEAALERLYRWT...QSHCRNV..---------------------....
COG6_ASHGO/158-791------..AMN..YEKAGKALL---GNINQYLQLANKRIYNYLLRFLYDYEYNTD---------------------TFGE
COG6_PICST/153-782------..SIE..NPQLGLKIM---SKSNHLINRSVERIINFT...NKTLSNL..---------------------..YS
Q7QJN1_ANOGA/31-623------..QSG..YQTVALDIM---EEMTLHQEAALERLYRWT...QSHCRNV..---------------------....
A7SZM3_NEMVE/34-607------..RTK..QQTAGLEIM---ESMALHMEASYERLYRWT...QDECRGL..---------------------...T
COG6_CANAL/144-758------..SLD..NPQLGLKII---AKSNQMINRSIDRIVSYT...NKTLGNM..---------------------..YS
COG6_MAGO7/53-703------..GFE..NQTSGLQIM---EQTSRNLDLAFQKLYRWI...QREFKTL..---------------------...N
COG6_KLULA/138-763------..SNE.KTTSAGVALL---KTMNNNLTVSNKRIYNYLINFIEEYDTLSR---------------------QYGE
COG6_SCLS1/52-643------..GTE..NQRLGLEIM---EQTSKNINGAFQKLYRWI...QREFKTL..---------------------...N
COG6_DROME/34-627------..QCG..YQTAAIDIM---EEMTLHQEGALERLYRWT...QNHCRSL..---------------------....
COG6_CAEEL/37-623------..QEQ..GHLAAFEVM---EKMQKIDERSHAIICNNL...KREFQNL..---------------------...T
COG6_ASPTN/56-707------..GGE..NQRLGLELM---EKSSRNLNSAYQKLYKWI...QKEFRSL..---------------------...N
COG6_NEUCR/63-712------..GFE..DQTLGLGIM---EQVTRNLNHGFQKLYRWI...QREFKSL..---------------------...N
Q00T18_OSTTA/85-728------.KDAD..QQRAGLQML---DAMTSYAETAHEKLRRWF...VAKCRML..---------------------..AE

PF03081

Q5Z4V4_ORYSJ/278-638-------------------------..RMDFNRLFGG......-------------------------------------
EXOC7_DICDI/436-836-------------------------..LPDFITAISS......-------------------------------------
EXO70_DEBHA/215-612-------------------------.NVSNIDVRSFP......-------------------------------------
A5DE46_PICGU/207-601-------------------------..MVASNLSPAT......-------------------------------------
A2QCL9_ASPNC/266-651-------------------------..VESKTGELKS......-------------------------------------
Q5KMS6_CRYNJ/297-673-------------------------..LPQWDHIMSSCLSRLG-------------------------------------
Q9SF51_ARATH/232-603-------------------------..WQAIESIFSF......-------------------------------------
Q5QLT4_ORYSJ/188-532-------------------------..LPVLDDAFNP......-------------------------------------
Q7XPT9_ORYSJ/273-640-------------------------..QSKVDAIFEG......-------------------------------------
EXO70_YARLI/227-601-------------------------..LEPLTNSAAP......-------------------------------------
Q9LZD3_ARATH/267-627-------------------------..HTEIETIFKG......-------------------------------------
Q5ZIN3_CHICK/309-677-------------------------..KPEFDQVLQG......-------------------------------------
A2WY31_ORYSI/215-549-------------------------..APGLLLMFTG......-------------------------------------
A2YJD7_ORYSI/54-381-------------------------..PID.............-------------------------------------
Q6ES92_ORYSJ/191-595-------------------------..SPTVLAMFKEASDLLA-------------------------------------
Q9SIB0_ARATH/209-553-------------------------..LPKINELFSS......-------------------------------------
A5C6J8_VITVI/270-630-------------------------..LLHIDALFSE......-------------------------------------
Q9LQP9_ARATH/237-588-------------------------..TPKIDQIFSY......-------------------------------------
EXO70_CANAL/229-666-------------------------KQIGLNRTLEQS......-------------------------------------
A5E7C7_LODEL/212-655-------------------------..LKLLQVKSVG......-------------------------------------
EXO70_GIBZE/245-630-------------------------..LETRTGELKG......-------------------------------------
EXO70_ASHGO/230-612-------------------------..FKGKPLQNNE......-------------------------------------
A2YJD9_ORYSI/318-664-------------------------..SPVLQEVFSG......-------------------------------------
A2XSN9_ORYSI/302-674-------------------------..IPELKELFFG......-------------------------------------
A6SNP3_BOTFB/246-636-------------------------..LESRTGELKP......-------------------------------------
Q6Z5V5_ORYSJ/162-505-------------------------..SPMIQQALLG......-------------------------------------
Q0WPK8_ARATH/246-618-------------------------..LPDIESVFDL......-------------------------------------
A2DS47_TRIVA/251-594-------------------------.....LDSQVND......-------------------------------------
Q9FY95_ARATH/272-641-------------------------..IPAVE...........-------------------------------------
Q9M3D4_ARATH/241-604-------------------------..WQDIEMIFHF......-------------------------------------
A2YSN5_ORYSI/155-523-------------------------..CDLLVSAGMGKDEITK-------------------------------------
Q9FNR3_ARATH/272-623-------------------------..LVDVDNLFPD......-------------------------------------
A7TQI9_VANPO/236-622-------------------------..LRGNTLKNYE......-------------------------------------
EXO70_SCHPO/244-610-------------------------..MNNLMPFEDA......-------------------------------------
A2YXE5_ORYSI/221-597-------------------------..EPDIESLFTG......-------------------------------------
Q4PDG8_USTMA/293-725-------------------------RWDVLLRAMEDSPEAPLH-------------------------------------
A5BYE5_VITVI/322-667-------------------------..KTQFSEIFEG......-------------------------------------
Q2QX89_ORYSJ/323-687-------------------------..SPVIDAFLTADDGNNS-------------------------------------
Q9SF50_ARATH/227-599-------------------------..LLAIEAIFSF......-------------------------------------
EXO70_CANGA/234-621-------------------------..VKGMNLKNQM......-------------------------------------
Q0U449_PHANO/246-624-------------------------..LQDTTGALKG......-------------------------------------
Q6Z5U7_ORYSJ/196-558-------------------------..APLLLAAFIG......-------------------------------------
Q5TQS7_ANOGA/314-704-------------------------..QPDIDRICDS......-------------------------------------
Q0WPV2_ARATH/303-668-------------------------..LQTLEVMVTD......-------------------------------------
A8XF23_CAEBR/258-601-------------------------..LARFHNLAAN......-------------------------------------
A3LWD2_PICST/217-612-------------------------..LRKNGVSNKE......-------------------------------------
EXO70_KLULA/233-617-------------------------..LRGKDIAEAD......-------------------------------------
Q9LMJ4_ARATH/246-593-------------------------..IPKMETLFSD......-------------------------------------
Q9C8H6_ARATH/253-624-------------------------..RIEFNRLFRG......-------------------------------------
A3BAD3_ORYSJ/211-560-------------------------..KPSIEALRYG......-------------------------------------
Q60EX4_ORYSJ/153-510-------------------------..SEIIMLSLKKETLWLP-------------------------------------
Q69JW6_ORYSJ/345-697-------------------------..MPELLALFSG......-------------------------------------
Q6YZW7_ORYSJ/295-656-------------------------..RGRLDELFSG......-------------------------------------
Q9LIA2_ARATH/265-644-------------------------..LPEIDALFLD......-------------------------------------
Q8H150_ARATH/227-595-------------------------..YVEIESIFYF......-------------------------------------
A2WYH2_ORYSI/258-597-------------------------..NPDFFLVSQC......-------------------------------------
B9FJQ2_ORYSJ/298-655-------------------------..LPDLDPVFAD......-------------------------------------
A2YA16_ORYSI/142-483-------------------------..YPGLARMFSW......-------------------------------------

PF15469

A4RXA7_OSTLU/41-217..................GATAELE-------------------------------------------------------
A6ZYC4_YEAS7/144-361..................INVESLN-------------------------------------------------------
A7TRG2_VANPO/143-342..................INIEHLS-------------------------------------------------------
A8IS87_CHLRE/340-518..................VGTDRVF-------------------------------------------------------
A8PCF2_COPC7/122-323..................YASKPLK-------------------------------------------------------
A8PUN7_MALGO/110-314..................EGVEGLR-------------------------------------------------------
A8QHB2_BRUMA/204-382..................LT.KNIS-------------------------------------------------------
A8WPA7_CAEBR/200-378..................AL.GNIS-------------------------------------------------------
A9RNH0_PHYPA/252-430..................TGTEHLH-------------------------------------------------------
A9S1F4_PHYPA/259-437..................TGTVHLN-------------------------------------------------------
B0ET40_ENTDS/59-222..................ERLEKTS-------------------------------------------------------
B0W3D0_CULQU/193-383..................QV.KDLE-------------------------------------------------------
B2RBE6_HUMAN/198-377..................SMTQKLE-------------------------------------------------------
B3MVG4_DROAN/193-383..................PL.NILE-------------------------------------------------------
B6K5G3_SCHJY/147-340..................TPWKKID-------------------------------------------------------
B7PR09_IXOSC/148-326..................LT.EKLS-------------------------------------------------------
B8ATQ6_ORYSI/262-452..................AGTAHLY-------------------------------------------------------
B8BR17_THAPS/466-647...............KLQHCFQTLD-------------------------------------------------------
B8P2C9_POSPM/114-312..................FASRPLK-------------------------------------------------------
C3XUC7_BRAFL/191-370..................SITEKLE-------------------------------------------------------
C4M2W7_ENTHI/111-299..................GVYLNVV-------------------------------------------------------
C4R5S5_PICPG/139-344............ANGGKEAAVDYLK-------------------------------------------------------
C4YAI9_CLAL4/138-372VFNPRSR....SSLSDGSGLLSELE-------------------------------------------------------
C5DMT2_LACTC/144-330..................FGTDDLG-------------------------------------------------------
C5DYM3_ZYGRC/146-354..................LDVNELG-------------------------------------------------------
C5MH42_CANTT/104-348VFNPQRRNMVSTNSNGKEDLTSELE-------------------------------------------------------
D0MT24_PHYIT/66-241.......................LV-------------------------------------------------------
D5GNN2_TUBMM/147-347..................WGVGKIR-------------------------------------------------------
D6W674_TRICA/193-371..................PT.LKLE-------------------------------------------------------
D7KJZ0_ARALL/260-438..................SGTTHLF-------------------------------------------------------
D8QDB4_SCHCM/114-323..................YASKPLR-------------------------------------------------------
D8RD25_SELML/239-417..................AGTAHLT-------------------------------------------------------
E0S9H6_ENCIT/50-261..................EFTTDLE-------------------------------------------------------
E0VQL4_PEDHC/200-377..................EFGEELE-------------------------------------------------------
E2AW35_CAMFO/194-372..................PT.EKLE-------------------------------------------------------
E3K655_PUCGT/121-321..................YGTADLK-------------------------------------------------------
E4XNP2_OIKDI/201-392.................PDMTDNLL-------------------------------------------------------
E6QYJ0_CRYGW/114-305..................HGTRELR-------------------------------------------------------
E6ZLD0_SPORE/109-315..................YGVASLN-------------------------------------------------------
E7R2N5_PICAD/151-341..................ANITALS-------------------------------------------------------
E9C1C0_CAPO3/243-420..................PITTRFD-------------------------------------------------------
E9G6B5_DAPPU/193-371..................MT.ASLE-------------------------------------------------------
F0W4R3_9STRA/41-214.......................FS-------------------------------------------------------
F0ZXN2_DICPU/132-311.......................MS-------------------------------------------------------
F2UAY3_SALS5/207-386..................SITSKLA-------------------------------------------------------
F4PCT9_BATDJ/225-428..................YGIAPFA-------------------------------------------------------
F4PGL2_DICFS/126-305.......................MS-------------------------------------------------------
F4Q787_DICFS/187-364..................HSVITLN-------------------------------------------------------
F4RSS6_MELLP/56-255..................YSIGPLR-------------------------------------------------------
F6Q8U3_CIOIN/201-380..................NLTDKLE-------------------------------------------------------
F6YQX0_XENTR/198-380..................SMTQVLE-------------------------------------------------------
F8NGV0_SERL9/40-233..................WC.....-------------------------------------------------------
G0VBU0_NAUCC/150-340..................LDVDRLN-------------------------------------------------------
G0WGP4_NAUDC/153-350..................LNIDQLH-------------------------------------------------------
G1XK06_ARTOA/190-398..................WGLKTIR-------------------------------------------------------
G3AUN6_SPAPN/128-368VFNPTK.....QRLDVQQDLCSELD-------------------------------------------------------
G4TT08_PIRID/115-310..................FATKKLK-------------------------------------------------------
G4VNQ3_SCHMA/214-394.................DSNDLRLE-------------------------------------------------------
G6D800_DANPL/194-372..................PL.PSLQ-------------------------------------------------------
G7DSD2_MIXOS/124-323..................YGIRDIK-------------------------------------------------------
G7IVK4_MEDTR/51-227..................SGTSHLF-------------------------------------------------------
G8BGG9_CANPC/145-407YFNPQRHRLNVSDNNGNGDISSELE-------------------------------------------------------
G8BMU6_TETPH/145-338..................IDIEALN-------------------------------------------------------
G8JTD1_ERECY/120-302..................LGIYHLD-------------------------------------------------------
G8XZB2_PICSO/148-394VFNPQRH....KKNAHDESLVSSLE-------------------------------------------------------
G8ZXE8_TORDC/144-345..................LDVDRLS-------------------------------------------------------
H2AR86_KAZAF/151-365..................SNLAQLS-------------------------------------------------------
H2KP67_CLOSI/214-393..................QFELPFE-------------------------------------------------------
H2ZFP8_CIOSA/151-287..................NLTDKLE-------------------------------------------------------
H3ERJ1_PRIPA/197-373..................AVTKIIG-------------------------------------------------------
I0ZAT9_9CHLO/267-451..................VSTNDVI-------------------------------------------------------
I1GNJ4_BRADI/14-163.........................-------------------------------------------------------
I1NBC3_SOYBN/28-188.........................-------------------------------------------------------
SEC5_SCHPO/139-329...................PAKTMD-------------------------------------------------------
Q019K9_OSTTA/44-232..................GAARELE-------------------------------------------------------
Q232N2_TETTS/349-532..................SYFNQLK-------------------------------------------------------
Q6CGI4_YARLI/146-334..................WGMGELT-------------------------------------------------------
Q6CQH1_KLULA/148-350..................LSVQRLN-------------------------------------------------------
Q6FVL5_CANGA/149-372..................MKVEKLK-------------------------------------------------------
Q750U7_ASHGO/122-304..................LGIDHLD-------------------------------------------------------

PF04124

COG8_MOUSE/56-394------------------ASLGRLL-------------------------------------------------------
COG8_SCHPO/15-354------------------HDFKELV-------------------------------------------------------
COG8_YEAST/28-381------------------AQLDDIA-------------------------------------------------------
COG8_CAEEL/10-353------------------DKTVNLS-------------------------------------------------------
Q9LYH5_ARATH/29-412------------------KHLESLI-------------------------------------------------------
COG8_DROME/37-379------------------QQLDTLV-------------------------------------------------------
Q9P3N9_NEUCS/31-347------------------ASTADLR-------------------------------------------------------

PF08700

COG5_MOUSE/37-120------------------..IAEQL-------------------------------------------------------
EXO84_CRYNJ/142-228------------------EEKRRFV-------------------------------------------------------
Q6BJZ0_DEBHA/76-158------------------QQIQKLN-------------------------------------------------------
Q0U0Z3_PHANO/76-170------------------KGVLKVE-------------------------------------------------------
Q0WQ75_ARATH/43-129------------------EVLLQRH-------------------------------------------------------
Q5KJF4_CRYNJ/98-180------------------REVKRVE-------------------------------------------------------
Q173I8_AEDAE/5-87------------------AEIDQVH-------------------------------------------------------
A2D783_TRIVA/6-88------------------ATIKKIK-------------------------------------------------------
Q7Q6Z6_ANOGA/11-97------------------KQIMDTE-------------------------------------------------------
Q2UQ54_ASPOR/108-197------------------STVLKAE-------------------------------------------------------
Q7S488_NEUCR/247-341------------------AELLKTY-------------------------------------------------------
VPS51_YEAST/84-163------------------KRLVQIH-------------------------------------------------------
A2E266_TRIVA/29-115------------------PALITKD-------------------------------------------------------
Q2U987_ASPOR/1-88------------------PTVRRVE-------------------------------------------------------
Q6FRQ2_CANGA/66-146------------------KELVATH-------------------------------------------------------
Q6CSC3_KLULA/100-179------------------KQLLQVQ-------------------------------------------------------
Q4SXW2_TETNG/10-92------------------EQIRKIE-------------------------------------------------------
EXO84_GIBZE/128-214------------------DQIREFE-------------------------------------------------------
Q75HJ9_ORYSJ/40-126------------------KEIRHLC-------------------------------------------------------
EXOC8_MOUSE/13-100------------------RDLQEHR-------------------------------------------------------
Q4P2N5_USTMA/76-162------------------SALLSKE-------------------------------------------------------
Q4PEG0_USTMA/79-161------------------KEVEAYE-------------------------------------------------------
Q8I2A9_PLAF7/116-202------------------YDLINKS-------------------------------------------------------
Q6CG64_YARLI/77-166------------------KDLLKKE-------------------------------------------------------
Q4E335_TRYCC/3-85------------------EQVRDYL-------------------------------------------------------
EXO84_YARLI/121-207------------------EEVDRFV-------------------------------------------------------
Q4MZL9_THEPA/63-149------------------SDTIGLL-------------------------------------------------------
COG1_SCHPO/7-89------------------AQTIQLE-------------------------------------------------------
Q59L27_CANAL/17-99------------------SQIHQLN-------------------------------------------------------
Q2UHE7_ASPOR/121-207------------------EEIEEYQ-------------------------------------------------------
Q7RZT4_NEUCR/9-91------------------PHIRAIH-------------------------------------------------------
Q8SWU0_DROME/4-91------------------SDLQQRK-------------------------------------------------------
E9AC89_LEIMA/3-81------------------EETLNYL-------------------------------------------------------
A2GBI6_TRIVA/24-110------------------HNIIATQ-------------------------------------------------------
Q4Y221_PLACH/14-100------------------DELINRS-------------------------------------------------------
EXO84_ASHGO/127-213------------------LEIDHFA-------------------------------------------------------
Q8LCN9_ARATH/18-103------------------DRLHKEP-------------------------------------------------------
FFR_DICDI/178-264------------------NQLIQKD-------------------------------------------------------
YEWA_SCHPO/52-138------------------AELLQRD-------------------------------------------------------
Q9FFF3_ARATH/21-103------------------SEIRIVE-------------------------------------------------------
Q4P6W6_USTMA/184-270------------------SSLRQFK-------------------------------------------------------
Q1WMT0_COPDI/48-130------------------AEVKNIQ-------------------------------------------------------
COG1_DICDI/113-195------------------EQMKQME-------------------------------------------------------
A2FRD0_TRIVA/32-118------------------HQLVAQE-------------------------------------------------------
A0C9R8_PARTE/6-92------------------QDLIQRH-------------------------------------------------------
Q00XX6_OSTTA/568-650------------------EEIREIE-------------------------------------------------------
EXO84_CANGA/190-276------------------VDIDLFT-------------------------------------------------------
Q754G8_ASHGO/53-137------------------DQLLQAH-------------------------------------------------------
FFR_CHICK/57-143------------------GELLSRE-------------------------------------------------------
Q55VT5_CRYNB/54-140------------------SGLMRTT-------------------------------------------------------
Q95Q35_CAEEL/9-99------------------RKLRHLR-------------------------------------------------------
Q6C0N6_YARLI/24-102------------------ADVVIIE-------------------------------------------------------
Q5DTY3_MOUSE/20-102------------------EEIRGLE-------------------------------------------------------
Q5CPU5_CRYPI/48-125------------------KELFLIR-------------------------------------------------------
Q4DYG1_TRYCC/45-131------------------KELVETD-------------------------------------------------------
Q5ZAZ1_ORYSJ/7-89------------------PEIRAAE-------------------------------------------------------

PF06148

Q0TYI9_PHANO/26-159------------------QTLEDLR-------------------------------------------------------
Q29BE0_DROPS/22-154------------------PSLEQLR-------------------------------------------------------
Q7QFV1_ANOGA/25-157------------------GSLEIIR-------------------------------------------------------
Q84LH7_ORYSJ/24-156------------------VPLDSLA-------------------------------------------------------
Q9ASS9_ARATH/31-163------------------VPFDTLR-------------------------------------------------------
Q01CT5_OSTTA/52-184------------------VGVDAMR-------------------------------------------------------
Q5K8I4_CRYNJ/34-165------------------IPLEELR-------------------------------------------------------
Q4P841_USTMA/85-240------------------SDLNFIL-------------------------------------------------------
A1C4Y0_ASPCL/32-165------------------QSLEDLR-------------------------------------------------------
Q2UA29_ASPOR/27-160------------------QSLEDLR-------------------------------------------------------
COG2_HUMAN/15-147------------------VQLEELR-------------------------------------------------------
Q0C728_AEDAE/17-149------------------GSLEIIR-------------------------------------------------------
Q5BZC0_SCHJA/41-174------------------ISLEKLR-------------------------------------------------------
A8WN13_CAEBR/23-155------------------ADLKTIQ-------------------------------------------------------
Q383M1_TRYB2/46-232------------------VPLDDLC-------------------------------------------------------
Q4DNE3_TRYCC/72-246------------------VPLRSLC-------------------------------------------------------
Q4Q0F6_LEIMA/80-262------------------VPLASLS-------------------------------------------------------
A0CKT7_PARTE/12-141------------------KKIEQSM-------------------------------------------------------
COG2_DICDI/53-185------------------VNLESVQ-------------------------------------------------------

PF10392

COG5_HUMAN/66-189------------------AVIAEQL-------------------------------------------------------
Q6BT79_DEBHA/15-147------------------LDGLTPL-------------------------------------------------------
Q5B379_EMENI/829-961------------------LDLSTPL-------------------------------------------------------
Q5APN5_CANAL/17-149------------------LDLVTPI-------------------------------------------------------
COG5_SCHPO/8-139------------------EDKEVAR-------------------------------------------------------
COG5_YEAST/14-146------------------LDLNTPL-------------------------------------------------------
Q9C9V9_ARATH/57-180------------------GSPASTA-------------------------------------------------------
Q0U7T7_PHANO/13-145------------------LDLSTPL-------------------------------------------------------
Q2HI55_CHAGB/25-157------------------LDLSTPL-------------------------------------------------------
Q5KKM0_CRYNJ/10-154------------------LDVGAEL-------------------------------------------------------
Q6CLE2_KLULA/11-144------------------LDLKTCV-------------------------------------------------------
COG5_DICDI/63-186------------------SSISLSL-------------------------------------------------------
Q6C2T6_YARLI/5-136------------------IDLDIPI-------------------------------------------------------
Q75B18_ASHGO/11-144------------------LDLYTPL-------------------------------------------------------
Q6FTM6_CANGA/9-140------------------LDIDAPK-------------------------------------------------------
Q65XH1_ORYSJ/52-175------------------GLAASRA-------------------------------------------------------

PF04100

VPS53_CAEEL/29-391------------------NELFPT........................E---QSLTQ------LDSII...---------
VPS53_HUMAN/39-453------------------NTLFPT........................E---QSLAN------IDEVV...---------
Q9VQY8_DROME/42-434------------------NQLFPN........................E---QSLAG------IDETI...---------
Q9C6Q3_ARATH/1-444------------------NQMFPTGNETLVEQSYSLYFDYGLELIFVAA---ASLTG------VEPLM...---------
YDLF_SCHPO/16-394------------------HELLPE........................D---ITYDD------LGSLRLS.---------
VPS53_YEAST/5-369------------------TNILFS........................K---ESLNN------IDELISIT---------
Q9C6I3_ARATH/1-331------------------NQMFPV........................E---ASLSC------VESFM...---------

PF10475

Q7QF78_ANOGA/99-388------------------LRKLSE------------------------SGQLLDCGS......IEQSM------------
Q336V4_ORYSJ/131-419------------------LQSIPA------------------------EG.DSSY........FDKQS------------
Q012F3_OSTTA/52-350------------------LRRLGA------------------------D...FTVED......LSKEE------------
Q54MU4_DICDI/72-370------------------LDLLPP------------------------N...VNNSSSEFSIFLDSNV------------
Q6JJ34_IPOTF/130-420------------------LEHIPT------------------------DENELAY........FEEKA------------
CC132_CHICK/54-327------------------LERLPP------------------------V...LSLQE......LEEYR------------
Q16RR9_AEDAE/70-360------------------LKKLSE------------------------TDELLNCQC......IEKAM------------
A1ZAY8_DROME/75-362------------------LKKVLN------------------------DG..IDNEL......IEVTI------------
Q54NV0_DICDI/113-401------------------LQNIPK------------------------D...APIDT......IDALT------------
Q8RXC2_ARATH/132-421------------------LENVPD------------------------DESELAY........FEKQA------------
Q18602_CAEEL/76-363------------------LKKLCD------------------------IE..MCYED......IQRER------------
A8XSD2_CAEBR/80-367------------------LKKLCD------------------------ID..MCYED......IQRER------------

PF04048

Q7PY10_ANOGA/23-144------------------.....E----------------------------TNEQ-------REREK------------
EXOC4_DROME/25-146------------------.....E----------------------------TTEE-------RQKEK------------
EXOC4_HUMAN/23-144------------------.....D----------------------------DVED-------RENEK------------
Q541W5_ARATH/15-151------------------LTSKDR----------------------------EA..-------...DI------------
Q69PQ1_ORYSJ/22-158------------------LTSKDR----------------------------EG..-------...EI------------
Q59NP0_CANAL/27-168------------------VALLDD----------------------------TSVG-------LAHRL------------
A5E514_LODEL/26-167------------------VAFLDD----------------------------TSVG-------LAHRL------------
Q6BLA3_DEBHA/30-171------------------VSLLDD----------------------------TSVG-------MAYKL------------
A5DKL1_PICGU/29-170------------------VSLLDR----------------------------SSVG-------LAHRL------------
A3LUX9_PICST/29-170------------------VALLDD----------------------------TSVG-------LAHRF------------
Q75B87_ASHGO/33-174------------------LQFLDD----------------------------TSVG-------LGHRY------------
Q6CNM5_KLULA/34-175------------------LRFLDE----------------------------TSVG-------LHHRF------------
A7TRV6_VANPO/35-176------------------LKFLDE----------------------------TSVG-------LGHRY------------
A6ZWU4_YEAS7/34-175------------------LAFLDD----------------------------TSVG-------LGHRY------------
Q6FWA6_CANGA/35-176------------------LAFLDD----------------------------TSVG-------LGHRY------------
Q6C3L8_YARLI/34-175------------------LSLMDT----------------------------SSIG-------KARFS------------
Q4WUD2_ASPFU/134-275------------------LQLMDT----------------------------STLG-------KADRE------------
Q0CDB2_ASPTN/131-272------------------LQLMDT----------------------------STLG-------KAERE------------
Q2U7S6_ASPOR/137-278------------------LQLMDT----------------------------STLG-------KADRE------------
SEC8_NEUCR/82-223------------------LQLLDT----------------------------SSVG-------RAHEY------------
SEC8_SCHPO/51-191------------------LELLDD----------------------------SSFG-------..RDY------------
Q4PBF9_USTMA/441-580------------------LSMLDE----------------------------SSLG-------ASRF.------------

PF06248

Q7QA24_ANOGA/4-537------------------...SINRDMLDDLKSLETDIKELIAS.TSQLTVDKSNVAWNDLRNYQRDLEEG---------
ZW10_DROPS/10-571------------------TNHTSPDIFLEESSSLGREINDLLET.VGTEGLAALNGSSTQLADHSRELREL---------
ZW10_ARATH/1-584------------------ELFSLCQDTVSRTRLISDDVSDVLQLVSDRPIDVEIRSVVDEITEKTKEVKLK---------
Q6ING5_XENLA/6-615------------------PSMQSAEDLVTQVHGLVSDV.DVLKSRIETEVKSDLKVAVNEFTELKQQLEKN---------
A7SSG2_NEMVE/20-670------------------DLSSSTSELNWKVSSLLKEI.DATTKKVKGSILPDLDAAAEEHANLVQQLKET---------
A8XRG3_CAEBR/1-605------------------LNINNTAKLIFDRLENLEDTAEMSSRELSNLIEQTEKDSPEMLAEIKTQARSC---------
Q4SPW6_TETNG/9-605------------------PSLQSSEQLMIQVDEVSKEM.EALKNCIKNEVWLDLNPTTKD.....RQADRS---------
ZW10_DROGR/1-567------------------PNHTSPDIFLEKSSALGDEISDLLAT.VGNEGLSVLSDASVELAALSRDLREK---------
ZW10_HUMAN/9-621------------------PSMQSAQGLITQVDKLSEDI.DLLKSRIESEVRRDLHVSTGEFTDLKQQLERD---------
Q16R15_AEDAE/1-545------------------PNCYDNMTIMKNGKLLEEEINKIVSM.VNQDTAWQLSMAQEHIQQHREELSEA---------
Q803G9_DANRE/9-612------------------PSMEGAEELLDQVESVSKDI.DLLKSCIENEVQQNLHDAVTEYAKLKQQLEKN---------
Q98TG8_CHICK/1-595------------------PGMQSAEELVARVDGLSRSV.DLLRAGVENEVQRDLTVAVAEFTELKQQLEQD---------

PF06046

Q4WPU5_ASPFU/183-757------------------GVIVMTEEKNDATVRALQEAQKD......HQDLAGRFKSMN.....................
EX3L4_HUMAN/179-709------------------ARVVSAEEEAHPSPPDDGDFLRT.......................................
EX3L1_DANRE/206-763------------------VRIVEREEALDQFFLEERRSTSG...............HNI.....................
A3LNE6_PICST/180-819------------------VKIVEYESNEDLKFSLMQSLGLNQS.RDVKTIDYASFR........................
A4RYX1_OSTLU/92-690------------------VRVVAEQEVLDEEFERDALTFEP...............ELDAAT..................
A5DIA8_PICGU/180-832------------------IKIIEFEANEDLKFSLLNKLDLL.........KARDMRIIN.....................
A5DY39_LODEL/293-930------------------IAIVLFEEKEDMKLQVTRNLGILTH.NIIQ..DYKNFR........................
A6RAW7_AJECN/390-965------------------ALIVMNEEKNDSKVRALQEAQKD......HKALASRFKSMN.....................
A7F9Q6_SCLS1/177-755------------------AVVIEAEEKSDKRVMALQEALKD......HKEMAARFKSIT.....................
SEC6_SCHPO/159-721------------------FKIVEAEESSDEVLKSIRDAKSS.....LPDSQDGPFLSLQ.....................
Q016Y9_OSTTA/124-721------------------LRVVAEQEVLDAEFERDAETFEP...............EFDPVT..................
TNAP2_HUMAN/122-651------------------LAVVAEQEREDRQAAAAGPGTSG...............L.......................
Q0TXU6_PHANO/187-762------------------AIIVEEEEKTDKKVKALQDAQRE......YKDLASRFRSIN.....................
EX3L1_BOVIN/188-722------------------VRVAEVDAGCTTSLEQA.............................................
Q16I77_AEDAE/179-730------------------LRIIEREEKADAFALQQQKQTGF...............I.......................
Q28ZN5_DROPS/179-731------------------LRIIEREEKNDQFAVQQQKVTGF.............LP........................
Q3SE84_PARTE/186-671------------------LQIIETADKSRELRKKE.............................................
TNAP2_MOUSE/157-688------------------LAVVSQEELEDRRASGGPLAAA................L.......................
Q4P8D1_USTMA/258-828------------------IKIVEKESREDERAAAIRLAKRA......NLEGAARFRSVV.....................
Q4RJ08_TETNG/178-739------------------VRIIEREEKIDRRMVDRRKQTGF...............I.......................
EXOC3_DICDI/183-774------------------AQIIEREKLHEQKQKEKKSQNSLIS.SEGIHDDDDDDDDTEVNLNNSNKQQNNENENSSSNN
Q5A7K3_CANAL/180-812------------------LGVVTWEENEDLKVSLLKSLDMVSA..DPKTVNYKTFR........................
Q5BBU2_EMENI/183-758------------------AVVVANEEKNDETVKALQEAQKD......HQDLAGRFKSMN.....................
Q5K9B3_CRYNJ/179-740------------------LKIIEVEGKEDEKAVAMRLVRKV.....TTTDAASKFKSMQ.....................
Q5RG40_DANRE/163-694------------------LISILQEEAQDRRWAEVSENQRP.......................................
Q69YP2_HUMAN/105-661------------------VRIIEREEKIDRRILDRKKQTGF...............V.......................
Q6BJB6_DEBHA/180-833------------------IKIIEFESNEDMKFELMSNLKLMENRSISS.IDYANFR........................
Q6C9T6_YARLI/183-804------------------AKIIDLEEREDLKATVLLEVNGKAK..QQNGGTGGGFRSPHMNGNSNNKN............
Q6CU40_KLULA/178-794------------------FKVIHVEECEDIKIIATRNIIKAKE.LESESKKSKKVSDKMSAFDTNNKKYTEY....PTAL
EX3L4_MOUSE/181-708------------------AQVVHLEEEAHQTSQAEGDFLST.......................................
Q6DJR6_XENTR/177-732------------------VRIIEREEKVDRRMMDRKKQTGF...............I.......................
Q6FPK2_CANGA/177-798------------------FKIIDFEEREDLRIEAIRNIIKKKE.IEAEKSTFKKLPSSKNIGRLELESNSKALE.YPTDQ
E9P8I5_YEASX/178-798------------------FKIYDLEEREDLRIEAIRNIIKKKE.IEIEKSSIKKLPNSKNTARLQDETPKVIE..YPTNK
Q873E6_NEUCS/175-753------------------ALIIEAEEKSDQRVLALQEALKD......HKEMATRFQSIT.....................
EX3L1_MOUSE/189-722------------------IRVAEVETER.TILGQA.............................................
Q8NAC4_HUMAN/132-655------------------VRVAEVETGRTTPLGQV.............................................
Q8SU74_ENCCU/160-687------------------VQIVEKEEARDELTRKVQEGEKS...............DNPVLKEF................
Q9M9G4_ARATH/172-724------------------LRVVEMQEILDQQLAEEAAEAEGEG.AMASVANPRRPGKKSTTTSAS...............

PF04091

Q4WDM8_ASPFU/443-722------------------.......-------------------------------------------------------
EXOC6_ARATH/442-755------------------...FTYI-------------------------------------------------------
Q753S5_ASHGO/493-835------------------...FSVT-------------------------------------------------------
Q6BHQ3_DEBHA/493-827------------------...MPIS-------------------------------------------------------
A5DMM0_PICGU/481-812------------------...MPVS-------------------------------------------------------
A8XM86_CAEBR/483-791------------------...FPRK-------------------------------------------------------
Q6CYE5_KLULA/488-829------------------...FSAT-------------------------------------------------------
Q8S5T3_ORYSJ/441-754------------------...FPYV-------------------------------------------------------
EXOC6_DROME/427-731------------------...FPKK-------------------------------------------------------
Q17EP0_AEDAE/418-723------------------...FPKK-------------------------------------------------------
EXOC6_RAT/455-763------------------...FPKK-------------------------------------------------------
A7TQS9_VANPO/505-846------------------...FSVT-------------------------------------------------------
Q6C1W0_YARLI/479-794------------------DGVFPKT-------------------------------------------------------
Q560L3_CRYNB/479-787------------------...FPQP-------------------------------------------------------
A6RZT9_BOTFB/417-719------------------...FPGV-------------------------------------------------------
A3LS60_PICST/479-812------------------...MPIT-------------------------------------------------------
SEC15_SCHPO/435-740------------------...FPRT-------------------------------------------------------
Q7RYL2_NEUCR/450-733------------------.......-------------------------------------------------------
Q0CL01_ASPTN/446-728------------------.......-------------------------------------------------------
A7E4G0_SCLS1/408-698------------------...FQQI-------------------------------------------------------
O81298_ARATH/430-736------------------...FPFI-------------------------------------------------------
Q0UFZ1_PHANO/442-734------------------.......-------------------------------------------------------
A6R9C0_AJECN/443-746------------------...FPCV-------------------------------------------------------
Q4P319_USTMA/445-765------------------...FPLS-------------------------------------------------------
Q7XEN0_ORYSJ/441-754------------------...FPYV-------------------------------------------------------
A5BA73_VITVI/441-754------------------...FPYF-------------------------------------------------------
SEC15_YEAST/520-865------------------...FAVT-------------------------------------------------------
Q4SZ84_TETNG/313-614------------------...FPKK-------------------------------------------------------
Q6FRK2_CANGA/500-842------------------...FSVT-------------------------------------------------------
A5E457_LODEL/495-827------------------...FPVK-------------------------------------------------------
EXOC6_DICDI/691-995------------------...LPKS-------------------------------------------------------

PF09763

Q75AA6_ASHGO/631-1297SDLNELLSGLLVFSSL----------P----------------------L--------F---CKDVSEHTF---------
A5DBH0_PICGU/582-1282SAIYHELSNQLIYSSF----------V----------------------F--------F---LKDVSISDF---------
A3GH85_PICST/625-1329HILLRELNNMLIYTGI----------T----------------------Y--------F---VKECGAIEF---------
Q6FRC5_CANGA/652-1329EQVMNILNNLLVFSPL----------I----------------------L--------F---CKIMSPESY---------
A6QQU0_BOVIN/176-464PNHHPFHRDLLRYAKL----------M----------------------E--------W---LKSTDYRKY---------
Q2UK85_ASPOR/702-1427RAREYFRRELWMYNAL----------M----------------------L--------F---AKEVSGAEW---------
A7TSV5_VANPO/776-1455DQLTNILGRLLIYSSL----------T----------------------S--------F---CKDISPERY---------
Q6CQX3_KLULA/540-1218ENTKEALTNTLVFSSL----------T----------------------L--------F---CKDVSMKSY---------
Q57ZX4_TRYB2/198-1064KMHLGVTNMMTSFQEL----------I----------------------K--------T---LRYVDFEGF---------
EXOC1_DROME/186-866PNHSNVHRELTPYTEL----------M----------------------H--------W---TKAMDRKTY---------
A7E4X8_SCLS1/708-1443RHHDLARNILWRYSPL----------M----------------------L--------F---SREVAPDEW---------
Q4RKW7_TETNG/106-846PKHNPLHRDLLRYAKL----------M----------------------E--------W---LKNTQREMY---------
Q6C0U5_YARLI/751-1484PGLISTVNSLYKFAGI----------I----------------------L--------F---IRDVDQTAY---------
Q2GRZ6_CHAGB/575-1334RNHEPGRDLLWMYSPL----------I----------------------L--------Y---ARDVDLDNW---------
Q5K9I2_CRYNJ/475-1177ESHQKMGEKLMIYTGL----------V----------------------L--------Y---IKEMDDARY---------
Q7T2A6_DANRE/169-869PKHSPLHRDLLRYAKL----------M----------------------E--------W---LKNTQREKY---------
A7RVQ5_NEMVE/151-846PKHLNCHKDLLPYTGL----------M----------------------K--------W---LKVVDQELF---------
Q5TMX8_ANOGA/189-872PKHQNVHKELCTFMEL----------M----------------------H--------W---MKTMDRKAY---------
Q10GJ4_ORYSJ/212-854PDHADLRYKCRTYARL----------L----------------------Q--------H---LKSLDKSCL---------
Q4PFK6_USTMA/462-1173RDHAPMEEVLGQYCGL----------L----------------------L--------Y---MREVSSATF---------
A6ZQV5_YEAS7/640-1316DQMIRILTTLLIFSPL----------I----------------------L--------F---CKEISQKSY---------
Q7S5W6_NEUCR/694-1488RNHEAGRDILWMYSPL----------I----------------------L--------Y---AKEVDVANW---------
A5E4P0_LODEL/994-1796ELFITALSLLLFYSGI----------T----------------------Y--------Y---MREVGATHF---------
EXOC1_DICDI/95-855PDYLEYYDLLRKFKPL----------V----------------------N--------W---LKEMDHEKL---------

PF04129

VPS52_YEAST/47-607PSQRIQN.KLLKVQKI----------F----------------------P--------F---IRDNNLSLA---------
VPS52_SCHPO/1-508DVFPIRKHRLIANKNY----------Y----------------------L--------F---LFKFNRKLA---------
Q9VMQ8_DROME/42-546NYQIPQN.AMLKHKFF----------F----------------------E--------F---ILSNERHVA---------
Q9FVV3_ARATH/83-615NIQILQQSVLLKYKYI----------I----------------------S--------F---LKEHGKEVF---------
VPS52_RAT/94-601NYQIPQT.ALLKYRFF----------Y----------------------Q--------F---LLGNERATA---------

PF15278

B6K1Q5_SCHJY/526-611--------------------------------------------------------------------------------
YD6C_SCHPO/520-605--------------------------------------------------------------------------------

PF06419

COG6_CRYNJ/69-690EAQLEA...SSVMRQA----------I----------------------C--------R---LRD-RPALL---------
COG6_EMENI/58-693LEDPQI...SGTIRQA----------L----------------------R--------V---LAE-RPSLF---------
COG6_ASPFU/55-708LEDPRI...SSSIRRA----------L----------------------R--------V---LAE-RPSLF---------
COG6_PICGU/131-737LNNRDR...VRTLHQC----------F----------------------V--------Y---LRH-RPHYL---------
COG6_DEBHA/132-759LNTTTK...LTTLHQC----------L----------------------K--------F---LRK-RLNYF---------
COG6_HUMAN/55-656QESCDV...SPVLTQA----------M----------------------E--------A---LQD-RPVLY---------
COG6_CANGA/175-819HVIDPTERNLALFQKG----------L----------------------V--------Y---LSN-DIQYY---------
Q6C1G5_YARLI/25-595TDNFKQ...DPQLRER----------L----------------------S--------L---LND-..VNR---------
COG6_ASPNC/57-685LEDPRI...SSSIRRV----------L----------------------R--------V---LAE-RPSLF---------
COG6_YEAST/181-824HGTTEQE.SLNIFRKS----------L----------------------V--------F---LSS-DLELF---------
COG6_PHANO/54-693LENPQI...SASVRRS----------L----------------------R--------V---LAE-RPTLF---------
COG6_ASPOR/121-774LEDPRI...SSSIRRA----------L----------------------R--------V---LAE-RPSLF---------
COG6_CHAGB/46-689LENPQI...GSSIRHA----------L----------------------R--------V---LAE-RPSLF---------
COG6_COCIM/32-673LEDPQM...GSSIRKG----------L----------------------R--------V---LAE-RPTLF---------
COG6_SCHPO/43-650PQTAQTLEANSHLKKA----------F----------------------T--------K---LFS-EPTMV---------
Q17KR7_AEDAE/31-620.DANEI...GMLVIQA----------M----------------------A--------R---LQE-RPVLF---------
COG6_ASHGO/158-791RNFEGDNVGLSSF.NA----------V----------------------W--------Y---TCP-PTGGT---------
COG6_PICST/153-782LNSKAR...LRTLHQC----------M----------------------R--------Y---LKN-KLNYF---------
Q7QJN1_ANOGA/31-623.ESNEM...GVLIVEA----------M----------------------A--------R---LQE-RPVLF---------
A7SZM3_NEMVE/34-607SDLPDI...SPTLTKA----------M----------------------A--------C---LED-RPVLF---------
COG6_CANAL/144-758LSSKSR...LATLHQC----------F----------------------K--------Y---LQN-KLNYF---------
COG6_MAGO7/53-703LESPQL...GSAIRRA----------L----------------------R--------A---LAE-RPSLF---------
COG6_KLULA/138-763RTIGDE..SLSNFQTS----------L----------------------I--------H---LSN-DVQFF---------
COG6_SCLS1/52-643LENPQI...SSSIRRA----------L----------------------R--------V---LAE-RPSLF---------
COG6_DROME/34-627.ENNEI...GPLIVEA----------M----------------------S--------R---LQD-RPVLF---------
COG6_CAEEL/37-623VDSHQK...KQILSKA----------F----------------------K--------I---ISQ-NDAVF---------
COG6_ASPTN/56-707LEDPRI...SSSIRRA----------L----------------------R--------V---LAE-RPSLF---------
COG6_NEUCR/63-712LENPQI...GSAIRRA----------L----------------------R--------V---LAE-RPTLF---------
Q00T18_OSTTA/85-728EDDFITEGDERTLRKA----------V----------------------R--------E---LRS-RPTLF---------

PF03081

Q5Z4V4_ORYSJ/278-638-KACVEIQT..RTREL..........V----------------------K--------R---VVDGSVEIF---------
EXOC7_DICDI/436-836-RDGKHIS...ELKTQ..........I----------------------K--------H---LQDTCASLL---------
EXO70_DEBHA/215-612-..........AFNEN..........Y----------------------H--------Q---LINISSEIF---------
A5DE46_PICGU/207-601-......MD..RFNDA..........Y----------------------G--------R---LTQSSRNIF---------
A2QCL9_ASPNC/266-651-..........LFIEA..........L----------------------R--------P---VRETAKSSL---------
Q5KMS6_CRYNJ/297-673-TPQSPATT..ELVTALD......QSV----------------------N--------T---LRSLSLRSF---------
Q9SF51_ARATH/232-603-DSISVVRS..LALKS..........L----------------------I--------S---LSESIRSLL---------
Q5QLT4_ORYSJ/188-532-..........EVAAL..........R----------------------E--------C---LGLSIKAIL---------
Q7XPT9_ORYSJ/273-640-NACSENQK..SALTL..........T----------------------K--------S---LAQTAKKTI---------
EXO70_YARLI/227-601-...........LDRL..........I----------------------Q--------S---SYNVSQGVF---------
Q9LZD3_ARATH/267-627-KACLEIRD..SATGL..........T----------------------K--------R---LAQTAQETF---------
Q5ZIN3_CHICK/309-677-...TAAGTKNKLPGL..........I----------------------T--------S---METTGAKAL---------
A2WY31_ORYSI/215-549-PHKELVAE..RSEEI..........L----------------------A--------K---LAMSIRSMV---------
A2YJD7_ORYSI/54-381-..........QLNGI..........T----------------------K--------E---LRKCVRKIL---------
Q6ES92_ORYSJ/191-595-SGSSRHGQ..EAQVFDGMDGIFLRKR----------------------K--------K---LSDAIWDMM---------
Q9SIB0_ARATH/209-553-DSTSTVRS..QVDLT..........L----------------------V--------N---LREGVVSMI---------
A5C6J8_VITVI/270-630-EAGASIRI..DFHKL..........Q----------------------R--------E---LGDAAGATF---------
Q9LQP9_ARATH/237-588-DSTAAVRL..QANES..........L----------------------E--------K---LSESVNAMM---------
EXO70_CANAL/229-666-..........NFINT..........F----------------------E--------Q---YLETNSVIF---------
A5E7C7_LODEL/212-655-...........FDRS..........L----------------------R--------S---FLELGSEIF---------
EXO70_GIBZE/245-630-..........ALAAA..........L----------------------K--------P---VRETAKSSL---------
EXO70_ASHGO/230-612-..........QLLEC..........E----------------------A--------E---LKSISESLF---------
A2YJD9_ORYSI/318-664-ELKESFTG..ELHKI..........L----------------------H--------T---LKDGTKETL---------
A2XSN9_ORYSI/302-674-NSGNDVIC..DLEGV..........L----------------------E--------R---LGDAVKGTL---------
A6SNP3_BOTFB/246-636-..........SFASA..........L----------------------K--------P---IRETAKGSL---------
Q6Z5V5_ORYSJ/162-505-EQKEFFVR..ELHRI..........L----------------------D--------T---LEDSAREIL---------
Q0WPK8_ARATH/246-618-KSSDSIRV..QAAGI..........L----------------------S--------R---LAEAARGIL---------
A2DS47_TRIVA/251-594-EDFQTYAV..QLAQL..........S----------------------H--------M---FHAGIERCL---------
Q9FY95_ARATH/272-641-QSDSDLIQ..EIKLA..........Q----------------------T--------R---LGEAAVTIF---------
Q9M3D4_ARATH/241-604-DAVAGVKS..QALTS..........L----------------------Q--------K---LKVSIHSAL---------
A2YSN5_ORYSI/155-523-MQALDAMNNGILMQS..........R----------------------R--------K---LSDAIWVMM---------
Q9FNR3_ARATH/272-623-ETGSSLRI..AFHNL..........S----------------------K--------K---LADHTTTTF---------
A7TQI9_VANPO/236-622-..........PIEEC..........Y----------------------R--------V---VSKLTQEPF---------
EXO70_SCHPO/244-610-..........SFLGF..........V----------------------N--------G---VGREMEKIL---------
A2YXE5_ORYSI/221-597-DARDFFSS..EVAGV..........A----------------------A--------Q---LGSTIRHTI---------
Q4PDG8_USTMA/293-725-STSPIDRAELDLNTGFAPAAEVLEIY----------------------S--------K---LKNTAIGIF---------
A5BYE5_VITVI/322-667-EAGADICL..RFREL..........T----------------------K--------L---LVHSSSKVF---------
Q2QX89_ORYSJ/323-687-TALTDLKH..ELNSV..........R----------------------S--------R---LGEFAAAIF---------
Q9SF50_ARATH/227-599-PSISNVRT..QAHSS..........L----------------------S--------R---LSESILAHL---------
EXO70_CANGA/234-621-..........QLIDA..........D----------------------K--------Q---VKDVTRSLF---------
Q0U449_PHANO/246-624-..........QIYDS..........V----------------------K--------P---VRETSKMSM---------
Q6Z5U7_ORYSJ/196-558-DAKERFAG..ELERT..........L----------------------A--------S---LGVAVRGIL---------
Q5TQS7_ANOGA/314-704-......TQKQQLSGV..........L----------------------N--------R---LQQTASKAL---------
Q0WPV2_ARATH/303-668-...CFVCN..ETKGV..........L----------------------E--------A---LGDAARGTF---------
A8XF23_CAEBR/258-601-SIGDV.....QFDSL..........M----------------------R--------Q---LQVKCSSYV---------
A3LWD2_PICST/217-612-...........FDNS..........I----------------------A--------L---FITKSSVLF---------
EXO70_KLULA/233-617-..........YLNSE..........L----------------------I--------E---IQRISHSLF---------
Q9LMJ4_ARATH/246-593-RYCSPLRH..EALAI..........H----------------------K--------R---LGEAIRGIF---------
Q9C8H6_ARATH/253-624-EQCSEIRR..VTREL..........I----------------------S--------N---LVKGVSEIF---------
A3BAD3_ORYSJ/211-560-DAKDAISQ..EADML..........L----------------------E--------K---LREEAVRLL---------
Q60EX4_ORYSJ/153-510-DSDEMLQG..LLNKTSNI...FSTAK----------------------D--------N---LGQAIQRMA---------
Q69JW6_ORYSJ/345-697-RTEQIVLA..EFRGL..........I----------------------D--------R---SSSTVLQLF---------
Q6YZW7_ORYSJ/295-656-ESATLLAIRERAREV..........E----------------------R--------A---LARAAAAAF---------
Q9LIA2_ARATH/265-644-HPGSSVRT..EYREV..........M----------------------R--------R---LGDCARTTF---------
Q8H150_ARATH/227-595-ESAAAVRS..QVINS..........L----------------------A--------R---LGDATRLMM---------
A2WYH2_ORYSI/258-597-RPEEFSVA..RYDDT..........L----------------------Q--------K---LRMAMYHML---------
B9FJQ2_ORYSJ/298-655-PYSAALRA..EVTAV..........C----------------------N--------T---LGSSIKGIF---------
A2YA16_ORYSI/142-483-STAAADAA.................L----------------------A--------A---LVDAARRCV---------

PF15469

A4RXA7_OSTLU/41-217--------------AR----------L---------------------.S--------R...AWKSARESL---------
A6ZYC4_YEAS7/144-361--------------KK----------V---------------------.D--------E...VIRTTTFKL---------
A7TRG2_VANPO/143-342--------------EK----------I---------------------.D--------D...QVKFTNLKL---------
A8IS87_CHLRE/340-518--------------RS----------L---------------------.E--------Q...VENNARRTF---------
A8PCF2_COPC7/122-323--------------DQ----------L---------------------.K--------Q...AAQKANQVF---------
A8PUN7_MALGO/110-314--------------TS----------V---------------------.T--------S...ANSQADDVF---------
A8QHB2_BRUMA/204-382--------------EK----------L---------------------.T--------E...SHTAANAVF---------
A8WPA7_CAEBR/200-378--------------KL----------I---------------------.K--------D...SKLKAESVF---------
A9RNH0_PHYPA/252-430--------------NA----------I---------------------.A--------E...VVVVAKRAF---------
A9S1F4_PHYPA/259-437--------------NA----------I---------------------.G--------E...VDVFAKRAF---------
B0ET40_ENTDS/59-222--------------SQ----------A---------------------.K--------E...SSDILFSKI---------
B0W3D0_CULQU/193-383--------------VA----------I---------------------.Q--------K...SIDASHELF---------
B2RBE6_HUMAN/198-377--------------NV----------L---------------------.N--------R...ASNTADTLF---------
B3MVG4_DROAN/193-383--------------AS----------I---------------------.E--------N...SITESQKIF---------
B6K5G3_SCHJY/147-340--------------TD----------L---------------------.D--------K...VLSTFQSSS---------
B7PR09_IXOSC/148-326--------------EA----------V---------------------.L--------R...SKEEAENIF---------
B8ATQ6_ORYSI/262-452--------------SV----------T---------------------.Q--------K...ISGVANRAF---------
B8BR17_THAPS/466-647--------------GI----------A---------------------.D--------S...CSDQARKSF---------
B8P2C9_POSPM/114-312--------------DH----------L---------------------.K--------L...SAQKADQVF---------
C3XUC7_BRAFL/191-370--------------TL----------L---------------------.N--------N...ANDKANAMY---------
C4M2W7_ENTHI/111-299--------------IK----------M---------------------.Q--------EKYNELLNSLSSI---------
C4R5S5_PICPG/139-344--------------NL----------I---------------------.E--------E...TMARSNELL---------
C4YAI9_CLAL4/138-372--------------KS----------I---------------------.N--------N...LNLSSTLMI---------
C5DMT2_LACTC/144-330--------------ET----------V---------------------.D--------E...SIREITIKV---------
C5DYM3_ZYGRC/146-354--------------DK----------V---------------------.D--------D...AIRATTLKL---------
C5MH42_CANTT/104-348--------------EN----------I---------------------.S--------N...LMNSTSASI---------
D0MT24_PHYIT/66-241--------------GD----------M---------------------.Q--------N...LSRMTDASL---------
D5GNN2_TUBMM/147-347--------------GY----------L---------------------.N--------D...AGAKADEVF---------
D6W674_TRICA/193-371--------------KS----------I---------------------.K--------E...SEREGRKLF---------
D7KJZ0_ARALL/260-438--------------NC----------M---------------------.K--------S...VTSRANRAF---------
D8QDB4_SCHCM/114-323--------------DQ----------L---------------------.K--------E...AAIKADQVF---------
D8RD25_SELML/239-417--------------HA----------I---------------------.Q--------D...LDEVAKRAF---------
E0S9H6_ENCIT/50-261--------------NN----------I---------------------.K--------V...VEEKFRKMT---------
E0VQL4_PEDHC/200-377--------------IK----------I---------------------.Q--------I...SKEEACRLF---------
E2AW35_CAMFO/194-372--------------KA----------I---------------------.R--------Q...SMSEANKLF---------
E3K655_PUCGT/121-321--------------ES----------L---------------------.R--------L...CTSKADQVY---------
E4XNP2_OIKDI/201-392--------------GL----------L---------------------.K--------K...AESRSYNLF---------
E6QYJ0_CRYGW/114-305--------------EI----------F---------------------.K--------V...AAHRADQVF---------
E6ZLD0_SPORE/109-315--------------TI----------L---------------------.A--------N...ASAKADQVF---------
E7R2N5_PICAD/151-341--------------ES----------I---------------------.A--------K...ANTSSTMML---------
E9C1C0_CAPO3/243-420--------------SI----------I---------------------.N--------E...ASHYAHDEF---------
E9G6B5_DAPPU/193-371--------------NS----------I---------------------.L--------S...AKTEAGRLF---------
F0W4R3_9STRA/41-214--------------KA----------A---------------------.E--------S...LTSITNSSL---------
F0ZXN2_DICPU/132-311--------------SS----------F---------------------.T--------K...IINKSSDVY---------
F2UAY3_SALS5/207-386--------------ES----------I---------------------.S--------K...LEETTHATY---------
F4PCT9_BATDJ/225-428--------------KA----------L---------------------.E--------E...LESNANNLY---------
F4PGL2_DICFS/126-305--------------GS----------F---------------------.K--------K...IIDKSEVVY---------
F4Q787_DICFS/187-364--------------DQ----------L---------------------.Q--------D...SGKRFVEKA---------
F4RSS6_MELLP/56-255--------------ES----------L---------------------.K--------S...ATSKAEQVY---------
F6Q8U3_CIOIN/201-380--------------ST----------L---------------------.N--------E...ASENANKLF---------
F6YQX0_XENTR/198-380--------------KV----------L---------------------KT--------R...SKNVHFLLF---------
F8NGV0_SERL9/40-233--------------..----------I---------------------.I--------G...AAVKANQVF---------
G0VBU0_NAUCC/150-340--------------EK----------V---------------------.D--------E...SIRITNLKL---------
G0WGP4_NAUDC/153-350--------------EK----------V---------------------.D--------E...SIRSINLKL---------
G1XK06_ARTOA/190-398--------------TP----------L---------------------.N--------A...AQAQAETLF---------
G3AUN6_SPAPN/128-368--------------SA----------I---------------------.N--------N...MNTTTSLMI---------
G4TT08_PIRID/115-310--------------EH----------L---------------------.K--------N...ATTKADTVF---------
G4VNQ3_SCHMA/214-394--------------SI----------L---------------------.Y--------D...TRTLGHRLF---------
G6D800_DANPL/194-372--------------SA----------I---------------------.E--------E...SITLADSLF---------
G7DSD2_MIXOS/124-323--------------ET----------L---------------------.R--------A...ATSKADQVF---------
G7IVK4_MEDTR/51-227--------------NI----------I---------------------.Q--------G...VSSQANYAF---------
G8BGG9_CANPC/145-407--------------SS----------L---------------------.N--------N...MATTTTLMI---------
G8BMU6_TETPH/145-338--------------GK----------L---------------------.D--------D...AVKATNQRL---------
G8JTD1_ERECY/120-302--------------ES----------L---------------------.N--------N...MVRATTMKL---------
G8XZB2_PICSO/148-394--------------ES----------I---------------------.N--------N...VNMATSLVI---------
G8ZXE8_TORDC/144-345--------------SK----------V---------------------.D--------E...SITATTLKL---------
H2AR86_KAZAF/151-365--------------EK----------V---------------------.D--------E...SIRATTLTL---------
H2KP67_CLOSI/214-393--------------AS----------L---------------------.S--------E...SRNLGYELF---------
H2ZFP8_CIOSA/151-287--------------TT----------L---------------------.N--------E...ASENANTLF---------
H3ERJ1_PRIPA/197-373--------------DK----------V---------------------.S--------Q...AREKAESVF---------
I0ZAT9_9CHLO/267-451--------------DT----------V---------------------.R--------E...VKTVAEHAF---------
I1GNJ4_BRADI/14-163--------------..----------.---------------------..--------....VQSRSDTVN---------
I1NBC3_SOYBN/28-188--------------..----------.---------------------..--------....VQSRSDSVN---------
SEC5_SCHPO/139-329--------------MC----------E---------------------.E--------S...ISGALQQLQ---------
Q019K9_OSTTA/44-232--------------AR----------C---------------------.E--------R...ASRLARDGL---------
Q232N2_TETTS/349-532--------------VS----------Q---------------------.T--------N...LEKSVDVVN---------
Q6CGI4_YARLI/146-334--------------QS----------L---------------------.D--------E...GNSKAAILM---------
Q6CQH1_KLULA/148-350--------------EN----------L---------------------.N--------E...TMKQTSLKL---------
Q6FVL5_CANGA/149-372--------------EE----------L---------------------.D--------E...TIRFTTQKL---------
Q750U7_ASHGO/122-304--------------ES----------V---------------------.N--------N...MVRGTTMKV---------

PF04124

COG8_MOUSE/56-394--------------DR----------L......................P--------R---FQQSCRNFV---------
COG8_SCHPO/15-354--------------LH----------T......................N--------Q---LYEPVKRSQ---------
COG8_YEAST/28-381--------------KS----------L......................E--------Q---LWELDTNIN---------
COG8_CAEEL/10-353--------------DQ----------A......................E--------E---LTSAFVEFR---------
Q9LYH5_ARATH/29-412--------------LK----------LVEVGGVRGIVFGAFNSFGIGEVP--------K---LTSGCTEFI---------
COG8_DROME/37-379--------------SK----------L......................P--------D---LSVQCERFL---------
Q9P3N9_NEUCS/31-347--------------HS----------I......................P--------K---LDHEAVRFS---------

PF08700

COG5_MOUSE/37-120--------------AK----------L----------------------A........Q---GISQLDKEL------H--
EXO84_CRYNJ/142-228--------------AA----------L----------------------M........R---EKQANKKEL------Q--
Q6BJZ0_DEBHA/76-158--------------KN----------Y----------------------K........Q---NVTNAKEDL------H--
Q0U0Z3_PHANO/76-170--------------AD----------L----------------------VSPLLANDIQ---EIRNLDSDR------K--
Q0WQ75_ARATH/43-129--------------VQ----------M----------------------A........A---EIKNLDTDL------Q--
Q5KJF4_CRYNJ/98-180--------------AK----------M----------------------R........S---EALNKQSEL------R--
Q173I8_AEDAE/5-87--------------KR----------L----------------------Q........A---ELELKREEL------R--
A2D783_TRIVA/6-88--------------ES----------A----------------------Q........T---EIEHKQNVL------R--
Q7Q6Z6_ANOGA/11-97--------------AT----------I----------------------V........R---QTQTLHSDM------Q--
Q2UQ54_ASPOR/108-197--------------NT----------L----------------------V........G---DIKTLDSER------K--
Q7S488_NEUCR/247-341--------------AR----------I----------------------L........S---EIRALDAEK------K--
VPS51_YEAST/84-163--------------NK----------L----------------------L........G---KETETNNSI------K--
A2E266_TRIVA/29-115--------------LT----------I----------------------K........K---EIHDLDGSL------Q--
Q2U987_ASPOR/1-88--------------QE----------L----------------------R........R---DIASNKEKL------R--
Q6FRQ2_CANGA/66-146--------------NT----------L----------------------L........G---KETATNSSI------K--
Q6CSC3_KLULA/100-179--------------NL----------L----------------------L........A---EETEADNAI------K--
Q4SXW2_TETNG/10-92--------------RK----------V----------------------R........G---EIEQKKEEL------R--
EXO84_GIBZE/128-214--------------ES----------L----------------------R........Q---VKTRVGTDL------Q--
Q75HJ9_ORYSJ/40-126--------------SY----------L----------------------Q........D---LKKASSEEM------R--
EXOC8_MOUSE/13-100--------------QR----------V----------------------Q........A---LAEETAQNL------K--
Q4P2N5_USTMA/76-162--------------SE----------L----------------------I........V---QIRELDGER------Q--
Q4PEG0_USTMA/79-161--------------RA----------V----------------------R........S---TALGKQEEL------R--
Q8I2A9_PLAF7/116-202--------------KK----------V----------------------D........K---EIKQNDSCM------Q--
Q6CG64_YARLI/77-166--------------NS----------L----------------------L........Q---SIRVLQSEQ------K--
Q4E335_TRYCC/3-85--------------ST----------I----------------------T........R---GIQESDYRL------K--
EXO84_YARLI/121-207--------------SK----------L----------------------K........S---LKSRLVDEQ------R--
Q4MZL9_THEPA/63-149--------------RK----------L----------------------E........R---EIRQLTAGK------Q--
COG1_SCHPO/7-89--------------KF----------V----------------------S........Q---QIEEKGREL------Q--
Q59L27_CANAL/17-99--------------KK----------Y----------------------R........N---IIDDTKSNL------H--
Q2UHE7_ASPOR/121-207--------------RS----------L----------------------K........K---VKNRTSTDL------Q--
Q7RZT4_NEUCR/9-91--------------KA----------L----------------------H........A---EIDDKQSRL------R--
Q8SWU0_DROME/4-91--------------KE----------I----------------------E........A---YNETTAATL------K--
E9AC89_LEIMA/3-81--------------ST----------V----------------------T........R---CIEDNQHDL------R--
A2GBI6_TRIVA/24-110--------------NQ----------I----------------------I........S---EIRTYENEL------Q--
Q4Y221_PLACH/14-100--------------KK----------M----------------------E........K---EIKQNDNSI------Q--
EXO84_ASHGO/127-213--------------SN----------L----------------------N........H---LSQEIEQEI------K--
Q8LCN9_ARATH/18-103--------------EL----------L----------------------R........V---DAERIQRQM------Q--
FFR_DICDI/178-264--------------NQ----------M----------------------V........S---EIRTLDGDM------K--
YEWA_SCHPO/52-138--------------KS----------L----------------------V........A---SIQGLSVDH------R--
Q9FFF3_ARATH/21-103--------------SA----------T----------------------R........K---NIEDKKEEL------R--
Q4P6W6_USTMA/184-270--------------SS----------L----------------------A........A---VKQAANDDL------K--
Q1WMT0_COPDI/48-130--------------AR----------L----------------------R........N---DADIKQEEL------R--
COG1_DICDI/113-195--------------FK----------K----------------------R........S---EIEDMKSQL------R--
A2FRD0_TRIVA/32-118--------------IS----------L----------------------V........A---DIESLDNDM------Q--
A0C9R8_PARTE/6-92--------------NQ----------L----------------------Q........S---EIKEYDQDI------Q--
Q00XX6_OSTTA/568-650--------------RR----------T----------------------R........R---EASEKAEAL------R--
EXO84_CANGA/190-276--------------SN----------L----------------------T........E---LSTDVQEEV------K--
Q754G8_ASHGO/53-137--------------NL----------L----------------------L........G---RETAANNSI------K--
FFR_CHICK/57-143--------------AT----------L----------------------G........R---EIRALDSDM------Q--
Q55VT5_CRYNB/54-140--------------AS----------L----------------------S........S---DIGRLQGTR------H--
Q95Q35_CAEEL/9-99--------------SE----------M----------------------G........A---LNHASQETL------K--
Q6C0N6_YARLI/24-102--------------QQ----------L----------------------R........S---KKDRRNEEL------R--
Q5DTY3_MOUSE/20-102--------------RQ----------V----------------------R........A---EIEHKKEEL------R--
Q5CPU5_CRYPI/48-125--------------KE----------L----------------------N........K---MIQNYQAEM------Q--
Q4DYG1_TRYCC/45-131--------------TQ----------L----------------------L........R---NVRQLDGEL------Q--
Q5ZAZ1_ORYSJ/7-89--------------GA----------T----------------------R........R---EISAKEEEL------R--

PF06148

Q0TYI9_PHANO/26-159--------------SE----------L----------------------R--------S---RSQLLSKEL------L--
Q29BE0_DROPS/22-154--------------DN----------L----------------------G--------L---YLKGLRSAM------I--
Q7QFV1_ANOGA/25-157--------------DD----------L----------------------G--------L---YLKVLRSAM------I--
Q84LH7_ORYSJ/24-156--------------AE----------L----------------------R--------S---HLASLRAEL------V--
Q9ASS9_ARATH/31-163--------------SE----------L----------------------R--------S---HLASLNREL------V--
Q01CT5_OSTTA/52-184--------------EA----------L----------------------D--------A---YEKEVKARL------E--
Q5K8I4_CRYNJ/34-165--------------GE----------L----------------------R--------E---YLGELREEL------V--
Q4P841_USTMA/85-240--------------SD----------L----------------------R--------S---YSEKLKDEL------Y--
A1C4Y0_ASPCL/32-165--------------QE----------L----------------------R--------N---LDQLLSREL------L--
Q2UA29_ASPOR/27-160--------------QE----------L----------------------R--------D---LDQLLSREL------L--
COG2_HUMAN/15-147--------------DD----------L----------------------E--------L---YYKLLKTAM------V--
Q0C728_AEDAE/17-149--------------DD----------L----------------------G--------V---YLKVLRSAM------I--
Q5BZC0_SCHJA/41-174--------------DD----------L----------------------L--------Q---YSNILKSSL------I--
A8WN13_CAEBR/23-155--------------QD----------L----------------------R--------L---YLKSVQNSM------I--
Q383M1_TRYB2/46-232--------------RD----------L----------------------E--------T---YMSLLNKII------L--
Q4DNE3_TRYCC/72-246--------------RD----------L----------------------E--------A---YATLLDRSI------L--
Q4Q0F6_LEIMA/80-262--------------RD----------L----------------------H--------A---YVEYLEDKI------A--
A0CKT7_PARTE/12-141--------------PQ----------I----------------------A--------Q---IQSQTCEDI------A--
COG2_DICDI/53-185--------------KD----------L----------------------R--------E---YSKHLDSEL------I--

PF10392

COG5_HUMAN/66-189--------------AK----------L----------------------A--------Q---GISQLDREL------H--
Q6BT79_DEBHA/15-147--------------KK----------L----------------------K--------F---DIDECDKRM------A--
Q5B379_EMENI/829-961--------------SR----------V----------------------L--------F---DLQEIDTHI------H--
Q5APN5_CANAL/17-149--------------KK----------L----------------------K--------F---DIQECDKRI------E--
COG5_SCHPO/8-139--------------KR----------L----------------------G--------Y---ALKEVERQI------T--
COG5_YEAST/14-146--------------KK----------L----------------------N--------Y---DLHEIDSRI------D--
Q9C9V9_ARATH/57-180--------------ER----------L----------------------H--------Q---AIRLLDSQL------R--
Q0U7T7_PHANO/13-145--------------SR----------V----------------------L--------F---DVQEVDTHI------D--
Q2HI55_CHAGB/25-157--------------SR----------V----------------------L--------F---DIQEIDSHI------D--
Q5KKM0_CRYNJ/10-154--------------AR----------L----------------------N--------Y---GIEDVTKQL------R--
Q6CLE2_KLULA/11-144--------------KR----------C----------------------S--------Y---DLQELDRRI------E--
COG5_DICDI/63-186--------------NT----------L----------------------T--------S---CTRELGQEL------T--
Q6C2T6_YARLI/5-136--------------KK----------I----------------------S--------Y---DVQHLDDQV------R--
Q75B18_ASHGO/11-144--------------KQ----------V----------------------N--------Y---DIVEVDKRI------D--
Q6FTM6_CANGA/9-140--------------KK----------A----------------------Q--------Y---DADELKSRY------E--
Q65XH1_ORYSJ/52-175--------------EQ----------L----------------------Q--------E---AIRLLRRHL------R--

PF04100

VPS53_CAEEL/29-391----------....AS----------V----------------------E--------G---EIGELDNEL------A--
VPS53_HUMAN/39-453----------....NK----------I----------------------R--------L---KIRRLDDNI------R--
Q9VQY8_DROME/42-434----------....QK----------M----------------------Q--------C---EVSLIDDNI------R--
Q9C6Q3_ARATH/1-444----------....QK----------I----------------------Q--------G---EIRRVDASI------L--
YDLF_SCHPO/16-394----------..LSER----------L----------------------Q--------E---SVKKLDANK------K--
VPS53_YEAST/5-369----------RSYKKQ----------L----------------------Q--------E---DILKEENEL------K--
Q9C6I3_ARATH/1-331----------....QK----------I----------------------C--------D---EIRRVDATI------L--

PF10475

Q7QF78_ANOGA/99-388--------------GV----------L----------------------R--------R---QHRVISKKV------L--
Q336V4_ORYSJ/131-419--------------TL----------R----------------------L--------A---QLDKIAERL------S--
Q012F3_OSTTA/52-350--------------ER----------L----------------------S--------E---LADRVSSAL------N--
Q54MU4_DICDI/72-370--------------KQ----------F----------------------T--------R---AMDYVNSKL------Y--
Q6JJ34_IPOTF/130-420--------------AS----------R----------------------L--------A---QLDRIAERL------S--
CC132_CHICK/54-327--------------DK----------L----------------------K--------Q---QQ.......------.--
Q16RR9_AEDAE/70-360--------------GT----------L----------------------K--------Q---QHKVISKKV------L--
A1ZAY8_DROME/75-362--------------AQ----------L----------------------R--------T---QQKVLTKQV------L--
Q54NV0_DICDI/113-401--------------VK----------I----------------------S--------G---YHEAVDSRF------N--
Q8RXC2_ARATH/132-421--------------TL----------R----------------------L--------V---QLDKVAETL------S--
Q18602_CAEEL/76-363--------------FR----------L----------------------K--------S---QHTVVSKKI------S--
A8XSD2_CAEBR/80-367--------------FR----------L----------------------K--------S---QHTVVSKKI------S--

PF04048

Q7PY10_ANOGA/23-144--------------LK----------I----------------------E--------R---EFRKTDQRL------N--
EXOC4_DROME/25-146--------------QK----------I----------------------E--------A---EFKRSDLRL------N--
EXOC4_HUMAN/23-144--------------GR----------L----------------------E--------E---AYEKCDRDL------D--
Q541W5_ARATH/15-151--------------HI----------L----------------------K--------E---QSDVVEEVV------D--
Q69PQ1_ORYSJ/22-158--------------QF----------L----------------------K--------E---QSDLIEDVV------D--
Q59NP0_CANAL/27-168--------------QE----------F----------------------N--------M---LKESSEQAL------R--
A5E514_LODEL/26-167--------------KE----------F----------------------S--------G---FKRRTEGVL------R--
Q6BLA3_DEBHA/30-171--------------PE----------F----------------------Q--------D---LSKQTKTAL------R--
A5DKL1_PICGU/29-170--------------DD----------F----------------------H--------D---ISKQTQQAL------R--
A3LUX9_PICST/29-170--------------PE----------F----------------------Q--------H---IMKGTETAL------R--
Q75B87_ASHGO/33-174--------------GE----------F----------------------H--------Q---LKSQIANNL------Q--
Q6CNM5_KLULA/34-175--------------DE----------F----------------------I--------E---LKSRFAKDL------Q--
A7TRV6_VANPO/35-176--------------TE----------F----------------------N--------Q---LKKQIGSDL------Q--
A6ZWU4_YEAS7/34-175--------------EE----------F----------------------N--------Q---LKSQIGSHL------Q--
Q6FWA6_CANGA/35-176--------------IE----------F----------------------N--------Q---LKEQIGSHL------Q--
Q6C3L8_YARLI/34-175--------------KD----------Y----------------------E--------K---LTSDISNVL------K--
Q4WUD2_ASPFU/134-275--------------PD----------F----------------------L--------N---MNQQIQKTL------K--
Q0CDB2_ASPTN/131-272--------------PD----------F----------------------L--------L---MRDRIQKTL------K--
Q2U7S6_ASPOR/137-278--------------PE----------F----------------------L--------D---VHNRIQKTL------K--
SEC8_NEUCR/82-223--------------RN----------F----------------------Q--------Q---THQFLQESL------K--
SEC8_SCHPO/51-191--------------KS----------F----------------------L--------N---VYDRISAAL------Q--
Q4PBF9_USTMA/441-580--------------.E----------F----------------------D--------Q---VKQMIETAL------Q--

PF06248

Q7QA24_ANOGA/4-537----------IRGYKI----------A----------------------R--------K---L.LSIHDLF.....ES--
ZW10_DROPS/10-571----------MLGLQV----------S----------------------E--------H---I.LKIDELF.....QC--
ZW10_ARATH/1-584----------RESLDL----------V----------------------N--------A---I.VGICEAL.....QE--
Q6ING5_XENLA/6-615----------TLILGV----------L----------------------K--------Q---L.QEFDSAI.....EK--
A7SSG2_NEMVE/20-670----------DMVRVI----------L----------------------I--------R---L.GKIHLGL.....ET--
A8XRG3_CAEBR/1-605----------ENLVEF----------L----------------------Q--------S---M.KKVEEQLIIMRSKT--
Q4SPW6_TETNG/9-605----------ANSLFY----------L----------------------T--------S---LCLQFHNAM.....EE--
ZW10_DROGR/1-567----------LFGLRV----------S----------------------E--------H---I.LKLDDLF.....QC--
ZW10_HUMAN/9-621----------SVVLSL----------L----------------------K--------Q---L.QEFSTAI.....EE--
Q16R15_AEDAE/1-545----------IVGYKT----------S----------------------Y--------K---L.QTIHSLF.....EM--
Q803G9_DANRE/9-612----------TAVIDL----------L----------------------Q--------H---L.QEFDTAI.....EE--
Q98TG8_CHICK/1-595----------TLVLSI----------L----------------------K--------K---L.QEFDTAL.....KE--

PF06046

Q4WPU5_ASPFU/183-757..........IGP.KT----------V----------------------R--------G---YKEKLLQAI------E--
EX3L4_HUMAN/179-709................----------P----------------------R--------R---WRQHWEEAV------R--
EX3L1_DANRE/206-763..........PMPAGR----------P----------------------R--------N---WRDRFFKVM------E--
A3LNE6_PICST/180-819..............GR----------R----------------------R--------N---YRKFFYDKL------E--
A4RYX1_OSTLU/92-690......NKVINVAPPE----------P----------------------K--------R---WKTKVLEQM------S--
A5DIA8_PICGU/180-832.........YGNFRGS----------K----------------------R--------N---YRKFFYDKL------Q--
A5DY39_LODEL/293-930..............SN----------E----------------------R--------H---YKKFFMEKF------K--
A6RAW7_AJECN/390-965..........LGP.KT----------V----------------------R--------G---YKENFLKSI------E--
A7F9Q6_SCLS1/177-755..........DGA.KS----------T----------------------R--------G---YKEKFLMAI------K--
SEC6_SCHPO/159-721..........GMT.RQ----------L----------------------R--------N---FRLRVLEEF------Q--
Q016Y9_OSTTA/124-721......NRATNAPPPE----------P----------------------K--------R---WKTRVFAEV------S--
TNAP2_HUMAN/122-651............AATR----------P----------------------R--------R---WLQLWRRGV------A--
Q0TXU6_PHANO/187-762..........SGP.KE----------L----------------------R--------G---YKDKFIKSI------E--
EX3L1_BOVIN/188-722................----------P----------------------R--------D---WRQRCLRAL------Q--
Q16I77_AEDAE/179-730............PPGR----------P----------------------K--------E---WRKKALQVL------N--
Q28ZN5_DROPS/179-731.............PGR----------P----------------------K--------A---WRKMILDVL------Q--
Q3SE84_PARTE/186-671................----------.----------------------L--------I---YKKRAIVTI------Q--
TNAP2_MOUSE/157-688............EATR----------P----------------------R--------R---WLQRWRGVV------A--
Q4P8D1_USTMA/258-828..........ANA.RV----------I----------------------K--------L---YRPKFVEAI------D--
Q4RJ08_TETNG/178-739............PPGR----------P----------------------K--------R---WKDKMFDVL------E--
EXOC3_DICDI/183-774NNNYDINNEDEGYDRN----------R----------------------S--------N---YGDRFLEVL------I--
Q5A7K3_CANAL/180-812..............GR----------S----------------------R--------N---YKKFFFDKL------R--
Q5BBU2_EMENI/183-758..........VGP.KT----------V----------------------R--------G---YKEKFIQAI------E--
Q5K9B3_CRYNJ/179-740..........ANA.RV----------I----------------------K--------N---YRHKFLDVM------K--
Q5RG40_DANRE/163-694.............IWR----------P----------------------T--------E---CRQKIHDPL------L--
Q69YP2_HUMAN/105-661............PPGR----------P----------------------K--------N---WKEKMFTIL------E--
Q6BJB6_DEBHA/180-833..............GA----------K----------------------R--------N---YKKFFYKKL------E--
Q6C9T6_YARLI/183-804.NSMSVTLGNNVAPRS----------P----------------------R--------G---YPTLFLRAM------E--
Q6CU40_KLULA/178-794GIATEINKGTIQTRTL----------P----------------------R--------G---YKTFFLSTI------H--
EX3L4_MOUSE/181-708................----------P----------------------R--------H---WRMHWEDAV------R--
Q6DJR6_XENTR/177-732............PPGR----------P----------------------K--------K---WKDKMFDVL------D--
Q6FPK2_CANGA/177-798GLYQEIINGTITTRVQ----------S----------------------R--------G---YKNLLYNKI------K--
E9P8I5_YEASX/178-798GLYQEIMSGTISTRTA----------P----------------------R--------G---YKHFLINGI------N--
Q873E6_NEUCS/175-753..........DGA.KT----------V----------------------R--------G---YKDKFLKAI------K--
EX3L1_MOUSE/189-722................----------P----------------------R--------D---WRQRCLRAL------Q--
Q8NAC4_HUMAN/132-655................----------P----------------------R--------D---WRQRCPRAL------Q--
Q8SU74_ENCCU/160-687.....YRMYRMYATRK----------T----------------------K--------K---LKDKVIKSI------E--
Q9M9G4_ARATH/172-724....SKGLAQQKLKVQ----------G----------------------K--------G---YKDKCYEQI------R--

PF04091

Q4WDM8_ASPFU/443-722--------------..----------.----------------------.--------.---...SMC...------S..
EXOC6_ARATH/442-755--------------AP----------F----------------------S--------S---MVPDVCRII------R..
Q753S5_ASHGO/493-835--------------LP----------F----------------------S--------P---LYPMTCALI------K..
Q6BHQ3_DEBHA/493-827--------------FP----------F----------------------S--------E---DYVHYCLGI------R..
A5DMM0_PICGU/481-812--------------FP----------F----------------------S--------E---DFVDYCLWI------R..
A8XM86_CAEBR/483-791--------------FP----------F----------------------S--------R---FVISAYTQA------K..
Q6CYE5_KLULA/488-829--------------FP----------F----------------------S--------P---LYPMTCTLV------K..
Q8S5T3_ORYSJ/441-754--------------AP----------F----------------------S--------S---GVPDICRIV------R..
EXOC6_DROME/427-731--------------FP----------F----------------------S--------R---MVPEVYHQA------K..
Q17EP0_AEDAE/418-723--------------FP----------F----------------------S--------R---MVPEVYHQA------M..
EXOC6_RAT/455-763--------------FP----------M----------------------S--------Q---SVPLIYIQV------K..
A7TQS9_VANPO/505-846--------------LP----------F----------------------S--------P---LYPMTCTLI------K..
Q6C1W0_YARLI/479-794--------------LP----------F----------------------S--------P---ILPLCCAKI------T..
Q560L3_CRYNB/479-787--------------MP----------F----------------------S--------Q---TYPMCCINI------R..
A6RZT9_BOTFB/417-719--------------LP----------F----------------------S--------Q---MYPMCCIDI------R..
A3LS60_PICST/479-812--------------FP----------F----------------------S--------E---DYVHYCLGV------R..
SEC15_SCHPO/435-740--------------MS----------F----------------------S--------K---MCPLCCTTL------S..
Q7RYL2_NEUCR/450-733--------------..----------.----------------------.--------.---.........------...
Q0CL01_ASPTN/446-728--------------..----------.----------------------.--------.---.........------...
A7E4G0_SCLS1/408-698--------------VS----------T----------------------D--------E---YMPMPVNSE------EDF
O81298_ARATH/430-736--------------AP----------F----------------------S--------T---TVPDCCRIV------R..
Q0UFZ1_PHANO/442-734--------------..----------.----------------------.--------.---MYPLCCIDI------R..
A6R9C0_AJECN/443-746--------------LP----------F----------------------S--------Q---MYPLCCIDI------R..
Q4P319_USTMA/445-765--------------LP----------F----------------------S--------Q---TYPLCCMDM------R..
Q7XEN0_ORYSJ/441-754--------------AP----------F----------------------S--------S---SVPDACLIV------R..
A5BA73_VITVI/441-754--------------AP----------F----------------------S--------S---MVPDVCRII------R..
SEC15_YEAST/520-865--------------LP----------F----------------------S--------P---LYPMTCTLA------K..
Q4SZ84_TETNG/313-614--------------LP----------F----------------------S--------E---FVPKVYCQL------K..
Q6FRK2_CANGA/500-842--------------LP----------F----------------------S--------P---LYPMTCTMT------Q..
A5E457_LODEL/495-827--------------FP----------F----------------------S--------E---DYVHFCGFV------R..
EXOC6_DICDI/691-995--------------FL----------F----------------------S--------K---MVPQFYTLI------K..

PF09763

Q75AA6_ASHGO/631-1297--------NVLLENWSADVCKLYNTRVASVLDYMQERTA.........................................
A5DBH0_PICGU/582-1282--------LDLNGIFTEKMSTILEKVLIGRVRTIKNSST.........................................
A3GH85_PICST/625-1329--------QELNQFFNALISNFLESLIKSKLKRINYSNN.........................................
Q6FRC5_CANGA/652-1329--------EKLLELWNANSQAIHKTIWDKEFAKLDKNEI.........................................
A6QQU0_BOVIN/176-464--------EGLTKNYMDYLSRLYEREIKDFFEVAKIKMTGTT......................................
Q2UK85_ASPOR/702-1427--------HGLINLYEQQAKQPYQNEFRDNSLAWKKASR.........................................
A7TSV5_VANPO/776-1455--------TEIIDEWTDDIQPVYTGRFSKIFGKLDLKIS.........................................
Q6CQX3_KLULA/540-1218--------EELIDLWNEDIYQLYERKTNILLSRMRPVAV.........................................
Q57ZX4_TRYB2/198-1064--------IAVLRRYRVCMQRVYAREMQNFFKYLRGQLKKVGSHRPFLIGVR............................
EXOC1_DROME/186-866--------DGLMRVYTASLSKIYDRDVRNFFNLAKIQVT.........................................
A7E4X8_SCLS1/708-1443--------EKFLLDYESACKPLYQDEFRDAVFAWKRIAK.........................................
Q4RKW7_TETNG/106-846--------EGLSRTYVDYMSRLYEREIREFFEVAKIKMAGTSKE....................................
Q6C0U5_YARLI/751-1484--------SAILKQYERSARDYYEAASTAFFAKWKQQFK.........................................
Q2GRZ6_CHAGB/575-1334--------NRILQIYQDRSHPIYKAEFREAIEAWKKTVR.........................................
Q5K9I2_CRYNJ/475-1177--------QKLCSDYMSRASQLHQSEMRELLTYMASLNV.........................................
Q7T2A6_DANRE/169-869--------EGLSRTYMDYMTRLYEREIKDFFEVAKIKMAGTSKDGKGKFAT.............................
A7RVQ5_NEMVE/151-846--------MDLCLAYIQSLNKVYEREVKEFFESAKQRLSTKGGTRSAIATFK............................
Q5TMX8_ANOGA/189-872--------DALIKVYTASLSKVYDRDIQIFFENAKQALT.........................................
Q10GJ4_ORYSJ/212-854--------GPLRKAYCHSLNLLLRREAREFANELRASTK.........................................
Q4PFK6_USTMA/462-1173--------SRVSAAYFASASECYRTEMQQLFSAYRKQLR.........................................
A6ZQV5_YEAS7/640-1316--------QAIVENWNVSIQPVYMELWTKKISQLQGIDT.........................................
Q7S5W6_NEUCR/694-1488--------DRIMQIYQDISHPIYKAEFKDAMDSWKKNAR.........................................
A5E4P0_LODEL/994-1796--------NMIKQQFNEIFAKVLDKMLVYKVNSLRASQKSQNKRRSNSNIFHSNFDNDQKSSHNTNNDKDYGNGNGNDNV
EXOC1_DICDI/95-855--------IPLIVSYIKAFRRIYESDIKLFFSTIQQSLE.........................................

PF04129

VPS52_YEAST/47-607--------LELRQAYCYTMKWYYREYFSRYIRSLTILQF-----------------------------------------
VPS52_SCHPO/1-508--------LELQRAYINTMNWFYLYHFEQYSRFLDKVHV-----------------------------------------
Q9VMQ8_DROME/42-546--------QEICSEYIDTMGKIYYSYFKSYSTRLTSLKF-----------------------------------------
Q9FVV3_ARATH/83-615--------MDVRAAYIDTMNKVLSAHFRAYIQALEKLQL-----------------------------------------
VPS52_RAT/94-601--------KEVRDEYVETLSKIYLSYYRSYVGRLMKVQY-----------------------------------------

PF15278

B6K1Q5_SCHJY/526-611--------------------------------------------------------------------------------
YD6C_SCHPO/520-605--------------------------------------------------------------------------------

PF06419

COG6_CRYNJ/69-690--------ADAIQTLTSTRQSSILHQFLDALTRGGP...-----------------------------------------
COG6_EMENI/58-693--------QTCLDFFAEARDYVLSDAFHYALTDAVS...-----------------------------------------
COG6_ASPFU/55-708--------HSCLDFFADARDYALSDAFHYALTDTVS...-----------------------------------------
COG6_PICGU/131-737--------NSVLATFVGSRSKTLVDEFLGQANSRVA...-----------------------------------------
COG6_DEBHA/132-759--------NTVIDNFVDTRSRLIIDEFLNQINGDLDKSG-----------------------------------------
COG6_HUMAN/55-656--------KYTLDEFGTARRSTVVRGFIDALTRGGP...-----------------------------------------
COG6_CANGA/175-819--------DDFLKRVTTMRSKTLLDEFLSQFGTTSE...-----------------------------------------
Q6C1G5_YARLI/25-595--------AKTLGQFTETRRRQLLKSFTSALTENSQ...-----------------------------------------
COG6_ASPNC/57-685--------HSCLDFFAEARDYVLSDAFHYALTDAVS...-----------------------------------------
COG6_YEAST/181-824--------NELLKRVTTLRSKSILDEFLSQFDMNST...-----------------------------------------
COG6_PHANO/54-693--------QSCLDSFAEARESILSDSFHSALTGSAS...-----------------------------------------
COG6_ASPOR/121-774--------HSCLDFFAEARDYTLSDAFHYALTDAVS...-----------------------------------------
COG6_CHAGB/46-689--------QNCLDFLAEAREHVLSNSFHTALTGSSP...-----------------------------------------
COG6_COCIM/32-673--------HSCLDFFAEAREYILSDSFHYALTAAVS...-----------------------------------------
COG6_SCHPO/43-650--------NKSINLIVQARQQILSTAYLTALTRGDF...-----------------------------------------
Q17KR7_AEDAE/31-620--------KYVIDEYSTARRSVVVRSFIDALTVGSP...-----------------------------------------
COG6_ASHGO/158-791--------LMILSKGTSMRSKKLLDEFLIPFVIDNN...-----------------------------------------
COG6_PICST/153-782--------SNVVNTFVDSRAKVLVDDFLSQIQGNLDSNG-----------------------------------------
Q7QJN1_ANOGA/31-623--------KYVVDEYSTARRSVVVRSFIDALTIGGP...-----------------------------------------
A7SZM3_NEMVE/34-607--------KYCLDEYGTARRTAVVRCFIDALTRGGP...-----------------------------------------
COG6_CANAL/144-758--------NSIVNTFSESRSKVLVDEFNRQVQGDFEVNG-----------------------------------------
COG6_MAGO7/53-703--------QNCLDFFAEARENVLSDAFFTALTGTTS...-----------------------------------------
COG6_KLULA/138-763--------QDFLNRIVGLRSKRLLDDFLSQFDIDNK...-----------------------------------------
COG6_SCLS1/52-643--------QSCLDFFAEARENILSDGFYTALTGTTV...-----------------------------------------
COG6_DROME/34-627--------KYVIDEYAIARRAVLVRQFIEALTEGGP...-----------------------------------------
COG6_CAEEL/37-623--------QLAIDQYISSRSQELLNQFVEINKMAVQ...-----------------------------------------
COG6_ASPTN/56-707--------HSCLDFFAEARDYVLSDAFHYALTDAVT...-----------------------------------------
COG6_NEUCR/63-712--------QNCLDFFAEAREHVLSEAFYTALTGSSA...-----------------------------------------
Q00T18_OSTTA/85-728--------RASVEEVTRTRHNALFRRFITALTRGSV...-----------------------------------------

PF03081

Q5Z4V4_ORYSJ/278-638--------EELLVQVEL..............-------------------------------------------------
EXOC7_DICDI/436-836--------DFSLDEEKEI.............-------------------------------------------------
EXO70_DEBHA/215-612--------RELIEYSENR.............-------------------------------------------------
A5DE46_PICGU/207-601--------GELMKWVDAR.............-------------------------------------------------
A2QCL9_ASPNC/266-651--------SELLEETKRK.............-------------------------------------------------
Q5KMS6_CRYNJ/297-673--------PEMLVDVRS..............-------------------------------------------------
Q9SF51_ARATH/232-603--------VEFESGIQK..............-------------------------------------------------
Q5QLT4_ORYSJ/188-532--------MALENLVRR..............-------------------------------------------------
Q7XPT9_ORYSJ/273-640--------GDFMEYILN..............-------------------------------------------------
EXO70_YARLI/227-601--------TEILKICEAR.............-------------------------------------------------
Q9LZD3_ARATH/267-627--------GDFEEAVEK..............-------------------------------------------------
Q5ZIN3_CHICK/309-677--------EEFADNIKND.............-------------------------------------------------
A2WY31_ORYSI/215-549--------ASLIAKVRDG.............-------------------------------------------------
A2YJD7_ORYSI/54-381--------RRVCSLSQT..............-------------------------------------------------
Q6ES92_ORYSJ/191-595--------EKVRSSFLQD.............-------------------------------------------------
Q9SIB0_ARATH/209-553--------DEFESSISK..............-------------------------------------------------
A5C6J8_VITVI/270-630--------MEFETAIAS..............-------------------------------------------------
Q9LQP9_ARATH/237-588--------TEFQSSITK..............-------------------------------------------------
EXO70_CANAL/229-666--------KEFIQAIDNR.............-------------------------------------------------
A5E7C7_LODEL/212-655--------PKFYREVDAK.............-------------------------------------------------
EXO70_GIBZE/245-630--------AELLEETRRK.............-------------------------------------------------
EXO70_ASHGO/230-612--------KDLIQYIGQK.............-------------------------------------------------
A2YJD9_ORYSI/318-664--------DQLRVQIQS..............-------------------------------------------------
A2XSN9_ORYSI/302-674--------LEFGKVLQQ..............-------------------------------------------------
A6SNP3_BOTFB/246-636--------ADLLDDTRRR.............-------------------------------------------------
Q6Z5V5_ORYSJ/162-505--------GKLKVQIQS..............-------------------------------------------------
Q0WPK8_ARATH/246-618--------SEFENAVLR..............-------------------------------------------------
A2DS47_TRIVA/251-594--------SNYRVAVEM..............-------------------------------------------------
Q9FY95_ARATH/272-641--------GELEKSIKS..............-------------------------------------------------
Q9M3D4_ARATH/241-604--------TDFESIIQK..............-------------------------------------------------
A2YSN5_ORYSI/155-523--------EKVRALFLMD.............-------------------------------------------------
Q9FNR3_ARATH/272-623--------LKFKDAIAS..............-------------------------------------------------
A7TQI9_VANPO/236-622--------RNSIQRIISK.............-------------------------------------------------
EXO70_SCHPO/244-610--------ISSISRLYNG.............-------------------------------------------------
A2YXE5_ORYSI/221-597--------DQFVNVIHG..............-------------------------------------------------
Q4PDG8_USTMA/293-725--------PRFIEDVKAI.............-------------------------------------------------
A5BYE5_VITVI/322-667--------WEFGLQIEG..............-------------------------------------------------
Q2QX89_ORYSJ/323-687--------RELESSIRA..............-------------------------------------------------
Q9SF50_ARATH/227-599--------MDFESQIRK..............-------------------------------------------------
EXO70_CANGA/234-621--------KDTVDRIKSK.............-------------------------------------------------
Q0U449_PHANO/246-624--------GKLLDDVRSK.............-------------------------------------------------
Q6Z5U7_ORYSJ/196-558--------SKTKALIHSYGGS........PG-------------------------------------------------
Q5TQS7_ANOGA/314-704--------EQFIESVRNDAGGGGMVSMTSST-------------------------------------------------
Q0WPV2_ARATH/303-668--------VEFENNVRN..............-------------------------------------------------
A8XF23_CAEBR/258-601--------NEVVEHLNE..............-------------------------------------------------
A3LWD2_PICST/217-612--------KEYIKLIELR.............-------------------------------------------------
EXO70_KLULA/233-617--------QELFAYINTK.............-------------------------------------------------
Q9LMJ4_ARATH/246-593--------MELENLIRR..............-------------------------------------------------
Q9C8H6_ARATH/253-624--------WELPCQVEL..............-------------------------------------------------
A3BAD3_ORYSJ/211-560--------LKFSEAQINH.............-------------------------------------------------
Q60EX4_ORYSJ/153-510--------NDAEAVTPVLS............-------------------------------------------------
Q69JW6_ORYSJ/345-697--------MELNNLIKS..............-------------------------------------------------
Q6YZW7_ORYSJ/295-656--------YEFGLRVET..............-------------------------------------------------
Q9LIA2_ARATH/265-644--------LEFKSAIAA..............-------------------------------------------------
Q8H150_ARATH/227-595--------TDFESAIQK..............-------------------------------------------------
A2WYH2_ORYSI/258-597--------RELKILIQT..............-------------------------------------------------
B9FJQ2_ORYSJ/298-655--------MELENLIRR..............-------------------------------------------------
A2YA16_ORYSI/142-483--------RGLPASIRS..............-------------------------------------------------

PF15469

A4RXA7_OSTLU/41-217--------REVFAIEER---------------------------------------------------------------
A6ZYC4_YEAS7/144-361--------KPLMDNYQK---------------------------------------------------------------
A7TRG2_VANPO/143-342--------KPLLDRSTK---------------------------------------------------------------
A8IS87_CHLRE/340-518--------GPILDRAAK---------------------------------------------------------------
A8PCF2_COPC7/122-323--------LPVLENASK---------------------------------------------------------------
A8PUN7_MALGO/110-314--------RPVLENYVK---------------------------------------------------------------
A8QHB2_BRUMA/204-382--------YDVLTRKDR---------------------------------------------------------------
A8WPA7_CAEBR/200-378--------ADVLKRKDD---------------------------------------------------------------
A9RNH0_PHYPA/252-430--------APLLELQSQ---------------------------------------------------------------
A9S1F4_PHYPA/259-437--------APLLERQAQ---------------------------------------------------------------
B0ET40_ENTDS/59-222--------KLLSNNRVS---------------------------------------------------------------
B0W3D0_CULQU/193-383--------KDVLSRKEK---------------------------------------------------------------
B2RBE6_HUMAN/198-377--------QEVLGRKDK---------------------------------------------------------------
B3MVG4_DROAN/193-383--------TDVLVRKEK---------------------------------------------------------------
B6K5G3_SCHJY/147-340--------LISSQSS..---------------------------------------------------------------
B7PR09_IXOSC/148-326--------ESILARKDQ---------------------------------------------------------------
B8ATQ6_ORYSI/262-452--------EPLFERQAQ---------------------------------------------------------------
B8BR17_THAPS/466-647--------KPLLDNTNE---------------------------------------------------------------
B8P2C9_POSPM/114-312--------LPVLENALK---------------------------------------------------------------
C3XUC7_BRAFL/191-370--------QDVLGRKDK---------------------------------------------------------------
C4M2W7_ENTHI/111-299--------KQLTDLKNR---------------------------------------------------------------
C4R5S5_PICPG/139-344--------KPVLEEART---------------------------------------------------------------
C4YAI9_CLAL4/138-372--------RPIMDHRSK---------------------------------------------------------------
C5DMT2_LACTC/144-330--------KPILDISTK---------------------------------------------------------------
C5DYM3_ZYGRC/146-354--------KPLLETNRK---------------------------------------------------------------
C5MH42_CANTT/104-348--------QPINESKHK---------------------------------------------------------------
D0MT24_PHYIT/66-241--------AVMLQRSRE---------------------------------------------------------------
D5GNN2_TUBMM/147-347--------GPAMRGRGR---------------------------------------------------------------
D6W674_TRICA/193-371--------DDVLARRDR---------------------------------------------------------------
D7KJZ0_ARALL/260-438--------EPLFERQAQ---------------------------------------------------------------
D8QDB4_SCHCM/114-323--------LPVLENASK---------------------------------------------------------------
D8RD25_SELML/239-417--------GPLLERQAQ---------------------------------------------------------------
E0S9H6_ENCIT/50-261--------SGISDDVEG---------------------------------------------------------------
E0VQL4_PEDHC/200-377--------QEVLTKREK---------------------------------------------------------------
E2AW35_CAMFO/194-372--------DDVLARRDR---------------------------------------------------------------
E3K655_PUCGT/121-321--------TPLLENRKK---------------------------------------------------------------
E4XNP2_OIKDI/201-392--------EDVLTQKDK---------------------------------------------------------------
E6QYJ0_CRYGW/114-305--------LPVLENAVK---------------------------------------------------------------
E6ZLD0_SPORE/109-315--------MPVLENNLK---------------------------------------------------------------
E7R2N5_PICAD/151-341--------NPVFDGMER---------------------------------------------------------------
E9C1C0_CAPO3/243-420--------SPLLDRKDR---------------------------------------------------------------
E9G6B5_DAPPU/193-371--------DDVLKRKEQ---------------------------------------------------------------
F0W4R3_9STRA/41-214--------KRMLQRVKE---------------------------------------------------------------
F0ZXN2_DICPU/132-311--------HPLLMNKKK---------------------------------------------------------------
F2UAY3_SALS5/207-386--------DAILERQKE---------------------------------------------------------------
F4PCT9_BATDJ/225-428--------GPVLGRRSN---------------------------------------------------------------
F4PGL2_DICFS/126-305--------DPLLQGKQE---------------------------------------------------------------
F4Q787_DICFS/187-364--------DQLFTCKRE---------------------------------------------------------------
F4RSS6_MELLP/56-255--------TPILENRRK---------------------------------------------------------------
F6Q8U3_CIOIN/201-380--------DTVLSCKDR---------------------------------------------------------------
F6YQX0_XENTR/198-380--------SLVFGKAKV---------------------------------------------------------------
F8NGV0_SERL9/40-233--------LPVLENSSK---------------------------------------------------------------
G0VBU0_NAUCC/150-340--------KPLIDTSKK---------------------------------------------------------------
G0WGP4_NAUDC/153-350--------KPLIDTSQT---------------------------------------------------------------
G1XK06_ARTOA/190-398--------GPVMENQER---------------------------------------------------------------
G3AUN6_SPAPN/128-368--------RPISELKAK---------------------------------------------------------------
G4TT08_PIRID/115-310--------LPVLENAEK---------------------------------------------------------------
G4VNQ3_SCHMA/214-394--------EDILKRRDR---------------------------------------------------------------
G6D800_DANPL/194-372--------SEILTRKEN---------------------------------------------------------------
G7DSD2_MIXOS/124-323--------MPILDAQLR---------------------------------------------------------------
G7IVK4_MEDTR/51-227--------KPLFECQAQ---------------------------------------------------------------
G8BGG9_CANPC/145-407--------KPIVENKAK---------------------------------------------------------------
G8BMU6_TETPH/145-338--------KPLYESANK---------------------------------------------------------------
G8JTD1_ERECY/120-302--------LPLVDQSTK---------------------------------------------------------------
G8XZB2_PICSO/148-394--------RPIMDHKNK---------------------------------------------------------------
G8ZXE8_TORDC/144-345--------KPMLKTSKR---------------------------------------------------------------
H2AR86_KAZAF/151-365--------KPLLDTTTR---------------------------------------------------------------
H2KP67_CLOSI/214-393--------EGVLKRRDR---------------------------------------------------------------
H2ZFP8_CIOSA/151-287--------KTVLSCKDR---------------------------------------------------------------
H3ERJ1_PRIPA/197-373--------KDVLARKDT---------------------------------------------------------------
I0ZAT9_9CHLO/267-451--------KELVERAAA---------------------------------------------------------------
I1GNJ4_BRADI/14-163--------TSLFNKREN---------------------------------------------------------------
I1NBC3_SOYBN/28-188--------PSPYKNREH---------------------------------------------------------------
SEC5_SCHPO/139-329--------LFNTESTNE---------------------------------------------------------------
Q019K9_OSTTA/44-232--------REVFELEER---------------------------------------------------------------
Q232N2_TETTS/349-532--------QEMIKMKSD---------------------------------------------------------------
Q6CGI4_YARLI/146-334--------NPVFNTRLK---------------------------------------------------------------
Q6CQH1_KLULA/148-350--------QPLLSNNDK---------------------------------------------------------------
Q6FVL5_CANGA/149-372--------NPVINYEKK---------------------------------------------------------------
Q750U7_ASHGO/122-304--------IPLVDQASK---------------------------------------------------------------

PF04124

COG8_MOUSE/56-394--------KEAEEISSS.--------------------------------------------------------------
COG8_SCHPO/15-354--------NFLTSISEH.--------------------------------------------------------------
COG8_YEAST/28-381--------KAADRNVTND--------------------------------------------------------------
COG8_CAEEL/10-353--------AKAKQLSEE.--------------------------------------------------------------
Q9LYH5_ARATH/29-412--------DSAENILEK.--------------------------------------------------------------
COG8_DROME/37-379--------QDSAELNEQ.--------------------------------------------------------------
Q9P3N9_NEUCS/31-347--------TNYSKSSESD--------------------------------------------------------------

PF08700

COG5_MOUSE/37-120--------LQVVARHE----------------------------------------------------------------
EXO84_CRYNJ/142-228--------RTVFKHYA----------------------------------------------------------------
Q6BJZ0_DEBHA/76-158--------GLVGNKYR----------------------------------------------------------------
Q0U0Z3_PHANO/76-170--------SLVYDNYS----------------------------------------------------------------
Q0WQ75_ARATH/43-129--------MLVYENYN----------------------------------------------------------------
Q5KJF4_CRYNJ/98-180--------AMVGARYR----------------------------------------------------------------
Q173I8_AEDAE/5-87--------TMVGERYR----------------------------------------------------------------
A2D783_TRIVA/6-88--------QFIGDNYK----------------------------------------------------------------
Q7Q6Z6_ANOGA/11-97--------TLVYENYN----------------------------------------------------------------
Q2UQ54_ASPOR/108-197--------ALVYDNYS----------------------------------------------------------------
Q7S488_NEUCR/247-341--------ALVYDNYS----------------------------------------------------------------
VPS51_YEAST/84-163--------NTIYENYY----------------------------------------------------------------
A2E266_TRIVA/29-115--------FLVYDNYT----------------------------------------------------------------
Q2U987_ASPOR/1-88--------ALVGTRYR----------------------------------------------------------------
Q6FRQ2_CANGA/66-146--------NTIYENYY----------------------------------------------------------------
Q6CSC3_KLULA/100-179--------NTIYDNYY----------------------------------------------------------------
Q4SXW2_TETNG/10-92--------QMVGERYR----------------------------------------------------------------
EXO84_GIBZE/128-214--------QSVMQNRT----------------------------------------------------------------
Q75HJ9_ORYSJ/40-126--------RSVYANYA----------------------------------------------------------------
EXOC8_MOUSE/13-100--------RNVYQNYR----------------------------------------------------------------
Q4P2N5_USTMA/76-162--------SLVYNHHH----------------------------------------------------------------
Q4PEG0_USTMA/79-161--------SLVGQRYE----------------------------------------------------------------
Q8I2A9_PLAF7/116-202--------TLIYENYN----------------------------------------------------------------
Q6CG64_YARLI/77-166--------ALVYNNYS----------------------------------------------------------------
Q4E335_TRYCC/3-85--------QIVGQSYR----------------------------------------------------------------
EXO84_YARLI/121-207--------EAMYTNYN----------------------------------------------------------------
Q4MZL9_THEPA/63-149--------LLIYDNYE----------------------------------------------------------------
COG1_SCHPO/7-89--------QNVCFNYQ----------------------------------------------------------------
Q59L27_CANAL/17-99--------DLVGSKYR----------------------------------------------------------------
Q2UHE7_ASPOR/121-207--------QNVYQNRT----------------------------------------------------------------
Q7RZT4_NEUCR/9-91--------TQVGGSYR----------------------------------------------------------------
Q8SWU0_DROME/4-91--------QTCKKNYM----------------------------------------------------------------
E9AC89_LEIMA/3-81--------AVIGNSYR----------------------------------------------------------------
A2GBI6_TRIVA/24-110--------TIVYGNYQ----------------------------------------------------------------
Q4Y221_PLACH/14-100--------SIVYENYN----------------------------------------------------------------
EXO84_ASHGO/127-213--------SNINKSYN----------------------------------------------------------------
Q8LCN9_ARATH/18-103--------EVAVGNYR----------------------------------------------------------------
FFR_DICDI/178-264--------TLVYDNYT----------------------------------------------------------------
YEWA_SCHPO/52-138--------SLVYNHYK----------------------------------------------------------------
Q9FFF3_ARATH/21-103--------QLVGTRYR----------------------------------------------------------------
Q4P6W6_USTMA/184-270--------RQVFKNYS----------------------------------------------------------------
Q1WMT0_COPDI/48-130--------LMVGERYR----------------------------------------------------------------
COG1_DICDI/113-195--------NLIGNKYR----------------------------------------------------------------
A2FRD0_TRIVA/32-118--------TLVYDNYT----------------------------------------------------------------
A0C9R8_PARTE/6-92--------SLVFENYS----------------------------------------------------------------
Q00XX6_OSTTA/568-650--------RVLGESYK----------------------------------------------------------------
EXO84_CANGA/190-276--------RNIYKSYN----------------------------------------------------------------
Q754G8_ASHGO/53-137--------NTIYDNYY----------------------------------------------------------------
FFR_CHICK/57-143--------TLLYENYN----------------------------------------------------------------
Q55VT5_CRYNB/54-140--------SLVYNHHH----------------------------------------------------------------
Q95Q35_CAEEL/9-99--------NNVFRNYQ----------------------------------------------------------------
Q6C0N6_YARLI/24-102--------CLINTTYR----------------------------------------------------------------
Q5DTY3_MOUSE/20-102--------QMVGERYR----------------------------------------------------------------
Q5CPU5_CRYPI/48-125--------KFIHSNYK----------------------------------------------------------------
Q4DYG1_TRYCC/45-131--------ELVYRNYA----------------------------------------------------------------
Q5ZAZ1_ORYSJ/7-89--------QLVGRSYR----------------------------------------------------------------

PF06148

Q0TYI9_PHANO/26-159--------DLVNSNYQ----------------------------------------------------------------
Q29BE0_DROPS/22-154--------DLINEDYA----------------------------------------------------------------
Q7QFV1_ANOGA/25-157--------ELINQDYA----------------------------------------------------------------
Q84LH7_ORYSJ/24-156--------GLINRDYA----------------------------------------------------------------
Q9ASS9_ARATH/31-163--------DLINRDYA----------------------------------------------------------------
Q01CT5_OSTTA/52-184--------VIVRDNYE----------------------------------------------------------------
Q5K8I4_CRYNJ/34-165--------KLINEDYE----------------------------------------------------------------
Q4P841_USTMA/85-240--------SIINEDYK----------------------------------------------------------------
A1C4Y0_ASPCL/32-165--------DLVNENYR----------------------------------------------------------------
Q2UA29_ASPOR/27-160--------DLVNENYQ----------------------------------------------------------------
COG2_HUMAN/15-147--------ELINKDYA----------------------------------------------------------------
Q0C728_AEDAE/17-149--------ELINQDYA----------------------------------------------------------------
Q5BZC0_SCHJA/41-174--------ELINQDYA----------------------------------------------------------------
A8WN13_CAEBR/23-155--------ELINDDYA----------------------------------------------------------------
Q383M1_TRYB2/46-232--------RHVNTDVH----------------------------------------------------------------
Q4DNE3_TRYCC/72-246--------RHVNMDVH----------------------------------------------------------------
Q4Q0F6_LEIMA/80-262--------QCVNTDVH----------------------------------------------------------------
A0CKT7_PARTE/12-141--------SSVDNNLE----------------------------------------------------------------
COG2_DICDI/53-185--------ELINKEYQ----------------------------------------------------------------

PF10392

COG5_HUMAN/66-189--------LQVVARHE----------------------------------------------------------------
Q6BT79_DEBHA/15-147--------SIASTNYE----------------------------------------------------------------
Q5B379_EMENI/829-961--------TLTTKSAL----------------------------------------------------------------
Q5APN5_CANAL/17-149--------KISSSNYS----------------------------------------------------------------
COG5_SCHPO/8-139--------DLIVHEET----------------------------------------------------------------
COG5_YEAST/14-146--------QLMNSNPL----------------------------------------------------------------
Q9C9V9_ARATH/57-180--------NDVISRHP----------------------------------------------------------------
Q0U7T7_PHANO/13-145--------TLTTKSAL----------------------------------------------------------------
Q2HI55_CHAGB/25-157--------QLTTRSAL----------------------------------------------------------------
Q5KKM0_CRYNJ/10-154--------QEITASHL----------------------------------------------------------------
Q6CLE2_KLULA/11-144--------GAIKTNPS----------------------------------------------------------------
COG5_DICDI/63-186--------ENITTNYD----------------------------------------------------------------
Q6C2T6_YARLI/5-136--------TLCRDNHK----------------------------------------------------------------
Q75B18_ASHGO/11-144--------RIIKDEPL----------------------------------------------------------------
Q6FTM6_CANGA/9-140--------SFLKSHAS----------------------------------------------------------------
Q65XH1_ORYSJ/52-175--------AEVLRRHP----------------------------------------------------------------

PF04100

VPS53_CAEEL/29-391--------YLVETNAN----------------------------------------------------------------
VPS53_HUMAN/39-453--------TVVRGQTN----------------------------------------------------------------
Q9VQY8_DROME/42-434--------SVVRGQTN----------------------------------------------------------------
Q9C6Q3_ARATH/1-444--------SAVRQQSN----------------------------------------------------------------
YDLF_SCHPO/16-394--------TYEDAKLS----------------------------------------------------------------
VPS53_YEAST/5-369--------EHPKNSA.----------------------------------------------------------------
Q9C6I3_ARATH/1-331--------AVVSQQGN----------------------------------------------------------------

PF10475

Q7QF78_ANOGA/99-388--------QLILEQRA----------------------------------------------------------------
Q336V4_ORYSJ/131-419--------HHVMGHHE----------------------------------------------------------------
Q012F3_OSTTA/52-350--------REIMAHGE----------------------------------------------------------------
Q54MU4_DICDI/72-370--------NRVRENYT----------------------------------------------------------------
Q6JJ34_IPOTF/130-420--------RHVMQHHE----------------------------------------------------------------
CC132_CHICK/54-327--------........----------------------------------------------------------------
Q16RR9_AEDAE/70-360--------QLILEQRP----------------------------------------------------------------
A1ZAY8_DROME/75-362--------QNILEQRN----------------------------------------------------------------
Q54NV0_DICDI/113-401--------DLIRKSYN----------------------------------------------------------------
Q8RXC2_ARATH/132-421--------HHVMEHHE----------------------------------------------------------------
Q18602_CAEEL/76-363--------TLIMQKSS----------------------------------------------------------------
A8XSD2_CAEBR/80-367--------TLIMQKSS----------------------------------------------------------------

PF04048

Q7PY10_ANOGA/23-144--------ELVSRSDG----------------------------------------------------------------
EXOC4_DROME/25-146--------ELVSRHDQ----------------------------------------------------------------
EXOC4_HUMAN/23-144--------ELIVQHYT----------------------------------------------------------------
Q541W5_ARATH/15-151--------EVVHAYHG----------------------------------------------------------------
Q69PQ1_ORYSJ/22-158--------EVVHAYHH----------------------------------------------------------------
Q59NP0_CANAL/27-168--------SVVNEHYD----------------------------------------------------------------
A5E514_LODEL/26-167--------HVVDEHYE----------------------------------------------------------------
Q6BLA3_DEBHA/30-171--------HVVNEHHD----------------------------------------------------------------
A5DKL1_PICGU/29-170--------NVVSQHHE----------------------------------------------------------------
A3LUX9_PICST/29-170--------HVVNEHHE----------------------------------------------------------------
Q75B87_ASHGO/33-174--------EAANEHYQ----------------------------------------------------------------
Q6CNM5_KLULA/34-175--------EVANDHYQ----------------------------------------------------------------
A7TRV6_VANPO/35-176--------AAVNEHYQ----------------------------------------------------------------
A6ZWU4_YEAS7/34-175--------DVVNEHSQ----------------------------------------------------------------
Q6FWA6_CANGA/35-176--------EVVNQHSQ----------------------------------------------------------------
Q6C3L8_YARLI/34-175--------DVVNDNYQ----------------------------------------------------------------
Q4WUD2_ASPFU/134-275--------SVVNEHHQ----------------------------------------------------------------
Q0CDB2_ASPTN/131-272--------SVVNEHHQ----------------------------------------------------------------
Q2U7S6_ASPOR/137-278--------SVVNEHHQ----------------------------------------------------------------
SEC8_NEUCR/82-223--------NIVHDHHQ----------------------------------------------------------------
SEC8_SCHPO/51-191--------TIAHTHKD----------------------------------------------------------------
Q4PBF9_USTMA/441-580--------GTVDDHYE----------------------------------------------------------------

PF06248

Q7QA24_ANOGA/4-537--------LN..LSGN----------------------------------------------------------------
ZW10_DROPS/10-571--------VEEAKGTK----------------------------------------------------------------
ZW10_ARATH/1-584--------TKEALKNG----------------------------------------------------------------
Q6ING5_XENLA/6-615--------YNCALTGK----------------------------------------------------------------
A7SSG2_NEMVE/20-670--------LPGTLKSK----------------------------------------------------------------
A8XRG3_CAEBR/1-605--------TNRIEWGN----------------------------------------------------------------
Q4SPW6_TETNG/9-605--------FDKALPNK----------------------------------------------------------------
ZW10_DROGR/1-567--------VEEAKSTK----------------------------------------------------------------
ZW10_HUMAN/9-621--------YNCALTEK----------------------------------------------------------------
Q16R15_AEDAE/1-545--------IP..RSGD----------------------------------------------------------------
Q803G9_DANRE/9-612--------YHRALQEK----------------------------------------------------------------
Q98TG8_CHICK/1-595--------YNTALLEK----------------------------------------------------------------

PF06046

Q4WPU5_ASPFU/183-757--------LYAENQFR..--------------------------------------------------------------
EX3L4_HUMAN/179-709--------RSAQERVRRP--------------------------------------------------------------
EX3L1_DANRE/206-763--------EAVSARFR..--------------------------------------------------------------
A3LNE6_PICST/180-819--------ENLSETFN..--------------------------------------------------------------
A4RYX1_OSTLU/92-690--------IAVEARLAL.--------------------------------------------------------------
A5DIA8_PICGU/180-832--------ESLDEIFD..--------------------------------------------------------------
A5DY39_LODEL/293-930--------VYFQGTFA..--------------------------------------------------------------
A6RAW7_AJECN/390-965--------LYAQTQFE..--------------------------------------------------------------
A7F9Q6_SCLS1/177-755--------LKAEGNLE..--------------------------------------------------------------
SEC6_SCHPO/159-721--------GAAAENFQ..--------------------------------------------------------------
Q016Y9_OSTTA/124-721--------NAVEAKLAL.--------------------------------------------------------------
TNAP2_HUMAN/122-651--------EAAEERMG..--------------------------------------------------------------
Q0TXU6_PHANO/187-762--------YVCQAQMD..--------------------------------------------------------------
EX3L1_BOVIN/188-722--------QGLERVHF..--------------------------------------------------------------
Q16I77_AEDAE/179-730--------EAVVQRIEG.--------------------------------------------------------------
Q28ZN5_DROPS/179-731--------SSVATRIEG.--------------------------------------------------------------
Q3SE84_PARTE/186-671--------QGIDEKFN..--------------------------------------------------------------
TNAP2_MOUSE/157-688--------EVAAERLD..--------------------------------------------------------------
Q4P8D1_USTMA/258-828--------RSTAELFD..--------------------------------------------------------------
Q4RJ08_TETNG/178-739--------ATVSTRIEG.--------------------------------------------------------------
EXOC3_DICDI/183-774--------QSISGKFE..--------------------------------------------------------------
Q5A7K3_CANAL/180-812--------THLYEIFD..--------------------------------------------------------------
Q5BBU2_EMENI/183-758--------FYAQNQFE..--------------------------------------------------------------
Q5K9B3_CRYNJ/179-740--------STVQRSFE..--------------------------------------------------------------
Q5RG40_DANRE/163-694--------KTLVETRLKN--------------------------------------------------------------
Q69YP2_HUMAN/105-661--------RTVTTRIEG.--------------------------------------------------------------
Q6BJB6_DEBHA/180-833--------ESLVDTFD..--------------------------------------------------------------
Q6C9T6_YARLI/183-804--------KSIKDSFE..--------------------------------------------------------------
Q6CU40_KLULA/178-794--------KGIQEMFT..--------------------------------------------------------------
EX3L4_MOUSE/181-708--------LSAQESVQQA--------------------------------------------------------------
Q6DJR6_XENTR/177-732--------KTIITRIEG.--------------------------------------------------------------
Q6FPK2_CANGA/177-798--------QSIQEMFI..--------------------------------------------------------------
E9P8I5_YEASX/178-798--------NSISEMFG..--------------------------------------------------------------
Q873E6_NEUCS/175-753--------TFAEDQFK..--------------------------------------------------------------
EX3L1_MOUSE/189-722--------EGLERVHF..--------------------------------------------------------------
Q8NAC4_HUMAN/132-655--------EGLEQAHF..--------------------------------------------------------------
Q8SU74_ENCCU/160-687--------VSVKGKFD..--------------------------------------------------------------
Q9M9G4_ARATH/172-724--------KAVEDRFN..--------------------------------------------------------------

PF04091

Q4WDM8_ASPFU/443-722........AFFSDVSL----------------------------------------------------------------
EXOC6_ARATH/442-755........SYIKGSVD----------------------------------------------------------------
Q753S5_ASHGO/493-835........KSYANMLL----------------------------------------------------------------
Q6BHQ3_DEBHA/493-827........SLLEEIVQ----------------------------------------------------------------
A5DMM0_PICGU/481-812........SLLDDSLA----------------------------------------------------------------
A8XM86_CAEBR/483-791........QYLIGCLK----------------------------------------------------------------
Q6CYE5_KLULA/488-829........KTYSSLHS----------------------------------------------------------------
Q8S5T3_ORYSJ/441-754........SFIGDSVS----------------------------------------------------------------
EXOC6_DROME/427-731........EFMYACMK----------------------------------------------------------------
Q17EP0_AEDAE/418-723........EFMYACMK----------------------------------------------------------------
EXOC6_RAT/455-763........EFIYASLK----------------------------------------------------------------
A7TQS9_VANPO/505-846........KTYSKLTA----------------------------------------------------------------
Q6C1W0_YARLI/479-794........HLIHQHYA----------------------------------------------------------------
Q560L3_CRYNB/479-787........NFVDQFYQ----------------------------------------------------------------
A6RZT9_BOTFB/417-719........NFLNRFYF----------------------------------------------------------------
A3LS60_PICST/479-812........SLLEDIIS----------------------------------------------------------------
SEC15_SCHPO/435-740........KFVRHFFM----------------------------------------------------------------
Q7RYL2_NEUCR/450-733........NFLNQFYF----------------------------------------------------------------
Q0CL01_ASPTN/446-728........NFLNQFYF----------------------------------------------------------------
A7E4G0_SCLS1/408-698DKIVQVSWNFLNRFYF----------------------------------------------------------------
O81298_ARATH/430-736........SFIEDSVS----------------------------------------------------------------
Q0UFZ1_PHANO/442-734........NFLNQIYL----------------------------------------------------------------
A6R9C0_AJECN/443-746........NFLNQFYF----------------------------------------------------------------
Q4P319_USTMA/445-765........NLVDQYYI----------------------------------------------------------------
Q7XEN0_ORYSJ/441-754........SFIDDSVN----------------------------------------------------------------
A5BA73_VITVI/441-754........SFIKDSVS----------------------------------------------------------------
SEC15_YEAST/520-865........KTYSKITA----------------------------------------------------------------
Q4SZ84_TETNG/313-614........EFIYACLK----------------------------------------------------------------
Q6FRK2_CANGA/500-842........KVYAKLTS----------------------------------------------------------------
A5E457_LODEL/495-827........QLINRTLK----------------------------------------------------------------
EXOC6_DICDI/691-995........KFISEFYE----------------------------------------------------------------

PF09763

Q75AA6_ASHGO/631-1297...................KLQQPPSTTG........KDELVQLW....DTYRKTKSLSF..................AS
A5DBH0_PICGU/582-1282................GVSHVSKVLEQTS........TRRSRTLR....LSARKERFLHK..................RS
A3GH85_PICST/625-1329.....................SNSTASNG........LSQVLDE.....NHLRKSRTLRL..................SR
Q6FRC5_CANGA/652-1329...............MELKANHAILMEKG........TEQLLKQW....KHFKTTRKTTT..................DE
A6QQU0_BOVIN/176-464..........KESK..................................................................
Q2UK85_ASPOR/702-1427..............KPSGEE.HELLFTHQ........EKEKENEG....IT.MAARKLTV..................KR
A7TSV5_VANPO/776-1455..............EVQDIQEEAPIHQQQ........ESTFITQW....IKFKKDKKVMA..................ET
Q6CQX3_KLULA/540-1218..............SQNSQLSQLSFNQSE........QDSLYQWW....YTLRIQKAPFQ..................DS
Q57ZX4_TRYB2/198-1064DSSDGIVFSGSESTRSETPHRRGSLANSDGLRWTPTCSPLGYPHS....FCHMSGSFSRLNISAPTEGQLFVDLPVACDD
EXOC1_DROME/186-866.............EKLRNSREDLDMSTSS.......................RKSAVSTI..................PY
A7E4X8_SCLS1/708-1443..............KAHGDE.SENLFTS.........QIEKHTEG....LATTTARKLTV..................KR
Q4RKW7_TETNG/106-846.........AKGKFGLHGSSGKLTGSTSS........L.....NK....LNVQGSNSRRS..................QS
Q6C0U5_YARLI/751-1484...............ASDKTDQQSMFSPG........REHEPTE.....HKVSAVRQLTM..................KR
Q2GRZ6_CHAGB/575-1334..............KVTGDE.SELLFTS.........QQEKKEEG....LA.TTARKLTV..................KR
Q5K9I2_CRYNJ/475-1177...............SSGDAGADADFSSA....................PGANYARPSAL..................QK
Q7T2A6_DANRE/169-869.LPRKESALKQETESLHGSSGKLTGSTSS........L.....NK....LAVSSSNSRRS..................QS
A7RVQ5_NEMVE/151-846MTVASPAKSREDTASLRSSPRPSPRVSTH....................RFGRRDRKDTG..................DS
Q5TMX8_ANOGA/189-872.............LKQFSSREDINNSSIS................NKLKLGPQSNKQPAQ..................PY
Q10GJ4_ORYSJ/212-854..........................APK........NPAVWLEG....SNSGGQNGSSA..................DT
Q4PFK6_USTMA/462-1173..............KASDEDMVESSFVVP.......TSTGVGTSA....IRSGTIRRTQR..................DK
A6ZQV5_YEAS7/640-1316....................NDEKMNELS........LSQLLNEW....NTFRKERKTND..................IN
Q7S5W6_NEUCR/694-1488..............KMTGEETAELLFTS.........GHDKKDEG....LA.NTARKLTV..................KR
A5E4P0_LODEL/994-1796NDHSVFKQNENHSGQSTPRGSRSRLSQSPAFHHTFDDLDDDDDEDDDDIMLLRKSRSTRFGRSGGRSGLGGAGGSGGNSG
EXOC1_DICDI/95-855..............KESKDQNDFFSSSSSSKKSIDSLNNNTSTST....PSKNSSSSSSS..................SS

PF04129

VPS52_YEAST/47-607-------------------QQIDSQFALG--------------------NGLSTTSVSGF--------------------
VPS52_SCHPO/1-508-------------------LKGETI....--------------------.RVEEDRK...--------------------
Q9VMQ8_DROME/42-546-------------------EESCTKDDL.--------------------MGIEDNAS...--------------------
Q9FVV3_ARATH/83-615-------------------DIATAY.DL.--------------------IGVETRTT...--------------------
VPS52_RAT/94-601-------------------EEVAEKDDL.--------------------MGVEDTAK...--------------------

PF15278

B6K1Q5_SCHJY/526-611--------------------------------------------------------------------------------
YD6C_SCHPO/520-605--------------------------------------------------------------------------------

PF06419

COG6_CRYNJ/69-690-------------------------------------..........GGLP....RPIEI--------------------
COG6_EMENI/58-693-------------------------------------..........GGDS..AVKPIEF--------------------
COG6_ASPFU/55-708-------------------------------------..........GSGGDRNVKPIEF--------------------
COG6_PICGU/131-737-------------------------------------.............G...SSPQSE--------------------
COG6_DEBHA/132-759-------------------------------------D.....NRSGSIQH...DRPIIL--------------------
COG6_HUMAN/55-656-------------------------------------..........GGTP....RPIEM--------------------
COG6_CANGA/175-819-------------------------------------.................LSTTIS--------------------
Q6C1G5_YARLI/25-595-------------------------------------..........KNGT....KALDF--------------------
COG6_ASPNC/57-685-------------------------------------..........GTTGDTNVKPIEF--------------------
COG6_YEAST/181-824-------------------------------------................TSKPIIL--------------------
COG6_PHANO/54-693-------------------------------------...........DAEHIATKPIEF--------------------
COG6_ASPOR/121-774-------------------------------------..........GTAGDSNVKPIEF--------------------
COG6_CHAGB/46-689-------------------------------------..........SGIEDQSVKPIEL--------------------
COG6_COCIM/32-673-------------------------------------..........GDRLDANAKPIEF--------------------
COG6_SCHPO/43-650-------------------------------------..........LSSS....RPIEL--------------------
Q17KR7_AEDAE/31-620-------------------------------------............NA....KPIEM--------------------
COG6_ASHGO/158-791-------------------------------------................EGRSIIL--------------------
COG6_PICST/153-782-------------------------------------NVSTFKRRSSSISSETSSRPIYV--------------------
Q7QJN1_ANOGA/31-623-------------------------------------..........GGNP....RPIEM--------------------
A7SZM3_NEMVE/34-607-------------------------------------..........GGTP....RPIEL--------------------
COG6_CANAL/144-758-------------------------------------Q.....GRSSSISS..DSRPIYM--------------------
COG6_MAGO7/53-703-------------------------------------..........GGTVDHSVKPIEM--------------------
COG6_KLULA/138-763-------------------------------------..............K.LQRPIIL--------------------
COG6_SCLS1/52-643-------------------------------------..........GGDEDPSIKPIEL--------------------
COG6_DROME/34-627-------------------------------------..........GGNP....KPIEL--------------------
COG6_CAEEL/37-623-------------------------------------..................MPEGL--------------------
COG6_ASPTN/56-707-------------------------------------..........GAGGD.NVKPIEF--------------------
COG6_NEUCR/63-712-------------------------------------..........AGLEDPSVKPIEL--------------------
Q00T18_OSTTA/85-728-------------------------------------..........GS......KPLEV--------------------

PF03081

Q5Z4V4_ORYSJ/278-638--------------------------------------------------------------------------------
EXOC7_DICDI/436-836--------------------------------------------------------------------------------
EXO70_DEBHA/215-612--------------------------------------------------------------------------------
A5DE46_PICGU/207-601--------------------------------------------------------------------------------
A2QCL9_ASPNC/266-651--------------------------------------------------------------------------------
Q5KMS6_CRYNJ/297-673--------------------------------------------------------------------------------
Q9SF51_ARATH/232-603--------------------------------------------------------------------------------
Q5QLT4_ORYSJ/188-532--------------------------------------------------------------------------------
Q7XPT9_ORYSJ/273-640--------------------------------------------------------------------------------
EXO70_YARLI/227-601--------------------------------------------------------------------------------
Q9LZD3_ARATH/267-627--------------------------------------------------------------------------------
Q5ZIN3_CHICK/309-677--------------------------------------------------------------------------------
A2WY31_ORYSI/215-549--------------------------------------------------------------------------------
A2YJD7_ORYSI/54-381--------------------------------------------------------------------------------
Q6ES92_ORYSJ/191-595--------------------------------------------------------------------------------
Q9SIB0_ARATH/209-553--------------------------------------------------------------------------------
A5C6J8_VITVI/270-630--------------------------------------------------------------------------------
Q9LQP9_ARATH/237-588--------------------------------------------------------------------------------
EXO70_CANAL/229-666--------------------------------------------------------------------------------
A5E7C7_LODEL/212-655--------------------------------------------------------------------------------
EXO70_GIBZE/245-630--------------------------------------------------------------------------------
EXO70_ASHGO/230-612--------------------------------------------------------------------------------
A2YJD9_ORYSI/318-664--------------------------------------------------------------------------------
A2XSN9_ORYSI/302-674--------------------------------------------------------------------------------
A6SNP3_BOTFB/246-636--------------------------------------------------------------------------------
Q6Z5V5_ORYSJ/162-505--------------------------------------------------------------------------------
Q0WPK8_ARATH/246-618--------------------------------------------------------------------------------
A2DS47_TRIVA/251-594--------------------------------------------------------------------------------
Q9FY95_ARATH/272-641--------------------------------------------------------------------------------
Q9M3D4_ARATH/241-604--------------------------------------------------------------------------------
A2YSN5_ORYSI/155-523--------------------------------------------------------------------------------
Q9FNR3_ARATH/272-623--------------------------------------------------------------------------------
A7TQI9_VANPO/236-622--------------------------------------------------------------------------------
EXO70_SCHPO/244-610--------------------------------------------------------------------------------
A2YXE5_ORYSI/221-597--------------------------------------------------------------------------------
Q4PDG8_USTMA/293-725--------------------------------------------------------------------------------
A5BYE5_VITVI/322-667--------------------------------------------------------------------------------
Q2QX89_ORYSJ/323-687--------------------------------------------------------------------------------
Q9SF50_ARATH/227-599--------------------------------------------------------------------------------
EXO70_CANGA/234-621--------------------------------------------------------------------------------
Q0U449_PHANO/246-624--------------------------------------------------------------------------------
Q6Z5U7_ORYSJ/196-558--------------------------------------------------------------------------------
Q5TQS7_ANOGA/314-704--------------------------------------------------------------------------------
Q0WPV2_ARATH/303-668--------------------------------------------------------------------------------
A8XF23_CAEBR/258-601--------------------------------------------------------------------------------
A3LWD2_PICST/217-612--------------------------------------------------------------------------------
EXO70_KLULA/233-617--------------------------------------------------------------------------------
Q9LMJ4_ARATH/246-593--------------------------------------------------------------------------------
Q9C8H6_ARATH/253-624--------------------------------------------------------------------------------
A3BAD3_ORYSJ/211-560--------------------------------------------------------------------------------
Q60EX4_ORYSJ/153-510--------------------------------------------------------------------------------
Q69JW6_ORYSJ/345-697--------------------------------------------------------------------------------
Q6YZW7_ORYSJ/295-656--------------------------------------------------------------------------------
Q9LIA2_ARATH/265-644--------------------------------------------------------------------------------
Q8H150_ARATH/227-595--------------------------------------------------------------------------------
A2WYH2_ORYSI/258-597--------------------------------------------------------------------------------
B9FJQ2_ORYSJ/298-655--------------------------------------------------------------------------------
A2YA16_ORYSI/142-483--------------------------------------------------------------------------------

PF15469

A4RXA7_OSTLU/41-217--------------------------------------------------------------------------------
A6ZYC4_YEAS7/144-361--------------------------------------------------------------------------------
A7TRG2_VANPO/143-342--------------------------------------------------------------------------------
A8IS87_CHLRE/340-518--------------------------------------------------------------------------------
A8PCF2_COPC7/122-323--------------------------------------------------------------------------------
A8PUN7_MALGO/110-314--------------------------------------------------------------------------------
A8QHB2_BRUMA/204-382--------------------------------------------------------------------------------
A8WPA7_CAEBR/200-378--------------------------------------------------------------------------------
A9RNH0_PHYPA/252-430--------------------------------------------------------------------------------
A9S1F4_PHYPA/259-437--------------------------------------------------------------------------------
B0ET40_ENTDS/59-222--------------------------------------------------------------------------------
B0W3D0_CULQU/193-383--------------------------------------------------------------------------------
B2RBE6_HUMAN/198-377--------------------------------------------------------------------------------
B3MVG4_DROAN/193-383--------------------------------------------------------------------------------
B6K5G3_SCHJY/147-340--------------------------------------------------------------------------------
B7PR09_IXOSC/148-326--------------------------------------------------------------------------------
B8ATQ6_ORYSI/262-452--------------------------------------------------------------------------------
B8BR17_THAPS/466-647--------------------------------------------------------------------------------
B8P2C9_POSPM/114-312--------------------------------------------------------------------------------
C3XUC7_BRAFL/191-370--------------------------------------------------------------------------------
C4M2W7_ENTHI/111-299--------------------------------------------------------------------------------
C4R5S5_PICPG/139-344--------------------------------------------------------------------------------
C4YAI9_CLAL4/138-372--------------------------------------------------------------------------------
C5DMT2_LACTC/144-330--------------------------------------------------------------------------------
C5DYM3_ZYGRC/146-354--------------------------------------------------------------------------------
C5MH42_CANTT/104-348--------------------------------------------------------------------------------
D0MT24_PHYIT/66-241--------------------------------------------------------------------------------
D5GNN2_TUBMM/147-347--------------------------------------------------------------------------------
D6W674_TRICA/193-371--------------------------------------------------------------------------------
D7KJZ0_ARALL/260-438--------------------------------------------------------------------------------
D8QDB4_SCHCM/114-323--------------------------------------------------------------------------------
D8RD25_SELML/239-417--------------------------------------------------------------------------------
E0S9H6_ENCIT/50-261--------------------------------------------------------------------------------
E0VQL4_PEDHC/200-377--------------------------------------------------------------------------------
E2AW35_CAMFO/194-372--------------------------------------------------------------------------------
E3K655_PUCGT/121-321--------------------------------------------------------------------------------
E4XNP2_OIKDI/201-392--------------------------------------------------------------------------------
E6QYJ0_CRYGW/114-305--------------------------------------------------------------------------------
E6ZLD0_SPORE/109-315--------------------------------------------------------------------------------
E7R2N5_PICAD/151-341--------------------------------------------------------------------------------
E9C1C0_CAPO3/243-420--------------------------------------------------------------------------------
E9G6B5_DAPPU/193-371--------------------------------------------------------------------------------
F0W4R3_9STRA/41-214--------------------------------------------------------------------------------
F0ZXN2_DICPU/132-311--------------------------------------------------------------------------------
F2UAY3_SALS5/207-386--------------------------------------------------------------------------------
F4PCT9_BATDJ/225-428--------------------------------------------------------------------------------
F4PGL2_DICFS/126-305--------------------------------------------------------------------------------
F4Q787_DICFS/187-364--------------------------------------------------------------------------------
F4RSS6_MELLP/56-255--------------------------------------------------------------------------------
F6Q8U3_CIOIN/201-380--------------------------------------------------------------------------------
F6YQX0_XENTR/198-380--------------------------------------------------------------------------------
F8NGV0_SERL9/40-233--------------------------------------------------------------------------------
G0VBU0_NAUCC/150-340--------------------------------------------------------------------------------
G0WGP4_NAUDC/153-350--------------------------------------------------------------------------------
G1XK06_ARTOA/190-398--------------------------------------------------------------------------------
G3AUN6_SPAPN/128-368--------------------------------------------------------------------------------
G4TT08_PIRID/115-310--------------------------------------------------------------------------------
G4VNQ3_SCHMA/214-394--------------------------------------------------------------------------------
G6D800_DANPL/194-372--------------------------------------------------------------------------------
G7DSD2_MIXOS/124-323--------------------------------------------------------------------------------
G7IVK4_MEDTR/51-227--------------------------------------------------------------------------------
G8BGG9_CANPC/145-407--------------------------------------------------------------------------------
G8BMU6_TETPH/145-338--------------------------------------------------------------------------------
G8JTD1_ERECY/120-302--------------------------------------------------------------------------------
G8XZB2_PICSO/148-394--------------------------------------------------------------------------------
G8ZXE8_TORDC/144-345--------------------------------------------------------------------------------
H2AR86_KAZAF/151-365--------------------------------------------------------------------------------
H2KP67_CLOSI/214-393--------------------------------------------------------------------------------
H2ZFP8_CIOSA/151-287--------------------------------------------------------------------------------
H3ERJ1_PRIPA/197-373--------------------------------------------------------------------------------
I0ZAT9_9CHLO/267-451--------------------------------------------------------------------------------
I1GNJ4_BRADI/14-163--------------------------------------------------------------------------------
I1NBC3_SOYBN/28-188--------------------------------------------------------------------------------
SEC5_SCHPO/139-329--------------------------------------------------------------------------------
Q019K9_OSTTA/44-232--------------------------------------------------------------------------------
Q232N2_TETTS/349-532--------------------------------------------------------------------------------
Q6CGI4_YARLI/146-334--------------------------------------------------------------------------------
Q6CQH1_KLULA/148-350--------------------------------------------------------------------------------
Q6FVL5_CANGA/149-372--------------------------------------------------------------------------------
Q750U7_ASHGO/122-304--------------------------------------------------------------------------------

PF04124

COG8_MOUSE/56-394--------------------------------------------------------------------------------
COG8_SCHPO/15-354--------------------------------------------------------------------------------
COG8_YEAST/28-381--------------------------------------------------------------------------------
COG8_CAEEL/10-353--------------------------------------------------------------------------------
Q9LYH5_ARATH/29-412--------------------------------------------------------------------------------
COG8_DROME/37-379--------------------------------------------------------------------------------
Q9P3N9_NEUCS/31-347--------------------------------------------------------------------------------

PF08700

COG5_MOUSE/37-120--------------------------------------------------------------------------------
EXO84_CRYNJ/142-228--------------------------------------------------------------------------------
Q6BJZ0_DEBHA/76-158--------------------------------------------------------------------------------
Q0U0Z3_PHANO/76-170--------------------------------------------------------------------------------
Q0WQ75_ARATH/43-129--------------------------------------------------------------------------------
Q5KJF4_CRYNJ/98-180--------------------------------------------------------------------------------
Q173I8_AEDAE/5-87--------------------------------------------------------------------------------
A2D783_TRIVA/6-88--------------------------------------------------------------------------------
Q7Q6Z6_ANOGA/11-97--------------------------------------------------------------------------------
Q2UQ54_ASPOR/108-197--------------------------------------------------------------------------------
Q7S488_NEUCR/247-341--------------------------------------------------------------------------------
VPS51_YEAST/84-163--------------------------------------------------------------------------------
A2E266_TRIVA/29-115--------------------------------------------------------------------------------
Q2U987_ASPOR/1-88--------------------------------------------------------------------------------
Q6FRQ2_CANGA/66-146--------------------------------------------------------------------------------
Q6CSC3_KLULA/100-179--------------------------------------------------------------------------------
Q4SXW2_TETNG/10-92--------------------------------------------------------------------------------
EXO84_GIBZE/128-214--------------------------------------------------------------------------------
Q75HJ9_ORYSJ/40-126--------------------------------------------------------------------------------
EXOC8_MOUSE/13-100--------------------------------------------------------------------------------
Q4P2N5_USTMA/76-162--------------------------------------------------------------------------------
Q4PEG0_USTMA/79-161--------------------------------------------------------------------------------
Q8I2A9_PLAF7/116-202--------------------------------------------------------------------------------
Q6CG64_YARLI/77-166--------------------------------------------------------------------------------
Q4E335_TRYCC/3-85--------------------------------------------------------------------------------
EXO84_YARLI/121-207--------------------------------------------------------------------------------
Q4MZL9_THEPA/63-149--------------------------------------------------------------------------------
COG1_SCHPO/7-89--------------------------------------------------------------------------------
Q59L27_CANAL/17-99--------------------------------------------------------------------------------
Q2UHE7_ASPOR/121-207--------------------------------------------------------------------------------
Q7RZT4_NEUCR/9-91--------------------------------------------------------------------------------
Q8SWU0_DROME/4-91--------------------------------------------------------------------------------
E9AC89_LEIMA/3-81--------------------------------------------------------------------------------
A2GBI6_TRIVA/24-110--------------------------------------------------------------------------------
Q4Y221_PLACH/14-100--------------------------------------------------------------------------------
EXO84_ASHGO/127-213--------------------------------------------------------------------------------
Q8LCN9_ARATH/18-103--------------------------------------------------------------------------------
FFR_DICDI/178-264--------------------------------------------------------------------------------
YEWA_SCHPO/52-138--------------------------------------------------------------------------------
Q9FFF3_ARATH/21-103--------------------------------------------------------------------------------
Q4P6W6_USTMA/184-270--------------------------------------------------------------------------------
Q1WMT0_COPDI/48-130--------------------------------------------------------------------------------
COG1_DICDI/113-195--------------------------------------------------------------------------------
A2FRD0_TRIVA/32-118--------------------------------------------------------------------------------
A0C9R8_PARTE/6-92--------------------------------------------------------------------------------
Q00XX6_OSTTA/568-650--------------------------------------------------------------------------------
EXO84_CANGA/190-276--------------------------------------------------------------------------------
Q754G8_ASHGO/53-137--------------------------------------------------------------------------------
FFR_CHICK/57-143--------------------------------------------------------------------------------
Q55VT5_CRYNB/54-140--------------------------------------------------------------------------------
Q95Q35_CAEEL/9-99--------------------------------------------------------------------------------
Q6C0N6_YARLI/24-102--------------------------------------------------------------------------------
Q5DTY3_MOUSE/20-102--------------------------------------------------------------------------------
Q5CPU5_CRYPI/48-125--------------------------------------------------------------------------------
Q4DYG1_TRYCC/45-131--------------------------------------------------------------------------------
Q5ZAZ1_ORYSJ/7-89--------------------------------------------------------------------------------

PF06148

Q0TYI9_PHANO/26-159--------------------------------------------------------------------------------
Q29BE0_DROPS/22-154--------------------------------------------------------------------------------
Q7QFV1_ANOGA/25-157--------------------------------------------------------------------------------
Q84LH7_ORYSJ/24-156--------------------------------------------------------------------------------
Q9ASS9_ARATH/31-163--------------------------------------------------------------------------------
Q01CT5_OSTTA/52-184--------------------------------------------------------------------------------
Q5K8I4_CRYNJ/34-165--------------------------------------------------------------------------------
Q4P841_USTMA/85-240--------------------------------------------------------------------------------
A1C4Y0_ASPCL/32-165--------------------------------------------------------------------------------
Q2UA29_ASPOR/27-160--------------------------------------------------------------------------------
COG2_HUMAN/15-147--------------------------------------------------------------------------------
Q0C728_AEDAE/17-149--------------------------------------------------------------------------------
Q5BZC0_SCHJA/41-174--------------------------------------------------------------------------------
A8WN13_CAEBR/23-155--------------------------------------------------------------------------------
Q383M1_TRYB2/46-232--------------------------------------------------------------------------------
Q4DNE3_TRYCC/72-246--------------------------------------------------------------------------------
Q4Q0F6_LEIMA/80-262--------------------------------------------------------------------------------
A0CKT7_PARTE/12-141--------------------------------------------------------------------------------
COG2_DICDI/53-185--------------------------------------------------------------------------------

PF10392

COG5_HUMAN/66-189--------------------------------------------------------------------------------
Q6BT79_DEBHA/15-147--------------------------------------------------------------------------------
Q5B379_EMENI/829-961--------------------------------------------------------------------------------
Q5APN5_CANAL/17-149--------------------------------------------------------------------------------
COG5_SCHPO/8-139--------------------------------------------------------------------------------
COG5_YEAST/14-146--------------------------------------------------------------------------------
Q9C9V9_ARATH/57-180--------------------------------------------------------------------------------
Q0U7T7_PHANO/13-145--------------------------------------------------------------------------------
Q2HI55_CHAGB/25-157--------------------------------------------------------------------------------
Q5KKM0_CRYNJ/10-154--------------------------------------------------------------------------------
Q6CLE2_KLULA/11-144--------------------------------------------------------------------------------
COG5_DICDI/63-186--------------------------------------------------------------------------------
Q6C2T6_YARLI/5-136--------------------------------------------------------------------------------
Q75B18_ASHGO/11-144--------------------------------------------------------------------------------
Q6FTM6_CANGA/9-140--------------------------------------------------------------------------------
Q65XH1_ORYSJ/52-175--------------------------------------------------------------------------------

PF04100

VPS53_CAEEL/29-391--------------------------------------------------------------------------------
VPS53_HUMAN/39-453--------------------------------------------------------------------------------
Q9VQY8_DROME/42-434--------------------------------------------------------------------------------
Q9C6Q3_ARATH/1-444--------------------------------------------------------------------------------
YDLF_SCHPO/16-394--------------------------------------------------------------------------------
VPS53_YEAST/5-369--------------------------------------------------------------------------------
Q9C6I3_ARATH/1-331--------------------------------------------------------------------------------

PF10475

Q7QF78_ANOGA/99-388--------------------------------------------------------------------------------
Q336V4_ORYSJ/131-419--------------------------------------------------------------------------------
Q012F3_OSTTA/52-350--------------------------------------------------------------------------------
Q54MU4_DICDI/72-370--------------------------------------------------------------------------------
Q6JJ34_IPOTF/130-420--------------------------------------------------------------------------------
CC132_CHICK/54-327--------------------------------------------------------------------------------
Q16RR9_AEDAE/70-360--------------------------------------------------------------------------------
A1ZAY8_DROME/75-362--------------------------------------------------------------------------------
Q54NV0_DICDI/113-401--------------------------------------------------------------------------------
Q8RXC2_ARATH/132-421--------------------------------------------------------------------------------
Q18602_CAEEL/76-363--------------------------------------------------------------------------------
A8XSD2_CAEBR/80-367--------------------------------------------------------------------------------

PF04048

Q7PY10_ANOGA/23-144--------------------------------------------------------------------------------
EXOC4_DROME/25-146--------------------------------------------------------------------------------
EXOC4_HUMAN/23-144--------------------------------------------------------------------------------
Q541W5_ARATH/15-151--------------------------------------------------------------------------------
Q69PQ1_ORYSJ/22-158--------------------------------------------------------------------------------
Q59NP0_CANAL/27-168--------------------------------------------------------------------------------
A5E514_LODEL/26-167--------------------------------------------------------------------------------
Q6BLA3_DEBHA/30-171--------------------------------------------------------------------------------
A5DKL1_PICGU/29-170--------------------------------------------------------------------------------
A3LUX9_PICST/29-170--------------------------------------------------------------------------------
Q75B87_ASHGO/33-174--------------------------------------------------------------------------------
Q6CNM5_KLULA/34-175--------------------------------------------------------------------------------
A7TRV6_VANPO/35-176--------------------------------------------------------------------------------
A6ZWU4_YEAS7/34-175--------------------------------------------------------------------------------
Q6FWA6_CANGA/35-176--------------------------------------------------------------------------------
Q6C3L8_YARLI/34-175--------------------------------------------------------------------------------
Q4WUD2_ASPFU/134-275--------------------------------------------------------------------------------
Q0CDB2_ASPTN/131-272--------------------------------------------------------------------------------
Q2U7S6_ASPOR/137-278--------------------------------------------------------------------------------
SEC8_NEUCR/82-223--------------------------------------------------------------------------------
SEC8_SCHPO/51-191--------------------------------------------------------------------------------
Q4PBF9_USTMA/441-580--------------------------------------------------------------------------------

PF06248

Q7QA24_ANOGA/4-537--------------------------------------------------------------------------------
ZW10_DROPS/10-571--------------------------------------------------------------------------------
ZW10_ARATH/1-584--------------------------------------------------------------------------------
Q6ING5_XENLA/6-615--------------------------------------------------------------------------------
A7SSG2_NEMVE/20-670--------------------------------------------------------------------------------
A8XRG3_CAEBR/1-605--------------------------------------------------------------------------------
Q4SPW6_TETNG/9-605--------------------------------------------------------------------------------
ZW10_DROGR/1-567--------------------------------------------------------------------------------
ZW10_HUMAN/9-621--------------------------------------------------------------------------------
Q16R15_AEDAE/1-545--------------------------------------------------------------------------------
Q803G9_DANRE/9-612--------------------------------------------------------------------------------
Q98TG8_CHICK/1-595--------------------------------------------------------------------------------

PF06046

Q4WPU5_ASPFU/183-757--------------------------------------------------------------------------------
EX3L4_HUMAN/179-709--------------------------------------------------------------------------------
EX3L1_DANRE/206-763--------------------------------------------------------------------------------
A3LNE6_PICST/180-819--------------------------------------------------------------------------------
A4RYX1_OSTLU/92-690--------------------------------------------------------------------------------
A5DIA8_PICGU/180-832--------------------------------------------------------------------------------
A5DY39_LODEL/293-930--------------------------------------------------------------------------------
A6RAW7_AJECN/390-965--------------------------------------------------------------------------------
A7F9Q6_SCLS1/177-755--------------------------------------------------------------------------------
SEC6_SCHPO/159-721--------------------------------------------------------------------------------
Q016Y9_OSTTA/124-721--------------------------------------------------------------------------------
TNAP2_HUMAN/122-651--------------------------------------------------------------------------------
Q0TXU6_PHANO/187-762--------------------------------------------------------------------------------
EX3L1_BOVIN/188-722--------------------------------------------------------------------------------
Q16I77_AEDAE/179-730--------------------------------------------------------------------------------
Q28ZN5_DROPS/179-731--------------------------------------------------------------------------------
Q3SE84_PARTE/186-671--------------------------------------------------------------------------------
TNAP2_MOUSE/157-688--------------------------------------------------------------------------------
Q4P8D1_USTMA/258-828--------------------------------------------------------------------------------
Q4RJ08_TETNG/178-739--------------------------------------------------------------------------------
EXOC3_DICDI/183-774--------------------------------------------------------------------------------
Q5A7K3_CANAL/180-812--------------------------------------------------------------------------------
Q5BBU2_EMENI/183-758--------------------------------------------------------------------------------
Q5K9B3_CRYNJ/179-740--------------------------------------------------------------------------------
Q5RG40_DANRE/163-694--------------------------------------------------------------------------------
Q69YP2_HUMAN/105-661--------------------------------------------------------------------------------
Q6BJB6_DEBHA/180-833--------------------------------------------------------------------------------
Q6C9T6_YARLI/183-804--------------------------------------------------------------------------------
Q6CU40_KLULA/178-794--------------------------------------------------------------------------------
EX3L4_MOUSE/181-708--------------------------------------------------------------------------------
Q6DJR6_XENTR/177-732--------------------------------------------------------------------------------
Q6FPK2_CANGA/177-798--------------------------------------------------------------------------------
E9P8I5_YEASX/178-798--------------------------------------------------------------------------------
Q873E6_NEUCS/175-753--------------------------------------------------------------------------------
EX3L1_MOUSE/189-722--------------------------------------------------------------------------------
Q8NAC4_HUMAN/132-655--------------------------------------------------------------------------------
Q8SU74_ENCCU/160-687--------------------------------------------------------------------------------
Q9M9G4_ARATH/172-724--------------------------------------------------------------------------------

PF04091

Q4WDM8_ASPFU/443-722--------------------------------------------------------------------------------
EXOC6_ARATH/442-755--------------------------------------------------------------------------------
Q753S5_ASHGO/493-835--------------------------------------------------------------------------------
Q6BHQ3_DEBHA/493-827--------------------------------------------------------------------------------
A5DMM0_PICGU/481-812--------------------------------------------------------------------------------
A8XM86_CAEBR/483-791--------------------------------------------------------------------------------
Q6CYE5_KLULA/488-829--------------------------------------------------------------------------------
Q8S5T3_ORYSJ/441-754--------------------------------------------------------------------------------
EXOC6_DROME/427-731--------------------------------------------------------------------------------
Q17EP0_AEDAE/418-723--------------------------------------------------------------------------------
EXOC6_RAT/455-763--------------------------------------------------------------------------------
A7TQS9_VANPO/505-846--------------------------------------------------------------------------------
Q6C1W0_YARLI/479-794--------------------------------------------------------------------------------
Q560L3_CRYNB/479-787--------------------------------------------------------------------------------
A6RZT9_BOTFB/417-719--------------------------------------------------------------------------------
A3LS60_PICST/479-812--------------------------------------------------------------------------------
SEC15_SCHPO/435-740--------------------------------------------------------------------------------
Q7RYL2_NEUCR/450-733--------------------------------------------------------------------------------
Q0CL01_ASPTN/446-728--------------------------------------------------------------------------------
A7E4G0_SCLS1/408-698--------------------------------------------------------------------------------
O81298_ARATH/430-736--------------------------------------------------------------------------------
Q0UFZ1_PHANO/442-734--------------------------------------------------------------------------------
A6R9C0_AJECN/443-746--------------------------------------------------------------------------------
Q4P319_USTMA/445-765--------------------------------------------------------------------------------
Q7XEN0_ORYSJ/441-754--------------------------------------------------------------------------------
A5BA73_VITVI/441-754--------------------------------------------------------------------------------
SEC15_YEAST/520-865--------------------------------------------------------------------------------
Q4SZ84_TETNG/313-614--------------------------------------------------------------------------------
Q6FRK2_CANGA/500-842--------------------------------------------------------------------------------
A5E457_LODEL/495-827--------------------------------------------------------------------------------
EXOC6_DICDI/691-995--------------------------------------------------------------------------------

PF09763

Q75AA6_ASHGO/631-1297CTKS....................................NEVDTILKSLGAIEELCITYQNF-----------------
A5DBH0_PICGU/582-1282SAEGSP.................EFHVD..TISNKNSSEVEDPRAVIELLNETKDLITVLQFF-----------------
A3GH85_PICST/625-1329KRFGLNMEES........DDHKQQAHLENVRKYSKNSNEIEDPKAVVAIIDESKDLISIIQFF-----------------
Q6FRC5_CANGA/652-1329PIYG....................................DILVSVLEMLESLQKQCIYYQNF-----------------
A6QQU0_BOVIN/176-464...............................................................-----------------
Q2UK85_ASPOR/702-1427GKTMRAAAGL.......RLPSGDKQ...........HGHLEPYESFAGALHETLSMISEEQNF-----------------
A7TSV5_VANPO/776-1455PIIV....................................NVLSEFMSLINKVENLCIVYQNF-----------------
Q6CQX3_KLULA/540-1218SELD....................................PQLVSIINAIREMESVCTVYQNF-----------------
Q57ZX4_TRYB2/198-1064TLRLYDPIHTQAANVGHNSPTPAPSLLA..PTVSKTNGQLKPDVAFAMTLEAAFCMVLQEEDT-----------------
EXOC1_DROME/186-866GTLGINRD............QWGPG........VETADRMRFDALLEKVLAELEPIALQEQLF-----------------
A7E4X8_SCLS1/708-1443SQTLAKIRSPAG....DGGNKSTAD........KA.DGRLPPHEVFTGALDEMVPIMSMEQNF-----------------
Q4RKW7_TETNG/106-846SSLLDMGN............MSASD........LDVADRTKFDKVLSP..SEASAEERVRVLI-----------------
Q6C0U5_YARLI/751-1484SHSHQN................VGQRKR..DVSLSLSKNDKLQNSFSGIVEALQTALNSEQEI-----------------
Q2GRZ6_CHAGB/575-1334SQTLARSLRSPL...GDGSRTNLAE........KTPDGRALPYEVFAGVLDDLLPLVEMEQNF-----------------
Q5K9I2_CRYNJ/475-1177SKTVIGLGLGNQP.KQEKRTGNNVN...............RAAELYRQAFTQIINQIVIEEDF-----------------
Q7T2A6_DANRE/169-869SSLLDMGN............MSASD........LDVADRTRFDKIFEQVLSELEPLCLAEQDF-----------------
A7RVQ5_NEMVE/151-846GSETRSRSGS.......IGSVDSAT........EPLDIRGRFDRVFDILLSELEPVCTSEQEF-----------------
Q5TMX8_ANOGA/189-872GILGTSKE............MWSPG........AEAIERQRFDSILEKVLAELEPVALSEQHF-----------------
Q10GJ4_ORYSJ/212-854STVS.......................................DAYSKMLTIFIPLLVDESSF-----------------
Q4PFK6_USTMA/462-1173SSRG.............................ARDRGDVSGQDSLQRILSCIFPVLLREQSF-----------------
A6ZQV5_YEAS7/640-1316PVFK....................................NSFSLLTECLQTMRQECIVYQNF-----------------
Q7S5W6_NEUCR/694-1488SQTLARTLRSQV...GEGKAGTAAD........KTLDSRALPYEAFAGVLDDLLPLVEMEQNF-----------------
A5E4P0_LODEL/994-1796GRFGGLLSDGDFESKKQERLEMMKQQAM..ASYPKSSNDLDDSKAVVTFIDETRSVIMFLQFF-----------------
EXOC1_DICDI/95-855GKDG................................IKKRKINRLFKYALSCLEIYIMTKQNF-----------------

PF04129

VPS52_YEAST/47-607---------------------------------NNSPSLFFSNYLTTSASNAFYNKLPVTDEK-----------------
VPS52_SCHPO/1-508---------------------------------....GLFNL.............SKGAQQSY-----------------
Q9VMQ8_DROME/42-546---------------------------------....KGLFS..............KTTSLKH-----------------
Q9FVV3_ARATH/83-615---------------------------------....GLFSR..............AREPLKN-----------------
VPS52_RAT/94-601---------------------------------....KGFFS..............K.PSLRS-----------------

PF15278

B6K1Q5_SCHJY/526-611--------------------------------------------------------------------------------
YD6C_SCHPO/520-605--------------------------------------------------------------------------------

PF06419

COG6_CRYNJ/69-690-------------------------------------HAHDPTRYVGDMLAWVHQTTATEHEF-----------------
COG6_EMENI/58-693-------------------------------------SAHDPLRYIGDMLAWVHSTTVSEREA-----------------
COG6_ASPFU/55-708-------------------------------------SAHDPLRYVGDMLAWVHSTTVSEREA-----------------
COG6_PICGU/131-737-------------------------------------EYQDPVRVIGDLLAYIHSVVVSESET-----------------
COG6_DEBHA/132-759-------------------------------------SAHDPVRFIGDLLAYIHSVVVNETET-----------------
COG6_HUMAN/55-656-------------------------------------HSHDPLRYVGDMLAWLHQATASEKEH-----------------
COG6_CANGA/175-819-------------------------------------SSEDPVRYIGDVLATIHTMIANEVDF-----------------
Q6C1G5_YARLI/25-595-------------------------------------YAYDCQRYIGDILAWVYSCVVLETEN-----------------
COG6_ASPNC/57-685-------------------------------------SAHDPLRYIGDMLAWVHSTTVSEREA-----------------
COG6_YEAST/181-824-------------------------------------SAHDPIRYIGDVLASVHSIIANEADF-----------------
COG6_PHANO/54-693-------------------------------------QAHDPLRYVGDMLAWVHSTTVSEREA-----------------
COG6_ASPOR/121-774-------------------------------------SAHDPLRYIGDMLAWVHSTTVSEREA-----------------
COG6_CHAGB/46-689-------------------------------------VAHDTLRYVGDMLAWAHSAAVGEREA-----------------
COG6_COCIM/32-673-------------------------------------SAHDPLRYVGDMLAWVHSATVSEREA-----------------
COG6_SCHPO/43-650-------------------------------------SAPDTVRFIGDLLAWIHQTIVNEKEL-----------------
Q17KR7_AEDAE/31-620-------------------------------------LAHDPKRYVGDMFAYIHQILPVEREN-----------------
COG6_ASHGO/158-791-------------------------------------SAHDPARYLGDVLAHVHSLLANEGDF-----------------
COG6_PICST/153-782-------------------------------------SAHDPIRFIGDLLAYVHSLVVNESDT-----------------
Q7QJN1_ANOGA/31-623-------------------------------------LAHDPKRYIGDMFAYIHQILPPEKEN-----------------
A7SZM3_NEMVE/34-607-------------------------------------HSHDPIRYVGDMLAWLHQAIASDKEL-----------------
COG6_CANAL/144-758-------------------------------------SAHDPVRFVGDLLAYVHSVSVNESET-----------------
COG6_MAGO7/53-703-------------------------------------AAHDPLRYVGDMLAWSHSATVSEREA-----------------
COG6_KLULA/138-763-------------------------------------SAHDPVRYLGDVLAYVHSMIVNELEF-----------------
COG6_SCLS1/52-643-------------------------------------VAHDPLRYVGDMLAWTHSATVGEREA-----------------
COG6_DROME/34-627-------------------------------------HAHDPKRYIGDMFAWLHQSIPTEKEN-----------------
COG6_CAEEL/37-623-------------------------------------A..EPLKAVGDMLTSIHELTEQEKQL-----------------
COG6_ASPTN/56-707-------------------------------------SAHDPLRYIGDMLAWVHSTTVSEREA-----------------
COG6_NEUCR/63-712-------------------------------------VAHDPLRYVGDMLAWSHSAAVGEREA-----------------
Q00T18_OSTTA/85-728-------------------------------------HAHDPLRYVGDMLSWVHAAVASEREF-----------------

PF03081

Q5Z4V4_ORYSJ/278-638-------------------------------------...QRNMPPP.ADGGVPRIVSFVAKY-----------------
EXOC7_DICDI/436-836-------------------------------------.SSSNRKEII.SDATVDEISSNMINY-----------------
EXO70_DEBHA/215-612-------------------------------------..VKSVERL..TDLNATEAVVELISR-----------------
A5DE46_PICGU/207-601-------------------------------------..VTSVEKY..NDKTIAEITVEIISR-----------------
A2QCL9_ASPNC/266-651-------------------------------------..AAGIAMLP.PDGGSVPLVNEVMSS-----------------
Q5KMS6_CRYNJ/297-673-------------------------------------....ATTEGP.PTSVISDITYSTITY-----------------
Q9SF51_ARATH/232-603-------------------------------------...DSSKVVV.PGGGVHPLTISVMDH-----------------
Q5QLT4_ORYSJ/188-532-------------------------------------...DPSESCP.LDGGVHPMTRYVMNY-----------------
Q7XPT9_ORYSJ/273-640-------------------------------------...HSVTSTT.VDGAVHYMTSYVTDY-----------------
EXO70_YARLI/227-601-------------------------------------..VQQVMTLP.SDNGVCDATVEVMSR-----------------
Q9LZD3_ARATH/267-627-------------------------------------...DATKTAV.LDGTVHPLTSYVINY-----------------
Q5ZIN3_CHICK/309-677-------------------------------------..PDKEYNMP.KDGTVHELTSNAILF-----------------
A2WY31_ORYSI/215-549-------------------------------------.VSNTKNIVG.VGVGVHPLTKYAVLC-----------------
A2YJD7_ORYSI/54-381-------------------------------------...QSGLYHVAQRGGVHKITLYVMNY-----------------
Q6ES92_ORYSJ/191-595-------------------------------------.GCWQVSPEA.SASGVHETTVLMMNY-----------------
Q9SIB0_ARATH/209-553-------------------------------------...ESSKSLI.SGGGIHQLTRYVMNF-----------------
A5C6J8_VITVI/270-630-------------------------------------...YTSTSPF.PGGGILHLTRYVMNY-----------------
Q9LQP9_ARATH/237-588-------------------------------------...ESSKSAI.SGGGVHQLTRYVMNF-----------------
EXO70_CANAL/229-666-------------------------------------..FQNLGKF..NEINTQEVIVELMSK-----------------
A5E7C7_LODEL/212-655-------------------------------------..CSSLPQY..TESNTSQMTVEIASV-----------------
EXO70_GIBZE/245-630-------------------------------------..VGMLQILP.SDGAPIPLVSETMQR-----------------
EXO70_ASHGO/230-612-------------------------------------..TASLAQLP.TDNGVTEATVDVMSR-----------------
A2YJD9_ORYSI/318-664-------------------------------------...YSSEDMP.EGGGIHLVTTYLIRY-----------------
A2XSN9_ORYSI/302-674-------------------------------------...ESSRRPM.MAGEIHPMTRYVMNY-----------------
A6SNP3_BOTFB/246-636-------------------------------------..INLLQTLP.PDAATVPMTTETMMR-----------------
Q6Z5V5_ORYSJ/162-505-------------------------------------....HDSPII.PGGSVHLVTTYLMRY-----------------
Q0WPK8_ARATH/246-618-------------------------------------...EPSRVPV.PGGTIHPLTRYVMNY-----------------
A2DS47_TRIVA/251-594-------------------------------------...NDPDNVP.ANGSVIANVSNVIIF-----------------
Q9FY95_ARATH/272-641-------------------------------------...DNGRTPV.PSGAVHPLTRYTMNY-----------------
Q9M3D4_ARATH/241-604-------------------------------------...DTTKALT.PGGGIHKLTRSTMNF-----------------
A2YSN5_ORYSI/155-523-------------------------------------.ACWQVSQEA.AASGTHETTELTMNY-----------------
Q9FNR3_ARATH/272-623-------------------------------------...DESTRPF.HGGGIHHLTRYVMNY-----------------
A7TQI9_VANPO/236-622-------------------------------------..TKNITTIP.SDNGVTEATVDTMSR-----------------
EXO70_SCHPO/244-610-------------------------------------.TCHNNKTVPLTTDRVSEMTHGIMSF-----------------
A2YXE5_ORYSI/221-597-------------------------------------...ESSRRPV.LGGEIHPMTRYVLNY-----------------
Q4PDG8_USTMA/293-725-------------------------------------.PARKVSEVP..STSVNEITYLGLQF-----------------
A5BYE5_VITVI/322-667-------------------------------------...NQDGFPPLQDGSVPKLCSHGKGS-----------------
Q2QX89_ORYSJ/323-687-------------------------------------...DAGKQPV.PGGAVHPLTRYVMNY-----------------
Q9SF50_ARATH/227-599-------------------------------------...DSSKTVV.RGGGVHPMTISAMNH-----------------
EXO70_CANGA/234-621-------------------------------------..TNQMTTIP.SDNGVTEATVDTMSR-----------------
Q0U449_PHANO/246-624-------------------------------------..TQSLIALP.IDGGAVPITTETMRR-----------------
Q6Z5U7_ORYSJ/196-558-------------------------------------QNVVVVVVVP.DGGGIHVVTSYLARY-----------------
Q5TQS7_ANOGA/314-704-------------------------------------ISYGGGSSVP.RDATVYELTSNTIWF-----------------
Q0WPV2_ARATH/303-668-------------------------------------...ETSKRPT.TNGEVHPMIRYVMNY-----------------
A8XF23_CAEBR/258-601-------------------------------------...DTTKFVP.PDGNVHPTTASTLNF-----------------
A3LWD2_PICST/217-612-------------------------------------..FQNTEKI..TEINIPQIIVDLFSR-----------------
EXO70_KLULA/233-617-------------------------------------..TRSMSQLP.SDNGVPEPTVDIMSK-----------------
Q9LMJ4_ARATH/246-593-------------------------------------...DPPKTAF.PGGGIHPITRYVMNY-----------------
Q9C8H6_ARATH/253-624-------------------------------------...QRPNCPP.LDGGVPKLVSVVTEY-----------------
A3BAD3_ORYSJ/211-560-------------------------------------.ESYDNETIV.LNGSVLSFPQYTMGV-----------------
Q60EX4_ORYSJ/153-510-------------------------------------.GMHSWETFP.QSAEIHKATHLIMDY-----------------
Q69JW6_ORYSJ/345-697-------------------------------------.....QRLVM.VDIGVHHITRHITEY-----------------
Q6YZW7_ORYSJ/295-656-------------------------------------..HYVTAAAAGESGHVPKIVRYAVNY-----------------
Q9LIA2_ARATH/265-644-------------------------------------...DVSSHPF.PGGAVHPLTNYVMNY-----------------
Q8H150_ARATH/227-595-------------------------------------...ETSKTPI.IGGGVHPLTRYVMNY-----------------
A2WYH2_ORYSI/258-597-------------------------------------...RASRRVP.PGGGIHEVTRYVMNY-----------------
B9FJQ2_ORYSJ/298-655-------------------------------------...DPARVAA.QGGGIHPITRYVMNY-----------------
A2YA16_ORYSI/142-483-------------------------------------...HYPWRMP.QGGEVHPCVGFWMGY-----------------

PF15469

A4RXA7_OSTLU/41-217---------------------------------------------REKIARALEAMER----------------------
A6ZYC4_YEAS7/144-361---------------------------------------------ILNYQATKKFIEL----------------------
A7TRG2_VANPO/143-342---------------------------------------------ISNYQLTKTFIEE----------------------
A8IS87_CHLRE/340-518---------------------------------------------ADRIRAVAGLLQR----------------------
A8PCF2_COPC7/122-323---------------------------------------------AQKLRTTLGVFER----------------------
A8PUN7_MALGO/110-314---------------------------------------------SVKLRNTLGVFQR----------------------
A8QHB2_BRUMA/204-382---------------------------------------------ADATRNALSILTR----------------------
A8WPA7_CAEBR/200-378---------------------------------------------ADATRNALGVIVR----------------------
A9RNH0_PHYPA/252-430---------------------------------------------AERTRSVQRMLKR----------------------
A9S1F4_PHYPA/259-437---------------------------------------------VERIRSVQGMLQR----------------------
B0ET40_ENTDS/59-222---------------------------------------------TVNIMKTLGFVEK----------------------
B0W3D0_CULQU/193-383---------------------------------------------ADATRAALSALSR----------------------
B2RBE6_HUMAN/198-377---------------------------------------------ADSTRNALNVLQR----------------------
B3MVG4_DROAN/193-383---------------------------------------------ADSTRSVLFALSR----------------------
B6K5G3_SCHJY/147-340---------------------------------------------.DVAYADVLLAKR----------------------
B7PR09_IXOSC/148-326---------------------------------------------ADSTRNALSILQK----------------------
B8ATQ6_ORYSI/262-452---------------------------------------------AEKIRSVQGMLQR----------------------
B8BR17_THAPS/466-647---------------------------------------------VRKVQSALAVLQR----------------------
B8P2C9_POSPM/114-312---------------------------------------------AQKLRTTLGVFER----------------------
C3XUC7_BRAFL/191-370---------------------------------------------ADATRNALNVLQR----------------------
C4M2W7_ENTHI/111-299---------------------------------------------VDQSRDAISVIER----------------------
C4R5S5_PICPG/139-344---------------------------------------------ETALKHTLEYIQK----------------------
C4YAI9_CLAL4/138-372---------------------------------------------EAKVSKLIEFVQS----------------------
C5DMT2_LACTC/144-330---------------------------------------------RRNAQTTIAFLQD----------------------
C5DYM3_ZYGRC/146-354---------------------------------------------MVNYQATKNFIEE----------------------
C5MH42_CANTT/104-348---------------------------------------------EDKVLKMTEFIKA----------------------
D0MT24_PHYIT/66-241---------------------------------------------QRRIRHTLAVLAR----------------------
D5GNN2_TUBMM/147-347---------------------------------------------EEGLRLALAVLEK----------------------
D6W674_TRICA/193-371---------------------------------------------AEKTRNALNVLAR----------------------
D7KJZ0_ARALL/260-438---------------------------------------------AEKIRSVQGMLQR----------------------
D8QDB4_SCHCM/114-323---------------------------------------------AQKLRTTLGVFER----------------------
D8RD25_SELML/239-417---------------------------------------------AERIRSVQGMLQR----------------------
E0S9H6_ENCIT/50-261---------------------------------------------KIEGGRREYYMKK----------------------
E0VQL4_PEDHC/200-377---------------------------------------------ADATRNALTVLTR----------------------
E2AW35_CAMFO/194-372---------------------------------------------ADATRNALAVMQR----------------------
E3K655_PUCGT/121-321---------------------------------------------AERLRSTLGVFER----------------------
E4XNP2_OIKDI/201-392---------------------------------------------ADKIRNTLAVLQR----------------------
E6QYJ0_CRYGW/114-305---------------------------------------------ASKLRSTLGVFEK----------------------
E6ZLD0_SPORE/109-315---------------------------------------------TIKLRSTLNVFER----------------------
E7R2N5_PICAD/151-341---------------------------------------------ASEIESFLSLISS----------------------
E9C1C0_CAPO3/243-420---------------------------------------------SDSIRNVLNVLHR----------------------
E9G6B5_DAPPU/193-371---------------------------------------------ADGTRNALGILQR----------------------
F0W4R3_9STRA/41-214---------------------------------------------QRKLKNAIYVLGR----------------------
F0ZXN2_DICPU/132-311---------------------------------------------ADEIRKVLTLLNK----------------------
F2UAY3_SALS5/207-386---------------------------------------------ANQHRAMLHVLAT----------------------
F4PCT9_BATDJ/225-428---------------------------------------------GDKIRITLGILEG----------------------
F4PGL2_DICFS/126-305---------------------------------------------ADHIRKVLTLLNK----------------------
F4Q787_DICFS/187-364---------------------------------------------KDNIRKTKEIINN----------------------
F4RSS6_MELLP/56-255---------------------------------------------AERLRSTLGVFER----------------------
F6Q8U3_CIOIN/201-380---------------------------------------------ADSIRNTLNVLQR----------------------
F6YQX0_XENTR/198-380---------------------------------------------SHSTSMAVHIYTV----------------------
F8NGV0_SERL9/40-233---------------------------------------------AQKLRTTLGVFER----------------------
G0VBU0_NAUCC/150-340---------------------------------------------IENFKSGKRFIEE----------------------
G0WGP4_NAUDC/153-350---------------------------------------------IKNFKLTKQFIEQ----------------------
G1XK06_ARTOA/190-398---------------------------------------------EDKLRFLLKSIDK----------------------
G3AUN6_SPAPN/128-368---------------------------------------------EVKLMKMIEIVKE----------------------
G4TT08_PIRID/115-310---------------------------------------------AAKLRSTLGVFER----------------------
G4VNQ3_SCHMA/214-394---------------------------------------------GDSIKNAISVLQR----------------------
G6D800_DANPL/194-372---------------------------------------------ADKTREALSLLTR----------------------
G7DSD2_MIXOS/124-323---------------------------------------------ADRLRSTVGVLER----------------------
G7IVK4_MEDTR/51-227---------------------------------------------AEKIRTVQGMLQR----------------------
G8BGG9_CANPC/145-407---------------------------------------------EDRLNIMLEFIKS----------------------
G8BMU6_TETPH/145-338---------------------------------------------IANYEKAKTFFEE----------------------
G8JTD1_ERECY/120-302---------------------------------------------LKSYRATIRYVEE----------------------
G8XZB2_PICSO/148-394---------------------------------------------EMKIAGVIDFVKT----------------------
G8ZXE8_TORDC/144-345---------------------------------------------MSSYQATKAFIEE----------------------
H2AR86_KAZAF/151-365---------------------------------------------ISNFKMARDFIEE----------------------
H2KP67_CLOSI/214-393---------------------------------------------AEATRNAIGVMQR----------------------
H2ZFP8_CIOSA/151-287---------------------------------------------ADSIRNTLNVLQR----------------------
H3ERJ1_PRIPA/197-373---------------------------------------------ADATRNALSVLTR----------------------
I0ZAT9_9CHLO/267-451---------------------------------------------CDRIRGVLALLKR----------------------
I1GNJ4_BRADI/14-163---------------------------------------------IEKLHRTRNLLRK----------------------
I1NBC3_SOYBN/28-188---------------------------------------------IEKMYQTCNLLFK----------------------
SEC5_SCHPO/139-329---------------------------------------------VDISYGELLVMRE----------------------
Q019K9_OSTTA/44-232---------------------------------------------RGKLERALETLER----------------------
Q232N2_TETTS/349-532---------------------------------------------SSSLRLTLSFLNK----------------------
Q6CGI4_YARLI/146-334---------------------------------------------EERLQAALEMVTA----------------------
Q6CQH1_KLULA/148-350---------------------------------------------LQKFQWAIQFVNE----------------------
Q6FVL5_CANGA/149-372---------------------------------------------INNFKLTKRFIEE----------------------
Q750U7_ASHGO/122-304---------------------------------------------VKHYKSAIRYVQD----------------------

PF04124

COG8_MOUSE/56-394----------------------------------------....-RRMNTLTLNRHTE----------------------
COG8_SCHPO/15-354----------------------------------------....-YRDAKLMHQVQPQ----------------------
COG8_YEAST/28-381----------------------------------------..DI-NNESVSIDDFLED----------------------
COG8_CAEEL/10-353----------------------------------------....-QDLVRKALDKSNP----------------------
Q9LYH5_ARATH/29-412----------------------------------------....-RKMNQALLANHST----------------------
COG8_DROME/37-379----------------------------------------....-RRLNSITLQKNAQ----------------------
Q9P3N9_NEUCS/31-347----------------------------------------VLLR-RKKALLLSRNVER----------------------

PF08700

COG5_MOUSE/37-120-------------------------------------------D-LLAQATGIESLEG-VL.......------------
EXO84_CRYNJ/142-228-------------------------------------------E-FVAISKEISTLEN-DM.......------------
Q6BJZ0_DEBHA/76-158-------------------------------------------D-LIKIAEDISNMYV-VT.......------------
Q0U0Z3_PHANO/76-170-------------------------------------------K-LLSATSTIRRMRG-NM.......------------
Q0WQ75_ARATH/43-129-------------------------------------------K-FISATDTIKRMKS-NI.......------------
Q5KJF4_CRYNJ/98-180-------------------------------------------D-LLTSATQITSLRS-SS.......------------
Q173I8_AEDAE/5-87-------------------------------------------D-LLKAADTIGDMRT-TA.......------------
A2D783_TRIVA/6-88-------------------------------------------P-VLETPPVLKDIQV-IF.......------------
Q7Q6Z6_ANOGA/11-97-------------------------------------------K-FISATDTIRKMKT-DF.......------------
Q2UQ54_ASPOR/108-197-------------------------------------------K-LIRAVETIGKMRQ-SMD.....D------------
Q7S488_NEUCR/247-341-------------------------------------------K-LISATETIRKMRT-SMFDPNALT------------
VPS51_YEAST/84-163-------------------------------------------D-LIKVNDLLKEITN-AN.......------------
A2E266_TRIVA/29-115-------------------------------------------K-FLLAEETIRSMSD-GL.......------------
Q2U987_ASPOR/1-88-------------------------------------------E-LVGTAETIVSMNR-EM.......------------
Q6FRQ2_CANGA/66-146-------------------------------------------D-LVKVNDKLKELSG-.........------------
Q6CSC3_KLULA/100-179-------------------------------------------D-LIKVDEILKEMTQ-LD.......------------
Q4SXW2_TETNG/10-92-------------------------------------------D-LIDAADTIREMRQ-CS.......------------
EXO84_GIBZE/128-214-------------------------------------------Q-FIKISKEAEKLKS-EM.......------------
Q75HJ9_ORYSJ/40-126-------------------------------------------A-FIRTSKEISDLER-EL.......------------
EXOC8_MOUSE/13-100-------------------------------------------Q-FIETAREISYLES-EM.......------------
Q4P2N5_USTMA/76-162-------------------------------------------E-LVAASDTIRDMKV-KS.......------------
Q4PEG0_USTMA/79-161-------------------------------------------D-LLGTANTIIDMAG-SS.......------------
Q8I2A9_PLAF7/116-202-------------------------------------------K-FINAADALVLLKE-KF.......------------
Q6CG64_YARLI/77-166-------------------------------------------R-LIAVSETLAKMKD-G........------------
Q4E335_TRYCC/3-85-------------------------------------------D-LIAACDKVVGMEQ-TC.......------------
EXO84_YARLI/121-207-------------------------------------------S-FLTVNKEILALNS-EV.......------------
Q4MZL9_THEPA/63-149-------------------------------------------C-LFSALDTVHNINK-EL.......------------
COG1_SCHPO/7-89-------------------------------------------S-FIEASENLSNIRN-NL.......------------
Q59L27_CANAL/17-99-------------------------------------------D-LIKIAEDIGDIYQ-HS.......------------
Q2UHE7_ASPOR/121-207-------------------------------------------Q-FIKISKEAEKLKG-EM.......------------
Q7RZT4_NEUCR/9-91-------------------------------------------E-LLGTADTIVQMRG-DM.......------------
Q8SWU0_DROME/4-91-------------------------------------------E-FIQTAKEISHLES-EM.......------------
E9AC89_LEIMA/3-81-------------------------------------------D-LLGACDGVVGMER-DC.......------------
A2GBI6_TRIVA/24-110-------------------------------------------K-FLHANDAVSEFKE-QI.......------------
Q4Y221_PLACH/14-100-------------------------------------------K-FIYAGDTVVLLKN-SF.......------------
EXO84_ASHGO/127-213-------------------------------------------E-LMQVNKELAVAST-EL.......------------
Q8LCN9_ARATH/18-103-------------------------------------------A-FITAADALLAIRQ-EV.......------------
FFR_DICDI/178-264-------------------------------------------K-FINATDIIKKMKT-NV.......------------
YEWA_SCHPO/52-138-------------------------------------------H-LLEASDAINSFCK-NL.......------------
Q9FFF3_ARATH/21-103-------------------------------------------D-LIDSADSIVHMKS-LC.......------------
Q4P6W6_USTMA/184-270-------------------------------------------E-FITISKEIATLEN-DM.......------------
Q1WMT0_COPDI/48-130-------------------------------------------D-LLQASTSIISMAV-SS.......------------
COG1_DICDI/113-195-------------------------------------------D-LVEGSDAIVKMKK-ST.......------------
A2FRD0_TRIVA/32-118-------------------------------------------K-FLNASDLVITFGD-NI.......------------
A0C9R8_PARTE/6-92-------------------------------------------K-FISSIDTVKKMKT-DI.......------------
Q00XX6_OSTTA/568-650-------------------------------------------D-AIASVEALETIEK-AG.......------------
EXO84_CANGA/190-276-------------------------------------------E-IITVNNDLHEASA-EL.......------------
Q754G8_ASHGO/53-137-------------------------------------------D-LVKVNQLLREMGE-S........------------
FFR_CHICK/57-143-------------------------------------------K-FISATDTIRKMKV-DF.......------------
Q55VT5_CRYNB/54-140-------------------------------------------Q-LFAAGDTISQLNA-RT.......------------
Q95Q35_CAEEL/9-99-------------------------------------------Q-FIDASKEISHLER-EI.......------------
Q6C0N6_YARLI/24-102-------------------------------------------D-LLGTTDDIQSLSE-KM.......------------
Q5DTY3_MOUSE/20-102-------------------------------------------D-LIEAADTIGQMRR-CA.......------------
Q5CPU5_CRYPI/48-125-------------------------------------------K-LKFISNILDK...-.........------------
Q4DYG1_TRYCC/45-131-------------------------------------------K-FISATDTIREMRD-NI.......------------
Q5ZAZ1_ORYSJ/7-89-------------------------------------------D-LLDSADSILLIKQ-SS.......------------

PF06148

Q0TYI9_PHANO/26-159-------------------------------------------D.FLNLGNSLHGGEE-KV-------------------
Q29BE0_DROPS/22-154-------------------------------------------D.FVNLSANLVGLDQ-SI-------------------
Q7QFV1_ANOGA/25-157-------------------------------------------D.FVDLSANLIGLDQ-QI-------------------
Q84LH7_ORYSJ/24-156-------------------------------------------D.FVGLSARLKGVDA-AA-------------------
Q9ASS9_ARATH/31-163-------------------------------------------D.FVNLSTKLVDIDA-AV-------------------
Q01CT5_OSTTA/52-184-------------------------------------------E.FASLGDGLRDYEE-LR-------------------
Q5K8I4_CRYNJ/34-165-------------------------------------------E.FLSLGIGLRGEEE-RL-------------------
Q4P841_USTMA/85-240-------------------------------------------D.FVSLGSSLKSEAH-RI-------------------
A1C4Y0_ASPCL/32-165-------------------------------------------D.FLSLGGALHGGEE-KI-------------------
Q2UA29_ASPOR/27-160-------------------------------------------D.FLSLGIALQGGEE-KV-------------------
COG2_HUMAN/15-147-------------------------------------------D.FVNLSTNLVGMDK-AL-------------------
Q0C728_AEDAE/17-149-------------------------------------------D.FVDLSANLIGLDR-KI-------------------
Q5BZC0_SCHJA/41-174-------------------------------------------D.FVSLSTNLVGLDK-SI-------------------
A8WN13_CAEBR/23-155-------------------------------------------D.FVHLSSNLVSLQE-SL-------------------
Q383M1_TRYB2/46-232-------------------------------------------DAFVKVSGHLVGMQD-DL-------------------
Q4DNE3_TRYCC/72-246-------------------------------------------DAFVKVSGHLVGMQD-EL-------------------
Q4Q0F6_LEIMA/80-262-------------------------------------------TAFVSVSGHLVGMRD-EL-------------------
A0CKT7_PARTE/12-141-------------------------------------------D.YVEISTQLTSLQS-QL-------------------
COG2_DICDI/53-185-------------------------------------------S.FFSLSTSLVGFDT-IL-------------------

PF10392

COG5_HUMAN/66-189-------------------------------------------D-LLAQATGIESLEG.VL-------------------
Q6BT79_DEBHA/15-147-------------------------------------------S-LMSNFSQIEKTRSLVN-------------------
Q5B379_EMENI/829-961-------------------------------------------P-LLTHTGDQTAAAGKIL-------------------
Q5APN5_CANAL/17-149-------------------------------------------S-LISNFQKIAEYQKILT-------------------
COG5_SCHPO/8-139-------------------------------------------T-LTKNVSSSLNAQS.YL-------------------
COG5_YEAST/14-146-------------------------------------------E-IIELIYKNEHVNSTIV-------------------
Q9C9V9_ARATH/57-180-------------------------------------------E-LLAQLSSLSHADV.SL-------------------
Q0U7T7_PHANO/13-145-------------------------------------------P-LLEHTRDHAESSGRIL-------------------
Q2HI55_CHAGB/25-157-------------------------------------------P-LLTHTSTHAHASAHIL-------------------
Q5KKM0_CRYNJ/10-154-------------------------------------------L-LLNHLTTSLSLSS.HL-------------------
Q6CLE2_KLULA/11-144-------------------------------------------H-VLEQIEKRKKEKSFVG-------------------
COG5_DICDI/63-186-------------------------------------------D-LFKLANNIKELDQ.LT-------------------
Q6C2T6_YARLI/5-136-------------------------------------------E-LLSRVADVSTKED.TL-------------------
Q75B18_ASHGO/11-144-------------------------------------------K-LLEQLDKRKLGREKVG-------------------
Q6FTM6_CANGA/9-140-------------------------------------------G-LMDEFDRERKLNGSIS-------------------
Q65XH1_ORYSJ/52-175-------------------------------------------L-LLSHLLSLRSASA.SL-------------------

PF04100

VPS53_CAEEL/29-391-------------------------------------------V-SERGEEALKHAQD-AMIEL----------------
VPS53_HUMAN/39-453-------------------------------------------V-GQDGRQALEEAQK-AIQQL----------------
Q9VQY8_DROME/42-434-------------------------------------------T-GQDGQLALCEAQK-VISSL----------------
Q9C6Q3_ARATH/1-444-------------------------------------------S-GTKAKEDLADATR-AVEEL----------------
YDLF_SCHPO/16-394-------------------------------------------M-GEK....MDDLNS-SIVSL----------------
VPS53_YEAST/5-369-------------------------------------------.-.........EIEA-SLRKV----------------
Q9C6I3_ARATH/1-331-------------------------------------------S-GTRAKENLNDAIC-AAEEL----------------

PF10475

Q7QF78_ANOGA/99-388-------------------------------------------A-CDGEFQRIRDTER-LLRDT----------------
Q336V4_ORYSJ/131-419-------------------------------------------E-MVKGMQLVMELEQ-DLKVA----------------
Q012F3_OSTTA/52-350-------------------------------------------D-FEKGMENITKIYD-TLEAA----------------
Q54MU4_DICDI/72-370-------------------------------------------E-FVQGMSQIHEIGV-ELQRS----------------
Q6JJ34_IPOTF/130-420-------------------------------------------V-MVKGMNLVRELER-DLKVA----------------
CC132_CHICK/54-327-------------------------------------------.-.AAELERVTSLQN-GLQLA----------------
Q16RR9_AEDAE/70-360-------------------------------------------A-CNEEFQRIQETEG-LLRET----------------
A1ZAY8_DROME/75-362-------------------------------------------A-CSSEFAAINDTQK-KLEES----------------
Q54NV0_DICDI/113-401-------------------------------------------G-FVQGMSQVYEIEK-DLTHS----------------
Q8RXC2_ARATH/132-421-------------------------------------------V-MVKGMNLVRELEK-DLKIA----------------
Q18602_CAEEL/76-363-------------------------------------------S-YTAQVGEMEKIRD-EVGSV----------------
A8XSD2_CAEBR/80-367-------------------------------------------S-YTNQVGEMENIRE-KVNGV----------------

PF04048

Q7PY10_ANOGA/23-144-------------------------------------------D-LTRVMQLFGKVST-EVTAS----------------
EXOC4_DROME/25-146-------------------------------------------Q-LTQVLPLFSQVSS-EVTAS----------------
EXOC4_HUMAN/23-144-------------------------------------------E-LTTAIRTYQSITE-RITNS----------------
Q541W5_ARATH/15-151-------------------------------------------G-FNKAIQNYSQILR-LFSES----------------
Q69PQ1_ORYSJ/22-158-------------------------------------------G-FNKAIQNYSQILR-LFSES----------------
Q59NP0_CANAL/27-168-------------------------------------------L-FNKSMGSYNTLLS-TMKNS----------------
A5E514_LODEL/26-167-------------------------------------------L-FSNSIGSYHMLLS-SLNQS----------------
Q6BLA3_DEBHA/30-171-------------------------------------------I-FNNSIGSYHVLLS-TLQDS----------------
A5DKL1_PICGU/29-170-------------------------------------------V-FNNSIGSYHLLLS-NIDNS----------------
A3LUX9_PICST/29-170-------------------------------------------L-FNNSIGSYHLLLS-TLQDS----------------
Q75B87_ASHGO/33-174-------------------------------------------T-FANSIASYGQTVK-YLNDS----------------
Q6CNM5_KLULA/34-175-------------------------------------------A-FNDSIASFSKTVY-CITDA----------------
A7TRV6_VANPO/35-176-------------------------------------------A-FNSNVASYSVAVD-SITVA----------------
A6ZWU4_YEAS7/34-175-------------------------------------------V-FNTNVASYGKAVS-SIMQA----------------
Q6FWA6_CANGA/35-176-------------------------------------------A-FNSNVASYTQAVN-AITKS----------------
Q6C3L8_YARLI/34-175-------------------------------------------G-FNSSVGSYRSIAQ-SIAES----------------
Q4WUD2_ASPFU/134-275-------------------------------------------G-FNSSIGTYHKIQS-NIQSS----------------
Q0CDB2_ASPTN/131-272-------------------------------------------G-FNSSIGTYHKIQS-SIQSS----------------
Q2U7S6_ASPOR/137-278-------------------------------------------G-FNSSIGTYHKIQS-SIQSS----------------
SEC8_NEUCR/82-223-------------------------------------------G-FNSSIGTFHKIQG-SIQSS----------------
SEC8_SCHPO/51-191-------------------------------------------D-FTRGISAYGEIME-GIQKC----------------
Q4PBF9_USTMA/441-580-------------------------------------------S-FASAITTHNSVLQ-SLTVA----------------

PF06248

Q7QA24_ANOGA/4-537-------------------------------------------G-YEKTAHILTKIKT-MLDELDDPVLEE.........
ZW10_DROPS/10-571-------------------------------------------D-YLVVLDLVGRLRS-LIYG....EGEAATQDV..VR
ZW10_ARATH/1-584-------------------------------------------R-FRFAAERIRELKV-VLRIGEEEDGE..........
Q6ING5_XENLA/6-615-------------------------------------------N-YISAARHLQKAHS-CLKVLKSRKGCE.........
A7SSG2_NEMVE/20-670-------------------------------------------A-FCKAAKLLEDVKE-DLEHV.PRAGQE.........
A8XRG3_CAEBR/1-605-------------------------------------------A-ILACKDYLNETNL-LLEGIQCEGFDM.........
Q4SPW6_TETNG/9-605-------------------------------------------D-YVEAANMLERART-SVDSLKVWKLSQ.........
ZW10_DROGR/1-567-------------------------------------------D-CLVVLDLMGRLRS-LIYG....EGTSDDISPDVER
ZW10_HUMAN/9-621-------------------------------------------K-YVTGAQRLEEAQK-CLKLLKSRKCFD.........
Q16R15_AEDAE/1-545-------------------------------------------D-YQKLISILEKIKS-LLN.....DGSDHV.......
Q803G9_DANRE/9-612-------------------------------------------N-YVVAAKQHGTARA-CVDALKTWKDTE.........
Q98TG8_CHICK/1-595-------------------------------------------R-YIEAAQQLEKARS-SLKTLESRKGFE.........

PF06046

Q4WPU5_ASPFU/183-757----------------------------------------...E-TKEAFLGDPEN..-.LDKSFKWY------------
EX3L4_HUMAN/179-709----------------------------------------GAGW-AFGEAEGASGLAQ-LLAELGGLV------------
EX3L1_DANRE/206-763----------------------------------------...S-VSYLHTRGPGLAS-HLSALQHCI------------
A3LNE6_PICST/180-819----------------------------------------...A-CINHFSEDRML..-VYENLD.WL------------
A4RYX1_OSTLU/92-690----------------------------------------.IAE-GFSGLDDKESIEH-VVGALD.ES------------
A5DIA8_PICGU/180-832----------------------------------------...K-CVEHFAHDKIL..-VFDNLN.WL------------
A5DY39_LODEL/293-930----------------------------------------...R-CEEHFSNDRMA..-LYDNLD.WL------------
A6RAW7_AJECN/390-965----------------------------------------...K-SKETFLDDPEK..-.LEKSFKWF------------
A7F9Q6_SCLS1/177-755----------------------------------------...G-TKQAFLEDPTK..-.LEKGLRWF------------
SEC6_SCHPO/159-721----------------------------------------...R-AWVSYLEDGSGEL-NLD....FI------------
Q016Y9_OSTTA/124-721----------------------------------------.IAE-GFSGLDDKQSIEQ-VLEALD.ES------------
TNAP2_HUMAN/122-651----------------------------------------....-.QRPAAGAEVPES-VFLHLGRTM------------
Q0TXU6_PHANO/187-762----------------------------------------...E-AREKFNEDPEK..-.IDKYFKWY------------
EX3L1_BOVIN/188-722----------------------------------------....-GTSLQPGPGELAK-WLEALRVAL------------
Q16I77_AEDAE/179-730----------------------------------------..SK-LEERSDNKLWLVR-DLELTRQFL------------
Q28ZN5_DROPS/179-731----------------------------------------..SK-LEERTDNKMWLVR-DLEILRQNI------------
Q3SE84_PARTE/186-671----------------------------------------....-..QKLKDAKDAVQ-ILEQSK.FS------------
TNAP2_MOUSE/157-688----------------------------------------..AQ-PATAPEGRSEAES-RFLHMGRTM------------
Q4P8D1_USTMA/258-828----------------------------------------...E-CWSRFGAKDSSLE-FLAHLD.WI------------
Q4RJ08_TETNG/178-739----------------------------------------..TQ-SVTREVDKMWLVR-LLEITRKYV------------
EXOC3_DICDI/183-774----------------------------------------....-.PMFLNSHNDLVQ-TLKDVN.KM------------
Q5A7K3_CANAL/180-812----------------------------------------...S-CVEYYGNDKIL..-VYDGLY.WL------------
Q5BBU2_EMENI/183-758----------------------------------------...D-TKEKFLDDPEG..-.LEKSFRWF------------
Q5K9B3_CRYNJ/179-740----------------------------------------....-.EYFLDNQHDFLG-FIEGLG.WV------------
Q5RG40_DANRE/163-694----------------------------------------ADGQ-ENKADKLSTSLKR-EVCRTGKQV------------
Q69YP2_HUMAN/105-661----------------------------------------..TQ-ADTRESDKMWLVR-HLEIIRKYV------------
Q6BJB6_DEBHA/180-833----------------------------------------...K-CVEHFSYDRIL..-VYDNLN.WL------------
Q6C9T6_YARLI/183-804----------------------------------------...A-CIESFPGDCIT..-LLENLA.WI------------
Q6CU40_KLULA/178-794----------------------------------------...E-VRNEYSGDKKF.D-VLNNLD.WV------------
EX3L4_MOUSE/181-708----------------------------------------GAKV-IPGAAEGSSDLAQ-LLAELGGVV------------
Q6DJR6_XENTR/177-732----------------------------------------..SQ-ADTRESDKMWLVR-HLEIIRRYM------------
Q6FPK2_CANGA/177-798----------------------------------------...E-VRKEYDGDKKF.D-VLNNLD.WV------------
E9P8I5_YEASX/178-798----------------------------------------...E-MREKYVGDQKF.D-VLDNMD.WI------------
Q873E6_NEUCS/175-753----------------------------------------...E-SKEKFLGDPDM..-.LDKSLKWY------------
EX3L1_MOUSE/189-722----------------------------------------....-ASPVLPEPGALAG-WLEALQVAL------------
Q8NAC4_HUMAN/132-655----------------------------------------....-GSPLLPAPGALPG-WLEALRVAL------------
Q8SU74_ENCCU/160-687----------------------------------------....-...RLRNEEIFVN-RMD....FV------------
Q9M9G4_ARATH/172-724----------------------------------------....-.RLLTLVFEDLKA-ALEEAR.MI------------

PF04091

Q4WDM8_ASPFU/443-722---------------------------------------------VLHRHPQ.....-----------------------
EXOC6_ARATH/442-755---------------------------------------------YLSYGVN...TN-----------------------
Q753S5_ASHGO/493-835---------------------------------------------FLNTFFQHDLSY-----------------------
Q6BHQ3_DEBHA/493-827---------------------------------------------FISQHYSYNINE-----------------------
A5DMM0_PICGU/481-812---------------------------------------------FIGRYYSHEQNE-----------------------
A8XM86_CAEBR/483-791---------------------------------------------FMDNLQL.NTSA-----------------------
Q6CYE5_KLULA/488-829---------------------------------------------FISIFYKHDISH-----------------------
Q8S5T3_ORYSJ/441-754---------------------------------------------YFSYSAR...TN-----------------------
EXOC6_DROME/427-731---------------------------------------------FAEELTL.SPNE-----------------------
Q17EP0_AEDAE/418-723---------------------------------------------FSEELTL.SPNE-----------------------
EXOC6_RAT/455-763---------------------------------------------FSESLHR.SSTE-----------------------
A7TQS9_VANPO/505-846---------------------------------------------FISNHFRHELHR-----------------------
Q6C1W0_YARLI/479-794---------------------------------------------FLDEFNVSEVTQ-----------------------
Q560L3_CRYNB/479-787---------------------------------------------FTDGVAQ.QHLD-----------------------
A6RZT9_BOTFB/417-719---------------------------------------------IMDDHFQ.QPNI-----------------------
A3LS60_PICST/479-812---------------------------------------------FIGQHYSYELNE-----------------------
SEC15_SCHPO/435-740---------------------------------------------FLNDSVI.LATE-----------------------
Q7RYL2_NEUCR/450-733---------------------------------------------FSNDHFQ.HPNI-----------------------
Q0CL01_ASPTN/446-728---------------------------------------------FATDDFP.YPSV-----------------------
A7E4G0_SCLS1/408-698---------------------------------------------IMDDHFQ.QPSI-----------------------
O81298_ARATH/430-736---------------------------------------------FMSHGGQ...LD-----------------------
Q0UFZ1_PHANO/442-734---------------------------------------------FSDDYFQ.KSSI-----------------------
A6R9C0_AJECN/443-746---------------------------------------------FSNDDFQ.HPSM-----------------------
Q4P319_USTMA/445-765---------------------------------------------FSDGF.Q.NHRE-----------------------
Q7XEN0_ORYSJ/441-754---------------------------------------------YLSYDPM...MD-----------------------
A5BA73_VITVI/441-754---------------------------------------------YLSYGGH...MN-----------------------
SEC15_YEAST/520-865---------------------------------------------FLSIFYRHELHT-----------------------
Q4SZ84_TETNG/313-614---------------------------------------------YSEDLHL.SSTE-----------------------
Q6FRK2_CANGA/500-842---------------------------------------------FISSFYRHSLHS-----------------------
A5E457_LODEL/495-827---------------------------------------------FLNEYYSYEVSE-----------------------
EXOC6_DICDI/691-995---------------------------------------------FSDQLTE.....-----------------------

PF09763

Q75AA6_ASHGO/631-1297----VDRF-----------------F......HMSS............................................
A5DBH0_PICGU/582-1282----LASM-----------------F......HYDNN...........................................
A3GH85_PICST/625-1329----VGTF-----------------F......HYDRD...........................................
Q6FRC5_CANGA/652-1329----IDLY-----------------F......HISS............................................
A6QQU0_BOVIN/176-464----..KF-----------------G......KL..............................................
Q2UK85_ASPOR/702-1427----LVQF-----------------F......HLSSL...........................................
A7TSV5_VANPO/776-1455----IDSF-----------------F......HISS............................................
Q6CQX3_KLULA/540-1218----VSSF-----------------F......HLSS............................................
Q57ZX4_TRYB2/198-1064----LRRC-----------------F......GLVEGREECSKGEENHHDFTPSASDALS.......NVPESDKAGLLRE
EXOC1_DROME/186-866----CINF-----------------F......QMDVISPTTK......................................
A7E4X8_SCLS1/708-1443----IVEF-----------------F......HITSL...........................................
Q4RKW7_TETNG/106-846----VSCF-----------------G......RY...S..........................................
Q6C0U5_YARLI/751-1484----LIQL-----------------F......HMTSF...........................................
Q2GRZ6_CHAGB/575-1334----IVDF-----------------F......HATTL...........................................
Q5K9I2_CRYNJ/475-1177----INAF-----------------L......RPVDT...........................................
Q7T2A6_DANRE/169-869----ISKF-----------------F......KLQQIPTL........................................
A7RVQ5_NEMVE/151-846----IQKF-----------------F......DLSA............................................
Q5TMX8_ANOGA/189-872----CIAF-----------------F......QLDVISPTAK......................................
Q10GJ4_ORYSJ/212-854----FAHF-----------------M......CFEVPALVPAGAP...................................
Q4PFK6_USTMA/462-1173----ISDF-----------------L......HINDN...........................................
A6ZQV5_YEAS7/640-1316----VEVF-----------------F......HISS............................................
Q7S5W6_NEUCR/694-1488----VIDF-----------------F......HASTL...........................................
A5E4P0_LODEL/994-1796----IIEF-----------------F......HYDVT...........................................
EXOC1_DICDI/95-855----VMDF-----------------FLYQDPPRLAGQRNHHSNSSGGGSGSNKDGKDRKDKKSSKKDKKDKKDKKDKKDK

PF04129

VPS52_YEAST/47-607----IDKY-----------------F------QIKKR-------------------------------------------
VPS52_SCHPO/1-508----GNQM-----------------L------SVNLR-------------------------------------------
Q9VMQ8_DROME/42-546----KSTI-----------------F------TIGKR-------------------------------------------
Q9FVV3_ARATH/83-615----RSAV-----------------F------ALGDR-------------------------------------------
VPS52_RAT/94-601----RNTI-----------------F------TLGTR-------------------------------------------

PF15278

B6K1Q5_SCHJY/526-611--------------------------------------------------------------------------------
YD6C_SCHPO/520-605--------------------------------------------------------------------------------

PF06419

COG6_CRYNJ/69-690----LEGM-----------------F------------------------------------------------------
COG6_EMENI/58-693----LETL-----------------F------------------------------------------------------
COG6_ASPFU/55-708----LEAL-----------------F------------------------------------------------------
COG6_PICGU/131-737----ISGI-----------------F------------------------------------------------------
COG6_DEBHA/132-759----ISSI-----------------F------------------------------------------------------
COG6_HUMAN/55-656----LEAL-----------------L------------------------------------------------------
COG6_CANGA/175-819----VKSL-----------------F------------------------------------------------------
Q6C1G5_YARLI/25-595----TSIL-----------------I------------------------------------------------------
COG6_ASPNC/57-685----LEAL-----------------F------------------------------------------------------
COG6_YEAST/181-824----VKSL-----------------F------------------------------------------------------
COG6_PHANO/54-693----LENL-----------------F------------------------------------------------------
COG6_ASPOR/121-774----LEAL-----------------F------------------------------------------------------
COG6_CHAGB/46-689----LEGL-----------------F------------------------------------------------------
COG6_COCIM/32-673----LEAL-----------------F------------------------------------------------------
COG6_SCHPO/43-650----VEAL-----------------F------------------------------------------------------
Q17KR7_AEDAE/31-620----LLML-----------------V------------------------------------------------------
COG6_ASHGO/158-791----LKSL-----------------F------------------------------------------------------
COG6_PICST/153-782----IISI-----------------F------------------------------------------------------
Q7QJN1_ANOGA/31-623----LQML-----------------V------------------------------------------