Sequence alignment for CL0295

PF08700

Q5KJF4_CRYNJ/98-180-----------------------------------------------------------EDW------------------
EXO84_ASHGO/127-213-----------------------------------------------------------LSN------------------
COG5_MOUSE/37-120-----------------------------------------------------------FLN------------------
EXO84_CRYNJ/142-228-----------------------------------------------------------LSN------------------
Q6BJZ0_DEBHA/76-158-----------------------------------------------------------IIN------------------
Q0U0Z3_PHANO/76-170-----------------------------------------------------------LDA------------------
Q0WQ75_ARATH/43-129-----------------------------------------------------------INS------------------
Q173I8_AEDAE/5-87-----------------------------------------------------------GNL------------------
A2D783_TRIVA/6-88-----------------------------------------------------------NVN------------------
Q7Q6Z6_ANOGA/11-97-----------------------------------------------------------MDG------------------
Q2UQ54_ASPOR/108-197-----------------------------------------------------------LDS------------------
VPS51_YEAST/84-163-----------------------------------------------------------LKE------------------
A2E266_TRIVA/29-115-----------------------------------------------------------IDG------------------
Q2U987_ASPOR/1-88-----------------------------------------------------------MAL------------------
Q6FRQ2_CANGA/66-146-----------------------------------------------------------DSD------------------
Q6CSC3_KLULA/100-179-----------------------------------------------------------IRL------------------
EXO84_GIBZE/128-214-----------------------------------------------------------LRD------------------
EXOC8_MOUSE/13-100-----------------------------------------------------------LES------------------
A0A0D1E7D8_USTMA/79-161-----------------------------------------------------------FDP------------------
Q8I2A9_PLAF7/116-202-----------------------------------------------------------MNC------------------
Q6CG64_YARLI/77-166-----------------------------------------------------------FEA------------------
Q4E335_TRYCC/3-85-----------------------------------------------------------SEE------------------
EXO84_YARLI/121-207-----------------------------------------------------------LLK------------------
Q4MZL9_THEPA/63-149-----------------------------------------------------------FLS------------------
COG1_SCHPO/7-89-----------------------------------------------------------MSS------------------
Q59L27_CANAL/17-99-----------------------------------------------------------DTN------------------
Q2UHE7_ASPOR/121-207-----------------------------------------------------------LRD------------------
Q7RZT4_NEUCR/9-91-----------------------------------------------------------LST------------------
E9AC89_LEIMA/3-81-----------------------------------------------------------MEE------------------
A2GBI6_TRIVA/24-110-----------------------------------------------------------IDS------------------
Q4Y221_PLACH/14-100-----------------------------------------------------------KKS------------------
VPS51_DICDI/178-264-----------------------------------------------------------IDG------------------
VPS51_SCHPO/52-138-----------------------------------------------------------FSD------------------
Q9FFF3_ARATH/21-103-----------------------------------------------------------NGG------------------
A0A0D1CLQ0_USTMA/184-270-----------------------------------------------------------LSQ------------------
COG1_DICDI/113-195-----------------------------------------------------------TKQ------------------
A2FRD0_TRIVA/32-118-----------------------------------------------------------INS------------------
A0C9R8_PARTE/6-92-----------------------------------------------------------IDS------------------
EXO84_CANGA/190-276-----------------------------------------------------------LSD------------------
Q754G8_ASHGO/53-137-----------------------------------------------------------AEG------------------
VPS51_CHICK/57-143-----------------------------------------------------------ING------------------
Q95Q35_CAEEL/9-99-----------------------------------------------------------FQT------------------
Q6C0N6_YARLI/24-102-----------------------------------------------------------MAL------------------
Q4DYG1_TRYCC/45-131-----------------------------------------------------------LDS------------------
B4QW21_DROSI/4-89-----------------------------------------------------------FDD------------------
Q5KKF4_CRYNJ/54-139-----------------------------------------------------------IDS------------------
Q7S488_NEUCR/124-217-----------------------------------------------------------LDS------------------
Q84K25_ARATH/20-102-----------------------------------------------------------..L------------------

PF06148

Q0TYI9_PHANO/26-159----------------------------------------------------APLQRNDFLA..................
Q29BE0_DROPS/22-154----------------------------------------------------LCFDKNEFMK..................
Q7QFV1_ANOGA/25-157----------------------------------------------------LCFDKNEFMK..................
Q84LH7_ORYSJ/24-156----------------------------------------------------PWFKPDSFLR..................
Q01CT5_OSTTA/52-184----------------------------------------------------TWFDPRAFEG..................
Q5K8I4_CRYNJ/34-165----------------------------------------------------LSHDHPLLTA..................
A1C4Y0_ASPCL/32-165----------------------------------------------------EPLSRSSFLA..................
Q2UA29_ASPOR/27-160----------------------------------------------------EPLSRSSFLA..................
COG2_HUMAN/15-147----------------------------------------------------LCFDKDEFMK..................
Q0C728_AEDAE/17-149----------------------------------------------------LCFDKNEFMK..................
A8WN13_CAEBR/23-155----------------------------------------------------LCFNKTHFNR..................
Q383M1_TRYB2/46-232----------------------------------------------------LCFGEHEFGVVLDSDNTTEHDTEGECIS
Q4DNE3_TRYCC/72-246----------------------------------------------------LCFGEHEFGVALDKDVTDERDEKHDGVG
Q4Q0F6_LEIMA/80-262----------------------------------------------------LCFAEHEFGIIVDENNPTDSRSISSSSD
A0CKT7_PARTE/12-141----------------------------------------------------SEFDVREFIL..................
COG2_DICDI/53-185----------------------------------------------------LCFSKDVFTS..................
F4JRR1_ARATH/31-163----------------------------------------------------LWFKPSLFLS..................

PF10392

Q5KKM0_CRYNJ/10-154---------------------------------------------------------KPFLS------------------
COG5_HUMAN/66-189---------------------------------------------------------SDFLN------------------
Q6BT79_DEBHA/15-147---------------------------------------------------------EAFLE------------------
Q5B379_EMENI/829-961---------------------------------------------------------EAFLD------------------
Q5APN5_CANAL/17-149---------------------------------------------------------EAFLE------------------
COG5_SCHPO/8-139---------------------------------------------------------SDYKK------------------
COG5_YEAST/14-146---------------------------------------------------------ESLLE------------------
Q9C9V9_ARATH/57-180---------------------------------------------------------SPFLS------------------
Q0U7T7_PHANO/13-145---------------------------------------------------------EAFLD------------------
Q2HI55_CHAGB/25-157---------------------------------------------------------EAFLD------------------
Q6CLE2_KLULA/11-144---------------------------------------------------------EDFLE------------------
COG5_DICDI/63-186---------------------------------------------------------NQFLG------------------
Q6C2T6_YARLI/5-136---------------------------------------------------------DQFLD------------------
Q75B18_ASHGO/11-144---------------------------------------------------------EVLLE------------------
Q6FTM6_CANGA/9-140---------------------------------------------------------EELID------------------
Q65XH1_ORYSJ/52-175---------------------------------------------------------SAFLS------------------

PF04124

COG8_MOUSE/56-394-----------------------LRELSG---------------SGLDRLRR...EPERLAE------------------
COG8_SCHPO/15-354-----------------------VRDLTM---------------KPYAELEK...RKAELHA------------------
COG8_YEAST/28-381-----------------------ILQSNT---------------KDYESYFSSRAVPGSITE------------------
COG8_CAEEL/10-353-----------------------GDDIRN---------------MGLEEMRR...QKVLLAS------------------
Q9LYH5_ARATH/29-412-----------------------VSELLS---------------FTLDRLHK...EPELLRV------------------
COG8_DROME/37-379-----------------------LAKLGT---------------CKVEQLKK...EQTRLAE------------------
Q9P3N9_NEUCS/31-347-----------------------LTSLSS---------------QPLTALET..TEPQALAQ------------------

PF15469

Q5KNA8_CRYNJ/115-308-----------------------------------------------------SEAVRILVE------------------
A7TRG2_VANPO/143-342-----------------------------------------------------SDELKILVQ------------------
G8BMU6_TETPH/145-338-----------------------------------------------------SKELRMLIQ------------------
C5DYM3_ZYGRC/146-354-----------------------------------------------------SDELKDLVQ------------------
G8ZXE8_TORDC/144-345-----------------------------------------------------SEELKELVQ------------------
H2AR86_KAZAF/151-365-----------------------------------------------------EDNLKHLVQ------------------
G0VBU0_NAUCC/150-340-----------------------------------------------------SGDMKNLVE------------------
G0WGP4_NAUDC/153-350-----------------------------------------------------SNDLKSLVQ------------------
Q6FVL5_CANGA/149-372-----------------------------------------------------AGDLQHLVQ------------------
E7QCY0_YEASZ/146-360-----------------------------------------------------..HLKQLVG------------------
C5DMT2_LACTC/144-330-----------------------------------------------------SEDLKQLVQ------------------
G8JTD1_ERECY/120-302-----------------------------------------------------SNHLKELVQ------------------
Q750U7_ASHGO/122-304-----------------------------------------------------GNDLKNLVQ------------------
Q6CQH1_KLULA/148-350-----------------------------------------------------SYELKQLVQ------------------
C4R5S5_KOMPG/139-344-----------------------------------------------------NKDLQLQIE------------------
Q6CGI4_YARLI/146-334-----------------------------------------------------SSALQTLVD------------------
W1QF47_OGAPD/153-339-----------------------------------------------------..RLQRLIG------------------
C4YAI9_CLAL4/138-372-----------------------------------------------------TSQLKSVLD------------------
G8Y2A4_PICSO/149-393-----------------------------------------------------.AQLKSVVN------------------
C5MH42_CANTT/104-348-----------------------------------------------------SENLRMAIE------------------
G3AUN6_SPAPN/128-368-----------------------------------------------------TSELKRAID------------------
G8BGG9_CANPC/145-407-----------------------------------------------------TRDLQSSLD------------------
B6K5G3_SCHJY/147-340-----------------------------------------------------SEMLVSLIN------------------
C4M2W7_ENTHI/111-299-----------------------------------------------------NKEIMHLVE------------------
D6W674_TRICA/193-371-----------------------------------------------------KEGQLSFLK------------------
B0W3D0_CULQU/193-383-----------------------------------------------------KEGQLSFLK------------------
B3MVG4_DROAN/193-383-----------------------------------------------------KEGQLSFLK------------------
G6D800_DANPL/194-372-----------------------------------------------------KEGQLSFLK------------------
E2AW35_CAMFO/194-372-----------------------------------------------------KEGQLSFLK------------------
E0VQL4_PEDHC/200-377-----------------------------------------------------KEGQLSFLK------------------
E9G6B5_DAPPU/193-371-----------------------------------------------------KEGQISFLK------------------
B7PR09_IXOSC/148-326-----------------------------------------------------QEGPSSFLK------------------
A8WPA7_CAEBR/200-378-----------------------------------------------------AKRSEEMHK------------------
H3ERJ1_PRIPA/197-373-----------------------------------------------------EKKSEEMHR------------------
A0A0I9R3C5_BRUMA/212-385-----------------------------------------------------....SDLHR------------------
C3XUC7_BRAFL/191-370-----------------------------------------------------SEGPLAFMK------------------
F6YQX0_XENTR/198-380-----------------------------------------------------NEGNVAYVK------------------
F7GSZ8_CALJA/50-227-----------------------------------------------------..GSLAYVK------------------
E4XNP2_OIKDI/201-392-----------------------------------------------------QSASMSHIK------------------
F6Q8U3_CIOIN/201-380-----------------------------------------------------NNAPLNHVK------------------
G4VNQ3_SCHMA/214-394-----------------------------------------------------PGEPVNVIR------------------
H2KP67_CLOSI/214-393-----------------------------------------------------LDEPVNVIR------------------
F2UAY3_SALR5/207-386-----------------------------------------------------DRNLKQLIN------------------
A9RNH0_PHYPA/252-430-----------------------------------------------------KENLMKLVK------------------
A9S1F4_PHYPA/259-437-----------------------------------------------------KEQLKKLVK------------------
D8RD25_SELML/239-417-----------------------------------------------------KQQLKLLVK------------------
D7KJZ0_ARALL/260-438-----------------------------------------------------NLQRKQLVK------------------
F0ZXN2_DICPU/132-311-----------------------------------------------------ALEIKFLVK------------------
F4PGL2_DICFS/126-305-----------------------------------------------------DLEIKYLVK------------------
A8PCF2_COPC7/122-323-----------------------------------------------------SEALRVLVE------------------
D8QDB4_SCHCM/114-323-----------------------------------------------------SEAVRILVE------------------
B8P2C9_POSPM/114-312-----------------------------------------------------SEAVRVLVE------------------
G4TT08_SERID/115-310-----------------------------------------------------SEAVRILVE------------------
A8PUN7_MALGO/110-314-----------------------------------------------------SEALKVLVD------------------
E6ZLD0_SPORE/109-315-----------------------------------------------------SEALKVLVE------------------
E3K655_PUCGT/121-321-----------------------------------------------------SEALKILVE------------------
F4RSS6_MELLP/56-255-----------------------------------------------------SEALKILVE------------------
F4PCT9_BATDJ/225-428-----------------------------------------------------NEIIKGLVK------------------
D5GNN2_TUBMM/147-347-----------------------------------------------------SGSLKLLVE------------------
G1XK06_ARTOA/190-398-----------------------------------------------------SSALKLLVS------------------

PF16528

C5DUD9_ZYGRC/539-743----------------------------------------------RVLDDLLEEIEIDLER------------------
G0VJV4_NAUCC/543-749----------------------------------------------KKLDDSIEEVDIELTR------------------
A7TL52_VANPO/508-712----------------------------------------------KHIDNTIEEVDIESSR------------------
G8ZS82_TORDC/494-698----------------------------------------------KFLDDGVEEIDIELGR------------------
G8BNG7_TETPH/532-736----------------------------------------------KFLENMIEEFDIELAR------------------
G0W548_NAUDC/557-766----------------------------------------------KRLDDCIEEVDIKLTR------------------
EXO84_CANGA/545-749----------------------------------------------KLVDNLIEEVDIDLAR------------------
H2AXV4_KAZAF/523-731----------------------------------------------KDLNDSIEEVDIQIAR------------------
G8JS46_ERECY/478-682----------------------------------------------KLADEELEELNVPVTR------------------
EXO84_KLULA/500-705----------------------------------------------KRLDDALEDLDLEIGR------------------
G0S6E5_CHATD/457-657----------------------------------------------RWVESQMDELDINIAL------------------
E3S512_PYRTT/452-652----------------------------------------------RWVESQLDDLDIEIAL------------------
EXO84_YARLI/444-642----------------------------------------------REIDDLVNDLDVKIAH------------------
D5GAW7_TUBMM/436-637----------------------------------------------RWVEAQMDELDEKIAH------------------
C4R6S9_KOMPG/506-717----------------------------------------------TGLEDTLDEVDIHLVH------------------
Q2H152_CHAGB/456-656----------------------------------------------RWVESQMDELDIHIAL------------------
C9S7T2_VERA1/440-640----------------------------------------------RWVEGQMDELDIEIAL------------------
B2B2W1_PODAN/463-663----------------------------------------------RWVESEMDELDINIAL------------------
H2Z9L4_CIOSA/281-487----------------------------------------------EWLLEMPEDLDVFIAQ------------------
H2MTA2_ORYLA/303-507----------------------------------------------EWIQELPEDLDVCIAQ------------------
G3JE74_CORMM/450-655----------------------------------------------RWVESQMDELDINIAM------------------
G0SXF2_RHOT2/870-1071----------------------------------------------SWIGDFSDELAVDVST------------------
EXO84_CRYNJ/449-651----------------------------------------------RWIDEYGDELTMAIAI------------------
C5FKA5_ARTOC/433-633----------------------------------------------RWVEGQLDELDIDIAI------------------
F4P2Q9_BATDJ/415-626----------------------------------------------RWLLELPDELDVLVAH------------------
G0R9T9_HYPJQ/449-649----------------------------------------------RWVEGQMDELDIDIAL------------------
C7Z4G1_NECH7/445-645----------------------------------------------RWVESEMDDLDIDVAM------------------
I1G637_AMPQE/287-497----------------------------------------------QWVKDAPENLDVCIAQ------------------
E7LRJ5_YEASV/465-668----------------------------------------------.FLDEGVEEIDIELAR------------------
EXO84_ASPFU/445-645----------------------------------------------RWVDGQVDELDIDIAL------------------
W4YYJ2_STRPU/291-496----------------------------------------------DWILELPEDLDMSIAQ------------------

PF06248

ZW10_DROPS/10-571LPE..................MFQSNGCA---------------SLEDTKSTVSKVQTRTERFQERV-------------
ZW10_ARATH/1-584MPEIDALFESINVRDLLAGHDLNDPTTPL---------------SAPDLRLLINRLESHSLRIKSKV-------------
A7SSG2_NEMVE/20-670L......................QKTGQL---------------EQEDFNKCATKMLKKAEEVKAEV-------------
A8XRG3_CAEBR/1-605M............................---------------..PSSEGSYRDLEKKLKDGLTSI-------------
ZW10_HUMAN/9-621L......................AHSGRL---------------EKEDLGTRISRLTRRVEEIKGEV-------------
F1QYH5_DANRE/9-611L......................ASSGKL---------------EKDDLACKISKLSRKVEETKEEV-------------
F7EQH5_XENTR/9-617L......................ANSGRL---------------EKEDLGTKISRLSRRVEELKGEV-------------
H3CQC8_TETNG/9-607L......................ASSGKL---------------EKEDLSGKISKMSRKVEETKEEL-------------

PF11988

C5DYW5_ZYGRC/14-364..SKAEILESLGKD....PLLVNEKESKS...........DNKDDTPVDFEGILKRESSLNQEL----------------
A7TF57_VANPO/11-362VADKERLLQLLRND....PLLSLNDDVEI...............TEKIDLEGLLKLDASLTEEL----------------
Q6CUS2_KLULA/12-352LSDTSALSQAIEAD....PQFKSSDSVHP..............KPNSKLLEEVLREDSDLTKDL----------------
G0WD68_NAUDC/10-396LSNKDELISSIKDD....LLLLQNKNNITTTGNDAEDDLNVSKMDKTPDVNTILTKETQLATEL----------------
I2GW53_TETBL/23-390.NNRDILVASIKND....IESTIEDSPTQ.......PPTIETHIKAHIDPFVIQQEDTQLSNDL----------------
C5DK93_LACTC/23-365LNDQDAILAGIESD....PNLKMEGSARR...............EEPSDVQAILNQDVQLSKKL----------------
E7KT96_YEASL/5-360FPNKGEIIRELLKD....PLILKNDSKRS............NGSELELDSSDLLQREAILANEL----------------
G8ZQK5_TORDC/17-366LADRNGILHQLEDD....PVLINDELREP................SKIDTDAILKREMGLSREL----------------
Q752C3_ASHGO/45-390LGNPMQVLAAIEDD....PSLWLDSSEKK...............PNHLALQELKQRDVEVTKTL----------------
J8Q396_SACAR/5-358SHNKDEIIRELRKD....PLVIKSDNQKI............NSGELKLDSSELLRQEATLANEL----------------
G8BQ21_TETPH/12-363..NEQSIKESLLQD....PLLFRNKSGDS..........VDSNSNELLSFESVMNKDTALVAEL----------------
H2AUI4_KAZAF/5-354LPDRETLISLVEQN.....LILKNKNTID...............DPSLEMNKILEEESKLSEEL----------------
Q6FNZ0_CANGA/3-351YADKDHVITELLKD....PVYLSRHNSLA...............THPKDENDLYALETKLEEEL----------------
G0V593_NAUCC/12-369LGNRDALIQSIEQNLETPPLTATHDGNSS...............TQELNRGQLMMKEEQLSSQL----------------
J7S867_KAZNA/7-376.PEREEVLLSVERD....PIFQGENGADV.........AASNYTQLTERIREVVAQEAQLGSML----------------

PF06419

F4PTE8_DICFS/25-669--------------------SLNELTTFYSNNSINA...RRNLRNDI-------ERRALDIN------------------
D7TU00_VITVI/30-688--------------------SLNTLSTFYTENTQHA...RRNLRSTI-------EKRCLSIN------------------
K4CMR1_SOLLC/27-689--------------------SLNTLSEFYTENTPHS...RRNLRSTI-------EKRSLSIN------------------
T1IZR2_STRMM/42-648--------------------ALKTLATYFTENNPRT...RRDLRSQI-------ERRSLVIN------------------
E6ZVT0_SPORE/99-753--------------------........GLVDTARA...RRDLDKDI-------RQRMLSAT------------------
E3QI24_COLGM/61-707--------------------ALQLLDSRGLKNTAET...RRQLRLDL-------QKEVIDSN------------------
G8ZRY6_TORDC/181-815--------------------YVGNLA.............RKSMRSDL-------ESELLKDH------------------
D0NH36_PHYIT/44-655--------------------.LVQLDASETPTLATL...RRNLRSSL-------EHQQLALA------------------
G2XGZ3_VERDV/42-689--------------------ALALLDEKQINNQPRV...RRQVRLDL-------QKEMIECN------------------
C5M6P2_CANTT/146-753--------------------ITGSIS.............RKKFKGRI-------EHEIIKNQ------------------
S3D9N6_GLAL2/53-695--------------------ALDLLDQRNVVNNAET...RRQIRLDV-------QKDVIESN------------------
K1QJ12_CRAGI/42-639--------------------SLKALSTFFNENSLRT...RRNLRSDI-------ERRSLSIN------------------
E9EWT4_METRA/42-671--------------------ALALIDQQEFANDAKN...RRQIRINL-------HKDVIDSN------------------
C1GBA8_PARBD/57-738--------------------ALEILDDRGVKNTPEM...RRQLRLEV-------QKEVIDSN------------------
G0VHH4_NAUCC/184-845--------------------YVGTLA.............RKSLRNDL-------ESQLLKEH------------------
T1K467_TETUR/31-648--------------------AVKILSSCFTDNTITI...RRNLSNTL-------EKRSLVII------------------
B9S1S6_RICCO/31-692--------------------SLDALSTFYSDNTPQA...RRNLRSTI-------EKRSLHIN------------------
G3J3T2_CORMM/115-739--------------------.LALIDQRGIRNDGKT...RRRLRLEL-------QKDVIEKN------------------
G3B3F3_CANTC/135-733--------------------VMGSLS.............RKKLRSKI-------EVNLIKNQ------------------
COG6_PICGU/138-737--------------------ALGSMS.............RRKLRGEI-------ERTLIRNQ------------------
U1G9I0_ENDPU/55-707--------------------SLSILDARGVVNDASA...RRRLRLDA-------QKEVIECN------------------
B7Q1K3_IXOSC/40-604--------------------ALKSLSEFFTENNIRT...RRNLRGDL-------EKRSLAIN------------------
F1A3Z4_DICPU/25-688--------------------ALEELSTFYTANSISA...RRNLRSEI-------EKRYLDIN------------------
A5DUD8_LODEL/174-816--------------------FVGAMT.............RKKLRSQV-------EFSLTKTQ------------------
C5FL60_ARTOC/56-718--------------------ALETLDSRGIQNTAET...RRTLRLDV-------QKEVIDSN------------------
X1WYM6_ACYPI/29-624--------------------ALKEISEFYTENTLEC...RRGLRTKI-------EKRSLALN------------------
COG6_CHAGB/47-689--------------------ALALLDERGVQNTAET...RRQLRLDL-------QKEVIDSN------------------
T1EFP4_HELRO/53-656--------------------ALKSLSIFFTENNIRT...RRNLRGDI-------EKRTLNIN------------------
G4V7Z1_SCHMA/35-648--------------------........MANNSISN...RRTLRSNL-------EKIQLNYY------------------
C1MX75_MICPC/28-699--------------------.LRGLSEFYTENTPEA...RRGLRLSI-------ERRGLDVN------------------
COG6_ASPCL/56-753--------------------ALETLSLRGIHNTAET...RRQLRLDV-------QKEVVDSN------------------
R9NZP8_PSEHS/106-778--------------------........QLVDTARA...RRDLDKDI-------RQRMLSAT------------------
M7T0Y3_EUTLA/61-714--------------------ALALLDERGVSNNAET...RRRLRLDV-------QKEVIDSN------------------
B3N2A1_DROAN/35-627--------------------ALSGLSTFFTENTIQN...RRNLRSQI-------EHRSVGIN------------------
G3AM15_SPAPN/147-779--------------------LIGSMN.............RKKLRGKV-------ESELIRNS------------------
COG6_DEBHA/142-759--------------------ITGSNS.............RKKLRGEI-------ENDLIKTQ------------------
COG6_DICDI/25-671--------------------ALEELSTFYTSNSIGA...RRNLRNEI-------EKRYLDIN------------------
D6WE56_TRICA/33-626--------------------ALKQLSTFYTENTLQA...RRNLRSQI-------EKRSLDIN------------------
K1Y0X5_MARBU/53-696--------------------ALALLDKRNVENNAET...RRQLRLDV-------QKEVIESN------------------
R0IIQ7_SETT2/55-693--------------------ALETLDARQVQNSAET...RRQLRLDV-------QKEVIQCN------------------
G2YFW1_BOTF4/53-688--------------------ALSLLDKRGTQNTAET...RRQLRLDV-------QKEVIESN------------------
B3RLZ3_TRIAD/43-642--------------------ALNALSGFFVRNDLRS...RRNLRSDI-------EKRSLAIN------------------
M2NAU2_BAUCO/56-695--------------------ALSILDERELQNTAET...RRNLRLDV-------QQELVQCN------------------
COG6_MAGO7/54-703--------------------ALSLLDSRGIQNTAEA...RRRLRLDL-------HREVIDSN------------------
N1PID3_DOTSN/58-692--------------------ALDILDERGLQNTADT...RRNLRLDV-------QEELIHCN------------------
M7NMJ9_PNEMU/26-631--------------------...IISQTELKNDEIS...KKKFKIDN-------VSNIISIN------------------
G0WDG5_NAUDC/220-947--------------------YIGILA.............RKTLRSDL-------ENELLKEH------------------
U4LN57_PYROM/30-663--------------------ALAVLDTRFVENTAES...RRQLRVDV-------QANVIRSN------------------
F4NVM0_BATDJ/55-674--------------------ALSALSDIYPQNTPSA...RRNLKSHV-------EKQVSGVS------------------
Q6NMI3_ARATH/31-678--------------------SLNALSSFYDENSAHA...RRNLRSTI-------EKRALQIN------------------
A9SY28_PHYPA/31-697--------------------.LGALSSLYTDNTQQA...RRSLRATI-------ERRGLSIN------------------
R4XC07_TAPDE/63-663--------------------ALNILEQSGFVNSATS...RRELAPNI-------AMQELETN------------------
COG6_CANGA/184-819--------------------YIGTLA.............RKSLRTDL-------ETQLLKDH------------------
A0A088AU02_APIME/31-620--------------------ALKELSTFFTENTLNS...RRNLRSKI-------ERRSLAIN------------------
M3AVJ9_PSEFD/47-684--------------------ALSILHERGLQNTADT...RRNLRLDV-------QEELIQCN------------------
G8BSH8_TETPH/181-817--------------------YVGTLA.............RKTLKNNV-------ETELLKEH------------------
V5EQK1_KALBG/40-699--------------------........HLVDTARA...RRDLEGDI-------QSRMLNAT------------------
COG6_YEAST/190-824--------------------YVGTLA.............RRALRTDL-------ESQLLKEH------------------
C4Y1K1_CLAL4/138-736--------------------VGGSMA.............RKNLRGEI-------EADLLKSQ------------------
C5DMM3_LACTC/169-799--------------------FVGSLA.............RNSLRSNL-------ESELLKSH------------------
J4VQT6_BEAB2/59-673--------------------....IDHRGLKHDGRT...RRRLRLDL-------QKEVIEKN------------------
G8BDK2_CANPC/146-760--------------------FMGTVS.............RKKLKSRI-------EHELIKNQ------------------
A0A0C4DUI8_MAGP6/47-702--------------------ALALLDSRGLQNTAET...RRRLRLDL-------QKEVIDSN------------------
COG6_ASHGO/167-791--------------------FLGSLS.............RKTLRSQL-------EKELLKDH------------------
D8T0Q7_SELML/31-672--------------------SLGTLSTFYAENSAQA...RRNLQATI-------EKRGLSIN------------------
COG6_SCHPO/44-649--------------------ALEQLSERKFKNEREA...RKQLPFEV-------FSDLIWTN------------------
A4S9H0_OSTLU/72-716--------------------....LSEILPLGAHGATTSSVNLRATV-------ERRGLALN------------------
M0TQE9_MUSAM/30-700--------------------SLATLSTFYADNTPQA...RRNLKSSI-------EQRALAIN------------------
E5ACR4_LEPMJ/80-720--------------------AFETLDARGVQNTAET...RRQIRLDV-------QKEVIQCN------------------
Q6C1G5_YARLI/26-595--------------------ALVALDDRITDNTASI...RRSLRANT-------EAEVIKAN------------------
A0A0D2XVZ8_FUSO4/62-692--------------------ALALLDERGIQNDAET...RRRVRLDL-------QKEVIDSN------------------
C5GW18_AJEDR/57-748--------------------ALEILDDRGIQNTPET...RRQLKLDV-------QKEVIDSN------------------
C1EEF9_MICCC/30-686--------------------.LKGLSEFYGENTPAA...RRGLRSSI-------ERRGLDIN------------------
W1QBZ5_OGAPD/148-758--------------------MLGSIA.............RRKLRGDV-------ESELLRQH------------------
A8HUT2_CHLRE/30-678--------------------SLQTLSTFYTDNTPAA...RRGLRTTI-------EKRGLAIN------------------
B0VZV1_CULQU/39-627--------------------ALTDLSQFYTENTLQS...RRNLRSQI-------ERRSLAIN------------------
G0RKF7_HYPJQ/55-674--------------------......QRAVGTNVKN...RRQLRLDL-------LGEAIGCN------------------
Q00T18_OSTTA/88-728--------------------..DILSSQHKTTTPCA...SVNVRAAV-------ERRGLALN------------------
COG6_CRYNJ/70-689--------------------TLPKRRTLKGQSAAIA...RKYLKQDI-------ETCLATGS------------------
A2E714_TRIVA/27-593--------------------.LSSID....DTTFNS...NTSVRTLL-------EEKELSEL------------------
L8G9L6_PSED2/56-700--------------------ALQLLDERGVENTVET...RRQLRLDI-------QKDVIDSN------------------
S2JPX5_MUCC1/49-650--------------------.LTSLSNIPDLDEISL...RRNLRGTI-------EKKEIETN------------------
G9PA30_HYPAI/22-644--------------------.IFLADERLSRGSAKT...RRLLRLEL-------LREAIDCN------------------
COG6_PHANO/55-693--------------------ALETLDTRGVRNTAET...RRQIRLDV-------QKEVIECN------------------
T5A889_OPHSC/60-688--------------------ALSLLDDRGIENNAKT...RRQIRLSI-------HKEVIDSN------------------
G7XM19_ASPKW/58-742--------------------ALETLSLRGIHNTAEV...RRQLRLDV-------QKEVVDSN------------------
N4VJY2_COLOR/52-699--------------------ALQLLDGRGLLNTPET...RRQLRLDL-------QREVIESN------------------
C4R6S3_KOMPG/154-788--------------------FVGNLA.............RRKLRNDI-------EHDVVDAN------------------
G8YLX1_PICSO/140-752--------------------FVGLSS.............RKKLRGEI-------EYDLTKTQ------------------
E1ZT97_CHLVA/34-681--------------------.LATLSDFFEDNSPAA...RRRLRSTI-------ENQGVRIN------------------
W1P048_AMBTC/29-693--------------------SLNALSTFYVQNNQLA...RRNLRSTI-------EKRSLAIN------------------
A0A0D2VZS5_CAPO3/71-723--------------------.LRALSTFVEDNTLHT...RRNLRSAI-------EAQALSVH------------------
K7J084_NASVI/37-626--------------------ALKELSTFFKENTVED...RRNLRSKI-------ERRSLAIN------------------
C5DUZ7_ZYGRC/192-819--------------------YLGILE.............RKSLRSDL-------ENELLKDH------------------
V5HY00_BYSSN/58-733--------------------ALETLDRRGVHNTADT...RRQLRLDV-------QKEVIDCN------------------
U9U8S1_RHIID/50-658--------------------...ALSEFYSNNNNNSLIIRRNLRGNI-------EQKAIEAN------------------
I1FMS4_AMPQE/123-704--------------------SLKVLSEFLPANTLHA...RRNLRSDI-------ERRGLILS------------------
COG6_PICST/163-782--------------------VVGSMS.............RKKLRGKV-------ENELIKNQ------------------
Q7QJN1_ANOGA/32-623--------------------ALSDLSTFFKENTLQS...RRNLRSQI-------EKRSLEIN------------------
COG6_ASPOR/122-808--------------------ALETLSLRDIHNTPEV...RRQLRLDV-------QKEVVDCN------------------
I1H7V6_BRADI/77-734--------------------.LGALSTFYVQNTPQA...RRNLKSSV-------EQRALAIN------------------
F9XD71_ZYMTI/57-693--------------------ALSILDERGLQNTAET...RRNLRLDV-------QEELIQCN------------------
J7S8L6_KAZNA/176-802--------------------YVGTLS.............RKNLRNDL-------ETELLKEH------------------
COG6_CANAL/150-758--------------------IVGSMS.............RKKFKGRI-------ESELIRNQ------------------
F6SQE9_CIOIN/44-655--------------------ALRSVSTFFTENNIRT...RRNLRGEI-------ERRSLLIN------------------
B9N0R1_POPTR/31-709--------------------SLNTLSAFYNENTPQS...RRHLRSTI-------EDRSLHLN------------------
T1I707_RHOPR/34-617--------------------ALKELNSYFHENTIQS...RRNLRSNI-------EKRSLSIN------------------
COG6_CAEEL/38-623--------------------FITPLVEDMNLDSNV....DRKLHNKL-------ERYELRLN------------------
F7BIB8_HORSE/4-604--------------------ALKALSSFFVENSLRT...RRNLRGDI-------ERRSLAIN------------------
COG6_NEUCR/64-712--------------------ALFLLDERGLQNVAEN...RRKLRLDL-------QKEVIDSN------------------
M3D478_SPHMS/53-688--------------------ALAVLDERHLQVTADA...RRNLRLDV-------QDELIRCN------------------
G8JRN3_ERECY/172-797--------------------FIGLLS.............RKSLRSDL-------EKELLKDH------------------
R1EQ64_BOTPV/49-680--------------------ALETLDARGLKNTQDM...RRQLRLDV-------QREVVQCN------------------
I2H727_TETBL/181-823--------------------YLGILA.............RKSLKSDL-------ESELLKDH------------------

PF03081

B4LDS3_DROVI/323-697-------------------------------------------...Y-------LVMLLGLQ------------------
Q5KMS6_CRYNJ/301-670-------------------------------------------....-------....EAIM------------------
J3MBU4_ORYBR/165-513-------------------------------------------.VWT-------STMRIVFR------------------
G1XRU1_ARTOA/244-617-------------------------------------------DNGI-------SHYAQALE------------------
W1PIG8_AMBTC/268-635-------------------------------------------RRWI-------RAIKLFVR------------------
S0EBU7_GIBF5/246-629-------------------------------------------TNGI-------GTYSQAME------------------
K4BC35_SOLLC/279-644-------------------------------------------RRWI-------RAMKIFVR------------------
K3XWI2_SETIT/155-495-------------------------------------------..WA-------QALSTMER------------------
C5E0R8_ZYGRC/237-621-------------------------------------------TSGL-------NSYAEALL------------------
Q6ES92_ORYSJ/192-594-------------------------------------------ERWI-------RALLTMVQ------------------
Q9SIB0_ARATH/210-552-------------------------------------------RKWL-------RTTTRAVN------------------
Q9LQP9_ARATH/238-587-------------------------------------------KIWV-------IVARVAIT------------------
F6GST9_VITVI/277-640-------------------------------------------KKWM-------QAVKIVVR------------------
G8ZSY9_TORDC/245-624-------------------------------------------....-------.SYTEALS------------------
I1LFL8_SOYBN/224-593-------------------------------------------ATWN-------QVVWHCTT------------------
M4F3N2_BRARP/219-571-------------------------------------------KKWL-------EATKIVIN------------------
W1NW13_AMBTC/231-604-------------------------------------------KRWV-------RAARASIR------------------
M0SRF8_MUSAM/218-582-------------------------------------------NKWK-------QAMCAFIQ------------------
J7REJ7_NAUDC/235-618-------------------------------------------.SGM-------ISYTEALL------------------
D2UX81_NAEGR/218-569-------------------------------------------...F-------IFYMNFYL------------------
M4DQ92_BRARP/206-564-------------------------------------------KGWV-------RLANVAFV------------------
K3Z4M7_SETIT/235-602-------------------------------------------AQWM-------QFYRIGVK------------------
B9S3S8_RICCO/351-722-------------------------------------------.AWI-------KTFKDCAF------------------
B7P4G4_IXOSC/289-655-------------------------------------------....-------.TALTALC------------------
F6H2V1_VITVI/283-641-------------------------------------------AQWG-------KHLEFAVK------------------
Q9FNR3_ARATH/273-622-------------------------------------------RKWT-------KVVKIITQ------------------
M0THS1_MUSAM/243-589-------------------------------------------RSWL-------GASRVALR------------------
C5XNX2_SORBI/186-525-------------------------------------------MRWI-------PAIRVVFH------------------
A7TQI9_VANPO/237-621-------------------------------------------SSGI-------LGYTEALL------------------
K3XFC8_SETIT/312-653-------------------------------------------.IWT-------TAMHIMVG------------------
E9G2G2_DAPPU/324-689-------------------------------------------....-------....TALL------------------
M4ELV2_BRARP/227-592-------------------------------------------RSWL-------EAVKVSME------------------
D7MQ70_ARALL/301-664-------------------------------------------KKWI-------QAVKITVR------------------
M4E3U0_BRARP/64-418-------------------------------------------..WN-------KTFKNCSS------------------
C5E318_LACTC/234-618-------------------------------------------SSGF-------LNYTEALL------------------
M0RFS4_MUSAM/240-598-------------------------------------------ARWV-------KAVNMAFL------------------
M0S9N6_MUSAM/277-655-------------------------------------------QDWV-------HLMQIAVN------------------
J3MUP3_ORYBR/158-521-------------------------------------------RRWS-------HAIRVVVK------------------
B9I6L2_POPTR/266-620-------------------------------------------DKWI-------KAANVSLR------------------
E4X2L8_OIKDI/306-653-------------------------------------------....-------....QAFV------------------
D7MSH8_ARALL/228-592-------------------------------------------KTWL-------KAVKLAVR------------------
B9IK77_POPTR/253-654-------------------------------------------KRRI-------QTMKMFMR------------------
M0RET8_MUSAM/246-597-------------------------------------------RSWL-------VASSVAVR------------------
A9RYU9_PHYPA/273-621-------------------------------------------TNWI-------QHMRIAIK------------------
Q69JW6_ORYSJ/346-696-------------------------------------------NAWV-------RAMRITLN------------------
M1AX18_SOLTU/275-644-------------------------------------------RRWI-------RCMNIFVR------------------
M0ZQS8_SOLTU/207-577-------------------------------------------TRWI-------NVARNCSN------------------
B8MLJ7_TALSN/245-625-------------------------------------------TNGI-------GVYSSALE------------------
I1I8W2_BRADI/260-643-------------------------------------------RRWN-------HGVRPVVR------------------
K7M841_SOYBN/188-545-------------------------------------------ENWI-------KTCKAAVK------------------
M7S7Y8_EUTLA/245-627-------------------------------------------TNGI-------GMYARAME------------------
I1MUP7_SOYBN/290-649-------------------------------------------KNWV-------QAVKVVVG------------------
I1LR33_SOYBN/232-587-------------------------------------------KSWL-------QVVKVAVG------------------
Q9LIA2_ARATH/266-643-------------------------------------------KKWV-------RVMRDIVQ------------------
I1MBG5_SOYBN/274-630-------------------------------------------EKWI-------KASNVALK------------------
M2MJA4_BAUCO/246-630-------------------------------------------SNGI-------GSYAHGLL------------------
B9RAG8_RICCO/276-630-------------------------------------------KKWI-------QAIKICVR------------------
U7Q7I3_SPOS1/370-767-------------------------------------------TSGI-------GMYAQSME------------------
Q5TQS7_ANOGA/318-703-------------------------------------------...Y-------LVLLLGLQ------------------
E0VIX9_PEDHC/327-689-------------------------------------------....-------..TVMALQ------------------
EXO70_KLULA/234-616-------------------------------------------SSGV-------NSYTEAML------------------
D8RZH2_SELML/269-629-------------------------------------------KKWI-------QVMDVGVK------------------
B9HPL3_POPTR/209-568-------------------------------------------KAWL-------NAVKVAVK------------------
M7PEF2_PNEMU/241-608-------------------------------------------SNGI-------IIYTQALL------------------
C4LW49_ENTHI/279-679-------------------------------------------....-------...MKHVL------------------
I1JCY6_SOYBN/322-699-------------------------------------------..WI-------NTWKECTS------------------
D6WW45_TRICA/328-692-------------------------------------------....-------.VCVIALH------------------
B6K881_SCHJY/235-604-------------------------------------------SDEI-------SIYSAALV------------------
F0XF34_GROCL/729-1128-------------------------------------------TNGI-------STYTQAME------------------
D8SPE6_SELML/233-605-------------------------------------------KKCL-------KAMKVSFK------------------
M0REN0_MUSAM/218-570-------------------------------------------RRWI-------RAARVCVR------------------
E0CP16_VITVI/299-657-------------------------------------------.LWI-------QHFELAVK------------------
K3Y3Q0_SETIT/194-605-------------------------------------------ERWI-------KALKTMVQ------------------
B9HV40_POPTR/282-631-------------------------------------------DQWC-------KHLQLAVK------------------
J3MH82_ORYBR/80-438-------------------------------------------ERWG-------RHLEFAVR------------------
B9GVY9_POPTR/242-613-------------------------------------------RRWI-------RAAKVCVR------------------
M7UD48_BOTF1/247-635-------------------------------------------TNGI-------GTYAMGME------------------
W1PWG9_AMBTC/231-597-------------------------------------------KVWL-------HAARVALK------------------
N1J6U6_BLUG1/243-631-------------------------------------------TNGI-------STYAKGIE------------------
K3XSA8_SETIT/229-593-------------------------------------------RRWN-------RAMRVFIR------------------
B9SNP4_RICCO/271-635-------------------------------------------KRWV-------RAMKIFVR------------------
M1CZG7_SOLTU/225-591-------------------------------------------KIWL-------NAVKVAVS------------------
Q9C8H6_ARATH/254-623-------------------------------------------DQWR-------LHMEIAVK------------------
H2ZQN6_CIOSA/276-638-------------------------------------------....-------.AMVSACA------------------
K3XFW5_SETIT/237-577-------------------------------------------KRWT-------TVTKIIGK------------------
A9TGT7_PHYPA/278-635-------------------------------------------RSWN-------HTVTVGVK------------------
M1W138_CLAP2/246-628-------------------------------------------TNGI-------STYAQAME------------------
A5B8C4_VITVI/267-614-------------------------------------------ERWT-------KAATVALR------------------
S3E3U8_GLAL2/246-630-------------------------------------------TNGM-------ATYAKGME------------------
B9T041_RICCO/247-608-------------------------------------------KNWL-------NAVKIAVK------------------
H6CBM6_EXODN/248-636-------------------------------------------SSGI-------GAYANAME------------------
I1JWP0_SOYBN/263-614-------------------------------------------RKWV-------RAMKIIVR------------------
F4KG58_ARATH/222-573-------------------------------------------MNWI-------HYIRISVK------------------
F6GTU7_VITVI/230-591-------------------------------------------RHWL-------NAVKAAVK------------------
M4CLF8_BRARP/249-615-------------------------------------------KNWI-------KAAKIGVT------------------
W5EWA8_WHEAT/175-531-------------------------------------------....-------KYLQITVK------------------
I1MDK3_SOYBN/222-572-------------------------------------------KSWL-------NAVRFVVR------------------
M1CA15_SOLTU/267-620-------------------------------------------KKWR-------QATKNVIA------------------
C4R8N1_KOMPG/235-620-------------------------------------------SNGV-------SNYSEAFI------------------
Q8VY27_ARATH/245-606-------------------------------------------KNWI-------KAAKIGIA------------------
Q0CYR3_ASPTN/219-599-------------------------------------------TNGI-------GIYSNALE------------------
U9SQP1_RHIID/236-607-------------------------------------------TCGF-------NSYTDAIL------------------
EXO70_EMENI/247-629-------------------------------------------TNGI-------GTYSDALE------------------
S2J047_MUCC1/214-590-------------------------------------------.SEF-------LKYTECYT------------------
J3L5F1_ORYBR/344-686-------------------------------------------LRWI-------PAIRAVFH------------------
K0KAQ4_WICCF/235-607-------------------------------------------SNGI-------NNYTEAFL------------------
M0W8E8_HORVD/215-574-------------------------------------------RRWN-------HAIRVVVR------------------
R8BPV7_TOGMI/250-634-------------------------------------------TNGI-------STYAQSME------------------
K3ZHK2_SETIT/304-675-------------------------------------------ATWI-------KAFRHAVE------------------
M0TX18_MUSAM/52-414-------------------------------------------RAWL-------AAAPIAFR------------------
K4CMD0_SOLLC/278-635-------------------------------------------ANWG-------KHLEFAVK------------------
G3JCP3_CORMM/249-631-------------------------------------------TNGI-------GSYAQAME------------------
Q6K647_ORYSJ/301-673-------------------------------------------KKWV-------QAVKTVVR------------------
J3N6B0_ORYBR/11-377-------------------------------------------ATWI-------RAFRHTIN------------------
C5FN52_ARTOC/246-625-------------------------------------------TNGI-------GVYSNVIE------------------
J7R1E6_KAZNA/236-614-------------------------------------------SNGM-------LNYTEALL------------------
EXOC7_DICDI/437-835-------------------------------------------SHPL-------ISYVQETL------------------
K1X101_MARBU/264-643-------------------------------------------TNGM-------GTYATGMA------------------
W1NJ63_AMBTC/264-632-------------------------------------------.KWV-------QAMKVSIH------------------
G0S641_CHATD/252-645-------------------------------------------TNGI-------GTYAQAME------------------
D5GH85_TUBMM/239-604-------------------------------------------SNGI-------SVYTNALE------------------
A9SN89_PHYPA/313-674-------------------------------------------HKWC-------EHFKIIVK------------------
J9JWJ5_ACYPI/326-687-------------------------------------------....-------...VIALQ------------------
W5AN73_WHEAT/1073-1426-------------------------------------------KKWT-------QALRVVVQ------------------
W1PHH8_AMBTC/279-635-------------------------------------------NQWG-------THLEFAVK------------------
U5H6T1_USTV1/251-633-------------------------------------------RRSL-------GRFLDVMF------------------
S7ZDA9_PENO1/246-625-------------------------------------------TNGI-------GIYSNALE------------------
K2RHI9_MACPH/246-628-------------------------------------------TNGI-------GTYAAGLE------------------
F6HQX6_VITVI/246-608-------------------------------------------KNWL-------EGIKISIT------------------
I1NUS0_ORYGL/283-640-------------------------------------------KKWI-------QALKVVVR------------------
M4AQR1_XIPMA/327-700-------------------------------------------....-------...ISAFV------------------
M7XH50_RHOT1/276-657-------------------------------------------.RGL-------GRVLDVML------------------
K4DFQ8_SOLLC/257-617-------------------------------------------DQWD-------KQLEFVVK------------------
D7LD39_ARALL/243-607-------------------------------------------KNWI-------KAAKIGVI------------------
E3S143_PYRTT/247-623-------------------------------------------TNGI-------GTYVQAIE------------------
E7LW76_YEASV/236-620-------------------------------------------SSGM-------NSYTEALL------------------
M3APZ2_PSEFD/248-629-------------------------------------------.CAI-------TTYATGIQ------------------
T5A733_OPHSC/248-627-------------------------------------------TNGI-------GTYAKAME------------------
U5CZ65_AMBTC/305-668-------------------------------------------SLWI-------QHFELALK------------------
Q0U449_PHANO/247-623-------------------------------------------TNGI-------GTYVAAIE------------------
I1Q027_ORYGL/148-486-------------------------------------------.VWA-------QALSTMDR------------------
M1CE10_SOLTU/253-614-------------------------------------------EKWV-------KAVNVALR------------------
M0U7Y4_MUSAM/169-538-------------------------------------------RSWL-------GASRVAVS------------------
EXO70_ASHGO/231-611-------------------------------------------SSGF-------NSYTEAFI------------------
G2XG72_VERDV/248-627-------------------------------------------TNGI-------GTYAQAME------------------
J3M2U7_ORYBR/269-636-------------------------------------------HHWR-------QSFRITVK------------------
L8G7J8_PSED2/268-651-------------------------------------------TNGI-------GMYAQAIK------------------
M4CEA6_BRARP/229-593-------------------------------------------KSWL-------QAAKLAVR------------------
A9SZG5_PHYPA/276-645-------------------------------------------KSWN-------QAMKVGVT------------------
EXO70_YARLI/228-600-------------------------------------------SNGI-------HIYAEALL------------------
A0A0D1CBV0_USTMA/294-724-------------------------------------------QAGA-------VELFEAYY------------------
M0TA71_MUSAM/314-686-------------------------------------------ATWN-------KVFRQTVE------------------
I1N4J9_SOYBN/299-665-------------------------------------------KRWI-------WAVKIFVR------------------
A0A068X0P1_HYMMI/337-709-------------------------------------------....-------..SLSAFL------------------
M3J203_CANMX/209-599-------------------------------------------SNGI-------TKYTDVFL------------------
K3ZZ59_SETIT/223-607-------------------------------------------RRWI-------RAACAAVR------------------
F9XKX9_ZYMTI/246-627-------------------------------------------.CAI-------TTYATAIQ------------------
B9RM96_RICCO/288-654-------------------------------------------AAWN-------DVLKHCYS------------------
D7L2C4_ARALL/228-595-------------------------------------------RKWI-------RAAKVCIR------------------
K7KYU0_SOYBN/278-635-------------------------------------------DQWG-------CHLELVVK------------------
D7KZD8_ARALL/246-616-------------------------------------------RRWI-------RAAKICVR------------------
U5FM28_POPTR/271-621-------------------------------------------KKWV-------RAVKIIIR------------------
W5AKS6_WHEAT/499-852-------------------------------------------REWI-------QALKVVVQ------------------
S9VZ38_SCHCR/246-609-------------------------------------------.EEV-------AIYLVALA------------------
R7YPE8_CONA1/246-628-------------------------------------------TNGV-------GTYAQGME------------------
M1C7K5_SOLTU/253-615-------------------------------------------KDWL-------RAADVAVK------------------
E9EGW9_METAQ/241-624-------------------------------------------TNGI-------GTYAQAME------------------
G8YBT4_PICSO/212-624-------------------------------------------SNGI-------NRYTNELI------------------
M0RE29_MUSAM/266-621-------------------------------------------KNWM-------QALKLVVG------------------
F6H486_VITVI/271-637-------------------------------------------RRWV-------RAMKIFVR------------------
W1PQ65_AMBTC/301-663-------------------------------------------KKWI-------QAIKILVK------------------
T1K8E7_TETUR/311-683-------------------------------------------....-------...VTALY------------------
J3MTK1_ORYBR/52-443-------------------------------------------RRWI-------RAARAAGR------------------
I2H140_TETBL/236-622-------------------------------------------SSGM-------MNYSQALL------------------
M3DCX2_SPHMS/245-628-------------------------------------------TCAI-------TTYATGLQ------------------
I1N7V8_SOYBN/316-682-------------------------------------------.AWI-------NTLKQCAA------------------
K3YBY1_SETIT/269-627-------------------------------------------GNWT-------HLMQIAVK------------------
G7YLN0_CLOSI/142-557-------------------------------------------....-------....TALV------------------
J3L4D1_ORYBR/230-594-------------------------------------------KKWN-------RAMKVFVQ------------------
R4XBR7_TAPDE/254-624-------------------------------------------SNGI-------GHYTEAIM------------------
A9RF66_PHYPA/295-650-------------------------------------------KKWT-------QQLEVVVK------------------
A2FJ22_TRIVA/250-590-------------------------------------------QHPV-------HTVANLVG------------------
I1MBG8_SOYBN/93-437-------------------------------------------LRWI-------KAVNVAHR------------------
J3NNQ2_GAGT3/246-625-------------------------------------------TNGM-------AMYVQAME------------------
M4CAS6_BRARP/212-578-------------------------------------------RSWI-------DAVSVSMK------------------
G8JUD2_ERECY/232-611-------------------------------------------.SGV-------NSYTEALV------------------
G8B940_CANPC/213-611-------------------------------------------TKGY-------NQFTDATD------------------
K4ATI3_SOLLC/271-650-------------------------------------------TRWI-------RAVKNCST------------------
K4D380_SOLLC/270-630-------------------------------------------GNWI-------HYMRISVR------------------
K4DB07_SOLLC/238-600-------------------------------------------KNWL-------GAVKIAVS------------------
EXO70_NEUCR/252-636-------------------------------------------TNGM-------GTYAQAME------------------
A8XF23_CAEBR/262-600-------------------------------------------...C-------HVMCSALL------------------
M4E1D8_BRARP/269-620-------------------------------------------GNWI-------HYMRISVK------------------
M0TCN3_MUSAM/206-567-------------------------------------------RDWL-------AAAPIAFR------------------
D7KLE4_ARALL/242-609-------------------------------------------RRWI-------RAAKVCVR------------------
K3Y1F3_SETIT/202-606-------------------------------------------ERWI-------KALKTMVQ------------------
J3MD06_ORYBR/268-610-------------------------------------------QMWI-------QALRVIVG------------------
A9S026_PHYPA/305-661-------------------------------------------EKWA-------QQLEVIVK------------------
W1QJT2_OGAPD/249-609-------------------------------------------....-------.NYSKMLQ------------------
E2BW20_HARSA/356-713-------------------------------------------....-------..LTAGLH------------------
K4BUL3_SOLLC/313-670-------------------------------------------SLWI-------QHFELAIK------------------
A5E7C7_LODEL/213-654-------------------------------------------QFKY-------NKFTEVVD------------------
EXO70_CANGA/235-620-------------------------------------------SSGF-------INYTEAVL------------------
C4Y3V1_CLAL4/216-602-------------------------------------------SSGI-------EKYTEKLL------------------
U4LH75_PYROM/239-603-------------------------------------------SNGI-------GMYTSSLE------------------
D7LJN0_ARALL/216-574-------------------------------------------KKWL-------EATKVLIA------------------
K4BJZ5_SOLLC/284-648-------------------------------------------KKWI-------YAVKVLVR------------------
C5MG62_CANTT/215-605-------------------------------------------SNGI-------TQYTDIMI------------------
EXO70_CANAL/230-665-------------------------------------------TNGI-------TKYTDVLS------------------
M4DQX8_BRARP/251-599-------------------------------------------.QWR-------VDVEIAVK------------------
A0A0D2X486_CAPO3/367-717-------------------------------------------....-------....TVFL------------------
F6HBV2_VITVI/280-635-------------------------------------------..WS-------KHLEYAVK------------------
I1JPF3_SOYBN/247-610-------------------------------------------KSWL-------EATRISVR------------------
M4D183_BRARP/85-443-------------------------------------------SQWG-------NHLEFAVK------------------
F6HRR9_VITVI/232-595-------------------------------------------KHWL-------SAVRIAVK------------------
B9RLN4_RICCO/271-620-------------------------------------------KKWI-------WTMKVIIK------------------
F6WWX5_CIOIN/361-724-------------------------------------------....-------VAMVSACA------------------
I1IU67_BRADI/277-636-------------------------------------------.DWT-------QFMRIAVK------------------
A3LWD2_PICST/218-611-------------------------------------------SNGI-------TSFTTTFM------------------
U5GI23_POPTR/267-628-------------------------------------------KRWV-------RTMKIFVR------------------
G3B334_CANTC/207-579-------------------------------------------TNGI-------HAYTYELL------------------
B9HCA8_POPTR/242-605-------------------------------------------KNWL-------EAIKIAMK------------------
A9S081_PHYPA/264-622-------------------------------------------GSWI-------QYMRIAVK------------------
M0RMY7_MUSAM/168-542-------------------------------------------RRWI-------RAARVCVR------------------
K1R8N3_CRAGI/240-606-------------------------------------------....-------....SALL------------------
M0TDJ2_MUSAM/228-592-------------------------------------------EKWK-------QAMQVFVR------------------
A9SEA0_PHYPA/286-643-------------------------------------------KKWN-------QAMNVGVK------------------
K3XX39_SETIT/77-423-------------------------------------------KLWI-------QGLKIFFG------------------
K7UV86_MAIZE/134-473-------------------------------------------..WV-------QALSTMEH------------------
M1BSP6_SOLTU/313-684-------------------------------------------TAWI-------ATFRHCTN------------------
U1GTL6_ENDPU/245-629-------------------------------------------TSGI-------GAYANGLE------------------
H2AMI9_KAZAF/241-641-------------------------------------------SSGM-------INYTEALL------------------
A9SHU0_PHYPA/294-653-------------------------------------------GKWS-------EHIEVAVK------------------
M0X2R1_HORVD/229-589-------------------------------------------KRWN-------RAMKAFVR------------------
B9SQM4_RICCO/281-628-------------------------------------------..WC-------EHLEFAVK------------------
C5YI28_SORBI/233-588-------------------------------------------RRWS-------HAVRAVVR------------------
G2Q2Y8_MYCTT/252-644-------------------------------------------TNGI-------GTYAQAME------------------
B9GMP7_POPTR/287-658-------------------------------------------AMWI-------TVIKHSSS------------------
D8QQ88_SELML/278-638-------------------------------------------GSWI-------QSMKVSVK------------------
I1IU36_BRADI/316-680-------------------------------------------ATWI-------KAFRHAIN------------------
Q7XVB9_ORYSJ/303-673-------------------------------------------KKWV-------HGVKTVVR------------------
M0T4W9_MUSAM/300-646-------------------------------------------ATWI-------KAFRHTIT------------------
C5Y540_SORBI/271-624-------------------------------------------GNWI-------HFMRIAVK------------------
Q6YYS2_ORYSJ/156-522-------------------------------------------KRWI-------RALLTMVQ------------------
S3C6C9_OPHP1/275-678-------------------------------------------TSGI-------GMYAQSME------------------
A0A0E0PVZ0_ORYRU/61-408-------------------------------------------EIWI-------QALRVIIG------------------
D8T120_SELML/259-622-------------------------------------------GNWI-------QHMRAAVK------------------
L0PB59_PNEJ8/240-610-------------------------------------------SNGF-------VVYTQALL------------------
G0V7P9_NAUCC/234-618-------------------------------------------SSGM-------ISYTEALL------------------
S8BBP5_DACHA/239-612-------------------------------------------DNGI-------THYAQAIE------------------
N1PXJ6_DOTSN/246-630-------------------------------------------.CAI-------GTYAQGIQ------------------
F6I1N2_VITVI/270-640-------------------------------------------AKWI-------KVVKHCSL------------------
M0UL49_HORVD/11-372-------------------------------------------GNWI-------HFMRIAVK------------------
F0ZNQ9_DICPU/422-793-------------------------------------------SHPL-------ISYVSETL------------------
D7L7W1_ARALL/228-598-------------------------------------------NRWI-------EAVKVSMK------------------
M0SVR7_MUSAM/268-627-------------------------------------------QKWC-------RHLEFAIK------------------
M1C5W1_SOLTU/259-619-------------------------------------------KHWI-------DSTKIAVK------------------
C5XFH3_SORBI/239-578-------------------------------------------KRWT-------TVTKIIGK------------------
K7LHG0_SOYBN/296-660-------------------------------------------KSWL-------EAVKIAVR------------------
M0UGE8_HORVD/125-479-------------------------------------------.MWI-------QALKVFVS------------------
B9T911_RICCO/241-598-------------------------------------------KTWL-------NAVKFAVK------------------
A5DE46_PICGU/208-600-------------------------------------------TNGI-------NRYNNELI------------------
A2DS47_TRIVA/252-593-------------------------------------------EHPI-------HTFGYLIS------------------
U5CSC4_AMBTC/276-637-------------------------------------------GNWI-------HYMRIAVK------------------
M0T8R9_MUSAM/272-640-------------------------------------------KKWI-------QAMKIVVR------------------
M0T1U3_MUSAM/274-635-------------------------------------------GNWI-------HHMRIAVK------------------
G8BXH6_TETPH/237-621-------------------------------------------SSGL-------LSYTDALL------------------
E9D819_COCPS/246-624-------------------------------------------TNGI-------GVYATGIE------------------
Q9LMJ4_ARATH/247-592-------------------------------------------DRWI-------KAVTLIFH------------------
D7L7W0_ARALL/233-602-------------------------------------------RSWL-------KAVKVSME------------------
E70B1_ARATH/265-614-------------------------------------------DRWI-------KAANVALR------------------
E3Q9K9_COLGM/252-632-------------------------------------------TNGI-------STYAQAME------------------
F6GSY9_VITVI/271-629-------------------------------------------KKWI-------RAMKIIIR------------------
G1MYP9_MELGA/336-701-------------------------------------------...Y-------IHCVSAFV------------------
D7M573_ARALL/269-636-------------------------------------------ASWI-------SIVRRCST------------------
E1Z8T0_CHLVA/286-659-------------------------------------------..WV-------AALRLYVR------------------
B9GF67_POPTR/330-700-------------------------------------------..WI-------KAVREYAS------------------
G4MVD0_MAGO7/250-629-------------------------------------------TNGI-------GTYAQAME------------------
G9MGQ5_HYPVG/255-640-------------------------------------------ANGI-------GTYTQAME------------------
W1PMJ7_AMBTC/280-638-------------------------------------------GKWM-------KAFRRIVT------------------
U5FZC2_POPTR/63-424-------------------------------------------KNWL-------NAVKIAAK------------------
W5BVL2_WHEAT/184-551-------------------------------------------THWI-------RCLQIAVK------------------
EXO70_SCHPO/249-608-------------------------------------------....-------SINLVALS------------------
B9R6Z3_RICCO/301-666-------------------------------------------TFWI-------QHFELAVR------------------
B9SF67_RICCO/265-616-------------------------------------------NKWI-------KASNVALR------------------
K4C312_SOLLC/207-568-------------------------------------------KNWL-------SSVKIAVN------------------
A9T7C4_PHYPA/238-605-------------------------------------------SKWN-------QRMKVCVR------------------
K7LIX4_SOYBN/109-470-------------------------------------------GNWI-------HFMRIAVK------------------
M7ZQD7_TRIUA/1206-1561-------------------------------------------KKWT-------QALKVVIQ------------------

PF04100

VPS53_HUMAN/39-453-----------------------------RA--D--------------------FNAVEYIN------------------
Q9VQY8_DROME/42-434-----------------------------AP--D--------------------FNTVDYIN------------------
VPS53_SCHPO/16-394-----------------------------NN--E--------------------FKFVETLH------------------
VPS53_YEAST/5-369-----------------------------TV--D--------------------YDPLEDIT------------------
VPS53_CAEEL/30-390-----------------------------.P--N--------------------MSLMAQIN------------------
VP53A_ARATH/1-424-----------------------------MD--K--------------------SSALEYIN------------------

PF10475

Q7QF78_ANOGA/99-388--------------------LESTEAIYFDG..G--------------------SNTGLHEL------------------
Q336V4_ORYSJ/131-419--------------------VDELEEVFFQE..E--------------------FDPIKYIL------------------
Q54MU4_DICDI/72-370--------------------LKITPAGFFDP..K--------------------FDTTQFIL------------------
VPS50_CHICK/54-327--------------------INSIEEVYFSN.DA--------------------FDIVKYEL------------------
Q16RR9_AEDAE/70-360--------------------LESTEAIYFDS..G--------------------SNTGLHEL------------------
A1ZAY8_DROME/75-362--------------------LESIEQCYYNP..D--------------------SNPQLYEL------------------
Q54NV0_DICDI/113-401--------------------IDSLDEVYFKE..D--------------------FDPA.FIL------------------
Q8RXC2_ARATH/132-421--------------------VEELEEGFYEE..D--------------------FDPVRHIL------------------
Q18602_CAEEL/76-363--------------------INSIDAAYFIDNDE--------------------FDAIDYEL------------------
A8XSD2_CAEBR/80-367--------------------IDSIDASYFIDNDE--------------------FDAIDYEL------------------

PF04048

SEC8_SCHPO/51-191----------------------DLENLVNEI--E--------------------DEWKDLGR------------------
Q69PQ1_ORYSJ/22-158----------------------YLKEGLSRI--D--------------------EGWAAARF------------------
Q59NP0_CANAL/27-168----------------------SLKEVYNTI--K--------------------YDWPQMLR------------------
A5E514_LODEL/26-167----------------------DLKMIHNEI--K--------------------YDWPQILQ------------------
Q6BLA3_DEBHA/30-171----------------------ELKEVQTTL--R--------------------YEWPQCLQ------------------
A5DKL1_PICGU/29-170----------------------ELKEVTNYL--K--------------------YEWPQLLD------------------
A3LUX9_PICST/29-170----------------------ELKEVHNTI--K--------------------YDWPQFLV------------------
Q75B87_ASHGO/33-174----------------------KLQNDLSRI--E--------------------SSWNKVIT------------------
Q6CNM5_KLULA/34-175----------------------KLQADIALL--G--------------------TEWNRIIN------------------
A7TRV6_VANPO/35-176----------------------NLDMDLAQV--Q--------------------SQWHRIIS------------------
Q6FWA6_CANGA/35-176----------------------NLRDDLSLV--K--------------------SQWNRVLT------------------
Q6C3L8_YARLI/34-175----------------------KIDELCRKV--D--------------------YEWPELGR------------------
Q4WUD2_ASPFU/134-275----------------------AMEDILQAI--Q--------------------RDWGFVAS------------------
SEC8_NEUCR/82-223----------------------QIGNVLDLI--K--------------------REWPAMVE------------------
A0A0D1E3Z5_USTMA/441-580----------------------SINAVLRKV--Q--------------------VEWPFVAN------------------
E7M1P6_YEASV/34-174----------------------HLQNDLNRI--N--------------------LQWNRILS------------------
SEC8_ARATH/16-151----------------------.LREELARI--D--------------------ESWAAARF------------------

PF06046

Q28ZN5_DROPS/179-731--------------------FEKVDTVSQAL--E--------------------KKLRLILS------------------
Q5K9B3_CRYNJ/179-740--------------------FEKVDKVAADF--E--------------------AWLWEIAG------------------
EX3L4_HUMAN/179-709--------------------AMDVCLLYDGL--A--------------------AEIGAIVR------------------
A5DIA8_PICGU/180-832--------------------VLPLQEVVKNF--D--------------------LLLAEIIY------------------
Q0TXU6_PHANO/187-762--------------------FTRLDDVVEWF--D--------------------KHIGETCI------------------
EX3L1_BOVIN/188-722--------------------FEGLGPLAEAL--G--------------------QAVEAAAG------------------
SEC6_SCHPO/181-743--------------------FSNLNTLSDNF--D--------------------RLVLNFCR------------------
TNAP2_MOUSE/157-688--------------------QSKVEALYVLL--C--------------------DQVLGVLR------------------
A5DY39_LODEL/293-930--------------------TIPTAKLIANF--D--------------------ALLVEVIN------------------
A0A0D1DY75_USTMA/258-828--------------------FAPLDGLIRAF--D--------------------DYIMSLAE------------------
A4RYX1_OSTLU/92-690--------------------FERVDAAWTTF--E--------------------GVLWNSVR------------------
Q6DJR6_XENTR/177-732--------------------FGKVHPLSEEL--A--------------------KQLWMVIQ------------------
A3LNE6_PICST/180-819--------------------IDPIKRTIGNF--Q--------------------ELLGEAII------------------
Q8SU74_ENCCU/160-687--------------------LNTIEKNSLDF--T--------------------AKVLEISE------------------
Q16I77_AEDAE/179-730--------------------FEKVETVSATL--E--------------------KKIRLILQ------------------
Q5RG40_DANRE/161-694--------------------EDKLLRDSEIF--R--------------------ERLKFAI.------------------
Q6CU40_KLULA/178-794--------------------FQRVPGCIEKF--N--------------------KLLRDITY------------------
Q5BBU2_EMENI/183-758--------------------FQGLDAVIDWF--D--------------------DHLGTLCM------------------
Q6FPK2_CANGA/177-798--------------------FSKVSGLVDKF--D--------------------QLLESLIY------------------
A7F9Q6_SCLS1/177-755--------------------FARLDDTIDWF--D--------------------ENIGKVAL------------------
Q6C9T6_YARLI/183-804--------------------FAPLDPLIAKF--D--------------------RVVEDVGG------------------
EX3L1_MOUSE/189-722--------------------FQGLGLLAEAL--G--------------------QAVEAAAG------------------
EX3L1_DANRE/206-763--------------------FSGVGRLVDAL--A--------------------KELWAVVG------------------
EXOC3_DICDI/183-774--------------------FSSVPELSHRF--E--------------------NKIWNIVS------------------
TNAP2_HUMAN/122-651--------------------QSKVEALYELL--R--------------------DQVLGVLR------------------
Q6BJB6_DEBHA/180-833--------------------VLPVKKTIKKF--D--------------------DLLGEIII------------------
EX3L4_MOUSE/181-708--------------------AMDLCLHYDGM--A--------------------AEIGAIVR------------------
Q5A7K3_CANAL/180-812--------------------VSPIKTTIKLF--D--------------------ELLNEGIQ------------------
A6RAW7_AJECN/390-965--------------------FQRLDSVIEWF--D--------------------DHVGTAIM------------------
E7KDN6_YEASA/178-797--------------------FSRLSGIISKF--D--------------------KLLDGLTY------------------
H3DL97_TETNG/187-739--------------------FEDVQGLSDEL--A--------------------KQLWMVLQ------------------
EXOC3_HUMAN/188-743--------------------FGSTQGLSDEL--A--------------------KQLWMVLQ------------------
Q1K527_NEUCR/175-753--------------------FSRLDKYIEWF--D--------------------VNITLVAM------------------
SEC6_ARATH/173-736--------------------FEDVDRTWETF--E--------------------KTLWGHVS------------------

PF04091

W5E5N0_WHEAT/442-753--------------------YNMNVTAFHLE--PSEVIPE..............FPYVAPFS------------------
A9S7S7_PHYPA/446-757--------------------YNMNVLAFHLQ--SVDVMPA..............FPYIAPFS------------------
H2WCC2_CAEJA/477-783--------------------FRDIIRQFPFY--KRSMEQEP.............FPRKFPFS------------------
T1EMI3_HELRO/450-756--------------------YAAVIESYPYK--NPALEREP.............FPKRFPFS------------------
A9V537_MONBE/417-723--------------------YRELLETYPFE--DGATVGATV............FPRQLLFS------------------
Q6BHQ3_DEBHA/494-826--------------------YENVMKICWYK--SDAPFA......PQNVH.S..MPISFPFS------------------
E9G3C4_DAPPU/410-716--------------------YQRVIESFPYR--DGHLEAAP.............FPKRFPFS------------------
B9GSB7_POPTR/457-761--------------------YSMNVLSFQLQ--TSDIVPA..............FPYVAPFS------------------
M7NJC8_PNEMU/439-739--------------------YQKILDVSWYK--PNNFSDSIK............FPVTLPFS------------------
U1HWP6_ENDPU/444-743--------------------FEKVITVSWYC--P....ERAV.DDTK.......FPCVLPFS------------------
G0VF38_NAUCC/501-841--------------------FQKVSQICWMK--EDEHLEPQEDMSG........FSITLPFS------------------
K5VZV5_AGABU/444-743--------------------YQAILDTVWIS--ET...ERNHLNNTP.......LPQALPWS------------------
R9AG66_WALI9/449-747--------------------LESILSICWVD--NSSVSAVYSQK..........PPIHLPFS------------------
D6X4X0_TRICA/433-740--------------------YEHILSSFPWD--EDLPNDVV.............FPHKFPFS------------------
C5E4W3_ZYGRC/494-839--------------------YEKMLKICWMK--DDELAKARAEAAEQNGQ....FTITLPFS------------------
G8ZUB2_TORDC/501-847--------------------YEKVLKICWMK--EDELVKCQDAATNENGE....FFVTLPFS------------------
G2RB31_THITE/448-748--------------------YDKVLEATWFV--D....ERPP.DQIT.......FPAVFPFS------------------
U5FMP1_POPTR/442-753--------------------YENNVLSFHLQ--TSDIMPA..............FPYIAPFS------------------
J9K5H0_ACYPI/421-724--------------------YDNVVRTFPYQ--DDQLESST.............FPRKFPFS------------------
C4R087_KOMPG/447-765--------------------YKSISIISWYR--HTPSNNR..............FPKQLPFS------------------
Q8S5T3_ORYSJ/442-753--------------------YNMNVTAFHFE--PDDVVPE..............FPYVAPFS------------------
M4DPW7_BRARP/456-760--------------------YSMNVLSFQLQ--TSDIAPA..............FPYIAPFS------------------
G6DDP0_DANPL/419-720--------------------YDAVMDTFPYD--GDELETQP.............FPRRFPFT------------------
M3XK92_LATCH/505-811--------------------YKRTMGQFPFQ--DSNLEKQP.............FPKKFPFS------------------
D5GMB3_TUBMM/427-725--------------------YDNIVKSVWYN--P....DKDP.EIIQ.......FPTAMPFS------------------
W1QAD1_OGAPD/459-774--------------------..NVQANCFHK--FKDTITE..............FPVVLPFS------------------
U9TBU2_RHIID/147-443--------------------YEAVVDACWFK--EDHRISQG.............YPRTLPFS------------------
A5DMM0_PICGU/482-811--------------------YENVMKVCWYH--PEVSFA......AHKVK.K..MPVSFPFS------------------
R9P8Q0_PSEHS/445-756--------------------LSKVLSVCWLK--PG...DDVLLKQSG.......FPLSLPFS------------------
Q6C1W0_YARLI/480-793--------------------YEKITRACWWT--PA...DDEAAGGKPGAATDGVFPKTLPFS------------------
J3PJI4_GAGT3/450-750--------------------YEKVVNVSWFT--P....EKPA.EEMS.......FPCVLPFS------------------
G8YKH3_PICSO/492-824--------------------YENVMKVCWYR--NDAPFS......PAKLR.Q..LPVTFPFS------------------
J9EJI0_WUCBA/484-791--------------------.RAVVTQFPFY--RRGMDQEP.............YPRVFPFS------------------
F6YT74_HORSE/409-715--------------------YKIVISKFPFQ--DPDLEKQS.............FPKKFPMS------------------
J4KKU7_BEAB2/450-750--------------------FDKVLNVSWYT--P....EHNV.ENIT.......FPCVLPFS------------------
I4YIZ3_WALMC/449-754--------------------LESVLEVCWVD--SSSFTAAYSQK..........PPIHLPFS------------------
F8PQ71_SERL3/445-743--------------------.DNVLGMVWLS--PI...EQEELAKGA.......LPMNLPWS------------------
G1XUE0_ARTOA/508-808--------------------YAKVISVSWFK--D....DKDA.EEIQ.......YPTVLPFS------------------
A7TQS9_VANPO/506-845--------------------YEKVIKICWMK--EDDEVLSDNQNLSE.......FSVTLPFS------------------
G3AZR4_CANTC/493-823--------------------YESVTQICWYK--EDAPFA......PRHVK.K..LPISFPFS------------------
B4R147_DROSI/428-730--------------------YECIIERFPFH--SEQLENTP.............FPKKFPFS------------------
S8FZN9_FOMPI/445-743--------------------.DSVLDTVWLT--KE...EREQLVKSP.......IPLTMPWS------------------
K5W5P8_PHACS/445-743--------------------.DSVLDTVWLG--NS...EREQLLESP.......LPINFPWS------------------
G2YIA1_BOTF4/452-752--------------------FDKIIQVSWYV--P....DRPK.EEYT.......FPGVLPFS------------------
A8NWX8_COPC7/444-743--------------------..AVLDVVWLE--DH...ERSEIQAQP.......VPQSLPWS------------------
R4X791_TAPDE/443-739--------------------WDKIKAYCWYR--SSVDSSILT............YPAIFPFS------------------
S9VV25_SCHCR/436-738--------------------YDELIAPYWTL--PPAP.................FPRMVEFS------------------
V2X5M8_MONRO/445-743--------------------.NTVLDVVWIS--NE...KTQEIKQSA.......LPQNLPWS------------------
C5M2I2_CANTT/488-818--------------------YNSIIANAWYK--KDASFV......PANVK.A..LPVTFPFS------------------
I2H3Y9_TETBL/508-832--------------------YQKIKRICWMK--EEDEQLNGNQEDGQ.......LMINFPFS------------------
Q17EP0_AEDAE/419-722--------------------YDAVLERFPFH--SEQLEAQQ.............FPKKFPFS------------------
M2ZTI7_PSEFD/439-745--------------------YTKVISVSWYT--PPP..EQENVEEMT.......YPCVLPFS------------------
I1MM64_SOYBN/441-752--------------------YENNVLSFNIQ--TSDIMPA..............FPYVAPFS------------------
B6K595_SCHJY/439-743--------------------...LIQPYWYD--KKVDS................FPVTMPFS------------------
U4LHC9_PYROM/436-732--------------------YEKVVEVSWFK--D.......PVENRE.......FPTVLPFS------------------
G3Q4R1_GASAC/450-759--------------------YKHYTAQFPLQ--DPELDKLP.............FPKKLPFS------------------
Q753S5_ASHGO/494-834--------------------YEKVMKLCWMK--PDSVPIVTQDDANG.......FSVTLPFS------------------
Q5KPL0_CRYNJ/450-754--------------------FDQVAGVCWLA--KG...EAESLAMQG.......FPQPMPFS------------------
C4Y6U1_CLAL4/493-821--------------------YDNVMKICWYK--KDANFA......PRNVH.S..MPISFPFS------------------
E0VNA5_PEDHC/435-739--------------------YDKIMESFPFQ--DDTANNLK.............FPRKLPFS------------------
Q7RYL2_NEUCR/451-751--------------------YEKVLKVSWYT--E....EKAP.EELT.......FPCVLPFS------------------
H6BY38_EXODN/444-761--------------------FEKVVNVSWYT--P....DRPV.QEMT.......FPTVFPFS------------------
J7R131_KAZNA/509-861--------------------YDKVIKICWLT--EDKELRDAGNKSRESGVP...FSVVLPFS------------------
M0S2D5_MUSAM/444-755--------------------YNMNVVSFHLQ--SSDTLPD..............FPYIAPFS------------------
H2YEW6_CIOSA/141-441--------------------....LETFPYE--SPGFESEK.............YPRKLPFS------------------
M7XX30_RHOT1/453-763--------------------FGKVVSVTWLP--SSGEWSAEQLKSSG.......FPLALPFS------------------
M2RQV4_CERS8/445-743--------------------.DSVLDTVWLA--RQ...ERDQLARSA.......LPLTLPWS------------------
M2N0E3_BAUCO/446-755--------------------YAKVINVSWYT--PPE..DVPPLEKME.......FPCVLPFS------------------
F4S5J6_MELLP/471-780--------------------FSKVVEVSFLP--EQGEWAQENLITGG.......YPAALPFS------------------
H3CIW2_TETNG/458-766--------------------YKYYTSQFPLQ--DPELEKLP.............FPKKLPFS------------------
I3MQ17_ICTTR/423-732--------------------YKIVTSKFPFQ--DPDLEKQS.............FPKKFPMS------------------
M1CVC4_SOLTU/449-755--------------------.....LLFHLQ--TSDIMPA..............FPFIAPFS------------------
H2B145_KAZAF/504-852--------------------.NKVIKICWMK--EADLKLIESVNANQNDEEQ..FVVTLPFS------------------
C8V0B6_EMENI/444-742--------------------FDKVLNVSWYT--P....SEP..QEQA.......FPCVLPFS------------------
D7TQV0_VITVI/442-753--------------------YTMNVLSFHLQ--TSDIMPA..............FPYFAPFS------------------
U5HF68_USTV1/463-770--------------------FDKVVSVSWLP--ASGEWSADELKTPG.......FPLALPFS------------------
SEC15_SCHPO/436-738--------------------YDHYIAPYWNF--PSEP.................FPRTMSFS------------------
K2SGN8_MACPH/382-681--------------------YEKVVNVSWYT--S....EKPR.EELT.......FPCVLPFS------------------
N1JD47_BLUG1/449-748--------------------YDKVLNVSWFK--P....EKSR.ENLT.......FPCVLPFS------------------
W5C2B9_WHEAT/447-753--------------------.....AACQLE--PIHAVPD..............LPYVAPFS------------------
U5D3X0_AMBTC/442-753--------------------YNMNVLSFHLQ--TSDIMPA..............FPYIAPFS------------------
A6R9C0_AJECN/444-745--------------------YDKVLNVSWYN--P....EKSR.EQQT.......FPCVLPFS------------------
Q6CYE5_KLULA/489-828--------------------YEKILKICWLA--DQGSDTSNTTNDN........FSATFPFS------------------
T1ICC1_RHOPR/422-724--------------------FDQVLSTFPFQ--DDALEAAL.............FPKKFPFS------------------
U7Q2U4_SPOS1/452-752--------------------YEKVVNVSWFT--Q....EKPL.SELT.......FPYVLPFS------------------
V5ESV2_KALBG/448-756--------------------LSKVLSVAWLK--PG...DEGLLRNSQ.......FPLSLPFS------------------
M9MGV3_PSEA3/448-761--------------------LNKVLSVCWLK--PG...DEAQLRAST.......FPLSLPFS------------------
M2T372_COCH5/443-742--------------------YDKVVSVSWYS--P....PANS.EQLT.......FPCVLPFS------------------
B0CXV0_LACBS/444-743--------------------LDMVLDMVWLD--GA...EKDEIKQTP.......VPHLLPWS------------------
A8Q0J7_MALGO/448-754--------------------LAKVLSVCWLK--PG...EADQLKQLP.......FPLSLPFS------------------
L8GBJ1_PSED2/444-744--------------------YDKVVNVSWFT--P....DKPR.DELS.......FPCVLPFS------------------
K1PXL0_CRAGI/475-788--------------------YTAIVTQFPFQ--DEELEQASLPRKEET......FPKRFPFS------------------
T1K0Q9_TETUR/511-835--------------------YDEIINEFPYY--EAEVVSTGDSD..........YPKKFPFS------------------
W4YBC1_STRPU/461-764--------------------...LIRSFPFR--DEKIDKAP.............YPRRLPFS------------------
I2FTP7_USTH4/451-766--------------------LNKVLCVCWLK--SG...DGEMLRSCA.......FPLSLPFS------------------
M4CSR8_BRARP/401-712--------------------YENNVLSFNLQ--TSEIMPA..............FTYIAPFS------------------
SEC15_YEAST/521-864--------------------YEKVLKICWMK--EGEHLSLPDPTNGEP......FAVTLPFS------------------
I1LA00_SOYBN/442-753--------------------YENIILSFNLQ--TSDIMPA..............FPYTAPFS------------------
D5G5B6_TUBMM/397-695--------------------YDNVVNVSWYK--P....DKER.DQLE.......FPIVLPFS------------------
S2IZP1_MUCC1/463-761--------------------.KEVMQYTRFR--P....DREFIKRYG.......FPLRLPFS------------------
K0KMH2_WICCF/500-804--------------------YRKISNISWYE--DSRSENEIK............FPQVLPFS------------------
A3LS60_PICST/480-811--------------------YENIMRICWYR--EDAPFA......PKNVT.K..MPITFPFS------------------
C5DLI6_LACTC/498-839--------------------YEKVLKICWLR--TDELEALHSREKTPDES....FFATLPFS------------------
G3AHA4_SPAPN/460-784--------------------YDSIMKLVWYQ--KDSAFA......PQNVR.S..MPIQLPFS------------------
G8BTV9_TETPH/518-863--------------------YEKVTKICWMK--DSDDMLVEQNGNDDD......FIVTLPFS------------------
G4TCP0_SERID/445-744--------------------LDAIVSGCWLP--SS...VAASLYSLD.......PPCVLPFS------------------
G8BIA4_CANPC/483-815--------------------YRDVMKTLFYF--KDAPFA......PERVRNK..FPVKFPFS------------------
E6ZRP7_SPORE/448-761--------------------LQKVLSVCWLK--PG...DDALLRQSG.......FPLSLPFS------------------
Q6FRK2_CANGA/501-841--------------------YEKVIKICWMK--ENHQIIDDMDDEN........FSVTLPFS------------------
G0WGH4_NAUDC/507-859--------------------FEKVAQICWMK--DDENIKPTIDNENTGE.....FMVTLPFS------------------
E3KWD2_PUCGT/502-831--------------------FSKVVEVSFLP--NHGIWTKAELAKQT.......FPTALPFS------------------
K7IYQ6_NASVI/422-728--------------------YDKVLASFPYQ--DEELKKAR.............FPKKFPFS------------------
A0A0D1DRH1_USTMA/446-764--------------------LQKVLSVCWLK--PG...DDAMLRSSG.......FPLSLPFS------------------
C3ZIQ9_BRAFL/402-708--------------------YSEIIRSFPYQ--DEALEKED.............FPKRFPFS------------------
D8PS05_SCHCM/445-743--------------------.DGVLEVILVT--EQ...EKYDIRRAP.......LPQILPWS------------------
A5E457_LODEL/496-826--------------------YDTIMKRIFYE--SNASFA......PRNVK.S..FPVKFPFS------------------

PF09763

Q5K9I2_CRYNJ/487-1172--------------------KKKGADVIENRLLDELTALDSAI.IHAF------LESDDRTA------------------
Q75AA6_ASHGO/631-1297--------------------DG..SDVVLERLLLKVAEAEYQF.NKQL------MSLPKKAS------------------
A5DBH0_PICGU/595-1282--------------------TSDNGDILIKKLSHELSALKYNN.VKQL------VTLDFGHN------------------
A3GH85_PICST/638-1329--------------------ITDDSDSLIKKLTRELNNVKQQN.VREL------IGLNFGSS------------------
Q6FRC5_CANGA/652-1329--------------------DD..ADTLLEKVNTNLSKTEYMF.NTSL------LTLSKLSN------------------
Q2UK85_ASPOR/702-1427--------------------KK..IEDLEADIRREIGRVEATSWLGNL------EQQEGKID------------------
A7TSV5_VANPO/776-1455--------------------ED..ADKLVERLDYKLAETEYDF.NNDL------LLLENLQT------------------
Q6CQX3_KLULA/540-1218--------------------DD..SSSLLEKLHSRLADVDYQL.NKNL------LFLPKSLG------------------
Q57ZX4_TRYB2/198-1064--------------------DD..IRATEKLLSTHQKKAELLS.VNDL------VISACAWE------------------
EXOC1_DROME/198-866--------------------AIKDAEQFIEQLSRELHDLDGAN.MQSV------LASEQKVL------------------
A7E4X8_SCLS1/708-1443--------------------KV..IDGLKDDVERELNKVQAGGWLNRL------EEEDERVE------------------
Q6C0U5_YARLI/751-1484--------------------KD..AKELEADINRELAQLEESN.ISHV------IDLDTKFG------------------
Q2GRZ6_CHAGB/575-1334--------------------RN..FDEMRTDLDRELSKAQAGGWLARF------QEEDERVE------------------
A7RVQ5_NEMVE/163-846--------------------AISNIETFTDQLSKDLSVLDGAN.IYSI------MASEDQVT------------------
Q5TMX8_ANOGA/201-872--------------------AISNAELFMDDLSHNLLQLDGAN.IQSV------LESEKQVQ------------------
A0A0D1E5C3_USTMA/474-1173--------------------GKGTADMIEARLLDELSALEAAN.IFAI------IESDDRVA------------------
A5E4P0_LODEL/994-1796--------------------MN..TEVLLKGLTKELNKAKRET.VKRL------VSVDL.TK------------------
EXOC1_DICDI/107-855--------------------FEKDVDILTERLGKTLSTLETEM.IVGV------LDSGVGVN------------------
A3KPP9_DANRE/184-869--------------------.N..AEAFAEKLSRELQVLDGAN.IQSI------MASEKQVN------------------
E7LTP8_YEASV/640-1316--------------------DD..ADSMIERIDLRLAETEYLF.NQNL------LSLQKIGP------------------
V5ILH3_NEUCR/647-1440--------------------.N..FDEMRIDVDRELSKAQAGGWLARF------QEEDERVD------------------

PF04129

VPS52_YEAST/47-607--------------------------------------NKDQS-PFAK------LK..SLQE------------------
VPS52_SCHPO/1-508--------------------------------------MQRAS-TQDV------YD...GSG------------------
Q9VMQ8_DROME/42-546--------------------------------------VENKS-IEDY------IAESQNIA------------------
VPS52_RAT/94-601--------------------------------------IEQKS-IRDY------IQESENIA------------------
VP52A_ARATH/93-587--------------------------------------.....-..DY------IKESDNLV------------------

PF15278

B6K1Q5_SCHJY/526-611--------------------------------------------GKHL------FELDWSGE------------------
YD6C_SCHPO/520-605--------------------------------------------ISRL------STLKWNEG------------------

PF08700

Q5KJF4_CRYNJ/98-180------------------------------ADIEPDEVF--R.---------------------...-------------
EXO84_ASHGO/127-213------------------------------PQFQAKRFV--H.---------------------EKL-------------
COG5_MOUSE/37-120------------------------------EDFDVKTYT--S.---------------------QSI-------------
EXO84_CRYNJ/142-228------------------------------EKVDAQAYV--K.---------------------KVL-------------
Q6BJZ0_DEBHA/76-158------------------------------EDTSIDDIF--T.---------------------...-------------
Q0U0Z3_PHANO/76-170------------------------------ADFDAEAFV--N.---------------------SLL-------------
Q0WQ75_ARATH/43-129------------------------------TSFDADQYM--D.---------------------LMI-------------
Q173I8_AEDAE/5-87------------------------------LNINVDKLF--E.---------------------...-------------
A2D783_TRIVA/6-88------------------------------INEDPRLLF--E.---------------------...-------------
Q7Q6Z6_ANOGA/11-97------------------------------SSFDADRYL--Q.---------------------KLL-------------
Q2UQ54_ASPOR/108-197------------------------------PDFDAQRYV--N.---------------------HLL-------------
VPS51_YEAST/84-163------------------------------GSEDAEEEI--K.---------------------...-------------
A2E266_TRIVA/29-115------------------------------NAFEAEPYY--K.---------------------NLI-------------
Q2U987_ASPOR/1-88------------------------------DGPDPQSLN--SW---------------------QDA-------------
Q6FRQ2_CANGA/66-146------------------------------SQPNVDRPI--N.---------------------...-------------
Q6CSC3_KLULA/100-179------------------------------ELEKGDIDV--T.---------------------...-------------
EXO84_GIBZE/128-214------------------------------PKLKPDRYV--Q.---------------------AAL-------------
EXOC8_MOUSE/13-100------------------------------GGFEARLYV--K.---------------------Q.L-------------
A0A0D1E7D8_USTMA/79-161------------------------------FGTEPDTLF--L.---------------------...-------------
Q8I2A9_PLAF7/116-202------------------------------SNFNVNNYF--K.---------------------ELL-------------
Q6CG64_YARLI/77-166------------------------------GSFDAEEIA--R.---------------------DIL-------------
Q4E335_TRYCC/3-85------------------------------AVQEVRRIF--T.---------------------...-------------
EXO84_YARLI/121-207------------------------------EDLDAHTFV--T.---------------------QQL-------------
Q4MZL9_THEPA/63-149------------------------------HSFDVEHHF--D.---------------------QIL-------------
COG1_SCHPO/7-89------------------------------HSSNWKEIF--R.---------------------...-------------
Q59L27_CANAL/17-99------------------------------LYSDVDEIF--T.---------------------...-------------
Q2UHE7_ASPOR/121-207------------------------------PSLPVDRYV--A.---------------------NLL-------------
Q7RZT4_NEUCR/9-91------------------------------LLSSAQIFS--S.---------------------...-------------
E9AC89_LEIMA/3-81------------------------------AAQEVRRIL--C.---------------------...-------------
A2GBI6_TRIVA/24-110------------------------------PNFNSDKYF--A.---------------------ENT-------------
Q4Y221_PLACH/14-100------------------------------SEFNADIYF--R.---------------------RLL-------------
VPS51_DICDI/178-264------------------------------PSFNLNSYF--D.---------------------SIV-------------
VPS51_SCHPO/52-138------------------------------PNFDSNAYV--S.---------------------KFM-------------
Q9FFF3_ARATH/21-103------------------------------GQRDAESLF--R.---------------------...-------------
A0A0D1CLQ0_USTMA/184-270------------------------------SDFDPQAYL--R.---------------------AKL-------------
COG1_DICDI/113-195------------------------------YESDVKILF--E.---------------------...-------------
A2FRD0_TRIVA/32-118------------------------------SIFNAKLLF--D.---------------------KST-------------
A0C9R8_PARTE/6-92------------------------------SKFDCQKYV--S.---------------------EFL-------------
EXO84_CANGA/190-276------------------------------PQFSAKKFI--H.---------------------ERL-------------
Q754G8_ASHGO/53-137------------------------------GAGDMAVEV--P.---------------------EKL-------------
VPS51_CHICK/57-143------------------------------PHFDPEVFL--T.---------------------KVR-------------
Q95Q35_CAEEL/9-99------------------------------DAFSPSDYI--R.---------------------DRL-------------
Q6C0N6_YARLI/24-102------------------------------GLSSWQSTM--S.---------------------...-------------
Q4DYG1_TRYCC/45-131------------------------------EFFNVSKYV--T.---------------------DLL-------------
B4QW21_DROSI/4-89------------------------------FNFSVEKYT--K.---------------------D.L-------------
Q5KKF4_CRYNJ/54-139------------------------------PTFKPAAYY--E.---------------------DLI-------------
Q7S488_NEUCR/124-217------------------------------PDFSAQPYL--A.---------------------ELL-------------
Q84K25_ARATH/20-102------------------------------ASATQQPYV--S.---------------------ELL-------------

PF06148

Q0TYI9_PHANO/26-159..............................PDFSPSTYL--S----------------------TLS-------------
Q29BE0_DROPS/22-154..............................ENFSVDEFL--H----------------------K.N-------------
Q7QFV1_ANOGA/25-157..............................KTFSVDEFL--H----------------------E.N-------------
Q84LH7_ORYSJ/24-156..............................PDFDPDAYV--A----------------------D.L-------------
Q01CT5_OSTTA/52-184..............................DDFDPWAYV--E----------------------E.T-------------
Q5K8I4_CRYNJ/34-165..............................PTFDPDAFL--L----------------------S..-------------
A1C4Y0_ASPCL/32-165..............................PNFDPAVYL--S----------------------SLT-------------
Q2UA29_ASPOR/27-160..............................PDFDPAKYL--S----------------------SLT-------------
COG2_HUMAN/15-147..............................EDFDVDHFV--S----------------------D.C-------------
Q0C728_AEDAE/17-149..............................KTFSVDEFL--H----------------------E.N-------------
A8WN13_CAEBR/23-155..............................DDFNVERFM--N----------------------L.A-------------
Q383M1_TRYB2/46-232AGANYVNASDDAEQMDFEHHNEPGETMLAAFEFDPVQFV--Q----------------------NKL-------------
Q4DNE3_TRYCC/72-246............SDLLRQRNKTHQNGVVIAFDFDPIQFV--Q----------------------EKL-------------
Q4Q0F6_LEIMA/80-262ASSL....SSSFDSVNGHDGPQRRRGQRGLPAYDPLSFV--K----------------------GKV-------------
A0CKT7_PARTE/12-141..............................KNFVQANF.--.----------------------..E-------------
COG2_DICDI/53-185..............................NTFEVDQFI--S----------------------D.C-------------
F4JRR1_ARATH/31-163..............................PNFDSESYI--S----------------------E.L-------------

PF10392

Q5KKM0_CRYNJ/10-154------------------------------DSFDVHSYT--NA---------------------ILQGRQYTP-------
COG5_HUMAN/66-189------------------------------EDFDVKTYT--SQ---------------------SIH......-------
Q6BT79_DEBHA/15-147------------------------------TSFQPLQFA--ND---------------------LLL......-------
Q5B379_EMENI/829-961------------------------------PAFSPAAFA--NS---------------------LVV......-------
Q5APN5_CANAL/17-149------------------------------TNFDPQQFA--NE---------------------LLL......-------
COG5_SCHPO/8-139------------------------------SDFDPKAQA--ER---------------------VLI......-------
COG5_YEAST/14-146------------------------------PDFDAKQFG--ND---------------------LLK......-------
Q9C9V9_ARATH/57-180------------------------------SSFSSASFS--SA---------------------ALA......-------
Q0U7T7_PHANO/13-145------------------------------PDFSATSFA--NT---------------------LVL......-------
Q2HI55_CHAGB/25-157------------------------------PSFTPSSFA--NT---------------------LVL......-------
Q6CLE2_KLULA/11-144------------------------------ADFQPLRFA--ND---------------------LLK......-------
COG5_DICDI/63-186------------------------------EDFNVVHYT--SN---------------------ALK......-------
Q6C2T6_YARLI/5-136------------------------------AEFDPVAYA--NQ---------------------LVL......-------
Q75B18_ASHGO/11-144------------------------------DNFNHSQFA--RE---------------------LIR......-------
Q6FTM6_CANGA/9-140------------------------------PEFDSKSYS--NS---------------------MLK......-------
Q65XH1_ORYSJ/52-175------------------------------PSFSPSDFS--SA---------------------ALS......-------

PF04124

COG8_MOUSE/56-394------------------------------ERAQRLQQT--RD---------------------LAFANYKTF-------
COG8_SCHPO/15-354------------------------------QKLKLVQKR--QQ---------------------LLRDNYNVL-------
COG8_YEAST/28-381------------------------------DIAEIDAEL--SA---------------------LDRKIRKTL-------
COG8_CAEEL/10-353------------------------------ELKAIDAQI--SD---------------------LAFNNYGTY-------
Q9LYH5_ARATH/29-412------------------------------DAERIQRQM--QE---------------------VAVGNYRAF-------
COG8_DROME/37-379------------------------------EARTILEQT--QD---------------------LAISNYRTF-------
Q9P3N9_NEUCS/31-347------------------------------TSHGLLLSI--QA---------------------LSKKSHKQV-------

PF15469

Q5KNA8_CRYNJ/115-308------------------------------DNFDRFVAV--KA---------------------SSDVVYRDM.......
A7TRG2_VANPO/143-342------------------------------DNFTKYVKV--KN---------------------RLDQIYENF.......
G8BMU6_TETPH/145-338------------------------------DNFTKYVKV--KN---------------------RVDQIYENF.......
C5DYM3_ZYGRC/146-354------------------------------TNFTKYVRV--KN---------------------RLDQIYEQF.......
G8ZXE8_TORDC/144-345------------------------------TNFTRYVRI--KN---------------------RLDEIYEQF.......
H2AR86_KAZAF/151-365------------------------------SNFTKYVKI--KN---------------------RLDLIYKQF.......
G0VBU0_NAUCC/150-340------------------------------ENFTKYVRI--KN---------------------RLDKIYNQF.......
G0WGP4_NAUDC/153-350------------------------------LNFTKYVKI--KN---------------------RLDQIYNQF.......
Q6FVL5_CANGA/149-372------------------------------TNFTKYVKI--KS---------------------RLDQIYSNF.......
E7QCY0_YEASZ/146-360------------------------------KNFTKYVKI--KN---------------------KLDQIYKEF.......
C5DMT2_LACTC/144-330------------------------------RNFVKYVRS--KN---------------------NLDRIYEQF.......
G8JTD1_ERECY/120-302------------------------------KNFVRYVRC--KS---------------------NLDQIYDQF.......
Q750U7_ASHGO/122-304------------------------------TNFVRYVRC--KS---------------------NLDQIYDQF.......
Q6CQH1_KLULA/148-350------------------------------TNFAKYVRS--KS---------------------NLDHIYKRF.......
C4R5S5_KOMPG/139-344------------------------------SEFLVYIKS--KN---------------------SLDRIFKQF.......
Q6CGI4_YARLI/146-334------------------------------RNFDKFVKS--KS---------------------YLDSVFKQF.......
W1QF47_OGAPD/153-339------------------------------ENFQKAIDN--KK---------------------LLDEVYSEY.......
C4YAI9_CLAL4/138-372------------------------------ENFEHFVSC--KK---------------------TIDEILVAF.......
G8Y2A4_PICSO/149-393------------------------------ENFSGFVGC--KK---------------------SIDDVLSWF.......
C5MH42_CANTT/104-348------------------------------SNFIHFINT--KS---------------------KIDDSLIDF.......
G3AUN6_SPAPN/128-368------------------------------DNFLKVINS--KK---------------------SIDDVLVEF.......
G8BGG9_CANPC/145-407------------------------------ANITHALNV--KA---------------------EMDGTLQAF.......
B6K5G3_SCHJY/147-340------------------------------TRFHAFVAA--KE---------------------VIDKVYQEM.......
C4M2W7_ENTHI/111-299------------------------------SHFDQFINC--KD---------------------TLDKMQVII.......
D6W674_TRICA/193-371------------------------------ANIGSVMDQ--ID---------------------TLVNLKEKI.......
B0W3D0_CULQU/193-383------------------------------SNAGSVMDQ--LD---------------------TLMALRDRV.......
B3MVG4_DROAN/193-383------------------------------SNAGSVIDQ--LD---------------------TLMNIRDKL.......
G6D800_DANPL/194-372------------------------------ANTGAVMDQ--LD---------------------RLVLLKNMY.......
E2AW35_CAMFO/194-372------------------------------ANVGAVMEQ--LD---------------------TIMSLKDQF.......
E0VQL4_PEDHC/200-377------------------------------SNVGSVIDQ--ID---------------------MLAKFKEKL.......
E9G6B5_DAPPU/193-371------------------------------THAGSVIEQ--MD---------------------TLMTLKKVV.......
B7PR09_IXOSC/148-326------------------------------SNVNAIVIC--LD---------------------VLHELQKAM.......
A8WPA7_CAEBR/200-378------------------------------ANLYSLINC--VD---------------------TLANLHQAL.......
H3ERJ1_PRIPA/197-373------------------------------AHLYSLINC--VS---------------------TLATLHQQL.......
A0A0I9R3C5_BRUMA/212-385------------------------------ANLYSLINC--VD---------------------TLATLYDKM.......
C3XUC7_BRAFL/191-370------------------------------GNLTSIMDC--QD---------------------ALAAMHQDL.......
F6YQX0_XENTR/198-380------------------------------GGLSTFFEA--QD---------------------ALAAIHQKL.......
F7GSZ8_CALJA/50-227------------------------------GGLSTFFEA--QD---------------------ALSAIHQKL.......
E4XNP2_OIKDI/201-392------------------------------DSLPIFFEV--HE---------------------ALNSIHGQMSKG....
F6Q8U3_CIOIN/201-380------------------------------DSLPVFFEV--HE---------------------TLSGIHHKM.......
G4VNQ3_SCHMA/214-394------------------------------TNLVLIFRC--LD---------------------GMDSLRRRL.......
H2KP67_CLOSI/214-393------------------------------TNLLLIFRC--LE---------------------GMDALKNKF.......
F2UAY3_SALR5/207-386------------------------------VSSSTFVSA--FD---------------------AVLNANRRI.......
A9RNH0_PHYPA/252-430------------------------------ENFDCFISC--KN---------------------TIDDIHSKL.......
A9S1F4_PHYPA/259-437------------------------------ENFDCFISC--KN---------------------TIDDIHLKL.......
D8RD25_SELML/239-417------------------------------ENFECFVSC--KN---------------------TIDDIHSKL.......
D7KJZ0_ARALL/260-438------------------------------DNFDCFVSC--KT---------------------TIDDIESKL.......
F0ZXN2_DICPU/132-311------------------------------ENFEHFVKC--KD---------------------TVDQVYDLI.......
F4PGL2_DICFS/126-305------------------------------DNFEHFVKC--KD---------------------TVDEVYNLI.......
A8PCF2_COPC7/122-323------------------------------DNFDRFVAV--KA---------------------STDALHAEM.......
D8QDB4_SCHCM/114-323------------------------------DNFDRFVAV--KN---------------------STDALHAEM.......
B8P2C9_POSPM/114-312------------------------------ENFNRFVAV--KA---------------------STDALYAEM.......
G4TT08_SERID/115-310------------------------------ENFDRFVAV--KA---------------------STDALYQDM.......
A8PUN7_MALGO/110-314------------------------------QNFDRFVTV--KA---------------------TNDSVFREM.......
E6ZLD0_SPORE/109-315------------------------------DNFDRFVAV--KA---------------------TTDGVYREM.......
E3K655_PUCGT/121-321------------------------------SEFDRFVAV--KV---------------------ANEAVYEQM.......
F4RSS6_MELLP/56-255------------------------------SEFDRFVAV--KA---------------------ATETVYEQM.......
F4PCT9_BATDJ/225-428------------------------------KHFAKFVSA--KG---------------------TIDTFYREM.......
D5GNN2_TUBMM/147-347------------------------------SNFDRFVAA--KG---------------------TIEGVYKEMKGDSF..
G1XK06_ARTOA/190-398------------------------------NNFERFVLA--KS---------------------TIDSVYKEMRAGSTTI

PF16528

C5DUD9_ZYGRC/539-743------------------------------LKFDKAVDS--LI---------------------DLESQLAEL-------
G0VJV4_NAUCC/543-749------------------------------LKFDIAVDT--LL---------------------DIESQLTEI-------
A7TL52_VANPO/508-712------------------------------LKFDKAVEL--IL---------------------DLESEMNNI-------
G8ZS82_TORDC/494-698------------------------------LKFGKAVDA--LN---------------------ALETQLKKL-------
G8BNG7_TETPH/532-736------------------------------LKFDKAVGI--LL---------------------SLEEENNKL-------
G0W548_NAUDC/557-766------------------------------LKFAVAVDT--LQ---------------------TVENQLTQL-------
EXO84_CANGA/545-749------------------------------LKFDSAVNT--LL---------------------EAESQLATM-------
H2AXV4_KAZAF/523-731------------------------------VNFEEAVLL--LT---------------------SIESKLNEY-------
G8JS46_ERECY/478-682------------------------------MNFEYAIRK--LR---------------------SIESILNGI-------
EXO84_KLULA/500-705------------------------------QNFDLAITK--LN---------------------HIQSSLKSL-------
G0S6E5_CHATD/457-657------------------------------QQIEPAVAR--IE---------------------....KLRNL-------
E3S512_PYRTT/452-652------------------------------QHFEEAVVK--V.---------------------...DRLRLL-------
EXO84_YARLI/444-642------------------------------RRFAEATDI--IL---------------------E...NIKDD-------
D5GAW7_TUBMM/436-637------------------------------RQFEEAV..--.V---------------------GVE.KLRGL-------
C4R6S9_KOMPG/506-717------------------------------QQFPDAVDS--LK---------------------QLSSQLNSI-------
Q2H152_CHAGB/456-656------------------------------QQIEPSVAL--IE---------------------K....LKSL-------
C9S7T2_VERA1/440-640------------------------------QHFENAVER--VE---------------------....KLKKL-------
B2B2W1_PODAN/463-663------------------------------QQIELAVAR--IE---------------------KLKSLA...-------
H2Z9L4_CIOSA/281-487------------------------------RNFEQAVEV--ML---------------------KTKDYLAGI-------
H2MTA2_ORYLA/303-507------------------------------RDFEGAVDL--LD---------------------KLNEYLKDQ-------
G3JE74_CORMM/450-655------------------------------QRFEPAVAG--V.---------------------..E.KLKSL-------
G0SXF2_RHOT2/870-1071------------------------------REFEDAVVL--IE---------------------KGKSILPKI-------
EXO84_CRYNJ/449-651------------------------------RDWEESVKL--VE---------------------K....GQAL-------
C5FKA5_ARTOC/433-633------------------------------QVFETAVCR--V.---------------------..E.KLRKL-------
F4P2Q9_BATDJ/415-626------------------------------RDFDNSVAN--LE---------------------KGKLVLNFI-------
G0R9T9_HYPJQ/449-649------------------------------QGFEPAVAR--VE---------------------....KLKAL-------
C7Z4G1_NECH7/445-645------------------------------QRFEVAVVR--VE---------------------....KLKAI-------
I1G637_AMPQE/287-497------------------------------REFEQAVNM--ID---------------------QVKSFLKDS-------
E7LRJ5_YEASV/465-668------------------------------LRFESAVET--LL---------------------DIESQLEDL-------
EXO84_ASPFU/445-645------------------------------QRFEEAVSG--IE---------------------....RLRKL-------
W4YYJ2_STRPU/291-496------------------------------RNFEESVDL--IL---------------------KANEYLEQV-------

PF06248

ZW10_DROPS/10-571------------------------------RKHIDENYS--..---------------------EFMTNHTSPDIFLEES
ZW10_ARATH/1-584------------------------------QSYLVAHHS--..---------------------DFSELFSLCQDTVSRT
A7SSG2_NEMVE/20-670------------------------------FNTIYKEYS--YA---------------------GFQDLSSSTSELNWKV
A8XRG3_CAEBR/1-605------------------------------SADIVDKYG--NL---------------------KVALNINNTAKLIFDR
ZW10_HUMAN/9-621------------------------------CNMISKKYS--..---------------------EFLPSMQSAQGLITQV
F1QYH5_DANRE/9-611------------------------------TDMINKKYI--..---------------------EFIPSMEGAEELLDQV
F7EQH5_XENTR/9-617------------------------------CDMINKKYD--..---------------------EFLPSMQCAEDLVTQV
H3CQC8_TETNG/9-607------------------------------YEMINKRYA--..---------------------DFLPSLQSSEQLMIQV

PF11988

C5DYW5_ZYGRC/14-364------------------------------HDLASLRSI--SG---------------------LIMEFKANFELLELEN
A7TF57_VANPO/11-362------------------------------HVLNSLKTI--PS---------------------LILEFKANMEYLELEN
Q6CUS2_KLULA/12-352------------------------------AKYNQYKIL--SD---------------------LLKEFNTNYELNELEN
G0WD68_NAUDC/10-396------------------------------HDLQQLKTI--SS---------------------LIMEFKTNFELFELEN
I2GW53_TETBL/23-390------------------------------YELNKLKTI--TS---------------------LIMEFKTNYELMEYEN
C5DK93_LACTC/23-365------------------------------GALKELNLV--AN---------------------LIDEFKANFELWELEN
E7KT96_YEASL/5-360------------------------------NILDNLKTF--LN---------------------LIKEVKTNLNILELEN
G8ZQK5_TORDC/17-366------------------------------REYTALKTV--PS---------------------LVLEFKTNLHLLEFEN
Q752C3_ASHGO/45-390------------------------------QQHLRLKIV--AD---------------------LLIKYNSEIQCAEFTA
J8Q396_SACAR/5-358------------------------------NTLDNLKAL--ST---------------------LIVEVKTNLDLLELEN
G8BQ21_TETPH/12-363------------------------------HDLNSLKQI--SD---------------------LILEFNANWEYIEVEN
H2AUI4_KAZAF/5-354------------------------------RDLTKLKTI--SS---------------------LLKEVNVNFELLEFEN
Q6FNZ0_CANGA/3-351------------------------------HDLKDLKIV--SS---------------------LVKETQVNLDLMELEN
G0V593_NAUCC/12-369------------------------------HDLNNLKIL--SG---------------------LLIEFKTNFELLELEN
J7S867_KAZNA/7-376------------------------------HDLSVLKTF--GD---------------------LLNEFNTNLAKSLFQD

PF06419

F4PTE8_DICFS/25-669------------------------------IQFLDQFTA--LNK............CIEDIQL-DYEDIKKGF--SEVRN
D7TU00_VITVI/30-688------------------------------HDFLRASDA--AQQ............ALDCVEE-EVNALADCC--DRIAK
K4CMR1_SOLLC/27-689------------------------------EEFLLSSAA--AQK............SLDRVEQ-EVNEIVECC--DKIAM
T1IZR2_STRMM/42-648------------------------------EEFVQDFRQ--VIQ............QLDSVHK-DVLAMSNCC--REMSN
E6ZVT0_SPORE/99-753------------------------------DDMIAVLHT--VDR............GLVQLSD-DVAAMHTSC--NAVQN
E3QI24_COLGM/61-707------------------------------GEIVSQFGR--VAD............QLRRIGA-TLDKLNNNY--QDVRN
G8ZRY6_TORDC/181-815------------------------------LTILEELTP--IIR............RIKRLST-SVEKIKNVG--HTIID
D0NH36_PHYIT/44-655------------------------------QKALDGLER--TLE............QVSNLAN-QVDALDTKC--DHVHK
G2XGZ3_VERDV/42-689------------------------------GEIINDFGR--VAD............QLRRVRH-TLNQLNETY--DEMRG
C5M6P2_CANTT/146-753------------------------------QSILKQYQP--TIR............QLKNIET-KLQKLNELS--KETNE
S3D9N6_GLAL2/53-695------------------------------GDIIKEFGH--VAE............QLRRIGL-TIASLNQGC--EEMKR
K1QJ12_CRAGI/42-639------------------------------EEFLQTFQG--VKE............QLDSVYA-DVKAMNDCC--QDMTS
E9EWT4_METRA/42-671------------------------------GTIIDNFGR--VSE............QLHRVRL-ILEKLKTEY--ESIKT
C1GBA8_PARBD/57-738------------------------------GKIVQDFGK--VAE............QLTRIGT-VISSLNNVC--DEMRR
G0VHH4_NAUCC/184-845------------------------------VLVLEEFRP--IVR............RIKRFTS-SVDKIESVA--GTILN
T1K467_TETUR/31-648------------------------------ENFQSCFGE--IKR............LMESLHL-DLTSMNQSC--LQTMN
B9S1S6_RICCO/31-692------------------------------LQFLQASNA--AQL............ALDRVEE-EVNSLAECC--DKIAK
G3J3T2_CORMM/115-739------------------------------GRILDDFST--VSE............QLRRIKT-ILDKLNTDY--SEMKR
G3B3F3_CANTC/135-733------------------------------SVFLKEFSP--MVK............QFRSMDN-KLTQLNKLS--DTNNE
COG6_PICGU/138-737------------------------------TQTLKEYQP--VIK............NLRKLEE-NVDALRSAS--MGVVD
U1G9I0_ENDPU/55-707------------------------------GAIVQDFGV--VVE............QLERVGT-MIADLNKTC--EEMRT
B7Q1K3_IXOSC/40-604------------------------------EQFLQSFGD--VKA............SLDALCT-DMSAMSTAC--QGMMA
F1A3Z4_DICPU/25-688------------------------------IEFLDQFNQ--LND............SINELIK-DFEEIKTGC--DDICN
A5DUD8_LODEL/174-816------------------------------TKMLKEYQP--ILR............HLKVIES-RLKKLNDLN--DEINT
C5FL60_ARTOC/56-718------------------------------GKIIQDFGR--VAE............QLTRISD-VIANLNTIC--QDMRS
X1WYM6_ACYPI/29-624------------------------------ENFLASFEK--VKN............AVNALHD-NVNSLNTSV--MSMSS
COG6_CHAGB/47-689------------------------------GEIIDEFAK--VAE............QLRRIGT-TIGRLNETF--NEMKT
T1EFP4_HELRO/53-656------------------------------EEFIGAFAV--VKE............QLDSIYK-DVEAINACC--QDMIS
G4V7Z1_SCHMA/35-648------------------------------QDLLTSFGD--VKK............RLDSLDT-CINSILETC--LRVNG
C1MX75_MICPC/28-699------------------------------REFLDASSN--ARD............ALSEVDA-QLDGLLAGC--QRISS
COG6_ASPCL/56-753------------------------------AEIVRDFGT--VAE............QLQRIGA-VISSLNQTC--EEMRQ
R9NZP8_PSEHS/106-778------------------------------DNIIAVLQT--VDN............GLVRLSD-DVAAMHASC--DAVQD
M7T0Y3_EUTLA/61-714------------------------------GEIIAEFGR--VAE............QLKRIGS-TIDKLNNSY--QGMKS
B3N2A1_DROAN/35-627------------------------------ENFLKAFRE--VKL............SLDAVCD-DLDKMATSV--ETMKS
G3AM15_SPAPN/147-779------------------------------SYVLKEYAP--LVR............QLKAIET-RLNQLNELN--RTTNE
COG6_DEBHA/142-759------------------------------GLMLKEYQP--VIK............NLSNLEN-DLKNLNGLR--DSITE
COG6_DICDI/25-671------------------------------IQFLDQFDQ--LNK............NINELVL-DFEGIKNSC--VDICD
D6WE56_TRICA/33-626------------------------------ENFLASFRE--VKL............CFDAVYN-DVSEMSKSI--QEMTH
K1Y0X5_MARBU/53-696------------------------------GDIIKEFSH--VAE............QLKRIGL-TIASLNQGC--EEMKR
R0IIQ7_SETT2/55-693------------------------------GEIISDFGH--VAE............QLKRIGT-AISSLNNYC--ADMRG
G2YFW1_BOTF4/53-688------------------------------GDIIREFGH--VAE............QLKRIGL-TIATLNQGC--EEMKR
B3RLZ3_TRIAD/43-642------------------------------EQFVDAFGK--VYT............SFNTLRS-EIEAMNESC--NQMTE
M2NAU2_BAUCO/56-695------------------------------GEIVRDFGK--VAE............QLQRIGA-SIQRLNDTC--TELRK
COG6_MAGO7/54-703------------------------------GEIIDEFGR--VAD............QLRRIGN-TLEKLNNSY--AEMKT
N1PID3_DOTSN/58-692------------------------------GEILHDFGR--VAE............QLKRIGS-AIANLNSSC--VEMRK
M7NMJ9_PNEMU/26-631------------------------------TKIIQEFEK--III............ELKTFKD-YISTIKNLT--NEMEK
G0WDG5_NAUDC/220-947------------------------------IIVLEEFKP--IVR............RIKRFSS-SVENISKIS--EQLID
U4LN57_PYROM/30-663------------------------------AQIIRDFSQ--VAE............QLTRIGT-ALDNMSNVV--SAMRI
F4NVM0_BATDJ/55-674------------------------------KEFLAAFDA--LHS............QLIGIES-HIDSIGNRC--EQMDI
Q6NMI3_ARATH/31-678------------------------------SEFLNAADS--TQI............ALDRVEE-EVNALADCC--DKIAA
A9SY28_PHYPA/31-697------------------------------EEFLRASES--AQK............ALDAVEL-EVAGLAECC--ERIAK
R4XC07_TAPDE/63-663------------------------------KTVLDDYRH--LVE............EMRLIKM-GLASMEAAC--DQMRV
COG6_CANGA/184-819------------------------------VTVLEDFKP--IVR............RIKRLAA-PVQQIENIG--EEILK
A0A088AU02_APIME/31-620------------------------------EEFLSAFRE--VKS............SLDGIYQ-DVLAMNNAV--QCMTN
M3AVJ9_PSEFD/47-684------------------------------GDIVHDFGT--LSE............QLRRIGL-AIANLNNSA--AEMRK
G8BSH8_TETPH/181-817------------------------------LSVLEAFKP--IVT............RIKTLSK-SLKNIEELG--NTVMD
V5EQK1_KALBG/40-699------------------------------DDIIRVLQT--VDD............GLVRLSS-DVAAMHTSC--NTVQD
COG6_YEAST/190-824------------------------------ITVLEEFKP--IIR............RIKRLSS-SVEKIQRTS--EKLLS
C4Y1K1_CLAL4/138-736------------------------------AAVLADYAR--PMR............GLRSLGD-QVAAMQQTV--EETGQ
C5DMM3_LACTC/169-799------------------------------LMILDDIQP--IVR............RIKRLSE-PVQNIHQMG--DALLK
J4VQT6_BEAB2/59-673------------------------------GKILDDFGF--VSD............QLRHIKV-VLEKLNADS--SKMKR
G8BDK2_CANPC/146-760------------------------------ATVLKEYQP--IVK............QLKHVEA-KLKKLNDLN--KQTND
A0A0C4DUI8_MAGP6/47-702------------------------------GQIINEFGR--VAD............QLRRIGS-TIEKLNKSY--AEMKS
COG6_ASHGO/167-791------------------------------LATLENFQP--IAR............RIMRLRQ-PVKNIQEIS--EKVLD
D8T0Q7_SELML/31-672------------------------------EEFLRASEA--AQK............ALDAVEL-EVAGLAESC--ERIAK
COG6_SCHPO/44-649------------------------------GSIIKELSE--LSS............QTLSVQS-QLLKVKNSI--DSYKN
A4S9H0_OSTLU/72-716------------------------------ERFLDESMR--ART............KLSQVEA-TLEALDGAR--ERMRT
M0TQE9_MUSAM/30-700------------------------------HHFLDASLA--AQQASISRYSLLLFFALDTVEE-EVNALAECC--DQIAK
E5ACR4_LEPMJ/80-720------------------------------GEIVKDFGQ--VAE............QLKRIGS-AITSLNSYC--SDMRS
Q6C1G5_YARLI/26-595------------------------------GEALKKFAP--LVA............QIQASGN-TIADLNHKF--TLMQQ
A0A0D2XVZ8_FUSO4/62-692------------------------------GEVIAEFGR--VAE............QLRRIKT-TIDKLNNGY--ADMKS
C5GW18_AJEDR/57-748------------------------------GKIVQDFSK--VAE............QLKRIGT-VISSLNNAC--EEMRR
C1EEF9_MICCC/30-686------------------------------REFLEASGQ--AQE............ALAVVDA-QLEGLLSGC--RRIAN
W1QBZ5_OGAPD/148-758------------------------------FQSLKKFHL--VVK............KLNVIKQ-DLDDLNSCY--DEIDG
A8HUT2_CHLRE/30-678------------------------------ERFIGAAES--VIK............ALDEVQR-SLDALSGSC--GAISG
B0VZV1_CULQU/39-627------------------------------ENFLAAFRE--VKL............ALDDICG-DIDAVSDSV--DSMKN
G0RKF7_HYPJQ/55-674------------------------------GEIVGEMGL--VAE............RLKDVRG-VVERLNSRI--QDMKR
Q00T18_OSTTA/88-728------------------------------ESFLDASLM--AQT............KLSQVEA-TLAALDGAR--ERMQR
COG6_CRYNJ/70-689------------------------------TKFLEAFAE--VDQ............KLNVLRE-HMQEMQVRC--DQVQS
A2E714_TRIVA/27-593------------------------------NRFIEQFSQ--LTT............TIDRVFT-TIDLLDKSC--DQMLT
L8G9L6_PSED2/56-700------------------------------GLVIKEFGH--VAE............QLRRIGQ-SIASLNQGC--EEMRR
S2JPX5_MUCC1/49-650------------------------------RKFLLAFEK--VVQ............QFERLET-QMGQMESVC--KDMEQ
G9PA30_HYPAI/22-644------------------------------GEIIEEMGS--VVE............RLKLIRG-LVEKVNSRI--EAIKR
COG6_PHANO/55-693------------------------------GEIVKDFGQ--VAE............QLKRIGT-AISSLNSYC--ADMRS
T5A889_OPHSC/60-688------------------------------GAIIDEFGH--VAE............QLRLIGT-TLGRMDAGY--DAIKS
G7XM19_ASPKW/58-742------------------------------AEIVRDFGL--VAE............QLKRIGT-VITNLNQTC--DEMRK
N4VJY2_COLOR/52-699------------------------------GHVVSHFGR--VAD............QLCRIGL-TLDKLNNNY--QQVQT
C4R6S3_KOMPG/154-788------------------------------FNFLKQLQP--LRK............TLGQIES-DLNEMNELN--NQITE
G8YLX1_PICSO/140-752------------------------------SLILKEYDP--HRK............KLYALES-DISKLNNIY--DSLTS
E1ZT97_CHLVA/34-681------------------------------EQFLEEAQG--VIK............MLDVVQG-DLDSLSACC--ESMGA
W1P048_AMBTC/29-693------------------------------EEFLLASEA--AQK............ALDRVEE-EVNVLDECC--DKIAK
A0A0D2VZS5_CAPO3/71-723------------------------------RELAASLGQ--VDA............ALDAAAQ-EVALMAACC--SQMTD
K7J084_NASVI/37-626------------------------------EEFIDAFKE--VKS............VLDNMHR-DVAGMNDCV--QSMTN
C5DUZ7_ZYGRC/192-819------------------------------LTVLEEFRP--IVR............RINRWSN-SVNNIKETG--QQLVE
V5HY00_BYSSN/58-733------------------------------GEIVKDFGK--VAD............QLQRIGT-VITSLNRTC--EEMRK
U9U8S1_RHIID/50-658------------------------------RNFLEIFGK--ITE............QLAVIES-EVKSMNTFC--NEIEK
I1FMS4_AMPQE/123-704------------------------------EEFRDLLGS--LAA............QIQDMQN-DVHSMRSCC--QDMQN
COG6_PICST/163-782------------------------------SLVLKEYQP--VIK............QLKVVED-RLSKLNDLN--KVTND
Q7QJN1_ANOGA/32-623------------------------------QNFLSAFKE--VKE............ALDGICD-DINSMSQSV--DSMKS
COG6_ASPOR/122-808------------------------------AEIVRDFGK--VAE............QLKRIGT-VITSLNQTC--DEMRK
I1H7V6_BRADI/77-734------------------------------RHFLDASLP--AHK............ALDRVEG-EVHALNDSW--KKIEE
F9XD71_ZYMTI/57-693------------------------------GEIVQDFGK--VAE............QLKRIGA-AIANLNSSC--VEMRR
J7S8L6_KAZNA/176-802------------------------------IIVLEEFRP--IVR............RIKRLST-SIENIRDVS--ESILP
COG6_CANAL/150-758------------------------------SNILKQYQP--IVK............QLKQIEV-KLNKLNELS--VQTND
F6SQE9_CIOIN/44-655------------------------------QQFADSFSL--LVK............DLECIHE-DVQAMSLCC--KDMTD
B9N0R1_POPTR/31-709------------------------------HEFLQASHT--AQQ............ALDHVEE-EVNALAECC--DNIAK
T1I707_RHOPR/34-617------------------------------ENFLSAFRK--VKE............RLDAIYE-DVIEMNFAV--QSMSQ
COG6_CAEEL/38-623------------------------------KEYLSEFEK--INN............IVQKFDE-LCVKMNSTC--TNLSK
F7BIB8_HORSE/4-604------------------------------EEFVSIFKE--VKE............ELESINE-DVQAMSNCC--QDMTS
COG6_NEUCR/64-712------------------------------GEIIHEFGK--VAE............QLKRIGY-TIGKLNESY--NDMRT
M3D478_SPHMS/53-688------------------------------GDIVHDFGK--VAD............QLNKIGN-AISNLQASC--VEMRK
G8JRN3_ERECY/172-797------------------------------LSVLEDFQP--IAR............KIKRLHK-PVERIQALG--QQLLE
R1EQ64_BOTPV/49-680------------------------------GDI......--...............QLRRVGT-AIQALNRCC--ADMRA
I2H727_TETBL/181-823------------------------------LLVLEEFKP--IAR............RIKRLTD-SVQTIRTLG--QSLTE

PF03081

B4LDS3_DROVI/323-697------------------------------RLLNWERAI--MR.------------......D-IIP......--.....
Q5KMS6_CRYNJ/301-670------------------------------HAAEGETML--AE.------------......S-LFP......--.....
J3MBU4_ORYBR/165-513------------------------------ALSEMQRQL--NQ.------------......N-DFEI.....--.....
G1XRU1_ARTOA/244-617------------------------------GIFSAEYDN--IQ.------------......R-LFK......--.....
W1PIG8_AMBTC/268-635------------------------------FILVSEKYL--CD.------------......Q-IFGD.....--.....
S0EBU7_GIBF5/246-629------------------------------GLFVSEYDN--VC.------------......S-VFS......--.....
K4BC35_SOLLC/279-644------------------------------IYLASEKWL--SD.------------......Q-IFSE.....--.....
K3XWI2_SETIT/155-495------------------------------VFRLRHREL--TV.------------......K-QV.......--.....
C5E0R8_ZYGRC/237-621------------------------------GFIANEKSF--VD.------------......D-LYVQ.....--.....
Q6ES92_ORYSJ/192-594------------------------------VLCITQLEL--RAK------------KP.TVA.-.GVRRAIQF--FLLRR
Q9SIB0_ARATH/210-552------------------------------TLFSGEQIL--SD.------------......H-VFSSS....--.....
Q9LQP9_ARATH/238-587------------------------------TLFNGERIL--SD.------------......H-IFS......--.....
F6GST9_VITVI/277-640------------------------------VLLWGEKRL--CD.------------......Q-AFSG.....--.....
G8ZSY9_TORDC/245-624------------------------------GFVANEKSL--VD.------------......D-LYLQ.....--.....
I1LFL8_SOYBN/224-593------------------------------VLFNAEQRL--YD.------------......S-IFPN.....--.....
M4F3N2_BRARP/219-571------------------------------NLFDGERIL--CD.------------......H-VFST.....--.....
W1NW13_AMBTC/231-604------------------------------LLFASERLL--CE.------------......S-VFEG.....--.....
M0SRF8_MUSAM/218-582------------------------------DFLARERHL--CN.------------......L-VFGKL....--.....
J7REJ7_NAUDC/235-618------------------------------GFIANEKSL--VN.------------......D-LYSQ.....--.....
D2UX81_NAEGR/218-569------------------------------KLLESERKI--AL.------------......K-VVSV.....--.....
M4DQ92_BRARP/206-564------------------------------TLFNGERIL--CD.------------......R-IFSTSSS..--.....
K3Z4M7_SETIT/235-602------------------------------LLFAAERKL--CD.------------......Q-IFEG.....--.....
B9S3S8_RICCO/351-722------------------------------IYFSKERKL--AE.------------......A-VFSD.....--.....
B7P4G4_IXOSC/289-655------------------------------KLMQSERTL--LQ.------------......Q-VLGSA....--.....
F6H2V1_VITVI/283-641------------------------------HLFEAEYKL--CN.------------......D-VFERI....--.....
Q9FNR3_ARATH/273-622------------------------------VYLASEKQL--CD.------------......Q-ILGD.....--.....
M0THS1_MUSAM/243-589------------------------------TLFHGEHVL--LD.------------......H-VFAG.....--.....
C5XNX2_SORBI/186-525------------------------------ILIPSERHL--CN.------------......C-IFEE.....--.....
A7TQI9_VANPO/237-621------------------------------GFISNEQSL--VD.------------......D-LYVQ.....--.....
K3XFC8_SETIT/312-653------------------------------FLGEIQKQL--NG.------------......Q-DLGY.....--.....
E9G2G2_DAPPU/324-689------------------------------RLLQSELRL--ML.------------......G-IVP......--.....
M4ELV2_BRARP/227-592------------------------------TLFKGEKIL--CD.------------......H-VFEA.....--.....
D7MQ70_ARALL/301-664------------------------------VLLVGEKKI--CD.------------......E-IFSS.....--.....
M4E3U0_BRARP/64-418------------------------------LFFPGEFKL--AE.------------......K-IFP......--.....
C5E318_LACTC/234-618------------------------------GFIANEYMF--TE.------------......D-ILAK.....--.....
M0RFS4_MUSAM/240-598------------------------------ILVPSERRL--CD.------------......R-VFAS.....--.....
M0S9N6_MUSAM/277-655------------------------------LLFAEERKI--CD.------------......Q-IFYG.....--.....
J3MUP3_ORYBR/158-521------------------------------TLLAGERRL--CD.------------......E-VFAS.....--.....
B9I6L2_POPTR/266-620------------------------------ILFPSERRL--CD.------------......R-VFYG.....--.....
E4X2L8_OIKDI/306-653------------------------------RLADREIRV--AQ.------------......E-VLP......--.....
D7MSH8_ARALL/228-592------------------------------SLFFGERIL--AD.------------......H-VFAS.....--.....
B9IK77_POPTR/253-654------------------------------VYLASDKRL--SE.------------......Q-IFGE.....--.....
M0RET8_MUSAM/246-597------------------------------TLFHGERVL--LD.------------......H-VFAG.....--.....
A9RYU9_PHYPA/273-621------------------------------LLFSAERML--CD.------------......Q-IWAR.....--.....
Q69JW6_ORYSJ/346-696------------------------------VLTEMRRQL--HK.------------......Q-NFGA.....--.....
M1AX18_SOLTU/275-644------------------------------VYLASEKWL--SD.------------......Q-IFGEL....--.....
M0ZQS8_SOLTU/207-577------------------------------TLFLAERRL--GE.------------......S-VFSA.....--.....
B8MLJ7_TALSN/245-625------------------------------GFIVVEHEG--IV.------------......R-IFT......--.....
I1I8W2_BRADI/260-643------------------------------TLMAGERLL--CA.------------......E-VFASDS...--.....
K7M841_SOYBN/188-545------------------------------IMFPNERRL--SN.------------......I-VFSG.....--.....
M7S7Y8_EUTLA/245-627------------------------------GIFLAEHEN--IC.------------......S-IFL......--.....
I1MUP7_SOYBN/290-649------------------------------VLLSGEKRL--CD.------------......G-LFGD.....--.....
I1LR33_SOYBN/232-587------------------------------TLFHGERIL--CD.------------......H-VFASD....--.....
Q9LIA2_ARATH/266-643------------------------------VYLLSEKSL--DN.------------......Q-IFGD.....--.....
I1MBG5_SOYBN/274-630------------------------------ILFPSERRL--CD.------------......R-VFFG.....--.....
M2MJA4_BAUCO/246-630------------------------------GMYTAEYDN--IC.------------......H-VFS......--.....
B9RAG8_RICCO/276-630------------------------------VLLTGEKRL--CD.------------......H-IFSG.....--.....
U7Q7I3_SPOS1/370-767------------------------------GMFLAEHEN--IC.------------......S-IFT......--.....
Q5TQS7_ANOGA/318-703------------------------------KLLVWERQL--LN.------------......D-IVP......--.....
E0VIX9_PEDHC/327-689------------------------------KLIQNERNL--MV.------------......G-IIP......--.....
EXO70_KLULA/234-616------------------------------GFIANENSL--IQ.------------......D-LYSK.....--.....
D8RZH2_SELML/269-629------------------------------VLFASERQL--CD.------------......Q-VFEGI....--.....
B9HPL3_POPTR/209-568------------------------------TLFYGERVL--SD.------------......H-VFSS.....--.....
M7PEF2_PNEMU/241-608------------------------------GMFKSESLI--IR.------------......D-VFP......--.....
C4LW49_ENTHI/279-679------------------------------SLFQNERIF--QQ.------------......D-ILQ......--.....
I1JCY6_SOYBN/322-699------------------------------VWFPGEWRL--AE.------------......S-VFGEEKEQD--.....
D6WW45_TRICA/328-692------------------------------KLMQIEQAL--IK.------------......G-IIA......--.....
B6K881_SCHJY/235-604------------------------------RLLPLEANE--LI.------------......E-IYG......--.....
F0XF34_GROCL/729-1128------------------------------GMFLSEYDS--IC.------------......S-VFT......--.....
D8SPE6_SELML/233-605------------------------------VLFASERFL--SD.------------......E-VFAV.....--.....
M0REN0_MUSAM/218-570------------------------------IIFASERRL--CE.------------......H-IFEG.....--.....
E0CP16_VITVI/299-657------------------------------TVLVSEKKL--CK.------------......Q-VLSGI....--.....
K3Y3Q0_SETIT/194-605------------------------------VLCITQMEL--RAN------------R...PAA-IGVRKAIRY--FML..
B9HV40_POPTR/282-631------------------------------QVFETEYKL--CS.------------......D-VFEKN....--.....
J3MH82_ORYBR/80-438------------------------------HLLEAERKL--CV.------------......A-VFER.....--.....
B9GVY9_POPTR/242-613------------------------------ILFASEKQL--CE.------------......E-IFYGI....--.....
M7UD48_BOTF1/247-635------------------------------GAFLAEYDN--IC.------------......A-LFT......--.....
W1PWG9_AMBTC/231-597------------------------------TLFAGERIL--CD.------------......H-VFAS.....--.....
N1J6U6_BLUG1/243-631------------------------------SSFLAEYEN--IC.------------......A-LFP......--.....
K3XSA8_SETIT/229-593------------------------------VYLASEKRL--SN.------------......H-IFGEL....--.....
B9SNP4_RICCO/271-635------------------------------VYLASEKWL--AE.------------......Q-ILGE.....--.....
M1CZG7_SOLTU/225-591------------------------------TLFYGERIL--CD.------------......Q-VFSI.....--.....
Q9C8H6_ARATH/254-623------------------------------EIYEFESKL--CY.------------......D-VFEDI....--.....
H2ZQN6_CIOSA/276-638------------------------------KLIVVEQDM--MQ.------------......S-VIP......--.....
K3XFW5_SETIT/237-577------------------------------AIVAMRRQL--HAQ------------TPGAFDS-.........--.....
A9TGT7_PHYPA/278-635------------------------------VLFSSEKQL--CD.------------......E-VFP......--.....
M1W138_CLAP2/246-628------------------------------AIFLSEYDN--IC.------------......S-IFR......--.....
A5B8C4_VITVI/267-614------------------------------ILFPSERRL--CD.------------......R-VFFG.....--.....
S3E3U8_GLAL2/246-630------------------------------GAFLAEYDN--IC.------------......A-LFS......--.....
B9T041_RICCO/247-608------------------------------TLFNGEKAL--CD.------------......H-VFSA.....--.....
H6CBM6_EXODN/248-636------------------------------AMFLAEAEN--TS.------------......R-VFR......--.....
I1JWP0_SOYBN/263-614------------------------------VYLVSEKRL--CK.------------......Q-VLGD.....--.....
F4KG58_ARATH/222-573------------------------------LLFAAEKEI--CH.------------......Q-ILDG.....--.....
F6GTU7_VITVI/230-591------------------------------TLFYGERIL--CD.------------......R-VFSA.....--.....
M4CLF8_BRARP/249-615------------------------------TLFKGEKLL--CD.------------......H-VFSA.....--.....
W5EWA8_WHEAT/175-531------------------------------.LLDGERKI--CD.------------......E-VFEG.....--.....
I1MDK3_SOYBN/222-572------------------------------TLFHGEKTL--CD.------------......Y-VFGSP....--.....
M1CA15_SOLTU/267-620------------------------------FYLPSEKNL--FD.------------......Q-ILCE.....--.....
C4R8N1_KOMPG/235-620------------------------------SFITNENAF--YE.------------......E-LFESSR...--.....
Q8VY27_ARATH/245-606------------------------------TLFRGEKLL--CD.------------......H-VFSA.....--.....
Q0CYR3_ASPTN/219-599------------------------------NFIYTEHDI--IS.------------......R-IFT......--.....
U9SQP1_RHIID/236-607------------------------------KMFKTEYEI--AE.------------......K-ILP......--.....
EXO70_EMENI/247-629------------------------------NFIYAEWEA--IK.------------......R-IFT......--.....
S2J047_MUCC1/214-590------------------------------KMLESEYKF--AQ.------------......Q-IMGN.....--.....
J3L5F1_ORYBR/344-686------------------------------ILIPSERHL--CD.------------......C-IFEG.....--.....
K0KAQ4_WICCF/235-607------------------------------GFLSNEYAL--LE.------------......S-ILNE.....--.....
M0W8E8_HORVD/215-574------------------------------TLLAGERRL--CD.------------......E-VFAS.....--.....
R8BPV7_TOGMI/250-634------------------------------GLYLAEYDN--IC.------------......S-IFM......--.....
K3ZHK2_SETIT/304-675------------------------------ADLPGERDL--CA.------------......R-VFAS.....--.....
M0TX18_MUSAM/52-414------------------------------ILFSRERLL--CD.------------......R-IFAG.....--.....
K4CMD0_SOLLC/278-635------------------------------HLLEAEYKL--CN.------------......D-VFDRF....--.....
G3JCP3_CORMM/249-631------------------------------GIFVAEYEN--VC.------------......S-IFS......--.....
Q6K647_ORYSJ/301-673------------------------------VLLAGERRL--CD.------------......Q-VLSV.....--.....
J3N6B0_ORYBR/11-377------------------------------VGLSGEHDL--CA.------------......R-VFAGC....--.....
C5FN52_ARTOC/246-625------------------------------GMFIAEYEN--II.------------......K-IFP......--.....
J7R1E6_KAZNA/236-614------------------------------GFIANERSL--VN.------------......D-LYSQ.....--.....
EXOC7_DICDI/437-835------------------------------RLYQIEYDL--AS.------------......E-LF.......--.....
K1X101_MARBU/264-643------------------------------GSFLAEYEN--IC.------------......G-LFS......--.....
W1NJ63_AMBTC/264-632------------------------------VFFPSEKLL--CD.------------......R-VFANLSLSS--PCVSL
G0S641_CHATD/252-645------------------------------GLFSAEYDN--IC.------------......N-IFT......--.....
D5GH85_TUBMM/239-604------------------------------AIFEAEYEN--IC.------------......Q-LFP......--.....
A9SN89_PHYPA/313-674------------------------------ILYAGEKRL--AR.------------......E-VFKFV....--.....
J9JWJ5_ACYPI/326-687------------------------------KLMQAELSL--MV.------------......G-IIP......--.....
W5AN73_WHEAT/1073-1426------------------------------GLLAEERHI--CS.------------......Q-IFTA.....--.....
W1PHH8_AMBTC/279-635------------------------------HLFEAEYKL--CN.------------......D-VFEKI....--.....
U5H6T1_USTV1/251-633------------------------------GLLKSEYAL--LS.------------......T-VFANV....--.....
S7ZDA9_PENO1/246-625------------------------------AFIVAEHGV--IV.------------......Q-IFP......--.....
K2RHI9_MACPH/246-628------------------------------GLFIAEYEN--IC.------------......P-IFA......--.....
F6HQX6_VITVI/246-608------------------------------TLFTGERIL--CD.------------......H-VFAA.....--.....
I1NUS0_ORYGL/283-640------------------------------GLLAEERRI--CN.------------......Q-IFAA.....--.....
M4AQR1_XIPMA/327-700------------------------------KLAQSEYAL--LT.------------......E-IIP......--.....
M7XH50_RHOT1/276-657------------------------------ALAKSEHAL--LG.------------......T-VFASL....--.....
K4DFQ8_SOLLC/257-617------------------------------YLLDTEHRL--CV.------------......E-VFRKA....--.....
D7LD39_ARALL/243-607------------------------------TLLRGEKLL--CD.------------......H-VFSA.....--.....
E3S143_PYRTT/247-623------------------------------GLFVAEFDN--LN.------------......Y-VFD......--.....
E7LW76_YEASV/236-620------------------------------GFIANEKSL--VD.------------......D-LYSQ.....--.....
M3APZ2_PSEFD/248-629------------------------------GMIVAEYDN--IC.------------......S-IFQ......--.....
T5A733_OPHSC/248-627------------------------------GIFLSEYNN--VC.------------......C-IFT......--.....
U5CZ65_AMBTC/305-668------------------------------TVFESEKKL--CQ.------------......Q-VFNNI....--.....
Q0U449_PHANO/247-623------------------------------GIFVAEYDN--IT.------------......N-IFP......--.....
I1Q027_ORYGL/148-486------------------------------VFRLRHREA--RNP------------ANETAAA-QL.......--.....
M1CE10_SOLTU/253-614------------------------------ILFPSERRL--CD.------------......R-VFFG.....--.....
M0U7Y4_MUSAM/169-538------------------------------TLFSGERVL--SD.------------......H-VFAS.....--.....
EXO70_ASHGO/231-611------------------------------TFVSGVSVL--ID.------------......D-VFVK.....--.....
G2XG72_VERDV/248-627------------------------------GLFLAEYEN--IC.------------......N-LFN......--.....
J3M2U7_ORYBR/269-636------------------------------LLFGSECML--CD.------------......Q-VFGR.....--.....
L8G7J8_PSED2/268-651------------------------------GAYIAEHEN--VC.------------......A-LFA......--.....
M4CEA6_BRARP/229-593------------------------------KLFFGERIL--AD.------------......H-VFSS.....--.....
A9SZG5_PHYPA/276-645------------------------------VLFASEKQL--CD.------------......Q-VFA......--.....
EXO70_YARLI/228-600------------------------------KMLQAEHDN--LR.------------......C-AFPK.....--.....
A0A0D1CBV0_USTMA/294-724------------------------------GMLDNDYRI--LQ.------------......G-LMTSAEL..--.....
M0TA71_MUSAM/314-686------------------------------VAFPREHDL--CE.------------......A-VFAG.....--.....
I1N4J9_SOYBN/299-665------------------------------VYLASERWL--SD.------------......Q-IFGE.....--.....
A0A068X0P1_HYMMI/337-709------------------------------ILTNREQLL--LD.------------......R-LNLAA....--.....
M3J203_CANMX/209-599------------------------------TEIHDELEL--LN.------------......V-CE.......--.....
K3ZZ59_SETIT/223-607------------------------------GVFASERRL--CF.------------......H-IFHDLPLCS--S....
F9XKX9_ZYMTI/246-627------------------------------GMYTAEYDN--IC.------------......P-VFS......--.....
B9RM96_RICCO/288-654------------------------------ILFPSEQKL--CD.------------......S-IFSE.....--.....
D7L2C4_ARALL/228-595------------------------------VVFSSEKRL--CE.------------......Q-LFDGI....--.....
K7KYU0_SOYBN/278-635------------------------------QLLETECRL--SA.------------......I-VFEKI....--.....
D7KZD8_ARALL/246-616------------------------------VVFASEKLL--CE.------------......H-VFESV....--.....
U5FM28_POPTR/271-621------------------------------VYLASEKRF--CN.------------......Q-ILGD.....--.....
W5AKS6_WHEAT/499-852------------------------------GLLAEERRI--CN.------------......Q-IFAA.....--.....
S9VZ38_SCHCR/246-609------------------------------RILSATATE--LL.------------......H-LYD......--.....
R7YPE8_CONA1/246-628------------------------------GLYVTEYEN--VR.------------......A-VFT......--.....
M1C7K5_SOLTU/253-615------------------------------ILFNGERIL--CD.------------......H-VFLS.....--.....
E9EGW9_METAQ/241-624------------------------------AIFLSEYDN--IC.------------......S-IFK......--.....
G8YBT4_PICSO/212-624------------------------------RELKAQNSR--LQ.------------......D-IGNEIG...--.....
M0RE29_MUSAM/266-621------------------------------VI.SAERQL--CE.------------......Q-ILAG.....--.....
F6H486_VITVI/271-637------------------------------VYLASEKWL--SD.------------......Q-VFGE.....--.....
W1PQ65_AMBTC/301-663------------------------------VLLSGEKNL--LE.------------......K-VFEY.....--.....
T1K8E7_TETUR/311-683------------------------------RLMKAELEL--ME.------------......G-LMEGV....--.....
J3MTK1_ORYBR/52-443------------------------------GGFASERRL--CF.------------......L-IFHDLPISN--ITV..
I2H140_TETBL/236-622------------------------------GFVAIESTL--VD.------------......D-LFSQ.....--.....
M3DCX2_SPHMS/245-628------------------------------GMVVAEYDS--IC.------------......P-VFQ......--.....
I1N7V8_SOYBN/316-682------------------------------VYFPGERKL--AE.------------......A-VFAS.....--.....
K3YBY1_SETIT/269-627------------------------------VLLPGERKN--CD.------------......Q-IFDG.....--.....
G7YLN0_CLOSI/142-557------------------------------KFMQNERRW--LE.------------......R-LQLTS....--.....
J3L4D1_ORYBR/230-594------------------------------VYLASEKRL--SN.------------......H-VFGEL....--.....
R4XBR7_TAPDE/254-624------------------------------RMSQSERSL--CI.------------......V-LFG......--.....
A9RF66_PHYPA/295-650------------------------------VLYAGERRL--AR.------------......Q-VFKDM....--.....
A2FJ22_TRIVA/250-590------------------------------FFYKRERAF--AL.------------......A-VFG......--.....
I1MBG8_SOYBN/93-437------------------------------ILFPSERRL--CD.------------......C-IFSR.....--.....
J3NNQ2_GAGT3/246-625------------------------------GLFLAEYEN--IT.------------......S-IFS......--.....
M4CAS6_BRARP/212-578------------------------------TLFNGEKTL--CD.------------......E-VFEGC....--.....
G8JUD2_ERECY/232-611------------------------------TFLGNESAL--IT.------------......E-LYGK.....--.....
G8B940_CANPC/213-611------------------------------NVLKEEVLV--LK.------------......Q-CS.......--.....
K4ATI3_SOLLC/271-650------------------------------TLFPGEKRL--GD.------------......S-VFSE.....--.....
K4D380_SOLLC/270-630------------------------------LLFAAEKKV--SD.------------......Q-IFEG.....--.....
K4DB07_SOLLC/238-600------------------------------TLFHGEKIL--CD.------------......H-VFSA.....--.....
EXO70_NEUCR/252-636------------------------------GLFLAEYDN--IC.------------......S-IFM......--.....
A8XF23_CAEBR/262-600------------------------------SLLELEEKL--MV.------------......R-AIPD.....--.....
M4E1D8_BRARP/269-620------------------------------LLFAAEKKI--CD.------------......Q-ILDG.....--.....
M0TCN3_MUSAM/206-567------------------------------TIFSGERLL--CD.------------......R-VFAS.....--.....
D7KLE4_ARALL/242-609------------------------------VVFASEKRL--CE.------------......Q-IFE......--.....
K3Y1F3_SETIT/202-606------------------------------VLRITQLDL--RAK------------.....KK-PAAGNGIWH--FML..
J3MD06_ORYBR/268-610------------------------------IVFPEERQA--CT.------------......Q-IFGS.....--.....
A9S026_PHYPA/305-661------------------------------MLYTGERRL--AR.------------......Q-VFKNV....--.....
W1QJT2_OGAPD/249-609------------------------------SLLYGEPHF--LS.------------......K-FFDD.....--.....
E2BW20_HARSA/356-713------------------------------KLMQAERTL--VA.------------......R-ILP......--.....
K4BUL3_SOLLC/313-670------------------------------NVFVSEKKL--CC.------------......Q-VLGTV....--.....
A5E7C7_LODEL/213-654------------------------------QALHNEYSV--LK.------------......Q-CL.......--.....
EXO70_CANGA/235-620------------------------------GFIANERSL--ID.------------......D-VFSQ.....--.....
C4Y3V1_CLAL4/216-602------------------------------LYAKSVSTV--CE.------------......E-LR.......--.....
U4LH75_PYROM/239-603------------------------------AIFDAEYEN--IC.------------......H-LFP......--.....
D7LJN0_ARALL/216-574------------------------------NLFEGERIL--CD.------------......H-VFSP.....--.....
K4BJZ5_SOLLC/284-648------------------------------ILLSAEKSL--CD.------------......Q-VFGD.....--.....
C5MG62_CANTT/215-605------------------------------NEVGQEVNL--LR.------------......S-CN.......--.....
EXO70_CANAL/230-665------------------------------GEIEQELII--LN.------------......E-CQ.......--.....
M4DQX8_BRARP/251-599------------------------------EVYEFESNL--CN.------------......E-VFKDVG...--.....
A0A0D2X486_CAPO3/367-717------------------------------RQMKAERVL--AQ.------------......R-VLP......--.....
F6HBV2_VITVI/280-635------------------------------NLLELEYQL--CN.------------......D-VFEKI....--.....
I1JPF3_SOYBN/247-610------------------------------TLFNGERIL--CD.------------......H-VFSY.....--.....
M4D183_BRARP/85-443------------------------------HLFEAEFKL--CN.------------......D-VFERF....--.....
F6HRR9_VITVI/232-595------------------------------TLFNGERVL--CD.------------......H-VFSA.....--.....
B9RLN4_RICCO/271-620------------------------------GYLASEKRL--CD.------------......Q-ILGE.....--.....
F6WWX5_CIOIN/361-724------------------------------KLFVVEQSM--IQ.------------......S-VIP......--.....
I1IU67_BRADI/277-636------------------------------HLLAGERKI--CD.------------......Q-VFDC.....--.....
A3LWD2_PICST/218-611------------------------------NVIENELRL--LK.------------......E-LN.......--.....
U5GI23_POPTR/267-628------------------------------VYLASEKCL--SE.------------......Q-IFGD.....--.....
G3B334_CANTC/207-579------------------------------NLLEKEYEL--LE.------------......R-LD.......--.....
B9HCA8_POPTR/242-605------------------------------TLFFGERFL--CD.------------......H-VFAV.....--.....
A9S081_PHYPA/264-622------------------------------LLFSAERKL--CD.------------......Q-IWYH.....--.....
M0RMY7_MUSAM/168-542------------------------------VVFASERRL--CE.------------......L-VFD......--.....
K1R8N3_CRAGI/240-606------------------------------KLIQSEAQL--MS.------------......G-IIA......--.....
M0TDJ2_MUSAM/228-592------------------------------VCLARERHL--CD.------------......L-VFGEL....--.....
A9SEA0_PHYPA/286-643------------------------------VLFASEKQL--CD.------------......E-LFP......--.....
K3XX39_SETIT/77-423------------------------------TVLPEERRA--CA.------------......H-IFGC.....--.....
K7UV86_MAIZE/134-473------------------------------VFRLRHQKL--KA.------------......A-HV.......--.....
M1BSP6_SOLTU/313-684------------------------------VLFSSERKL--AD.------------......A-VFED.....--.....
U1GTL6_ENDPU/245-629------------------------------GMITAEADN--VS.------------......K-IFP......--.....
H2AMI9_KAZAF/241-641------------------------------GFIANEKSL--ID.------------......D-IYSQ.....--.....
A9SHU0_PHYPA/294-653------------------------------VLYASEKQL--CE.------------......Q-VLGKV....--.....
M0X2R1_HORVD/229-589------------------------------VYLASERRL--SS.------------......L-VFGDL....--.....
B9SQM4_RICCO/281-628------------------------------HVFKIEYEL--CN.------------......K-VFDKV....--.....
C5YI28_SORBI/233-588------------------------------TFLADERRL--CD.------------......E-VFAS.....--.....
G2Q2Y8_MYCTT/252-644------------------------------GLFVAEYEN--IC.------------......N-IFT......--.....
B9GMP7_POPTR/287-658------------------------------VLFSGERKL--CS.------------......S-IFSE.....--.....
D8QQ88_SELML/278-638------------------------------LLFAAERKT--CD.------------......Q-VFYR.....--.....
I1IU36_BRADI/316-680------------------------------VGLSTEHDL--CL.------------......R-VFS......--.....
Q7XVB9_ORYSJ/303-673------------------------------SLLTGERRI--CD.------------......Q-VLAV.....--.....
M0T4W9_MUSAM/300-646------------------------------ASFAAERDL--CE.------------......A-VFAG.....--.....
C5Y540_SORBI/271-624------------------------------LLLAGERKI--CD.------------......Q-IFDG.....--.....
Q6YYS2_ORYSJ/156-522------------------------------VLNITLLEL--PLP------------VAGSTER-MAA......--.....
S3C6C9_OPHP1/275-678------------------------------GMFLAEYEN--IC.------------......S-IFT......--.....
A0A0E0PVZ0_ORYRU/61-408------------------------------TVLPEERQA--CT.------------......Q-IFGS.....--.....
D8T120_SELML/259-622------------------------------LLFAAEWKL--CN.------------......Q-VFDG.....--.....
L0PB59_PNEJ8/240-610------------------------------GMLKAESTI--AQ.------------......N-IFP......--.....
G0V7P9_NAUCC/234-618------------------------------GFMANEKSL--VD.------------......D-LYSQ.....--.....
S8BBP5_DACHA/239-612------------------------------GIFTAEYEN--IK.------------......S-LFS......--.....
N1PXJ6_DOTSN/246-630------------------------------GMYIAEYDS--TC.------------......P-VFQ......--.....
F6I1N2_VITVI/270-640------------------------------ILFPGERRF--AE.------------......S-VFED.....--.....
M0UL49_HORVD/11-372------------------------------LLFAGERQL--CD.------------......Q-VFEC.....--.....
F0ZNQ9_DICPU/422-793------------------------------RLYQIESDL--AS.------------......E-FF.......--.....
D7L7W1_ARALL/228-598------------------------------TLFNGEKSL--CD.------------......D-IFES.....--.....
M0SVR7_MUSAM/268-627------------------------------HLFEAEFKV--CI.------------......E-VFERA....--.....
M1C5W1_SOLTU/259-619------------------------------TLFYGERFL--CD.------------......H-VFST.....--.....
C5XFH3_SORBI/239-578------------------------------AIVAMRRQL--YAQ------------NPGAFDG-.........--.....
K7LHG0_SOYBN/296-660------------------------------TLFAGERIL--CD.------------......H-VFGA.....--.....
M0UGE8_HORVD/125-479------------------------------TILPEERNS--CA.------------......Q-IFGC.....--.....
B9T911_RICCO/241-598------------------------------TLFYGERIL--CD.------------......H-VFSA.....--.....
A5DE46_PICGU/208-600------------------------------ESIKLEIAL--AA.------------......E-INQN.....--.....
A2DS47_TRIVA/252-593------------------------------FFFKREKEF--AK.------------......K-VFG......--.....
U5CSC4_AMBTC/276-637------------------------------LLFTGERKV--CD.------------......Q-IFEG.....--.....
M0T8R9_MUSAM/272-640------------------------------ALLWGERRL--CD.------------......Q-ILAA.....--.....
M0T1U3_MUSAM/274-635------------------------------LLFAWEREL--CN.------------......Q-IFEG.....--.....
G8BXH6_TETPH/237-621------------------------------GFISNEQSL--ID.------------......D-LYGQ.....--.....
E9D819_COCPS/246-624------------------------------GMFAAEYES--VV.------------......S-IFP......--.....
Q9LMJ4_ARATH/247-592------------------------------VFFPSERLL--CD.------------......R-VFSDL....--.....
D7L7W0_ARALL/233-602------------------------------TLFKGEKIL--CD.------------......H-VFES.....--.....
E70B1_ARATH/265-614------------------------------ILFPSERRL--CD.------------......R-VFFG.....--.....
E3Q9K9_COLGM/252-632------------------------------GLFLAEYDN--IC.------------......S-IFT......--.....
F6GSY9_VITVI/271-629------------------------------VYLASEKRL--CD.------------......H-ILGD.....--.....
G1MYP9_MELGA/336-701------------------------------KLAQSEYQL--LT.------------......E-IVP......--.....
D7M573_ARALL/269-636------------------------------VLFPGELSL--CN.------------......A-VFPDQ....--.....
E1Z8T0_CHLVA/286-659------------------------------.LAQEEARL--CA.------------......A-VFP......--.....
B9GF67_POPTR/330-700------------------------------IYFVKELKL--AE.------------......A-IFSN.....--.....
G4MVD0_MAGO7/250-629------------------------------RLFQAEYEN--IT.------------......R-IFS......--.....
G9MGQ5_HYPVG/255-640------------------------------GIFIAEYDN--IC.------------......S-IFT......--.....
W1PMJ7_AMBTC/280-638------------------------------FYFPSEQRL--CE.------------......E-VFGK.....--.....
U5FZC2_POPTR/63-424------------------------------TLFSGEKAL--CD.------------......H-VFSA.....--.....
W5BVL2_WHEAT/184-551------------------------------LLFPSERAL--CD.------------......Q-IFEG.....--.....
EXO70_SCHPO/249-608------------------------------RLLPAVASE--LL.------------......L-LFD......--.....
B9R6Z3_RICCO/301-666------------------------------IVFLSEKKL--SN.------------......Q-ILGGI....--.....
B9SF67_RICCO/265-616------------------------------ILFPSERRL--CD.------------......R-VFFG.....--.....
K4C312_SOLLC/207-568------------------------------ALFRGERIL--CN.------------......Y-VFSS.....--.....
A9T7C4_PHYPA/238-605------------------------------ALLASEKHL--CE.------------......S-VFANA....--.....
K7LIX4_SOYBN/109-470------------------------------LLFAAERKV--CD.------------......Q-IFEG.....--.....
M7ZQD7_TRIUA/1206-1561------------------------------GLLPEERRI--CN.------------......Q-IFAA.....--.....

PF04100

VPS53_HUMAN/39-453------------------------------TLFPTE-----QS-------------------L-AN------I--DEVV.
Q9VQY8_DROME/42-434------------------------------QLFPNE-----QS-------------------L-AG------I--DETI.
VPS53_SCHPO/16-394------------------------------ELLPED-----IT-------------------Y-DD------L--GSLRL
VPS53_YEAST/5-369------------------------------NILFSK-----ES-------------------L-NN------I--DELIS
VPS53_CAEEL/30-390------------------------------ELFPTE-----QS-------------------L-TQ------L--DSII.
VP53A_ARATH/1-424------------------------------QMFPTE-----AS-------------------L-TG------V--EPLM.

PF10475

Q7QF78_ANOGA/99-388------------------------------RKLSESGQL--LD-------------------C-GS......I--EQSM-
Q336V4_ORYSJ/131-419------------------------------QSIPAEG.D--SS-------------------Y-........F--DKQS-
Q54MU4_DICDI/72-370------------------------------DLLPPN...--VN-------------------N-SSSEFSIFL--DSNV-
VPS50_CHICK/54-327------------------------------ERLPPV...--LS-------------------L-QE......L--EEYR-
Q16RR9_AEDAE/70-360------------------------------KKLSETDEL--LN-------------------C-QC......I--EKAM-
A1ZAY8_DROME/75-362------------------------------KKVLNDG..--ID-------------------N-EL......I--EVTI-
Q54NV0_DICDI/113-401------------------------------QNIPKD...--AP-------------------I-DT......I--DALT-
Q8RXC2_ARATH/132-421------------------------------ENVPDDESE--LA-------------------Y-........F--EKQA-
Q18602_CAEEL/76-363------------------------------KKLCDIE..--MC-------------------Y-ED......I--QRER-
A8XSD2_CAEBR/80-367------------------------------KKLCDID..--MC-------------------Y-ED......I--QRER-

PF04048

SEC8_SCHPO/51-191------------------------------EDYQPIS----TA-------------------L-EL------L--DDSSF
Q69PQ1_ORYSJ/22-158------------------------------DSLPHVV----HI-------------------L-TS------K--DREG.
Q59NP0_CANAL/27-168------------------------------EDANPIE----MA-------------------V-AL------L--DDTSV
A5E514_LODEL/26-167------------------------------SNANPIE----VA-------------------V-AF------L--DDTSV
Q6BLA3_DEBHA/30-171------------------------------ENANPIE----MA-------------------V-SL------L--DDTSV
A5DKL1_PICGU/29-170------------------------------SKTNPID----LA-------------------V-SL------L--DRSSV
A3LUX9_PICST/29-170------------------------------EDANPIE----VA-------------------V-AL------L--DDTSV
Q75B87_ASHGO/33-174------------------------------KDANPLE----LA-------------------L-QF------L--DDTSV
Q6CNM5_KLULA/34-175------------------------------KDTNPLE----LA-------------------L-RF------L--DETSV
A7TRV6_VANPO/35-176------------------------------NDSNPLE----LA-------------------L-KF------L--DETSV
Q6FWA6_CANGA/35-176------------------------------EDSNPLE----LA-------------------L-AF------L--DDTSV
Q6C3L8_YARLI/34-175------------------------------DNANILE----VS-------------------L-SL------M--DTSSI
Q4WUD2_ASPFU/134-275------------------------------DDCVPVQ----VA-------------------L-QL------M--DTSTL
SEC8_NEUCR/82-223------------------------------TDCIPVQ----LA-------------------L-QL------L--DTSSV
A0A0D1E3Z5_USTMA/441-580------------------------------DQFNSVA----LA-------------------L-SM------L--DESSL
E7M1P6_YEASV/34-174------------------------------DNTNPLE----LA-------------------L-AF------L--DDTSV
SEC8_ARATH/16-151------------------------------DSLPHVV----HI-------------------L-TS------K--DREA.

PF06046

Q28ZN5_DROPS/179-731------------------------------RTLNTVRKK--PT-------------------V-IV.TALRII--EREEK
Q5K9B3_CRYNJ/179-740------------------------------SVVELLRKG--NG-------------------G-TVVRLLKII--EVEGK
EX3L4_HUMAN/179-709------------------------------ETLDSDGVD--AA-------------------A-LA.ELARVV--SAEEE
A5DIA8_PICGU/180-832------------------------------SITEAAKEG--NY-------------------T-LAFKIIKII--EFEAN
Q0TXU6_PHANO/187-762------------------------------NLIDLVQSG--ND-------------------G-LVVRLAIIV--EEEEK
EX3L1_BOVIN/188-722------------------------------AAGQLAREN--PA-------------------L-LV.AAVRVA--EVDAG
SEC6_SCHPO/181-743------------------------------NIFQLVKSG--HI-------------------K-TIVQIFKIV--EAEES
TNAP2_MOUSE/157-688------------------------------RPLEAAPER--LS-------------------.-...QALAVV--SQEEL
A5DY39_LODEL/293-930------------------------------SLTESAKDN--NL-------------------E-ILFKLIAIV--LFEEK
A0A0D1DY75_USTMA/258-828------------------------------RTMDLVREG--RH-------------------A-VVVKLIKIV--EKESR
A4RYX1_OSTLU/92-690------------------------------QGILAGESG--SV-------------------G-LV.RAVRVV--AEQEV
Q6DJR6_XENTR/177-732------------------------------RSIVTVRRD--PT-------------------L-LV.SVVRII--EREEK
A3LNE6_PICST/180-819------------------------------SLTEVVKDG--NV-------------------Q-LVHRVVKIV--EYESN
Q8SU74_ENCCU/160-687------------------------------EFIE.....--NH-------------------E-AMDKIVQIV--EKEEA
Q16I77_AEDAE/179-730------------------------------RTLNTVRKE--PT-------------------V-IV.TALRII--EREEK
Q5RG40_DANRE/161-694------------------------------..LDSFNEE--NQ-------------------E-TLKSALISI--LQEEA
Q6CU40_KLULA/178-794------------------------------DIIEAVRTE--NQ-------------------S-LLIRLFKVI--HVEEC
Q5BBU2_EMENI/183-758------------------------------NLIPLVQSD--NP-------------------S-MVVRLAVVV--ANEEK
Q6FPK2_CANGA/177-798------------------------------DIVEMIRAE--NY-------------------S-LVVRLFKII--DFEER
A7F9Q6_SCLS1/177-755------------------------------NLIEVVVQG--NS-------------------S-LVVRLAVVI--EAEEK
Q6C9T6_YARLI/183-804------------------------------NLLEFIRSG--NT-------------------S-LVVRLAKII--DLEER
EX3L1_MOUSE/189-722------------------------------AAGRLARED--PA-------------------L-LV.AAIRVA--EVETE
EX3L1_DANRE/206-763------------------------------SGLSLAHQN--PT-------------------P-FV.SAVRIV--EREEA
EXOC3_DICDI/183-774------------------------------NSIDIAQIK--PA-------------------V-LV.KVAQII--EREKL
TNAP2_HUMAN/122-651------------------------------RPLEAPPER--LR-------------------.-...QALAVV--AEQER
Q6BJB6_DEBHA/180-833------------------------------SLTEALKEG--NV-------------------E-LVFKLIKII--EFESN
EX3L4_MOUSE/181-708------------------------------EALSSEGVD--RD-------------------A-LA.ELAQVV--HLEEE
Q5A7K3_CANAL/180-812------------------------------SLTEVTKEG--NF-------------------E-CFFNILGVV--TWEEN
A6RAW7_AJECN/390-965------------------------------NLIPLVQTD--NR-------------------S-MVVRLALIV--MNEEK
E7KDN6_YEASA/178-797------------------------------DIVEMARAE--QI-------------------S-LAIRLFKIY--DLEER
H3DL97_TETNG/187-739------------------------------RSMVTVRRD--PT-------------------M-LV.SVVRII--EREEK
EXOC3_HUMAN/188-743------------------------------RSLVTVRRD--PT-------------------L-LV.SVVRII--EREEK
Q1K527_NEUCR/175-753------------------------------SLINLVIAD--NN-------------------S-LVVRFALII--EAEEK
SEC6_ARATH/173-736------------------------------NYYKLSKES--PQ-------------------T-LV.RALRVV--EMQEI

PF04091

W5E5N0_WHEAT/442-753------------------------------SSVPEVCRI..VR-------------------S.FVEDSVSYLSYGGD..
A9S7S7_PHYPA/446-757------------------------------ATVPDCCRI..VR-------------------S.FIEDSVSFLAYGGH..
H2WCC2_CAEJA/477-783------------------------------RFVISAYTQ..AK-------------------Q.YLIGCLKFM..DNL..
T1EMI3_HELRO/450-756------------------------------QFVPAIFTE..VK-------------------R.YISACLEFS..EDL..
A9V537_MONBE/417-723------------------------------NAVPRLYAE..VR-------------------H.YIDLSHQFL..ENV..
Q6BHQ3_DEBHA/494-826------------------------------EDYVHYCLG..IR-------------------S.LLEEIVQFI..SQH..
E9G3C4_DAPPU/410-716------------------------------SLVPKVYRQ..IR-------------------N.YIQACLQFS..QDL..
B9GSB7_POPTR/457-761------------------------------STVPDCCRI..VR-------------------S.FIEDSVSFMSYGGQ..
M7NJC8_PNEMU/439-739------------------------------QVYPLCCVD..IR-------------------N.FVNKYYKFA..EGY..
U1HWP6_ENDPU/444-743------------------------------QMYPLCCID..IR-------------------N.FLNQFYFYA..NDD..
G0VF38_NAUCC/501-841------------------------------PLYPMTCTL..LK-------------------K.AYSKLTSFI..TMF..
K5VZV5_AGABU/444-743------------------------------QSFYLCCQE..IR-------------------S.FIKNFYGFV..EGV..
R9AG66_WALI9/449-747------------------------------SIYPDSCRL..LR-------------------Q.FIEDFYKYT..DGY..
D6X4X0_TRICA/433-740------------------------------GMVPKVYQQ..VK-------------------E.FIYACLKFS..EDL..
C5E4W3_ZYGRC/494-839------------------------------PLYPMTCTL..LK-------------------K.TYNKLIHFI..GTY..
G8ZUB2_TORDC/501-847------------------------------PLYPMTCTL..IK-------------------K.TYTKLTYFI..GFF..
G2RB31_THITE/448-748------------------------------KMYPLCCID..IR-------------------N.FAEQFLVFT..REN..
U5FMP1_POPTR/442-753------------------------------SMVPDTCRI..VR-------------------S.FIKGSVDYLSYGVH..
J9K5H0_ACYPI/421-724------------------------------SMVPSVYDQ..VK-------------------Q.FIFACLKFS..NDL..
C4R087_KOMPG/447-765------------------------------SIYPMTCLQ..IQ-------------------N.LIKEVNEFI..DDF..
Q8S5T3_ORYSJ/442-753------------------------------SGVPDICRI..VR-------------------S.FIGDSVSYFSYSAR..
M4DPW7_BRARP/456-760------------------------------TTVPDCCRI..VR-------------------S.FIEDSVSFMSHGGQ..
G6DDP0_DANPL/419-720------------------------------SLVPAVYVQ..VK-------------------E.FIYAWLKYS..AGL..
M3XK92_LATCH/505-811------------------------------EFVPKVYSQ..IK-------------------E.FIYACLKFS..EDL..
D5GMB3_TUBMM/427-725------------------------------RIYPLCCRH..IR-------------------D.LLEKYYFYA..DEY..
W1QAD1_OGAPD/459-774------------------------------IIYVATCLK..MR-------------------V.FIHDIYDFV..GKY..
U9TBU2_RHIID/147-443------------------------------QAYPSCCLD..IK-------------------K.FVDQYYTFA..EGD..
A5DMM0_PICGU/482-811------------------------------EDFVDYCLW..IR-------------------S.LLDDSLAFI..GRY..
R9P8Q0_PSEHS/445-756------------------------------QTYPLCCMD..MR-------------------N.LVDQYYIFS..SDF..
Q6C1W0_YARLI/480-793------------------------------PILPLCCAK..IT-------------------H.LIHQHYAFL..DEFNV
J3PJI4_GAGT3/450-750------------------------------QMYPLCCID..IR-------------------N.FLNQFYFFS..DDH..
G8YKH3_PICSO/492-824------------------------------EDYVHYCLG..IR-------------------S.LLEETIQFI..SEH..
J9EJI0_WUCBA/484-791------------------------------KFVPAVYCQ..AK-------------------N.YLVGCLKFM..EHL..
F6YT74_HORSE/409-715------------------------------QSVPHIYIQ..VK-------------------E.FIYASLKFS..ESL..
J4KKU7_BEAB2/450-750------------------------------QMYPLCCID..IQ-------------------N.FLNQFYFFS..DDH..
I4YIZ3_WALMC/449-754------------------------------SIYPEACKL..LR-------------------R.FIDDFYKYT..EGF..
F8PQ71_SERL3/445-743------------------------------QSFYLCCQD..IR-------------------T.FVQKFYQFV..EGV..
G1XUE0_ARTOA/508-808------------------------------QMYPLCCID..LR-------------------S.FLNKYYFFS..REY..
A7TQS9_VANPO/506-845------------------------------PLYPMTCTL..IK-------------------K.TYSKLTAFI..SNH..
G3AZR4_CANTC/493-823------------------------------EDYVHFCLG..IR-------------------S.LMEDIIQFV..KDF..
B4R147_DROSI/428-730------------------------------RMVPEVYHQ..AK-------------------E.FMYACMKFA..EEL..
S8FZN9_FOMPI/445-743------------------------------SGFYLCCQD..IR-------------------N.FVQNFYQFL..EGV..
K5W5P8_PHACS/445-743------------------------------SGFYLCCQD..IR-------------------N.FVHNFYQFL..EGV..
G2YIA1_BOTF4/452-752------------------------------QMYPMCCID..IR-------------------N.FLNRFYFIM..DDH..
A8NWX8_COPC7/444-743------------------------------QTFYLCCQDPQIR-------------------L.FIQKFYAFV..EGV..
R4X791_TAPDE/443-739------------------------------QIYPLCCIE..IR-------------------N.FINEFYLYA..DEL..
S9VV25_SCHCR/436-738------------------------------KMCSLCCIT..LS-------------------K.FARHFFMFS..NDS..
V2X5M8_MONRO/445-743------------------------------QTFYLCCED..IR-------------------S.FIQKFYAFV..EGV..
C5M2I2_CANTT/488-818------------------------------EDYVHFCFH..IR-------------------K.LIKDILRFI..EDY..
I2H3Y9_TETBL/508-832------------------------------PLYPMTCTL..LR-------------------K.TYTKLISFV..DNA..
Q17EP0_AEDAE/419-722------------------------------RMVPEVYHQ..AM-------------------E.FMYACMKFS..EEL..
M2ZTI7_PSEFD/439-745------------------------------QMYPLVCID..IR-------------------N.FLNQIYLFS..DDH..
I1MM64_SOYBN/441-752------------------------------SMVPDACRI..VR-------------------S.FIKGSVDYLSNGVR..
B6K595_SCHJY/439-743------------------------------KMCYECCQN..AD-------------------S.FIRRFFMFL..NDS..
U4LHC9_PYROM/436-732------------------------------QMYPLCCID..IR-------------------T.FLNKYYFFS..QHY..
G3Q4R1_GASAC/450-759------------------------------EFVPKVYCQ..LK-------------------ESYINLCSQLW..EET..
Q753S5_ASHGO/494-834------------------------------PLYPMTCAL..IK-------------------K.SYANMLLFL..NTF..
Q5KPL0_CRYNJ/450-754------------------------------QTYPMCCIN..IR-------------------N.FVDQFYQFT..DGV..
C4Y6U1_CLAL4/493-821------------------------------EDYVHYCLG..IR-------------------T.LLKDVLEFT..SRH..
E0VNA5_PEDHC/435-739------------------------------QMVPNVYNQ..VK-------------------K.YINACLKFS..EDL..
Q7RYL2_NEUCR/451-751------------------------------QMYPLCCID..IR-------------------N.FLNQFYFFS..NDH..
H6BY38_EXODN/444-761------------------------------QMYPLCCID..IR-------------------N.FVNQFYFFAAQDDT..
J7R131_KAZNA/509-861------------------------------PLYPMTCTL..TK-------------------K.IYSKLTTFV..ADF..
M0S2D5_MUSAM/444-755------------------------------SSVPDICRV..VR-------------------S.FIEDSVNYLSYGGP..
H2YEW6_CIOSA/141-441------------------------------RFVPRIFGE..MK-------------------R.FILSCLEYC..EDL..
M7XX30_RHOT1/453-763------------------------------QTYPLCCVD..IR-------------------S.FTEQYYQFA..EGF..
M2RQV4_CERS8/445-743------------------------------QSFYLCCQD..IR-------------------S.YVQNFYQFI..EGV..
M2N0E3_BAUCO/446-755------------------------------QMYPLVCID..IR-------------------N.FLNQIYLFT..DDH..
F4S5J6_MELLP/471-780------------------------------QTYPLCCID..IR-------------------N.FVTKYYHFA..DGF..
H3CIW2_TETNG/458-766------------------------------EFVPKVYCQ..LK-------------------E.FIYACLKYS..EDL..
I3MQ17_ICTTR/423-732------------------------------QSVPHIYIQ..VK-------------------E.FIYASLKFS..ESL..
M1CVC4_SOLTU/449-755------------------------------SMVPECCRI..VK-------------------S.FIKDSVNYLSYGSQ..
H2B145_KAZAF/504-852------------------------------PLYPMTCTL..VK-------------------K.VYSKLASFI..STF..
C8V0B6_EMENI/444-742------------------------------QMYPLCCID..IR-------------------N.FLNQFYFFA..NDD..
D7TQV0_VITVI/442-753------------------------------SMVPDVCRI..IR-------------------S.FIKDSVSYLSYGGH..
U5HF68_USTV1/463-770------------------------------QTYPLCCID..IR-------------------S.FTEQYYQFS..DGF..
SEC15_SCHPO/436-738------------------------------KMCPLCCTT..LS-------------------K.FVRHFFMFL..NDS..
K2SGN8_MACPH/382-681------------------------------QMYPLCCID..IR-------------------N.FLNQMYLFS..DDN..
N1JD47_BLUG1/449-748------------------------------QMYPLCCID..IR-------------------N.FLNQFYFFS..DDY..
W5C2B9_WHEAT/447-753------------------------------SSVPSACRI..IR-------------------S.FIEDLVSYLSYGVV..
U5D3X0_AMBTC/442-753------------------------------ATVPDCCRI..VR-------------------S.FIEDSVSYLSYGAN..
A6R9C0_AJECN/444-745------------------------------QMYPLCCID..IR-------------------N.FLNQFYFFS..NDD..
Q6CYE5_KLULA/489-828------------------------------PLYPMTCTL..VK-------------------K.TYSSLHSFI..SIF..
T1ICC1_RHOPR/422-724------------------------------PFVPNIYQQ..VK-------------------E.YIYACLKFS..EDL..
U7Q2U4_SPOS1/452-752------------------------------QMYPLCCID..IR-------------------N.FLNQFYFFS..DDH..
V5ESV2_KALBG/448-756------------------------------QTYPLCCMD..IR-------------------N.LVDQYYHFS..DGFAF
M9MGV3_PSEA3/448-761------------------------------QTYPLCCMD..MR-------------------N.LVDQYYVFS..DGFSF
M2T372_COCH5/443-742------------------------------QMYPLCCID..IR-------------------N.FLNQIYLFS..DDY..
B0CXV0_LACBS/444-743------------------------------QTFYLCCQD..IR-------------------T.FIQKFYAFV..DGV..
A8Q0J7_MALGO/448-754------------------------------QTYPLCCMD..IR-------------------S.LVEQYYSFS..SGM..
L8GBJ1_PSED2/444-744------------------------------QMYPLCCID..IR-------------------N.FLNQFYFFS..DDH..
K1PXL0_CRAGI/475-788------------------------------LFVPNIYTQ..VK-------------------A.YINACLKFS..ADL..
T1K0Q9_TETUR/511-835------------------------------SFVPKVFTQ..VK-------------------R.FINACREFS..QDL..
W4YBC1_STRPU/461-764------------------------------EFVPKVYRQ..IK-------------------E.FIYACHKFS..QDL..
I2FTP7_USTH4/451-766------------------------------QTYPLCCMD..IR-------------------N.LVDQYYNFS..EGV..
M4CSR8_BRARP/401-712------------------------------SMVPDVCRI..IR-------------------S.YIKGSVDYLSYGVN..
SEC15_YEAST/521-864------------------------------PLYPMTCTL..AK-------------------K.TYSKITAFL..SIF..
I1LA00_SOYBN/442-753------------------------------SMVPDACRI..VR-------------------S.FIKGSVDYLSYGIH..
D5G5B6_TUBMM/397-695------------------------------QMYPLCCID..IR-------------------N.FLNKYYFFS..DEY..
S2IZP1_MUCC1/463-761------------------------------KVFPTCCRD..VS-------------------F.FVHQFYQFA..EGF..
K0KMH2_WICCF/500-804------------------------------TIYPMTCAQ..VR-------------------A.YITHQTGFL..KDY..
A3LS60_PICST/480-811------------------------------EDYVHYCLG..VR-------------------S.LLEDIISFI..GQH..
C5DLI6_LACTC/498-839------------------------------PLYPMTCTL..VK-------------------K.TYNKVVACL..SEF..
G3AHA4_SPAPN/460-784------------------------------EDYIHYCFG..IR-------------------N.LINIVIVFI..SEH..
G8BTV9_TETPH/518-863------------------------------PLYPMTCTL..IK-------------------K.TYTKLISFI..SSF..
G4TCP0_SERID/445-744------------------------------QTFYQCCMN..IR-------------------S.FVQKFYQFV..EGV..
G8BIA4_CANPC/483-815------------------------------EDYATFCKI..LH-------------------K.LILKTLKFI..EVY..
E6ZRP7_SPORE/448-761------------------------------QTYPLCCMD..MR-------------------N.LVDQYYVFS..DGLSF
Q6FRK2_CANGA/501-841------------------------------PLYPMTCTM..TQ-------------------K.VYAKLTSFI..SSF..
G0WGH4_NAUDC/507-859------------------------------PLYPMTCTL..TK-------------------K.TYSKLSSFV..TIF..
E3KWD2_PUCGT/502-831------------------------------QAYPLCCIH..IR-------------------N.YVTNHYAYC..ESIT.
K7IYQ6_NASVI/422-728------------------------------AMVPKVYHQ..VK-------------------E.FIYACLKFS..EDL..
A0A0D1DRH1_USTMA/446-764------------------------------QTYPLCCMD..MR-------------------N.LVDQYYIFS..DGF..
C3ZIQ9_BRAFL/402-708------------------------------GSVPQVYKQ..IK-------------------E.FAYACIKFS..EDL..
D8PS05_SCHCM/445-743------------------------------QTFYLSCQD..IR-------------------G.FIQKFYTFV..EGV..
A5E457_LODEL/496-826------------------------------EDYVHFCGF..VR-------------------Q.LINRTLKFL..NEY..

PF09763

Q5K9I2_CRYNJ/487-1172------------------------------QVLAHI.DE--AL-------------------M-ELDDIDLQI--TGYRM
Q75AA6_ASHGO/631-1297------------------------------DLKLYK.AK--TV-------------------Q-ECDRMDPTL--SLFTM
A5DBH0_PICGU/595-1282------------------------------SISKDM.TD--SL-------------------N-ELSNLSTVF--KRAEL
A3GH85_PICST/638-1329------------------------------NVSKDV.GT--SI-------------------N-EVENLSHIF--KKMEI
Q6FRC5_CANGA/652-1329------------------------------NLQPYE.TN--VN-------------------K-ACDNINPTF--SLFLM
Q2UK85_ASPOR/702-1427------------------------------QLAKLI.DK--TI-------------------E-ECEELDNLL--TLYSH
A7TSV5_VANPO/776-1455------------------------------TLSGYE.QN--VS-------------------K-ECEKINPTF--SLFLM
Q6CQX3_KLULA/540-1218------------------------------ELNPYK.DL--VF-------------------K-ECDKLDPTL--SLFTM
Q57ZX4_TRYB2/198-1064------------------------------EVREHI.SS--IM-------------------E-DVGEMEARI--AQYSK
EXOC1_DROME/198-866------------------------------KMMEHI.DN--AI-------------------S-EADKFENRL--DSYED
A7E4X8_SCLS1/708-1443------------------------------AIKRGL.DT--CM-------------------D-ECDELDGLL--TLYLV
Q6C0U5_YARLI/751-1484------------------------------DLTTDL.DQ--AI-------------------A-QCDELDAIL--TFFSV
Q2GRZ6_CHAGB/575-1334------------------------------AIKRGI.DL--SI-------------------S-ECDELDNLL--TLYSV
A7RVQ5_NEMVE/163-846------------------------------SLMDLL.EA--AL-------------------V-ELDKLDTRL--THYDD
Q5TMX8_ANOGA/201-872------------------------------MLMERI.EE--AI-------------------K-EAEKVEKRL--DDYDE
A0A0D1E5C3_USTMA/474-1173------------------------------LVVKHM.EE--AL-------------------A-DLDMMDSMI--AGFKV
A5E4P0_LODEL/994-1796------------------------------TLAQDV.ET--AS-------------------G-EIDNMLRVF--QRMDY
EXOC1_DICDI/107-855------------------------------EVISQLGDK--DG-------------------T-HLTGVTAWI--EYYNK
A3KPP9_DANRE/184-869------------------------------TLMQLL.DQ--AL-------------------A-EVDTIEGKL--LSYEE
E7LTP8_YEASV/640-1316------------------------------NIRPYE.DK--VN-------------------D-ECHRIIPTL--SLFLM
V5ILH3_NEUCR/647-1440------------------------------AIKKGI.DV--AL-------------------A-ECDELDNLL--TLYSV

PF04129

VPS52_YEAST/47-607------------------------------THSNNE-AA--IN-------------------I-IIPQLIDYL--TEFTN
VPS52_SCHPO/1-508------------------------------DDLNKL-DS--LK-------------------S-VLNDVLSSL--ERFQV
Q9VMQ8_DROME/42-546------------------------------NLHNQI-ND--CD-------------------D-VLERMENML--MSFQS
VPS52_RAT/94-601------------------------------SLHNQI-TA--CD-------------------A-VLERMEQML--GAFQS
VP52A_ARATH/93-587------------------------------SLHDQI-RD--CD-------------------S-ILSQMETLL--SGFQE

PF15278

B6K1Q5_SCHJY/526-611------------------------------DAFEKNQQE--LL-------------------N-SLNE------------
YD6C_SCHPO/520-605------------------------------TTIKDVLKQ--TE-------------------F-SFDG------------

PF08700

Q5KJF4_CRYNJ/98-180--------------------------------------------------------------------------------
EXO84_ASHGO/127-213--------------------------------------------------------------------------------
COG5_MOUSE/37-120--------------------------------------------------------------------------------
EXO84_CRYNJ/142-228--------------------------------------------------------------------------------
Q6BJZ0_DEBHA/76-158--------------------------------------------------------------------------------
Q0U0Z3_PHANO/76-170--------------------------------------------------------------------------------
Q0WQ75_ARATH/43-129--------------------------------------------------------------------------------
Q173I8_AEDAE/5-87--------------------------------------------------------------------------------
A2D783_TRIVA/6-88--------------------------------------------------------------------------------
Q7Q6Z6_ANOGA/11-97--------------------------------------------------------------------------------
Q2UQ54_ASPOR/108-197--------------------------------------------------------------------------------
VPS51_YEAST/84-163--------------------------------------------------------------------------------
A2E266_TRIVA/29-115--------------------------------------------------------------------------------
Q2U987_ASPOR/1-88--------------------------------------------------------------------------------
Q6FRQ2_CANGA/66-146--------------------------------------------------------------------------------
Q6CSC3_KLULA/100-179--------------------------------------------------------------------------------
EXO84_GIBZE/128-214--------------------------------------------------------------------------------
EXOC8_MOUSE/13-100--------------------------------------------------------------------------------
A0A0D1E7D8_USTMA/79-161--------------------------------------------------------------------------------
Q8I2A9_PLAF7/116-202--------------------------------------------------------------------------------
Q6CG64_YARLI/77-166--------------------------------------------------------------------------------
Q4E335_TRYCC/3-85--------------------------------------------------------------------------------
EXO84_YARLI/121-207--------------------------------------------------------------------------------
Q4MZL9_THEPA/63-149--------------------------------------------------------------------------------
COG1_SCHPO/7-89--------------------------------------------------------------------------------
Q59L27_CANAL/17-99--------------------------------------------------------------------------------
Q2UHE7_ASPOR/121-207--------------------------------------------------------------------------------
Q7RZT4_NEUCR/9-91--------------------------------------------------------------------------------
E9AC89_LEIMA/3-81--------------------------------------------------------------------------------
A2GBI6_TRIVA/24-110--------------------------------------------------------------------------------
Q4Y221_PLACH/14-100--------------------------------------------------------------------------------
VPS51_DICDI/178-264--------------------------------------------------------------------------------
VPS51_SCHPO/52-138--------------------------------------------------------------------------------
Q9FFF3_ARATH/21-103--------------------------------------------------------------------------------
A0A0D1CLQ0_USTMA/184-270--------------------------------------------------------------------------------
COG1_DICDI/113-195--------------------------------------------------------------------------------
A2FRD0_TRIVA/32-118--------------------------------------------------------------------------------
A0C9R8_PARTE/6-92--------------------------------------------------------------------------------
EXO84_CANGA/190-276--------------------------------------------------------------------------------
Q754G8_ASHGO/53-137--------------------------------------------------------------------------------
VPS51_CHICK/57-143--------------------------------------------------------------------------------
Q95Q35_CAEEL/9-99--------------------------------------------------------------------------------
Q6C0N6_YARLI/24-102--------------------------------------------------------------------------------
Q4DYG1_TRYCC/45-131--------------------------------------------------------------------------------
B4QW21_DROSI/4-89--------------------------------------------------------------------------------
Q5KKF4_CRYNJ/54-139--------------------------------------------------------------------------------
Q7S488_NEUCR/124-217--------------------------------------------------------------------------------
Q84K25_ARATH/20-102--------------------------------------------------------------------------------

PF06148

Q0TYI9_PHANO/26-159--------------------------------------------------------------------------------
Q29BE0_DROPS/22-154--------------------------------------------------------------------------------
Q7QFV1_ANOGA/25-157--------------------------------------------------------------------------------
Q84LH7_ORYSJ/24-156--------------------------------------------------------------------------------
Q01CT5_OSTTA/52-184--------------------------------------------------------------------------------
Q5K8I4_CRYNJ/34-165--------------------------------------------------------------------------------
A1C4Y0_ASPCL/32-165--------------------------------------------------------------------------------
Q2UA29_ASPOR/27-160--------------------------------------------------------------------------------
COG2_HUMAN/15-147--------------------------------------------------------------------------------
Q0C728_AEDAE/17-149--------------------------------------------------------------------------------
A8WN13_CAEBR/23-155--------------------------------------------------------------------------------
Q383M1_TRYB2/46-232--------------------------------------------------------------------------------
Q4DNE3_TRYCC/72-246--------------------------------------------------------------------------------
Q4Q0F6_LEIMA/80-262--------------------------------------------------------------------------------
A0CKT7_PARTE/12-141--------------------------------------------------------------------------------
COG2_DICDI/53-185--------------------------------------------------------------------------------
F4JRR1_ARATH/31-163--------------------------------------------------------------------------------

PF10392

Q5KKM0_CRYNJ/10-154--------------------------------------------------------------------------------
COG5_HUMAN/66-189--------------------------------------------------------------------------------
Q6BT79_DEBHA/15-147--------------------------------------------------------------------------------
Q5B379_EMENI/829-961--------------------------------------------------------------------------------
Q5APN5_CANAL/17-149--------------------------------------------------------------------------------
COG5_SCHPO/8-139--------------------------------------------------------------------------------
COG5_YEAST/14-146--------------------------------------------------------------------------------
Q9C9V9_ARATH/57-180--------------------------------------------------------------------------------
Q0U7T7_PHANO/13-145--------------------------------------------------------------------------------
Q2HI55_CHAGB/25-157--------------------------------------------------------------------------------
Q6CLE2_KLULA/11-144--------------------------------------------------------------------------------
COG5_DICDI/63-186--------------------------------------------------------------------------------
Q6C2T6_YARLI/5-136--------------------------------------------------------------------------------
Q75B18_ASHGO/11-144--------------------------------------------------------------------------------
Q6FTM6_CANGA/9-140--------------------------------------------------------------------------------
Q65XH1_ORYSJ/52-175--------------------------------------------------------------------------------

PF04124

COG8_MOUSE/56-394--------------------------------------------------------------------------------
COG8_SCHPO/15-354--------------------------------------------------------------------------------
COG8_YEAST/28-381--------------------------------------------------------------------------------
COG8_CAEEL/10-353--------------------------------------------------------------------------------
Q9LYH5_ARATH/29-412--------------------------------------------------------------------------------
COG8_DROME/37-379--------------------------------------------------------------------------------
Q9P3N9_NEUCS/31-347--------------------------------------------------------------------------------

PF15469

Q5KNA8_CRYNJ/115-308.......KE...EFLA---------------------------------------------------------.DESD..
A7TRG2_VANPO/143-342.......ASSSSTSNS---------------------------------------------------------NKNNDFN
G8BMU6_TETPH/145-338.......SS...QDRS---------------------------------------------------------NSRNS..
C5DYM3_ZYGRC/146-354.......SMRYTPSLA---------------------------------------------------------PGSIDAN
G8ZXE8_TORDC/144-345.......SE...KSNT---------------------------------------------------------GALNDDD
H2AR86_KAZAF/151-365.......SE...SNN.---------------------------------------------------------.......
G0VBU0_NAUCC/150-340.......GEMKGNES.---------------------------------------------------------.......
G0WGP4_NAUDC/153-350.......ST...TTTQ---------------------------------------------------------TNDNEDY
Q6FVL5_CANGA/149-372.......SE...GGEQ---------------------------------------------------------ENQNI..
E7QCY0_YEASZ/146-360.......DE...KTNE---------------------------------------------------------KNQCDSP
C5DMT2_LACTC/144-330.......NK...FSLG---------------------------------------------------------.ESRD..
G8JTD1_ERECY/120-302.......NK...RMNG---------------------------------------------------------.SDNF..
Q750U7_ASHGO/122-304.......NK...RMSG---------------------------------------------------------.NENF..
Q6CQH1_KLULA/148-350.......DTLMNSADA---------------------------------------------------------ETYDED.
C4R5S5_KOMPG/139-344.......DN...MKLI---------------------------------------------------------.GKGDAN
Q6CGI4_YARLI/146-334.......KS...SGFT---------------------------------------------------------.QENE..
W1QF47_OGAPD/153-339.......SM...SNLS---------------------------------------------------------.A.....
C4YAI9_CLAL4/138-372.......RN...SKSQ---------------------------------------------------------.AQQDRE
G8Y2A4_PICSO/149-393.......KE...QKTH---------------------------------------------------------.SQKVME
C5MH42_CANTT/104-348.......MR...SKTK---------------------------------------------------------.AQQDRS
G3AUN6_SPAPN/128-368.......KQ...QKSK---------------------------------------------------------.AQADKE
G8BGG9_CANPC/145-407.......SQ...SKTK---------------------------------------------------------.SQEDKE
B6K5G3_SCHJY/147-340.......VN...HLES---------------------------------------------------------SNDQN..
C4M2W7_ENTHI/111-299.......NS...AKAE---------------------------------------------------------.AVKN..
D6W674_TRICA/193-371.......EG...DVAK---------------------------------------------------------.FGTE..
B0W3D0_CULQU/193-383.......SQ...DTKL---------------------------------------------------------.YGKD..
B3MVG4_DROAN/193-383.......QE...DVKL---------------------------------------------------------.HGNE..
G6D800_DANPL/194-372.......ED...DQRK---------------------------------------------------------.NGKE..
E2AW35_CAMFO/194-372.......EA...DMKS---------------------------------------------------------.YGSD..
E0VQL4_PEDHC/200-377.......EG...DLK.---------------------------------------------------------..GKD..
E9G6B5_DAPPU/193-371.......EE...NKTK---------------------------------------------------------.YGPD..
B7PR09_IXOSC/148-326.......EK...DKQE---------------------------------------------------------.MGSD..
A8WPA7_CAEBR/200-378.......EK...GQNA---------------------------------------------------------.DHFA..
H3ERJ1_PRIPA/197-373.......EE...HKGE---------------------------------------------------------M......
A0A0I9R3C5_BRUMA/212-385.......QL...ERNV---------------------------------------------------------.C..G..
C3XUC7_BRAFL/191-370.......LK...DEST---------------------------------------------------------.SEGG..
F6YQX0_XENTR/198-380.......EA...DGTE---------------------------------------------------------.KVEG..
F7GSZ8_CALJA/50-227.......EA...DGTE---------------------------------------------------------.KVEG..
E4XNP2_OIKDI/201-392....GQSSG...MQNA---------------------------------------------------------.QQVK..
F6Q8U3_CIOIN/201-380.......QR...DEGG---------------------------------------------------------.RKNG..
G4VNQ3_SCHMA/214-394.......DN...EKKS---------------------------------------------------------.IETN..
H2KP67_CLOSI/214-393.......LY...EKIS---------------------------------------------------------.SSGR..
F2UAY3_SALR5/207-386.......KF...HKRT---------------------------------------------------------.LNSA..
A9RNH0_PHYPA/252-430............EQIE---------------------------------------------------------CAKEG..
A9S1F4_PHYPA/259-437............QQIE---------------------------------------------------------SPKEG..
D8RD25_SELML/239-417............QQIE---------------------------------------------------------SDAEG..
D7KJZ0_ARALL/260-438............KRIE---------------------------------------------------------DDPDG..
F0ZXN2_DICPU/132-311............SKSK---------------------------------------------------------.ILED..
F4PGL2_DICFS/126-305............TSSK---------------------------------------------------------.MLDD..
A8PCF2_COPC7/122-323.......KD...GILA---------------------------------------------------------.PSTE..
D8QDB4_SCHCM/114-323.......KE...GLLA---------------------------------------------------------.PASD..
B8P2C9_POSPM/114-312.......QE...GLLA---------------------------------------------------------.GQTE..
G4TT08_SERID/115-310.......KD...GLLA---------------------------------------------------------.EDSE..
A8PUN7_MALGO/110-314.......SESMGGPFG---------------------------------------------------------.SAPD..
E6ZLD0_SPORE/109-315.......RDTESGPLQ---------------------------------------------------------.PQAD..
E3K655_PUCGT/121-321.......KA...GPLR---------------------------------------------------------.SECD..
F4RSS6_MELLP/56-255.......KN...GPLR---------------------------------------------------------.PEED..
F4PCT9_BATDJ/225-428.......CQ...KNLV---------------------------------------------------------.SSSN..
D5GNN2_TUBMM/147-347..LDKDR.........---------------------------------------------------------..ESE..
G1XK06_ARTOA/190-398NYEGEEEAT...FRLI---------------------------------------------------------.KEEE..

PF16528

C5DUD9_ZYGRC/539-743--------------------------------------------------------------------------------
G0VJV4_NAUCC/543-749--------------------------------------------------------------------------------
A7TL52_VANPO/508-712--------------------------------------------------------------------------------
G8ZS82_TORDC/494-698--------------------------------------------------------------------------------
G8BNG7_TETPH/532-736--------------------------------------------------------------------------------
G0W548_NAUDC/557-766--------------------------------------------------------------------------------
EXO84_CANGA/545-749--------------------------------------------------------------------------------
H2AXV4_KAZAF/523-731--------------------------------------------------------------------------------
G8JS46_ERECY/478-682--------------------------------------------------------------------------------
EXO84_KLULA/500-705--------------------------------------------------------------------------------
G0S6E5_CHATD/457-657--------------------------------------------------------------------------------
E3S512_PYRTT/452-652--------------------------------------------------------------------------------
EXO84_YARLI/444-642--------------------------------------------------------------------------------
D5GAW7_TUBMM/436-637--------------------------------------------------------------------------------
C4R6S9_KOMPG/506-717--------------------------------------------------------------------------------
Q2H152_CHAGB/456-656--------------------------------------------------------------------------------
C9S7T2_VERA1/440-640--------------------------------------------------------------------------------
B2B2W1_PODAN/463-663--------------------------------------------------------------------------------
H2Z9L4_CIOSA/281-487--------------------------------------------------------------------------------
H2MTA2_ORYLA/303-507--------------------------------------------------------------------------------
G3JE74_CORMM/450-655--------------------------------------------------------------------------------
G0SXF2_RHOT2/870-1071--------------------------------------------------------------------------------
EXO84_CRYNJ/449-651--------------------------------------------------------------------------------
C5FKA5_ARTOC/433-633--------------------------------------------------------------------------------
F4P2Q9_BATDJ/415-626--------------------------------------------------------------------------------
G0R9T9_HYPJQ/449-649--------------------------------------------------------------------------------
C7Z4G1_NECH7/445-645--------------------------------------------------------------------------------
I1G637_AMPQE/287-497--------------------------------------------------------------------------------
E7LRJ5_YEASV/465-668--------------------------------------------------------------------------------
EXO84_ASPFU/445-645--------------------------------------------------------------------------------
W4YYJ2_STRPU/291-496--------------------------------------------------------------------------------

PF06248

ZW10_DROPS/10-571SSLGREINDLLET.VG---------------------------------------------------------TEGLAAL
ZW10_ARATH/1-584RLISDDVSDVLQLVSD---------------------------------------------------------RPIDVEI
A7SSG2_NEMVE/20-670SSLLKEI.DATTKKVK---------------------------------------------------------GSILPDL
A8XRG3_CAEBR/1-605LENLEDTAEMSSRELS---------------------------------------------------------NLIEQTE
ZW10_HUMAN/9-621DKLSEDI.DLLKSRIE---------------------------------------------------------SEVRRDL
F1QYH5_DANRE/9-611ESVSKDI.DLLKSCIE---------------------------------------------------------NEVQQNL
F7EQH5_XENTR/9-617HGLASDV.DVLKSRIE---------------------------------------------------------TEVKSDL
H3CQC8_TETNG/9-607DEVSKEM.EALKNCIK---------------------------------------------------------NEVQQNI

PF11988

C5DYW5_ZYGRC/14-364CYYSLQNLRKKLR...---------------------------------------------------------...DTSS
A7TF57_VANPO/11-362CYYSLQNLRKKLK...---------------------------------------------------------...ENDT
Q6CUS2_KLULA/12-352CYYSLQNIHKKFK...---------------------------------------------------------....DVN
G0WD68_NAUDC/10-396CFYSLQSLRKQIGTIT---------------------------------------------------------INNNNPS
I2GW53_TETBL/23-390CYYSLQNLRKKIH...---------------------------------------------------------...ENEP
C5DK93_LACTC/23-365CYYSLQNLHKRLE...---------------------------------------------------------.KVDMSL
E7KT96_YEASL/5-360CYYSLQSLRKKMR...---------------------------------------------------------...NNAA
G8ZQK5_TORDC/17-366SFYSLQTLRKKLR...---------------------------------------------------------...DFSE
Q752C3_ASHGO/45-390AFETLRQCVQKAK...---------------------------------------------------------....SAD
J8Q396_SACAR/5-358CFYSLQSLRTKMR...---------------------------------------------------------...KNTA
G8BQ21_TETPH/12-363CYYSLLNLRKKLK...---------------------------------------------------------..QNDTV
H2AUI4_KAZAF/5-354CYYSLKSLRSKLT...---------------------------------------------------------..ENNSV
Q6FNZ0_CANGA/3-351CYYSLYNLSKKLK...---------------------------------------------------------...SSRS
G0V593_NAUCC/12-369CFYSLQSIRKRIN...---------------------------------------------------------.GNNNSS
J7S867_KAZNA/7-376CYRALQTLRQKLN...---------------------------------------------------------..TSRDC

PF06419

F4PTE8_DICFS/25-669HLSQSKSSF..SNVLQ---------------------------------------------------------EAKKLSY
D7TU00_VITVI/30-688ALNSCNATT..GDIIS---------------------------------------------------------TTERLKQ
K4CMR1_SOLLC/27-689ALSSCNATT..GDIIS---------------------------------------------------------TTERLKQ
T1IZR2_STRMM/42-648RLQSTKTQT..QDLIS---------------------------------------------------------QTTQLKT
E6ZVT0_SPORE/99-753KLRAAEESS..RYLVE---------------------------------------------------------HAEGLEK
E3QI24_COLGM/61-707RITAAHEDT..GPILE---------------------------------------------------------EASNLMK
G8ZRY6_TORDC/181-815DTGKTPTDKKEQTLEK---------------------------------------------------------NIESLQS
D0NH36_PHYIT/44-655FLETTKRET..QQVQT---------------------------------------------------------EAAALAT
G2XGZ3_VERDV/42-689PIATSHTQT..APVLQ---------------------------------------------------------DAALLIQ
C5M6P2_CANTT/146-753KVNKNFESS..NELNV---------------------------------------------------------EINDLNK
S3D9N6_GLAL2/53-695HISSAHQET..APALE---------------------------------------------------------EASELMK
K1QJ12_CRAGI/42-639RLKAAKEQT..HDLIS---------------------------------------------------------QTTKLHA
E9EWT4_METRA/42-671QVALAQSET..SPTLR---------------------------------------------------------EAASLLE
C1GBA8_PARBD/57-738HIALATQET..APVLE---------------------------------------------------------EAATLMN
G0VHH4_NAUCC/184-845KNEGNDHAT..SKVFD---------------------------------------------------------EVDQLKN
T1K467_TETUR/31-648KIKNLKTKN..QNLLE---------------------------------------------------------KTHYLKN
B9S1S6_RICCO/31-692ALNSCSAST..GDIIS---------------------------------------------------------TTERLKQ
G3J3T2_CORMM/115-739MVAAAHSEM..EPSLA---------------------------------------------------------EASALLE
G3B3F3_CANTC/135-733RLHDIFQDL..EQFNK---------------------------------------------------------EFKALNE
COG6_PICGU/138-737SVNNDFESS..EIFNS---------------------------------------------------------KMENLHR
U1G9I0_ENDPU/55-707QIHKAQQES..GSMLE---------------------------------------------------------EASTLTA
B7Q1K3_IXOSC/40-604RLQATRSQT..DTLMS---------------------------------------------------------RSAALRA
F1A3Z4_DICPU/25-688HLNSTNKVS..SKLLT---------------------------------------------------------NANMLTE
A5DUD8_LODEL/174-816RLNKTANGS..TQFTE---------------------------------------------------------KVGLMSS
C5FL60_ARTOC/56-718RLAIAHQET..GPVLE---------------------------------------------------------EASTLRA
X1WYM6_ACYPI/29-624QLKDTKTDT..QNLIE---------------------------------------------------------LTKRLQL
COG6_CHAGB/47-689QIGSAQKTT..SSTLI---------------------------------------------------------EASQLMI
T1EFP4_HELRO/53-656RLKKTKSQT..HDLIS---------------------------------------------------------QTTTLKA
G4V7Z1_SCHMA/35-648TLTSVKSET..VCLVE---------------------------------------------------------EAQQLKS
C1MX75_MICPC/28-699ALDSSRART..RVLLR---------------------------------------------------------ETSRLAE
COG6_ASPCL/56-753HIFLAKQDT..TPVLE---------------------------------------------------------EASALVS
R9NZP8_PSEHS/106-778KLRAAEESS..RYLVE---------------------------------------------------------HAEGLER
M7T0Y3_EUTLA/61-714HVTAAHEVT..SITLE---------------------------------------------------------ETNHLVT
B3N2A1_DROAN/35-627DLETSKALT..KDLID---------------------------------------------------------QTNTMQQ
G3AM15_SPAPN/147-779KIVKNYEFS..TEFNS---------------------------------------------------------KVSELNQ
COG6_DEBHA/142-759KVNKDFQST..KDLNG---------------------------------------------------------EVKNLND
COG6_DICDI/25-671HLNSTNRVS..SELLK---------------------------------------------------------NAHELSC
D6WE56_TRICA/33-626RLHNAKMQT..KQLLE---------------------------------------------------------QTKSLQE
K1Y0X5_MARBU/53-696HISAAHQET..APVLE---------------------------------------------------------EASELMK
R0IIQ7_SETT2/55-693HIAAASKET..DPVLE---------------------------------------------------------EATSLMG
G2YFW1_BOTF4/53-688HISAAHQET..APVIQ---------------------------------------------------------EASELMK
B3RLZ3_TRIAD/43-642RLMAAKSET..SDLIT---------------------------------------------------------KTSKLHN
M2NAU2_BAUCO/56-695HVGAANRET..GPMLD---------------------------------------------------------EARAILA
COG6_MAGO7/54-703QVTKAHECT..SPVLQ---------------------------------------------------------EASTLIA
N1PID3_DOTSN/58-692HINAAHREA..GPMLD---------------------------------------------------------EAKTILT
M7NMJ9_PNEMU/26-631EADIISLKS..THFLK---------------------------------------------------------QITTIYD
G0WDG5_NAUDC/220-947RANETSNHGTTDSVFN---------------------------------------------------------QVEALQN
U4LN57_PYROM/30-663GTSTASAEA..APILE---------------------------------------------------------ESTQLLT
F4NVM0_BATDJ/55-674QLKAAYKNA..ASVLK---------------------------------------------------------HTQDMKT
Q6NMI3_ARATH/31-678ALSSSAATT..SDIIS---------------------------------------------------------TTERLKQ
A9SY28_PHYPA/31-697SLSSCSSTT..SEIVS---------------------------------------------------------ATERLKQ
R4XC07_TAPDE/63-663QAQAVKTST..TQLLE---------------------------------------------------------QSTFLQA
COG6_CANGA/184-819NDKET....FSQKYIS---------------------------------------------------------DIDDCRN
A0A088AU02_APIME/31-620RLQTTKTQT..SQLID---------------------------------------------------------QTAKLQN
M3AVJ9_PSEFD/47-684HIAASTRDI..GPVVD---------------------------------------------------------EAKTVLA
G8BSH8_TETPH/181-817ETKEINEDS.KDGNLN---------------------------------------------------------EVYQLYQ
V5EQK1_KALBG/40-699KLRAAEESS..RYLVE---------------------------------------------------------HAEGLER
COG6_YEAST/190-824NETNEVPTN..NVVLQ---------------------------------------------------------EIDQYRL
C4Y1K1_CLAL4/138-736LLGSDDGDS..ARISA---------------------------------------------------------QVAALTR
C5DMM3_LACTC/169-799QGEMAHDET..KTYMD---------------------------------------------------------TVYILQN
J4VQT6_BEAB2/59-673MVAVAHSGM..ESPLA---------------------------------------------------------EASALLE
G8BDK2_CANPC/146-760RLQKNFEFS..HEFNT---------------------------------------------------------TVNKLYE
A0A0C4DUI8_MAGP6/47-702QITAAQDAT..STVLQ---------------------------------------------------------EASSLMA
COG6_ASHGO/167-791AQEAQNKSPLQDPLVS---------------------------------------------------------EV...RE
D8T0Q7_SELML/31-672SLSSCEAVT..GDIVA---------------------------------------------------------TTEKLRL
COG6_SCHPO/44-649EWSKKTNDA..QILLN---------------------------------------------------------SYETFCE
A4S9H0_OSTLU/72-716ALETSKQKT..SSLLR---------------------------------------------------------ETARAKE
M0TQE9_MUSAM/30-700ALSGCSEST..GDIIS---------------------------------------------------------TTERLKQ
E5ACR4_LEPMJ/80-720HIAAANRET..GPVLE---------------------------------------------------------EATSLMN
Q6C1G5_YARLI/26-595LVNTCKNDT..RHVVS---------------------------------------------------------EGSELMA
A0A0D2XVZ8_FUSO4/62-692QVVEAHRQT..LPALS---------------------------------------------------------EASSLLE
C5GW18_AJEDR/57-748HIVLASQET..APVLE---------------------------------------------------------EATILMS
C1EEF9_MICCC/30-686VLDKSRERT..GNLLD---------------------------------------------------------ETARFNN
W1QBZ5_OGAPD/148-758RLSESLQDT..AEYKK---------------------------------------------------------EVKDLIQ
A8HUT2_CHLRE/30-678VVAATKSSS..ASLLA---------------------------------------------------------DTERLAR
B0VZV1_CULQU/39-627LLSSTEAQQ..KELIQ---------------------------------------------------------QANTLQE
G0RKF7_HYPJQ/55-674QIDSAHDRT..TPALR---------------------------------------------------------GMASLFE
Q00T18_OSTTA/88-728ALDGSKQKT..SALLR---------------------------------------------------------EAERASE
COG6_CRYNJ/70-689ELDQANSGT..KFLLE---------------------------------------------------------RADVLRS
A2E714_TRIVA/27-593KLSIGQKGV..DEVLD---------------------------------------------------------MTTSLYI
L8G9L6_PSED2/56-700HITAAHQET..APVLD---------------------------------------------------------EASDLMA
S2JPX5_MUCC1/49-650RIVKAESHT..ADMIE---------------------------------------------------------QADIMQE
G9PA30_HYPAI/22-644QIDLAHAQT..SPALR---------------------------------------------------------DMSSLFE
COG6_PHANO/55-693HIAAANKET..GPVLE---------------------------------------------------------EATGLIN
T5A889_OPHSC/60-688HIISAHTGT..LPVLT---------------------------------------------------------EAASLLQ
G7XM19_ASPKW/58-742HIVSARQET..APVLE---------------------------------------------------------EASALMK
N4VJY2_COLOR/52-699RITAAHQET..EPMLE---------------------------------------------------------EACALIQ
C4R6S3_KOMPG/154-788KLSSRVEDT..TRLDN---------------------------------------------------------SIHELHA
G8YLX1_PICSO/140-752SVEKDFDLV..KQLVE---------------------------------------------------------NVGDLNR
E1ZT97_CHLVA/34-681SLAGSRSAA..ADLLH---------------------------------------------------------DTDKLQR
W1P048_AMBTC/29-693ALNSCNATT..GDIIS---------------------------------------------------------TTERLKQ
A0A0D2VZS5_CAPO3/71-723RLNAATSKT..ATLLE---------------------------------------------------------VTNKLNS
K7J084_NASVI/37-626RLQTTKART..LQLID---------------------------------------------------------QTTKLQN
C5DUZ7_ZYGRC/192-819ETEADQSNE.DDSVTD---------------------------------------------------------RVNQLRA
V5HY00_BYSSN/58-733HISQAKQET..APVLE---------------------------------------------------------EASALMS
U9U8S1_RHIID/50-658SLESANRQI..AVLLE---------------------------------------------------------QSDSLKS
I1FMS4_AMPQE/123-704RLADTKAKT..AGLLN---------------------------------------------------------ETAELKA
COG6_PICST/163-782NIENKFKYS..SEFNT---------------------------------------------------------KVKELNS
Q7QJN1_ANOGA/32-623QLRNTEAQT..KDLIL---------------------------------------------------------QANTLQE
COG6_ASPOR/122-808HISLARQDT..APVLE---------------------------------------------------------EASTLMN
I1H7V6_BRADI/77-734ALSSCSAST..GDIIS---------------------------------------------------------TTERLQQ
F9XD71_ZYMTI/57-693HISASNRET..APMLD---------------------------------------------------------EAKSLLA
J7S8L6_KAZNA/176-802NPSINENDT.ETTFLK---------------------------------------------------------DIDKIRA
COG6_CANAL/150-758KINKNFDFS..NKLNL---------------------------------------------------------EIKDLND
F6SQE9_CIOIN/44-655RLAATKEQT..QELIT---------------------------------------------------------QTSELKT
B9N0R1_POPTR/31-709ALSSCSAST..GDIIS---------------------------------------------------------TTERLKE
T1I707_RHOPR/34-617QLVATKAQT..NQLIE---------------------------------------------------------QTTKLQA
COG6_CAEEL/38-623QMETVKFKS..VDLVQ---------------------------------------------------------KTASLKE
F7BIB8_HORSE/4-604RLQAAKEQT..QDLIV---------------------------------------------------------KTTKLQA
COG6_NEUCR/64-712QIHAAHAST..ASTLG---------------------------------------------------------EASQLMT
M3D478_SPHMS/53-688YVDASSRET..GPMLD---------------------------------------------------------EAKSMLA
G8JRN3_ERECY/172-797MQDSGHEEV...IVDS---------------------------------------------------------DVVDLRK
R1EQ64_BOTPV/49-680QISSANRET..RPMLD---------------------------------------------------------EASTLMT
I2H727_TETBL/181-823SNDDTPSDN...QLLL---------------------------------------------------------QLNSLNK

PF03081

B4LDS3_DROVI/323-697........P--SKHNE---------------------------------------------------------VFARLAY
Q5KMS6_CRYNJ/301-670........N--HPPQT---------------------------------------------------------ILTQTLA
J3MBU4_ORYBR/165-513.......FS--SLKED---------------------------------------------------------YFSAIGK
G1XRU1_ARTOA/244-617........S--NVWLK---------------------------------------------------------VYTQTTQ
W1PIG8_AMBTC/268-635.......LG--STSEA---------------------------------------------------------CFVEITK
S0EBU7_GIBF5/246-629........R--EDWGV---------------------------------------------------------VFQSTCQ
K4BC35_SOLLC/279-644.......LE--AVGSV---------------------------------------------------------CFAEASK
K3XWI2_SETIT/155-495.........--.EALG---------------------------------------------------------ELAAASA
C5E0R8_ZYGRC/237-621.......ES--DMKPI---------------------------------------------------------VFCNIVI
Q6ES92_ORYSJ/192-594DSKTAHADY--VQQVV---------------------------------------------------------QFARFAE
Q9SIB0_ARATH/210-552.......SS--TIRES---------------------------------------------------------AFAEITS
Q9LQP9_ARATH/238-587........S--SVAES---------------------------------------------------------CFVDITL
F6GST9_VITVI/277-640.......SD--LIKEV---------------------------------------------------------CFTETAK
G8ZSY9_TORDC/245-624.......EL--ELKPK---------------------------------------------------------VFTGTIK
I1LFL8_SOYBN/224-593.......QP--SISQK---------------------------------------------------------LFGDLAR
M4F3N2_BRARP/219-571.......SP--SVAES---------------------------------------------------------CFSEITL
W1NW13_AMBTC/231-604.......AK--GIGDA---------------------------------------------------------CFMEVVK
M0SRF8_MUSAM/218-582.......PR--SARES---------------------------------------------------------CFVEISK
J7REJ7_NAUDC/235-618.......YT--KYKPI---------------------------------------------------------VINSIIT
D2UX81_NAEGR/218-569........D--YQKNQ---------------------------------------------------------IYGDVVS
M4DQ92_BRARP/206-564.....SSSV--SIAES---------------------------------------------------------TFVEITL
K3Z4M7_SETIT/235-602.......KH--ALKDH---------------------------------------------------------CFAQLTA
B9S3S8_RICCO/351-722.......RP--SISSF---------------------------------------------------------LFSNLVR
B7P4G4_IXOSC/289-655......DGK--EPAAL---------------------------------------------------------PLERVVL
F6H2V1_VITVI/283-641.......GL--DVWMG---------------------------------------------------------CFAKIAA
Q9FNR3_ARATH/273-622.......FE--SISTA---------------------------------------------------------CFIEISK
M0THS1_MUSAM/243-589.......SD--TVREA---------------------------------------------------------LFAYIAG
C5XNX2_SORBI/186-525.......FT--SYTKL---------------------------------------------------------AFATACK
A7TQI9_VANPO/237-621.......QP--DFKPH---------------------------------------------------------ILSSIVK
K3XFC8_SETIT/312-653.......FN--RLKED---------------------------------------------------------YFLAIAK
E9G2G2_DAPPU/324-689........L--PHQKA---------------------------------------------------------VLSIILR
M4ELV2_BRARP/227-592.......SD--SIRES---------------------------------------------------------CFSEISR
D7MQ70_ARALL/301-664.......SE--SSKEV---------------------------------------------------------CFNETTK
M4E3U0_BRARP/64-418.........--GDEGS---------------------------------------------------------LFCIVTH
C5E318_LACTC/234-618.......KP--SFRDQ---------------------------------------------------------VFANIVT
M0RFS4_MUSAM/240-598.......LP--PFADI---------------------------------------------------------AFAAACR
M0S9N6_MUSAM/277-655.......VT--FNKDL---------------------------------------------------------CFAEVTV
J3MUP3_ORYBR/158-521.......DE--ELGHE---------------------------------------------------------CFADVAR
B9I6L2_POPTR/266-620.......LG--SVSDL---------------------------------------------------------SFMEVCR
E4X2L8_OIKDI/306-653........E--ASVED---------------------------------------------------------VLDKIVS
D7MSH8_ARALL/228-592.......SG--LIVES---------------------------------------------------------SFTEITQ
B9IK77_POPTR/253-654.......LG--TVNLV---------------------------------------------------------SFTE...
M0RET8_MUSAM/246-597.......SD--AVREV---------------------------------------------------------VFADIAG
A9RYU9_PHYPA/273-621.......LD--PHREK---------------------------------------------------------CFADVTD
Q69JW6_ORYSJ/346-696.......FN--SFKHD---------------------------------------------------------YFMVIAT
M1AX18_SOLTU/275-644.......DH--SVSSV---------------------------------------------------------CFVESSK
M0ZQS8_SOLTU/207-577.......SP--MISQS---------------------------------------------------------LFNNLAR
B8MLJ7_TALSN/245-625........G--ENQGR---------------------------------------------------------ALQATCR
I1I8W2_BRADI/260-643......GAE--NLGRE---------------------------------------------------------CFADVCR
K7M841_SOYBN/188-545.......FH--RAADV---------------------------------------------------------SFTEVCM
M7S7Y8_EUTLA/245-627........R--QDWGP---------------------------------------------------------VFQTTCQ
I1MUP7_SOYBN/290-649.......LD--DLKEI---------------------------------------------------------CFNETAK
I1LR33_SOYBN/232-587......SGK--RIAES---------------------------------------------------------CFAEITK
Q9LIA2_ARATH/266-643.......LN--EIGLT---------------------------------------------------------CFVDTVK
I1MBG5_SOYBN/274-630.......FA--SAADF---------------------------------------------------------SFMEVCR
M2MJA4_BAUCO/246-630........R--EQWPV---------------------------------------------------------ILLATCQ
B9RAG8_RICCO/276-630.......SD--SAKDV---------------------------------------------------------CFNETAK
U7Q7I3_SPOS1/370-767........R--DDWAP---------------------------------------------------------VFQGTCQ
Q5TQS7_ANOGA/318-703........P--SRHNE---------------------------------------------------------VFSRLSQ
E0VIX9_PEDHC/327-689........L--QHQSK---------------------------------------------------------IFEIIIK
EXO70_KLULA/234-616.......ET--SRQPV---------------------------------------------------------IYAKLCS
D8RZH2_SELML/269-629.......PG--GVEES---------------------------------------------------------CFAELAK
B9HPL3_POPTR/209-568.......SP--SLKES---------------------------------------------------------CFADITR
M7PEF2_PNEMU/241-608.........--KNYQN---------------------------------------------------------VLLILIY
C4LW49_ENTHI/279-679.........--NDFDK---------------------------------------------------------FFVGTTD
I1JCY6_SOYBN/322-699...SSLSTN--NIAAS---------------------------------------------------------LFANLSR
D6WW45_TRICA/328-692........P--RHQPR---------------------------------------------------------VFELIVR
B6K881_SCHJY/235-604........L--ADAKQ---------------------------------------------------------LYPLIVN
F0XF34_GROCL/729-1128........R--EDWGP---------------------------------------------------------VFQAACQ
D8SPE6_SELML/233-605.......DL--EESDT---------------------------------------------------------CFAEMAN
M0REN0_MUSAM/218-570.......LG--IADDA---------------------------------------------------------PFIETVK
E0CP16_VITVI/299-657......MEG--LIWTE---------------------------------------------------------CFVKIAD
K3Y3Q0_SETIT/194-605LATGKMAER--EQEVA---------------------------------------------------------QFARFAE
B9HV40_POPTR/282-631.......GP--EVWMD---------------------------------------------------------CFAKIVT
J3MH82_ORYBR/80-438.......RP--EAVSS---------------------------------------------------------CFAEIAS
B9GVY9_POPTR/242-613.......GT--AIDDA---------------------------------------------------------CFMETVK
M7UD48_BOTF1/247-635........R--DEWGK---------------------------------------------------------VFNLTCQ
W1PWG9_AMBTC/231-597.......SD--SIRQS---------------------------------------------------------CYSEIAA
N1J6U6_BLUG1/243-631........Q--DEWGK---------------------------------------------------------AFNATCQ
K3XSA8_SETIT/229-593.......TD--STADL---------------------------------------------------------CFYEISF
B9SNP4_RICCO/271-635.......IG--TVNLV---------------------------------------------------------CFTEASK
M1CZG7_SOLTU/225-591.......SD--SIRES---------------------------------------------------------CFTGIAK
Q9C8H6_ARATH/254-623.......GE--DVPLR---------------------------------------------------------CFGEIAS
H2ZQN6_CIOSA/276-638........E--KYRRK---------------------------------------------------------VFDNIIT
K3XFW5_SETIT/237-577.........--.FRDE---------------------------------------------------------YLLAIAE
A9TGT7_PHYPA/278-635........L--PLSAD---------------------------------------------------------IFNGIGK
M1W138_CLAP2/246-628........R--EDWGS---------------------------------------------------------VFQATCR
A5B8C4_VITVI/267-614.......FS--SAANL---------------------------------------------------------SFMEVCR
S3E3U8_GLAL2/246-630........R--DEWKK---------------------------------------------------------VFNLTCQ
B9T041_RICCO/247-608.......SE--TLRES---------------------------------------------------------CFSEITK
H6CBM6_EXODN/248-636........G--GDAGK---------------------------------------------------------VLSMTCA
I1JWP0_SOYBN/263-614.......FG--SFYQC---------------------------------------------------------CFSEISQ
F4KG58_ARATH/222-573.......VE--PFRDQ---------------------------------------------------------SFAEITT
F6GTU7_VITVI/230-591.......SD--SIRES---------------------------------------------------------CFSEITK
M4CLF8_BRARP/249-615.......SL--TIGQS---------------------------------------------------------CFNQIAK
W5EWA8_WHEAT/175-531.......IS--FNKDQ---------------------------------------------------------CFSELAG
I1MDK3_SOYBN/222-572.......ER--KIAES---------------------------------------------------------CFAAVCR
M1CA15_SOLTU/267-620.......FG--SVSST---------------------------------------------------------CFIEVSK
C4R8N1_KOMPG/235-620......NKS--QLISD---------------------------------------------------------TLVAVFE
Q8VY27_ARATH/245-606.......SN--STRES---------------------------------------------------------CFYEIAN
Q0CYR3_ASPTN/219-599........G--DQRGL---------------------------------------------------------ALQTTCR
U9SQP1_RHIID/236-607........S--ESVMP---------------------------------------------------------GYRDTIQ
EXO70_EMENI/247-629........G--DHRGL---------------------------------------------------------ALQMTCR
S2J047_MUCC1/214-590........E--QRRAA---------------------------------------------------------ALKGSIV
J3L5F1_ORYBR/344-686.......ST--SCSDL---------------------------------------------------------AFATASQ
K0KAQ4_WICCF/235-607.......NN--DQIIT---------------------------------------------------------IYQKLIR
M0W8E8_HORVD/215-574.......DE--ELGHE---------------------------------------------------------CFADVSR
R8BPV7_TOGMI/250-634........R--DDWGP---------------------------------------------------------VFQATCQ
K3ZHK2_SETIT/304-675.......AD--GLARS---------------------------------------------------------IFADLAR
M0TX18_MUSAM/52-414.......SD--AVRES---------------------------------------------------------CFADVAR
K4CMD0_SOLLC/278-635.......GL--DVWMG---------------------------------------------------------CFAKIAS
G3JCP3_CORMM/249-631........R--EDWGP---------------------------------------------------------VFQAACQ
Q6K647_ORYSJ/301-673.......SD--ELREE---------------------------------------------------------CFIESTK
J3N6B0_ORYBR/11-377......DDP--AIGRA---------------------------------------------------------IFVDLAR
C5FN52_ARTOC/246-625........P--DQQGK---------------------------------------------------------ALQATCR
J7R1E6_KAZNA/236-614.......YT--ALQPN---------------------------------------------------------VLISIIT
EXOC7_DICDI/437-835.........--...GN---------------------------------------------------------QYQLILD
K1X101_MARBU/264-643........R--DEWGK---------------------------------------------------------VFNLTCQ
W1NJ63_AMBTC/264-632SSPKGYLSS--PVSDL---------------------------------------------------------CFMEVCR
G0S641_CHATD/252-645........R--EDWGP---------------------------------------------------------VFEATCQ
D5GH85_TUBMM/239-604........T--PEWSR---------------------------------------------------------VYIATTA
A9SN89_PHYPA/313-674......GHS--VWV.E---------------------------------------------------------CLRNLAE
J9JWJ5_ACYPI/326-687........I--KHHHQ---------------------------------------------------------VFQIIIQ
W5AN73_WHEAT/1073-1426.......DA--VTEEE---------------------------------------------------------CFTEVAK
W1PHH8_AMBTC/279-635.......GP--DVWLG---------------------------------------------------------CFARIAI
U5H6T1_USTV1/251-633.......PP--STRRE---------------------------------------------------------IYSNILP
S7ZDA9_PENO1/246-625........G--DQQGL---------------------------------------------------------TLQATFL
K2RHI9_MACPH/246-628........R--EDWAR---------------------------------------------------------VYSQTCQ
F6HQX6_VITVI/246-608.......SD--SMRES---------------------------------------------------------CFAEISK
I1NUS0_ORYGL/283-640.......DA--EAEED---------------------------------------------------------CFTEAAK
M4AQR1_XIPMA/327-700........E--HHQKK---------------------------------------------------------TFDSLIQ
M7XH50_RHOT1/276-657.......PA--SQRTS---------------------------------------------------------LYSSLLR
K4DFQ8_SOLLC/257-617......TFK--DRCME---------------------------------------------------------CFARVAV
D7LD39_ARALL/243-607.......SS--TIRES---------------------------------------------------------CFYEIVN
E3S143_PYRTT/247-623........R--DEWSD---------------------------------------------------------VYVATCQ
E7LW76_YEASV/236-620.......YT--ESKPH---------------------------------------------------------VLSQILS
M3APZ2_PSEFD/248-629........R--DEWAS---------------------------------------------------------VLQATCS
T5A733_OPHSC/248-627........R--EDSGT---------------------------------------------------------LFQFTCQ
U5CZ65_AMBTC/305-668......MEG--SMWPE---------------------------------------------------------CFVKIAD
Q0U449_PHANO/247-623........R--EEWSS---------------------------------------------------------VCEATCQ
I1Q027_ORYGL/148-486.........--.AALG---------------------------------------------------------ELASASA
M1CE10_SOLTU/253-614.......FN--SVSDL---------------------------------------------------------SFMEVSR
M0U7Y4_MUSAM/169-538.......SD--SIREA---------------------------------------------------------VFADISG
EXO70_ASHGO/231-611.......LP--DRRPA---------------------------------------------------------VFCKIVA
G2XG72_VERDV/248-627........R--GDWGA---------------------------------------------------------IFQVTCQ
J3M2U7_ORYBR/269-636.......KC--TWKDN---------------------------------------------------------CFAEVTT
L8G7J8_PSED2/268-651........R--DDWGR---------------------------------------------------------VFNLACQ
M4CEA6_BRARP/229-593.......ST--NIVEA---------------------------------------------------------SFTDITQ
A9SZG5_PHYPA/276-645........P--PLNDI---------------------------------------------------------CFNDFAK
EXO70_YARLI/228-600.......DE--ARVKQ---------------------------------------------------------YFTQLAQ
A0A0D1CBV0_USTMA/294-724.....DKQT--LLLAS---------------------------------------------------------TFSQLAS
M0TA71_MUSAM/314-686.......HS--AIAYS---------------------------------------------------------IFHNFAR
I1N4J9_SOYBN/299-665.......GE--PVGLS---------------------------------------------------------CFVDASK
A0A068X0P1_HYMMI/337-709.......NS--HEAHF---------------------------------------------------------AYSLICR
M3J203_CANMX/209-599.........--.LSPK---------------------------------------------------------LLDAITQ
K3ZZ59_SETIT/223-607..TATSAGT--ATHDA---------------------------------------------------------PFAEAVK
F9XKX9_ZYMTI/246-627........R--DEWGA---------------------------------------------------------VLSATCQ
B9RM96_RICCO/288-654.......YP--SISQR---------------------------------------------------------LFSDLAL
D7L2C4_ARALL/228-595.......CT--AMDET---------------------------------------------------------CFMETVK
K7KYU0_SOYBN/278-635.......GP--EAWMG---------------------------------------------------------CFAKIAM
D7KZD8_ARALL/246-616......GAV--NIHEA---------------------------------------------------------CFMETVK
U5FM28_POPTR/271-621.......FG--SLDSY---------------------------------------------------------CFVEISR
W5AKS6_WHEAT/499-852.......NA--DTVDE---------------------------------------------------------CFTWAAK
S9VZ38_SCHCR/246-609........A--ETSQA---------------------------------------------------------LYQRIGK
R7YPE8_CONA1/246-628........Q--DEWSR---------------------------------------------------------VFKATCQ
M1C7K5_SOLTU/253-615.......ND--SIRES---------------------------------------------------------CFTEISK
E9EGW9_METAQ/241-624........R--EDWGP---------------------------------------------------------VFQGTCQ
G8YBT4_PICSO/212-624......MTN--GTRKQ---------------------------------------------------------LLRDIAI
M0RE29_MUSAM/266-621.......SD--DLKEE---------------------------------------------------------CFDEVAK
F6H486_VITVI/271-637.......VG--SVSSA---------------------------------------------------------CFVEASR
W1PQ65_AMBTC/301-663.......TE--EVRHA---------------------------------------------------------CFIESAK
T1K8E7_TETUR/311-683......IPI--KCQKV---------------------------------------------------------IFSRLVQ
J3MTK1_ORYBR/52-443TAAATAAAP--ATHDT---------------------------------------------------------PFAEAVK
I2H140_TETBL/236-622.......QA--DFRPL---------------------------------------------------------VFKSIIQ
M3DCX2_SPHMS/245-628........R--EEWGA---------------------------------------------------------VLRATLQ
I1N7V8_SOYBN/316-682.......CP--SVAAG---------------------------------------------------------LFGSLSR
K3YBY1_SETIT/269-627.......IT--FNKDQ---------------------------------------------------------CFVELAG
G7YLN0_CLOSI/142-557.......DL--DETQV---------------------------------------------------------SLDVILK
J3L4D1_ORYBR/230-594.......SE--STADL---------------------------------------------------------CFYEISL
R4XBR7_TAPDE/254-624........E--GEGLE---------------------------------------------------------IHHTTAG
A9RF66_PHYPA/295-650......GQP--VWV.E---------------------------------------------------------CLNYVAQ
A2FJ22_TRIVA/250-590.........--DKYQT---------------------------------------------------------PFNSSFT
I1MBG8_SOYBN/93-437.......FS--SVAAL---------------------------------------------------------CFNEVCR
J3NNQ2_GAGT3/246-625........R--DDWGP---------------------------------------------------------LFQTTCQ
M4CAS6_BRARP/212-578.......SV--SLRES---------------------------------------------------------CFRDISK
G8JUD2_ERECY/232-611.......QP--EKRAI---------------------------------------------------------VLNKVGF
G8B940_CANPC/213-611.........--.LPPE---------------------------------------------------------LIAQISE
K4ATI3_SOLLC/271-650.......SP--MNSQT---------------------------------------------------------LFSNLAR
K4D380_SOLLC/270-630.......QD--SLRDQ---------------------------------------------------------CFAEVTG
K4DB07_SOLLC/238-600.......SD--AIRET---------------------------------------------------------CFAEIAR
EXO70_NEUCR/252-636........R--EDWGP---------------------------------------------------------VFQATCQ
A8XF23_CAEBR/262-600........T--SKRAQ---------------------------------------------------------VFRELVS
M4E1D8_BRARP/269-620.......VE--SLRDQ---------------------------------------------------------CFGEVTA
M0TCN3_MUSAM/206-567.......SD--AIRES---------------------------------------------------------CFADVAR
D7KLE4_ARALL/242-609........G--TMEET---------------------------------------------------------CFMEIVK
K3Y1F3_SETIT/202-606LATGKTAEH--EQEVA---------------------------------------------------------QFTRFAE
J3MD06_ORYBR/268-610.......DN--KVEVD---------------------------------------------------------CFASATT
A9S026_PHYPA/305-661......GQA--VWV.E---------------------------------------------------------ILYDLAE
W1QJT2_OGAPD/249-609........F--NDINQ---------------------------------------------------------LLFEIFS
E2BW20_HARSA/356-713........T--SLQAQ---------------------------------------------------------VLEATVR
K4BUL3_SOLLC/313-670......MDG--VIWPE---------------------------------------------------------CFVKIAD
A5E7C7_LODEL/213-654.........--.LSTL---------------------------------------------------------FINPILE
EXO70_CANGA/235-620.......FA--EIKPR---------------------------------------------------------VLRNILD
C4Y3V1_CLAL4/216-602.........--VSGSP---------------------------------------------------------ILSNTLC
U4LH75_PYROM/239-603........S--SSWSA---------------------------------------------------------VYHGTTS
D7LJN0_ARALL/216-574.......SV--SVAES---------------------------------------------------------CFTEITL
K4BJZ5_SOLLC/284-648.......SE--LIKEV---------------------------------------------------------CFMETAK
C5MG62_CANTT/215-605.........--.LPVT---------------------------------------------------------FIGTIIE
EXO70_CANAL/230-665.........--.LSTH---------------------------------------------------------LIGPIVE
M4DQX8_BRARP/251-599......EEH--DVPLH---------------------------------------------------------CFGAIAS
A0A0D2X486_CAPO3/367-717........A--AHFDV---------------------------------------------------------TFSTLCK
F6HBV2_VITVI/280-635.......GS--DVSMD---------------------------------------------------------CFARIAI
I1JPF3_SOYBN/247-610.......SD--SVRES---------------------------------------------------------CFAEISR
M4D183_BRARP/85-443.......GS--NVWMD---------------------------------------------------------CFSKIAA
F6HRR9_VITVI/232-595.......SD--SIRES---------------------------------------------------------SFAEITR
B9RLN4_RICCO/271-620.......ST--AANSY---------------------------------------------------------CFVEISK
F6WWX5_CIOIN/361-724........E--KNRRQ---------------------------------------------------------VFDSIIT
I1IU67_BRADI/277-636.......IS--FNKDQ---------------------------------------------------------CFAELAR
A3LWD2_PICST/218-611.........--LPRSE---------------------------------------------------------VVGPIVE
U5GI23_POPTR/267-628.......LG--TVNLV---------------------------------------------------------SFAEVSK
G3B334_CANTC/207-579.........--..RVD---------------------------------------------------------LFGLIVD
B9HCA8_POPTR/242-605.......SE--SIRES---------------------------------------------------------CFSEISK
A9S081_PHYPA/264-622.......LD--PHREK---------------------------------------------------------CFADVTD
M0RMY7_MUSAM/168-542........G--LTDDA---------------------------------------------------------PFTEAVK
K1R8N3_CRAGI/240-606........D--KHHRS---------------------------------------------------------VFDNIIQ
M0TDJ2_MUSAM/228-592.......PG--SIREP---------------------------------------------------------CFVDISN
A9SEA0_PHYPA/286-643........L--SLSEN---------------------------------------------------------IFNEIGK
K3XX39_SETIT/77-423.......NS--MVEKD---------------------------------------------------------CFTRATT
K7UV86_MAIZE/134-473.........--.VAMG---------------------------------------------------------EFAAASA
M1BSP6_SOLTU/313-684.......QP--SISET---------------------------------------------------------IFSNLSR
U1GTL6_ENDPU/245-629........T--SEVGQ---------------------------------------------------------AIEATCQ
H2AMI9_KAZAF/241-641.......YP--NLKES---------------------------------------------------------VVTTILA
A9SHU0_PHYPA/294-653......ANG--AYIDE---------------------------------------------------------CLYKVAR
M0X2R1_HORVD/229-589.......SG--TAVDL---------------------------------------------------------CFYEISF
B9SQM4_RICCO/281-628.......ES--NVWMG---------------------------------------------------------CFAKIAT
C5YI28_SORBI/233-588.......DE--DLGHE---------------------------------------------------------CFADVAR
G2Q2Y8_MYCTT/252-644........R--EDWGP---------------------------------------------------------VLEATCQ
B9GMP7_POPTR/287-658.......HP--SISQR---------------------------------------------------------LFCHIAL
D8QQ88_SELML/278-638.......LE--PHREE---------------------------------------------------------CIVALLE
I1IU36_BRADI/316-680........S--GVGRA---------------------------------------------------------VFADLAR
Q7XVB9_ORYSJ/303-673.......SD--ELRDE---------------------------------------------------------CFVESTK
M0T4W9_MUSAM/300-646.......HP--AVSDR---------------------------------------------------------LFRRFAR
C5Y540_SORBI/271-624.......VN--FNRGH---------------------------------------------------------CFAELTA
Q6YYS2_ORYSJ/156-522.........--AADHA---------------------------------------------------------QFTGFAE
S3C6C9_OPHP1/275-678........R--DDWGP---------------------------------------------------------AFQNTCM
A0A0E0PVZ0_ORYRU/61-408.......DS--KVEED---------------------------------------------------------CFARATM
D8T120_SELML/259-622.......LD--PYREA---------------------------------------------------------CFAEITQ
L0PB59_PNEJ8/240-610.........--ENYGN---------------------------------------------------------ILLTLIY
G0V7P9_NAUCC/234-618.......YP--SYKPI---------------------------------------------------------IMKNILT
S8BBP5_DACHA/239-612........S--ENWLK---------------------------------------------------------VYTLTTQ
N1PXJ6_DOTSN/246-630........R--EEWGA---------------------------------------------------------VFEATCR
F6I1N2_VITVI/270-640.......YP--EIFSS---------------------------------------------------------QFSNLAR
M0UL49_HORVD/11-372.......SQ--SLRDK---------------------------------------------------------CFSAITK
F0ZNQ9_DICPU/422-793.........--...GN---------------------------------------------------------QYHTILE
D7L7W1_ARALL/228-598.......SV--SLRES---------------------------------------------------------CFRDISK
M0SVR7_MUSAM/268-627......GPR--DVALS---------------------------------------------------------CFAEIAA
M1C5W1_SOLTU/259-619.......SK--TINET---------------------------------------------------------CFSDIAK
C5XFH3_SORBI/239-578.........--.FRDE---------------------------------------------------------YLLAIAE
K7LHG0_SOYBN/296-660.......SQ--SISEA---------------------------------------------------------CFAEISR
M0UGE8_HORVD/125-479.......DR--KVEED---------------------------------------------------------CFARATT
B9T911_RICCO/241-598.......SA--SITES---------------------------------------------------------CFAEITR
A5DE46_PICGU/208-600.......IA--IDHHK---------------------------------------------------------IVSSIVA
A2DS47_TRIVA/252-593.........--DKYKS---------------------------------------------------------PFQNSFQ
U5CSC4_AMBTC/276-637.......ID--SLRDQ---------------------------------------------------------CFAEVTA
M0T8R9_MUSAM/272-640.......SE--ELRDE---------------------------------------------------------CFSETTK
M0T1U3_MUSAM/274-635.......IG--SVKDQ---------------------------------------------------------CFSEITA
G8BXH6_TETPH/237-621.......KN--DYKSF---------------------------------------------------------VIGDIIR
E9D819_COCPS/246-624........P--DQQGK---------------------------------------------------------ALQSTCR
Q9LMJ4_ARATH/247-592......PVS--SVTDL---------------------------------------------------------SFMEVCR
D7L7W0_ARALL/233-602.......SD--AIRES---------------------------------------------------------CFSDISR
E70B1_ARATH/265-614.......FS--SAADL---------------------------------------------------------SFMEVCR
E3Q9K9_COLGM/252-632........R--EDWGP---------------------------------------------------------LFQATCQ
F6GSY9_VITVI/271-629.......FG--SINPI---------------------------------------------------------CFVETSK
G1MYP9_MELGA/336-701........E--HHQKK---------------------------------------------------------TFDSLIQ
D7M573_ARALL/269-636......DHA--SIRKR---------------------------------------------------------LFTGLVS
E1Z8T0_CHLVA/286-659........P--SEQAA---------------------------------------------------------VLSQVAA
B9GF67_POPTR/330-700.......YS--SISSS---------------------------------------------------------LFSNLTR
G4MVD0_MAGO7/250-629........R--EDWAP---------------------------------------------------------LFQATCQ
G9MGQ5_HYPVG/255-640........R--EDWGP---------------------------------------------------------ILQATCQ
W1PMJ7_AMBTC/280-638........G--AMADS---------------------------------------------------------LFQNLAR
U5FZC2_POPTR/63-424.......SQ--TIRES---------------------------------------------------------CFSEITI
W5BVL2_WHEAT/184-551.......KH--AWKDH---------------------------------------------------------CFAAATS
EXO70_SCHPO/249-608........Q--VTAKA---------------------------------------------------------LYPKIVK
B9R6Z3_RICCO/301-666......MDG--VVWLE---------------------------------------------------------CFVKIAD
B9SF67_RICCO/265-616.......FS--SAADL---------------------------------------------------------SFMEVCR
K4C312_SOLLC/207-568.......SV--NIRDS---------------------------------------------------------CFSEISN
A9T7C4_PHYPA/238-605.......PV--SVACS---------------------------------------------------------CFNELGK
K7LIX4_SOYBN/109-470.......FD--SLSDQ---------------------------------------------------------CFAEVTT
M7ZQD7_TRIUA/1206-1561.......DA--ATEEE---------------------------------------------------------CFTEAAK

PF04100

VPS53_HUMAN/39-453......NKI--RLKIR----------------------------------------------------------------
Q9VQY8_DROME/42-434......QKM--QCEVS----------------------------------------------------------------
VPS53_SCHPO/16-394S...LSERL--QESVK----------------------------------------------------------------
VPS53_YEAST/5-369ITRSYKKQL--QEDIL----------------------------------------------------------------
VPS53_CAEEL/30-390......ASV--EGEIG----------------------------------------------------------------
VP53A_ARATH/1-424......QKI--QGEIR----------------------------------------------------------------

PF10475

Q7QF78_ANOGA/99-388------GVL--RRQHR----------------------------------------------------------------
Q336V4_ORYSJ/131-419------TLR--LAQLD----------------------------------------------------------------
Q54MU4_DICDI/72-370------KQF--TRAMD----------------------------------------------------------------
VPS50_CHICK/54-327------DKL--KQQQ.----------------------------------------------------------------
Q16RR9_AEDAE/70-360------GTL--KQQHK----------------------------------------------------------------
A1ZAY8_DROME/75-362------AQL--RTQQK----------------------------------------------------------------
Q54NV0_DICDI/113-401------VKI--SGYHE----------------------------------------------------------------
Q8RXC2_ARATH/132-421------TLR--LVQLD----------------------------------------------------------------
Q18602_CAEEL/76-363------FRL--KSQHT----------------------------------------------------------------
A8XSD2_CAEBR/80-367------FRL--KSQHT----------------------------------------------------------------

PF04048

SEC8_SCHPO/51-191G..RDYKSF--LNVYD----------------------------------------------------------------
Q69PQ1_ORYSJ/22-158....EIQFL--KEQSD----------------------------------------------------------------
Q59NP0_CANAL/27-168GLAHRLQEF--NMLKE----------------------------------------------------------------
A5E514_LODEL/26-167GLAHRLKEF--SGFKR----------------------------------------------------------------
Q6BLA3_DEBHA/30-171GMAYKLPEF--QDLSK----------------------------------------------------------------
A5DKL1_PICGU/29-170GLAHRLDDF--HDISK----------------------------------------------------------------
A3LUX9_PICST/29-170GLAHRFPEF--QHIMK----------------------------------------------------------------
Q75B87_ASHGO/33-174GLGHRYGEF--HQLKS----------------------------------------------------------------
Q6CNM5_KLULA/34-175GLHHRFDEF--IELKS----------------------------------------------------------------
A7TRV6_VANPO/35-176GLGHRYTEF--NQLKK----------------------------------------------------------------
Q6FWA6_CANGA/35-176GLGHRYIEF--NQLKE----------------------------------------------------------------
Q6C3L8_YARLI/34-175GKARFSKDY--EKLTS----------------------------------------------------------------
Q4WUD2_ASPFU/134-275GKADREPDF--LNMNQ----------------------------------------------------------------
SEC8_NEUCR/82-223GRAHEYRNF--QQTHQ----------------------------------------------------------------
A0A0D1E3Z5_USTMA/441-580GASRF..EF--DQVKQ----------------------------------------------------------------
E7M1P6_YEASV/34-174GLGHRYEEF--NQLKS----------------------------------------------------------------
SEC8_ARATH/16-151....DIHIL--KEQSD----------------------------------------------------------------

PF06046

Q28ZN5_DROPS/179-731NDQFAVQQQ--KVTGFLPP..................................................GRPKAWRKMIL
Q5K9B3_CRYNJ/179-740EDEKAVAMR--LVRKV.TT...TDAASKFKSMQ.................................ANARVIKNYRHKFL
EX3L4_HUMAN/179-709AHPSPPDDG--DFL.......................................................RTPRRWRQHWE
A5DIA8_PICGU/180-832EDLKFSLLN--KLDLLKARDMRIINYGNFR.......................................GSKRNYRKFFY
Q0TXU6_PHANO/187-762TDKKVKALQ--DAQRE.YK....DLASRFRSIN.................................SGPKELRGYKDKFI
EX3L1_BOVIN/188-722CTTSLEQ..--...........................................................APRDWRQRCL
SEC6_SCHPO/181-743SDEVLKSIR--DAKSSLPD....SQDGPFLSLQ.................................GMTRQLRNFRLRVL
TNAP2_MOUSE/157-688EDRRASG.G--PLAAALEA..................................................TRPRRWLQRWR
A5DY39_LODEL/293-930EDMKLQVTR--NLGILTHNI.IQ.DYKNFR.......................................SNERHYKKFFM
A0A0D1DY75_USTMA/258-828EDERAAAIR--LAKRA.NL....EGAARFRSVV.................................ANARVIKLYRPKFV
A4RYX1_OSTLU/92-690LDEEFERDA--LTFEP.ELDAATNKVINVA......................................PPEPKRWKTKVL
Q6DJR6_XENTR/177-732VDRRMMDRK--KQTGFIPP..................................................GRPKKWKDKMF
A3LNE6_PICST/180-819EDLKFSLMQ--SLGLNQSRDVKTIDYASFR.......................................GRRRNYRKFFY
Q8SU74_ENCCU/160-687RDELTRKVQ--EGEKS.DNPVLKEFYRMYRMY...................................ATRKTKKLKDKVI
Q16I77_AEDAE/179-730ADAFALQQQ--KQTGFIPP..................................................GRPKEWRKKAL
Q5RG40_DANRE/161-694QDRRWAEVS--ENQRP....................................................IWRPTECRQKIH
Q6CU40_KLULA/178-794EDIKIIATR--NIIKA.KELESESKKSKKVSDKMSAFDTNNKKYTEY....PTALGIATEINKGTIQTRTLPRGYKTFFL
Q5BBU2_EMENI/183-758NDETVKALQ--EAQKD.HQ....DLAGRFKSMN.................................VGPKTVRGYKEKFI
Q6FPK2_CANGA/177-798EDLRIEAIR--NIIKK.KEIEAEKSTFKKLPSSKNIGRLELESNSKALE.YPTDQGLYQEIINGTITTRVQSRGYKNLLY
A7F9Q6_SCLS1/177-755SDKRVMALQ--EALKD.HK....EMAARFKSIT.................................DGAKSTRGYKEKFL
Q6C9T6_YARLI/183-804EDLKATVLL--EVNGK.AKQQNGGTGGGFRSPHMNGNSNNKN..............NSMSVTLGNNVAPRSPRGYPTLFL
EX3L1_MOUSE/189-722RTI.LGQ..--...........................................................APRDWRQRCL
EX3L1_DANRE/206-763LDQFFLEER--RSTSGHNIPMPA..............................................GRPRNWRDRFF
EXOC3_DICDI/183-774HEQKQKEKK--SQNSLISSEGIHDDDDDDDDTEVNLNNSNKQQNNENEN.SSSNNNNNYDINNEDEGYDRNRSNYGDRFL
TNAP2_HUMAN/122-651EDRQAAAAG--PGTSGLAA..................................................TRPRRWLQLWR
Q6BJB6_DEBHA/180-833EDMKFELMS--NLKLMENRSISSIDYANFR.......................................GAKRNYKKFFY
EX3L4_MOUSE/181-708AHQTSQAEG--DFL.......................................................STPRHWRMHWE
Q5A7K3_CANAL/180-812EDLKVSLLK--SLDMV.SADPKTVNYKTFR.......................................GRSRNYKKFFF
A6RAW7_AJECN/390-965NDSKVRALQ--EAQKD.HK....ALASRFKSMN.................................LGPKTVRGYKENFL
E7KDN6_YEASA/178-797EDLRIEAIR--NIIKK.KEIEIEK.SS.IKKLPNSKNTARLQDETPKVIEYPTNKGLYQEIMSGTISTRTAPRGYKHFLI
H3DL97_TETNG/187-739IDRRMVDRR--KQTGFIPP..................................................GRPKRWKDKMF
EXOC3_HUMAN/188-743IDRRILDRK--KQTGFVPP..................................................GRPKNWKEKMF
Q1K527_NEUCR/175-753SDQRVLALQ--EALKD.HK....EMATRFQSIT.................................DGAKTVRGYKDKFL
SEC6_ARATH/173-736LDQQLAEEA--AEAEG.EGA..MASVANPRRPGKKSTTTSA.................SSKGLAQQKLKVQGKGYKDKCY

PF04091

W5E5N0_WHEAT/442-753......MNL--YEVVK---------------------------------------------------------AYLDRLL
A9S7S7_PHYPA/446-757......IDY--YDLVK---------------------------------------------------------RYLDKLL
H2WCC2_CAEJA/477-783QLNT..SAV--DDTVR---------------------------------------------------------RCANVLL
T1EMI3_HELRO/450-756NISR..TEI--DDTIR---------------------------------------------------------KFANTLL
A9V537_MONBE/417-723GLSS..TEV--DELLR---------------------------------------------------------QSTNHLF
Q6BHQ3_DEBHA/494-826YSYNI.NEI--NNFI.---------------------------------------------------------..VNDIF
E9G3C4_DAPPU/410-716NLAD..QEI--DDTLR---------------------------------------------------------RYTNLLL
B9GSB7_POPTR/457-761......LEF--FDVVK---------------------------------------------------------KYLDRFL
M7NJC8_PNEMU/439-739YNHC..HDI--DDILK---------------------------------------------------------QILDELL
U1HWP6_ENDPU/444-743FPHR..EVV--DEALR---------------------------------------------------------VALDDLL
G0VF38_NAUCC/501-841YRHDL.PAL--NRLLV---------------------------------------------------------NAIDKIF
K5VZV5_AGABU/444-743SRHH..RDI--DELLG---------------------------------------------------------KSLDNLF
R9AG66_WALI9/449-747..AQ..VDT--NSLIV---------------------------------------------------------DGLDSVM
D6X4X0_TRICA/433-740NLSQ..VEV--DEMIR---------------------------------------------------------KSMNLLL
C5E4W3_ZYGRC/494-839YRHEL.HTL--NNILV---------------------------------------------------------KTMESIF
G8ZUB2_TORDC/501-847YRHDL.HKL--SNTLV---------------------------------------------------------ATIDTIF
G2RB31_THITE/448-748FDHP..SVV--DETLR---------------------------------------------------------KTLDELL
U5FMP1_POPTR/442-753......TNI--YDVVR---------------------------------------------------------KYLDKLL
J9K5H0_ACYPI/421-724NFSE..GEV--DEMVQ---------------------------------------------------------KSTKLLL
C4R087_KOMPG/447-765YSYQG.REI--LRITI---------------------------------------------------------ETIDSVL
Q8S5T3_ORYSJ/442-753......TNI--YEIVK---------------------------------------------------------GYLDRLL
M4DPW7_BRARP/456-760......LDF--YDVVK---------------------------------------------------------KYLDRLL
G6DDP0_DANPL/419-720GLGG..GRR--AAAAR---------------------------------------------------------HSASLLL
M3XK92_LATCH/505-811HLSS..TEI--DDMIR---------------------------------------------------------KSTNLLL
D5GMB3_TUBMM/427-725FQNQ..GAI--DRELQ---------------------------------------------------------KSLDELL
W1QAD1_OGAPD/459-774YVHQN.SEI--LKLIG---------------------------------------------------------KSVDHVL
U9TBU2_RHIID/147-443SRQF..STV--DDIAK---------------------------------------------------------QTLDNLL
A5DMM0_PICGU/482-811YSHEQ.NEI--NSII.---------------------------------------------------------..VNEIF
R9P8Q0_PSEHS/445-756.TSH..REI--DEILK---------------------------------------------------------SSLDQLL
Q6C1W0_YARLI/480-793SEV...TQT--EDYVQ---------------------------------------------------------QAMDSLL
J3PJI4_GAGT3/450-750FQHP..NII--DETLR---------------------------------------------------------KSLDSLL
G8YKH3_PICSO/492-824YSHNS.YEI--VNIV.---------------------------------------------------------..VNEIF
J9EJI0_WUCBA/484-791QLSP..TEV--DDTVR---------------------------------------------------------RYANVLL
F6YT74_HORSE/409-715HRSS..TEI--DDMLR---------------------------------------------------------KSTNLLL
J4KKU7_BEAB2/450-750FQHS..DVI--DESLR---------------------------------------------------------QSLDELL
I4YIZ3_WALMC/449-754..SQ..IDT--DSLIA---------------------------------------------------------SALDRLI
F8PQ71_SERL3/445-743SQHH..ANI--DELLS---------------------------------------------------------KSLDQLL
G1XUE0_ARTOA/508-808FHHP..HTI--DETLR---------------------------------------------------------VSLDEML
A7TQS9_VANPO/506-845FRHEL.HRL--NSILV---------------------------------------------------------KTVDSLF
G3AZR4_CANTC/493-823YGYEL.NEL--NNII.---------------------------------------------------------..VEQIF
B4R147_DROSI/428-730TLSP..NEV--AAMVR---------------------------------------------------------KAANLLL
S8FZN9_FOMPI/445-743SQHH..RNI--DDLLS---------------------------------------------------------KTLDNIL
K5W5P8_PHACS/445-743SQHH..RNI--DDLLS---------------------------------------------------------KSLENLL
G2YIA1_BOTF4/452-752FQQP..NII--DETLK---------------------------------------------------------KSIDELL
A8NWX8_COPC7/444-743SQHH..RDI--DEILS---------------------------------------------------------KSLDNLL
R4X791_TAPDE/443-739TRS...DEV--EDLLR---------------------------------------------------------RSLDDIL
S9VV25_SCHCR/436-738......ITL--ALDVQ---------------------------------------------------------EKIPRFY
V2X5M8_MONRO/445-743SQHH..RNI--DELLS---------------------------------------------------------KSLDGLL
C5M2I2_CANTT/488-818YNYEI.GEL--NNII.---------------------------------------------------------..VNNII
I2H3Y9_TETBL/508-832YRHEL.HKV--NNILV---------------------------------------------------------KTIDSIL
Q17EP0_AEDAE/419-722TLSP..NEI--AAMVR---------------------------------------------------------KAANLLL
M2ZTI7_PSEFD/439-745FKHT..TVI--DKTLK---------------------------------------------------------ESLDELL
I1MM64_SOYBN/441-752......TGF--FDFLR---------------------------------------------------------KYLDKFL
B6K595_SCHJY/439-743......ITL--AVEVN---------------------------------------------------------ERAPRLF
U4LHC9_PYROM/436-732FQNE..IAI--DDELK---------------------------------------------------------ASLDELL
G3Q4R1_GASAC/450-759SLSS..TEV--DDMIR---------------------------------------------------------KSTNLLL
Q753S5_ASHGO/494-834FQHDL.SYL--NIVLV---------------------------------------------------------RTVDDIF
Q5KPL0_CRYNJ/450-754AQQH..LDV--DEVLR---------------------------------------------------------RSLDGLL
C4Y6U1_CLAL4/493-821YSHEL.SDL--NHII.---------------------------------------------------------..VNDIF
E0VNA5_PEDHC/435-739HISQ..ATN--NDMVI---------------------------------------------------------KSTTLLL
Q7RYL2_NEUCR/451-751FQHP..NIV--DETLR---------------------------------------------------------KSLDELL
H6BY38_EXODN/444-761TPSPLSSKI--DAELL---------------------------------------------------------TSLDDLL
J7R131_KAZNA/509-861YRHEL.AIV--NRILV---------------------------------------------------------GTIETIF
M0S2D5_MUSAM/444-755......VNF--DDVLK---------------------------------------------------------KYLNKLM
H2YEW6_CIOSA/141-441HLSS..TEV--DDMIR---------------------------------------------------------KSTNLLL
M7XX30_RHOT1/453-763AEHH..RDI--DDVLR---------------------------------------------------------KALDNLL
M2RQV4_CERS8/445-743SQHH..RNI--DDLLS---------------------------------------------------------KSLDTIL
M2N0E3_BAUCO/446-755FKHT..NVI--DQTLK---------------------------------------------------------DSLDELL
F4S5J6_MELLP/471-780VSAM..RDT--DDVLR---------------------------------------------------------KSLDKLL
H3CIW2_TETNG/458-766HLSS..TEV--DDMIR---------------------------------------------------------KSTNLLL
I3MQ17_ICTTR/423-732HRSS..TEI--DDMLR---------------------------------------------------------KSTNLLL
M1CVC4_SOLTU/449-755......MNF--FDFVK---------------------------------------------------------KYLDKLL
H2B145_KAZAF/504-852YRHDL.HSL--NNILV---------------------------------------------------------KTIDSIF
C8V0B6_EMENI/444-742FTNP..DII--DATLK---------------------------------------------------------DALDELL
D7TQV0_VITVI/442-753......MNF--YDIVK---------------------------------------------------------KYLDKLL
U5HF68_USTV1/463-770AEQH..RDI--DDVLR---------------------------------------------------------KALDNLL
SEC15_SCHPO/436-738......VIL--ATEVN---------------------------------------------------------EKAPRFY
K2SGN8_MACPH/382-681FQRS..TVI--DETLR---------------------------------------------------------KSLDELL
N1JD47_BLUG1/449-748FQHP..SII--DNTLR---------------------------------------------------------TSLDSLL
W5C2B9_WHEAT/447-753......VNS--YDVVK---------------------------------------------------------GYLDKLL
U5D3X0_AMBTC/442-753......MDV--YDVVK---------------------------------------------------------KYLDKLL
A6R9C0_AJECN/444-745FQHP..SMI--DETLR---------------------------------------------------------ESLDSLL
Q6CYE5_KLULA/489-828YKHDI.SHL--NLIVI---------------------------------------------------------KAIDNIF
T1ICC1_RHOPR/422-724NLSQ..GEV--DDMIR---------------------------------------------------------KSTNLLL
U7Q2U4_SPOS1/452-752FQHA..SVI--DETLR---------------------------------------------------------KSLDELL
V5ESV2_KALBG/448-756T.....REI--DEILS---------------------------------------------------------KSLDSLL
M9MGV3_PSEA3/448-761SQNH..REI--DEILK---------------------------------------------------------KSLDELL
M2T372_COCH5/443-742FQKS..SVI--DETLR---------------------------------------------------------TSLDELL
B0CXV0_LACBS/444-743SQHH..RDI--DELLS---------------------------------------------------------KSLNNLL
A8Q0J7_MALGO/448-754TQYH..QDI--DLILT---------------------------------------------------------QSLDDLL
L8GBJ1_PSED2/444-744FQHP..NVI--DETLR---------------------------------------------------------KSLDQLL
K1PXL0_CRAGI/475-788HLSH..TEI--DDMIR---------------------------------------------------------KSTNLLL
T1K0Q9_TETUR/511-835NISQ..TEI--EDMVR---------------------------------------------------------KSTNLLL
W4YBC1_STRPU/461-764HLTQ..TER--DDMIR---------------------------------------------------------KSTNVLL
I2FTP7_USTH4/451-766.GGY..REI--DEILK---------------------------------------------------------QTLDHLL
M4CSR8_BRARP/401-712......TNF--FSVLR---------------------------------------------------------KYLDKIL
SEC15_YEAST/521-864YRHEL.HTL--NNILV---------------------------------------------------------KTMDDIF
I1LA00_SOYBN/442-753......VNF--FGVVR---------------------------------------------------------KYLDMFL
D5G5B6_TUBMM/397-695FTHQ..SAI--DEELK---------------------------------------------------------SSLDELL
S2IZP1_MUCC1/463-761SQTH..GEM--DDILK---------------------------------------------------------KAVDSLL
K0KMH2_WICCF/500-804YKYDV.ESL--NKLVI---------------------------------------------------------ENVDNLL
A3LS60_PICST/480-811YSYEL.NEL--NHII.---------------------------------------------------------..VNDIF
C5DLI6_LACTC/498-839YQYDL.GEL--NNIIV---------------------------------------------------------KTVDDIF
G3AHA4_SPAPN/460-784YNYEI.TEI--NNII.---------------------------------------------------------..VNDIV
G8BTV9_TETPH/518-863FRHEL.HTV--NSILV---------------------------------------------------------TTVDHLF
G4TCP0_SERID/445-744SQHH..RDI--DELLG---------------------------------------------------------TSLDRLM
G8BIA4_CANPC/483-815YNYEI.NEI--INVI.---------------------------------------------------------..VNDIF
E6ZRP7_SPORE/448-761SQNH..REI--DEILQ---------------------------------------------------------KSLDELL
Q6FRK2_CANGA/501-841YRHSL.HSL--NNILV---------------------------------------------------------NTIDGIL
G0WGH4_NAUDC/507-859YRHQL.HTL--NKLMV---------------------------------------------------------KTIDRIF
E3KWD2_PUCGT/502-831......RDA--DDSIR---------------------------------------------------------KCLDSLL
K7IYQ6_NASVI/422-728NLTQ..TEI--DEMIC---------------------------------------------------------KSTNLLL
A0A0D1DRH1_USTMA/446-764.QNH..REI--DEILK---------------------------------------------------------KSLDELL
C3ZIQ9_BRAFL/402-708NLSH..TEI--DDMVR---------------------------------------------------------KSTNLLL
D8PS05_SCHCM/445-743SDHH..RNI--DDLLS---------------------------------------------------------KSLDSLL
A5E457_LODEL/496-826YSYEV.SEI--NDII.---------------------------------------------------------..VNQIV

PF09763

Q5K9I2_CRYNJ/487-1172QLNAVSDDI--SYIES---------------------------------------------------------QGKGLQV
Q75AA6_ASHGO/631-1297ELSSISKDI--EYVER---------------------------------------------------------QSNGLQV
A5DBH0_PICGU/595-1282GFKFLSHEI--NSIEN---------------------------------------------------------DSKGLQV
A3GH85_PICST/638-1329DFKFLSSEV--DTIEN---------------------------------------------------------NSQGLQV
Q6FRC5_CANGA/652-1329EMSNCSEDI--DYVES---------------------------------------------------------QNNGLQI
Q2UK85_ASPOR/702-1427ELNTLHDDV--SYIET---------------------------------------------------------QSQGLQV
A7TSV5_VANPO/776-1455EMNNLLDDI--EYVER---------------------------------------------------------QNNGLQV
Q6CQX3_KLULA/540-1218ELSSVSNDI--EFVES---------------------------------------------------------QQNGLQV
Q57ZX4_TRYB2/198-1064CILSQKEQL--QRIEH---------------------------------------------------------QHNTLQR
EXOC1_DROME/198-866ILGHVKETM--EKIGG---------------------------------------------------------KNAMIEI
A7E4X8_SCLS1/708-1443ELGTLNEDI--AYIEA---------------------------------------------------------QSQGLQV
Q6C0U5_YARLI/751-1484ELGGLGSDI--DYIES---------------------------------------------------------QGHGLQV
Q2GRZ6_CHAGB/575-1334ELSTLSDDI--AYIEA---------------------------------------------------------QGHGLQV
A7RVQ5_NEMVE/163-846KLRTVREHM--EQMED---------------------------------------------------------KDRHMET
Q5TMX8_ANOGA/201-872ILCHVRDTM--EKMGE---------------------------------------------------------KNQMIEI
A0A0D1E5C3_USTMA/474-1173QLNARADDI--SHIES---------------------------------------------------------QNRGLQV
A5E4P0_LODEL/994-1796NLKTLTNDV--NAIDE---------------------------------------------------------KSKGLQL
EXOC1_DICDI/107-855QLQDMKKYI--EHIEG---------------------------------------------------------KNNKMEI
A3KPP9_DANRE/184-869MLQSVKEQM--DQISQ---------------------------------------------------------SNRLIQI
E7LTP8_YEASV/640-1316EMSNFSNDI--ENVES---------------------------------------------------------QDNGLQV
V5ILH3_NEUCR/647-1440ELSTLSDDI--AYIEA---------------------------------------------------------QGQGLQV

PF04129

VPS52_YEAST/47-607RLSNYTQDL--DFIKK---------------------------------------------------------KSNELQS
VPS52_SCHPO/1-508DLDVATSDI--YKVSE---------------------------------------------------------RSNKIQV
Q9VMQ8_DROME/42-546VLNNISTEI--TQLQR---------------------------------------------------------KSVSMSL
VPS52_RAT/94-601DLSSISCEI--RTLQE---------------------------------------------------------QSGAMNI
VP52A_ARATH/93-587EIGSISSDI--KILQE---------------------------------------------------------KSMDMGL

PF15278

B6K1Q5_SCHJY/526-611---SMRENV--EELFR---------------------------------------------------------QKMQAK-
YD6C_SCHPO/520-605---AIISSV--ENLAE---------------------------------------------------------EEIELQ-

PF08700

Q5KJF4_CRYNJ/98-180------------------------------------------------------------------.RL---P..---..
EXO84_ASHGO/127-213------------------------------------------------------------------GDA---T..---..
COG5_MOUSE/37-120------------------------------------------------------------------HQA---V..---..
EXO84_CRYNJ/142-228------------------------------------------------------------------TGA---D..---..
Q6BJZ0_DEBHA/76-158------------------------------------------------------------------.HL---T..---..
Q0U0Z3_PHANO/76-170------------------------------------------------------------------ARE---G..---..
Q0WQ75_ARATH/43-129------------------------------------------------------------------KKS---N..---..
Q173I8_AEDAE/5-87------------------------------------------------------------------.QN---S..---..
A2D783_TRIVA/6-88------------------------------------------------------------------.KY---D..---..
Q7Q6Z6_ANOGA/11-97------------------------------------------------------------------KEC---S..---..
Q2UQ54_ASPOR/108-197------------------------------------------------------------------ATS---S..---..
VPS51_YEAST/84-163------------------------------------------------------------------.NL---P..---..
A2E266_TRIVA/29-115------------------------------------------------------------------NNQ---S..---..
Q2U987_ASPOR/1-88------------------------------------------------------------------FQY---P..---..
Q6FRQ2_CANGA/66-146------------------------------------------------------------------.EQ---T..---..
Q6CSC3_KLULA/100-179------------------------------------------------------------------.KK---S..---..
EXO84_GIBZE/128-214------------------------------------------------------------------SDA---T..---..
EXOC8_MOUSE/13-100------------------------------------------------------------------SQQ---S..---..
A0A0D1E7D8_USTMA/79-161------------------------------------------------------------------.SL---T..---..
Q8I2A9_PLAF7/116-202------------------------------------------------------------------EKS---S..---..
Q6CG64_YARLI/77-166------------------------------------------------------------------SSR---GSG---SR
Q4E335_TRYCC/3-85------------------------------------------------------------------.NN---T..---..
EXO84_YARLI/121-207------------------------------------------------------------------ATS---N..---..
Q4MZL9_THEPA/63-149------------------------------------------------------------------RNN---S..---..
COG1_SCHPO/7-89------------------------------------------------------------------.TH---S..---..
Q59L27_CANAL/17-99------------------------------------------------------------------.KL---D..---..
Q2UHE7_ASPOR/121-207------------------------------------------------------------------ANA---T..---..
Q7RZT4_NEUCR/9-91------------------------------------------------------------------.NY---P..---..
E9AC89_LEIMA/3-81------------------------------------------------------------------.QN---D..---..
A2GBI6_TRIVA/24-110------------------------------------------------------------------KNE---S..---..
Q4Y221_PLACH/14-100------------------------------------------------------------------EKS---T..---..
VPS51_DICDI/178-264------------------------------------------------------------------KSS---T..---..
VPS51_SCHPO/52-138------------------------------------------------------------------EKA---T..---..
Q9FFF3_ARATH/21-103------------------------------------------------------------------.TK---P..---..
A0A0D1CLQ0_USTMA/184-270------------------------------------------------------------------SHH---S..---..
COG1_DICDI/113-195------------------------------------------------------------------.RN---T..---..
A2FRD0_TRIVA/32-118------------------------------------------------------------------KTL---S..---..
A0C9R8_PARTE/6-92------------------------------------------------------------------KNH---S..---..
EXO84_CANGA/190-276------------------------------------------------------------------SEA---S..---..
Q754G8_ASHGO/53-137------------------------------------------------------------------AES---T..---..
VPS51_CHICK/57-143------------------------------------------------------------------SEC---R..---..
Q95Q35_CAEEL/9-99------------------------------------------------------------------KGV---K..---..
Q6C0N6_YARLI/24-102------------------------------------------------------------------.KY---S..---..
Q4DYG1_TRYCC/45-131------------------------------------------------------------------RRE---S..---..
B4QW21_DROSI/4-89------------------------------------------------------------------TRE---C..---..
Q5KKF4_CRYNJ/54-139------------------------------------------------------------------AKS---T..---..
Q7S488_NEUCR/124-217------------------------------------------------------------------QSS---T..---..
Q84K25_ARATH/20-102------------------------------------------------------------------S.F---T..---..

PF06148

Q0TYI9_PHANO/26-159------------------------------------------------------------------NRH---Q-------
Q29BE0_DROPS/22-154------------------------------------------------------------------RNA---P-------
Q7QFV1_ANOGA/25-157------------------------------------------------------------------RNA---G-------
Q84LH7_ORYSJ/24-156------------------------------------------------------------------RSY---V-------
Q01CT5_OSTTA/52-184------------------------------------------------------------------SSF---V-------
Q5K8I4_CRYNJ/34-165------------------------------------------------------------------RIH---I-------
A1C4Y0_ASPCL/32-165------------------------------------------------------------------NRH---Q-------
Q2UA29_ASPOR/27-160------------------------------------------------------------------NRH---Q-------
COG2_HUMAN/15-147------------------------------------------------------------------RKR---V-------
Q0C728_AEDAE/17-149------------------------------------------------------------------RKA---G-------
A8WN13_CAEBR/23-155------------------------------------------------------------------RQK---A-------
Q383M1_TRYB2/46-232------------------------------------------------------------------SHG---V-------
Q4DNE3_TRYCC/72-246------------------------------------------------------------------DHG---V-------
Q4Q0F6_LEIMA/80-262------------------------------------------------------------------QHG---V-------
A0CKT7_PARTE/12-141------------------------------------------------------------------INY---K-------
COG2_DICDI/53-185------------------------------------------------------------------RKR---V-------
F4JRR1_ARATH/31-163------------------------------------------------------------------RTF---V-------

PF10392

Q5KKM0_CRYNJ/10-154----------------------------------------------------------DQSQQN-NNKE---D-------
COG5_HUMAN/66-189----------------------------------------------------------......-....---.-------
Q6BT79_DEBHA/15-147----------------------------------------------------------......-.ATN---D-------
Q5B379_EMENI/829-961----------------------------------------------------------......-.ATN---N-------
Q5APN5_CANAL/17-149----------------------------------------------------------......-.ATN---G-------
COG5_SCHPO/8-139----------------------------------------------------------......-.SVH---A-------
COG5_YEAST/14-146----------------------------------------------------------......-.ATN---N-------
Q9C9V9_ARATH/57-180----------------------------------------------------------......-....---.-------
Q0U7T7_PHANO/13-145----------------------------------------------------------......-.STN---N-------
Q2HI55_CHAGB/25-157----------------------------------------------------------......-.ATN---N-------
Q6CLE2_KLULA/11-144----------------------------------------------------------......-VTNN---G-------
COG5_DICDI/63-186----------------------------------------------------------......-....---.-------
Q6C2T6_YARLI/5-136----------------------------------------------------------......-.QTS---S-------
Q75B18_ASHGO/11-144----------------------------------------------------------......-AINN---K-------
Q6FTM6_CANGA/9-140----------------------------------------------------------......-..AM---N-------
Q65XH1_ORYSJ/52-175----------------------------------------------------------......-....---.-------

PF04124

COG8_MOUSE/56-394----------------------------------------------------------IRGAEC-TERI---HRL---FG
COG8_SCHPO/15-354----------------------------------------------------------VDYARN-QDAF---YQL---LE
COG8_YEAST/28-381----------------------------------------------------------LDNTSQ-IIGN---ILE---ND
COG8_CAEEL/10-353----------------------------------------------------------ADAGRA-THDC---SKT---FG
Q9LYH5_ARATH/29-412----------------------------------------------------------ITAADA-LLAI---RQE---VS
COG8_DROME/37-379----------------------------------------------------------ITTAEN-SRSI---FSE---FL
Q9P3N9_NEUCS/31-347----------------------------------------------------------IESATH-HSTL---RTS---LP

PF15469

Q5KNA8_CRYNJ/115-308...........-.----------.........HGIRELRE---IF------------.KV...A-AHRA---DQV---FL
A7TRG2_VANPO/143-342...........-.----------.......NRINIEHLSE---KI------------.DD...Q-VKFT---NLK---LK
G8BMU6_TETPH/145-338...........-.----------.........IDIEALNG---KL------------.DD...A-VKAT---NQR---LK
C5DYM3_ZYGRC/146-354...........-.----------......GGQLDVNELGD---KV------------.DD...A-IRAT---TLK---LK
G8ZXE8_TORDC/144-345...........-.----------.......NQLDVDRLSS---KV------------.DE...S-ITAT---TLK---LK
H2AR86_KAZAF/151-365...........-.----------.........SNLAQLSE---KV------------.DE...S-IRAT---TLT---LK
G0VBU0_NAUCC/150-340...........-.----------.........LDVDRLNE---KV------------.DE...S-IRIT---NLK---LK
G0WGP4_NAUDC/153-350T..........-.----------.....EDPVLNIDQLHE---KV------------.DE...S-IRSI---NLK---LK
Q6FVL5_CANGA/149-372...........-.----------.........MKVEKLKE---EL------------.DE...T-IRFT---TQK---LN
E7QCY0_YEASZ/146-360K..........-.----------......ENQINVESLNK---KV------------.DE...V-IRTT---TFK---LK
C5DMT2_LACTC/144-330...........-.----------.........FGTDDLGE---TV------------.DE...S-IREI---TIK---VK
G8JTD1_ERECY/120-302...........-.----------.........LGIYHLDE---SL------------.NN...M-VRAT---TMK---LL
Q750U7_ASHGO/122-304...........-.----------.........LGIDHLDE---SV------------.NN...M-VRGT---TMK---VI
Q6CQH1_KLULA/148-350...........-.----------........ELSVQRLNE---NL------------.NE...T-MKQT---SLK---LQ
C4R5S5_KOMPG/139-344G..........-.----------......GKEAAVDYLKN---LI------------.EE...T-MARS---NEL---LK
Q6CGI4_YARLI/146-334...........-.----------.........WGMGELTQ---SL------------.DE...G-NSKA---AIL---MN
W1QF47_OGAPD/153-339...........-.----------..........NITALSE---SI------------.AK...A-NTSS---TMM---LN
C4YAI9_CLAL4/138-372KSKVFNP....-R----------SRSSLSDGSGLLSELEK---SI------------.NN...L-NLSS---TLM---IR
G8Y2A4_PICSO/149-393RSTVFNP....-Q----------RHKKKAHDESLVSSLEE---SV------------.NN...V-NMAT---SLV---IR
C5MH42_CANTT/104-348NSRVFNPQRRN-M----------VSTNSNGKEDLTSELEE---NI------------.SN...L-MNST---SAS---IQ
G3AUN6_SPAPN/128-368SSKVFNP....-.----------TKQRLDVQQDLCSELDS---AI------------.NN...M-NTTT---SLM---IR
G8BGG9_CANPC/145-407TSKYFNPQRHR-L----------NVSDNNGNGDISSELES---SL------------.NN...M-ATTT---TLM---IK
B6K5G3_SCHJY/147-340...........-.----------.........TPWKKIDT---DL------------.DK...V-LSTF---QSS---S.
C4M2W7_ENTHI/111-299...........-.----------.........GVYLNVVI---KM------------.QEKYNE-LLNS---LSS---IK
D6W674_TRICA/193-371...........-.----------.........PT.LKLEK---SI------------.KE...S-EREG---RKL---FD
B0W3D0_CULQU/193-383...........-.----------.........QV.KDLEV---AI------------.QK...S-IDAS---HEL---FK
B3MVG4_DROAN/193-383...........-.----------.........PL.NILEA---SI------------.EN...S-ITES---QKI---FT
G6D800_DANPL/194-372...........-.----------.........PL.PSLQS---AI------------.EE...S-ITLA---DSL---FS
E2AW35_CAMFO/194-372...........-.----------.........PT.EKLEK---AI------------.RQ...S-MSEA---NKL---FD
E0VQL4_PEDHC/200-377...........-.----------.........EFGEELEI---KI------------.QI...S-KEEA---CRL---FQ
E9G6B5_DAPPU/193-371...........-.----------.........MT.ASLEN---SI------------.LS...A-KTEA---GRL---FD
B7PR09_IXOSC/148-326...........-.----------.........LT.EKLSE---AV------------.LR...S-KEEA---ENI---FE
A8WPA7_CAEBR/200-378...........-.----------.........AL.GNISK---LI------------.KD...S-KLKA---ESV---FA
H3ERJ1_PRIPA/197-373...........-.----------.........AVTKIIGD---KV------------.SQ...A-REKA---ESV---FK
A0A0I9R3C5_BRUMA/212-385...........-.----------........WPLTKNISE---KL------------.TE...S-HTAA---NAV---FY
C3XUC7_BRAFL/191-370...........-.----------.........SITEKLET---LL------------.NN...A-NDKA---NAM---YQ
F6YQX0_XENTR/198-380...........-.----------.........SMTQVLEK---VL------------KTR...S-KNVH---FLL---FS
F7GSZ8_CALJA/50-227...........-.----------.........SMTQKLEN---VL------------.NR...A-SNTA---DTL---FQ
E4XNP2_OIKDI/201-392...........-.----------........PDMTDNLLG---LL------------.KK...A-ESRS---YNL---FE
F6Q8U3_CIOIN/201-380...........-.----------.........NLTDKLES---TL------------.NE...A-SENA---NKL---FD
G4VNQ3_SCHMA/214-394...........-.----------........DSNDLRLES---IL------------.YD...T-RTLG---HRL---FE
H2KP67_CLOSI/214-393...........-.----------.........QFELPFEA---SL------------.SE...S-RNLG---YEL---FE
F2UAY3_SALR5/207-386...........-.----------.........SITSKLAE---SI------------.SK...L-EETT---HAT---YD
A9RNH0_PHYPA/252-430...........-.----------.........TGTEHLHN---AI------------.AE...V-VVVA---KRA---FA
A9S1F4_PHYPA/259-437...........-.----------.........TGTVHLNN---AI------------.GE...V-DVFA---KRA---FA
D8RD25_SELML/239-417...........-.----------.........AGTAHLTH---AI------------.QD...L-DEVA---KRA---FG
D7KJZ0_ARALL/260-438...........-.----------.........SGTTHLFN---CM------------.KS...V-TSRA---NRA---FE
F0ZXN2_DICPU/132-311...........-.----------..............MSS---SF------------.TK...I-INKS---SDV---YH
F4PGL2_DICFS/126-305...........-.----------..............MSG---SF------------.KK...I-IDKS---EVV---YD
A8PCF2_COPC7/122-323...........-.----------.........YASKPLKD---QL------------.KQ...A-AQKA---NQV---FL
D8QDB4_SCHCM/114-323...........-.----------.........YASKPLRD---QL------------.KE...A-AIKA---DQV---FL
B8P2C9_POSPM/114-312...........-.----------.........FASRPLKD---HL------------.KL...S-AQKA---DQV---FL
G4TT08_SERID/115-310...........-.----------.........FATKKLKE---HL------------.KN...A-TTKA---DTV---FL
A8PUN7_MALGO/110-314...........-.----------.........EGVEGLRT---SV------------.TS...A-NSQA---DDV---FR
E6ZLD0_SPORE/109-315...........-.----------.........YGVASLNT---IL------------.AN...A-SAKA---DQV---FM
E3K655_PUCGT/121-321...........-.----------.........YGTADLKE---SL------------.RL...C-TSKA---DQV---YT
F4RSS6_MELLP/56-255...........-.----------.........YSIGPLRE---SL------------.KS...A-TSKA---EQV---YT
F4PCT9_BATDJ/225-428...........-.----------.........YGIAPFAK---AL------------.EE...L-ESNA---NNL---YG
D5GNN2_TUBMM/147-347...........-.----------.........WGVGKIRG---YL------------.ND...A-GAKA---DEV---FG
G1XK06_ARTOA/190-398...........-.----------.........WGLKTIRT---PL------------.NA...A-QAQA---ETL---FG

PF16528

C5DUD9_ZYGRC/539-743--------------------------------...S..SQ.V.D.------------.R...ED-IILH---SFF---VL
G0VJV4_NAUCC/543-749--------------------------------...F..DK.I.N.------------.D...ED-LMLH---KLI---SL
A7TL52_VANPO/508-712--------------------------------...S..DK.V.Y.------------.D...EN-EILH---SLI---SL
G8ZS82_TORDC/494-698--------------------------------...A..DQ.G.E.------------.D...DD-MMLH---GLI---TL
G8BNG7_TETPH/532-736--------------------------------...P..NE.I.D.------------.R...DE-ELLH---RLL---FV
G0W548_NAUDC/557-766--------------------------------...V..DN.MNN.------------.D...EE-MMLY---NVL---IL
EXO84_CANGA/545-749--------------------------------...K..DP.T.K.------------.E...ED-AIIL---NVL---TL
H2AXV4_KAZAF/523-731--------------------------------FAAN..QS.I.S.------------.K...NE-SMFY---NLI---LL
G8JS46_ERECY/478-682--------------------------------...V..AG...T.------------.E...EE-VMLL---DLL---KM
EXO84_KLULA/500-705--------------------------------...Y..SS.A.T.------------.F...DE-SVMV---ELL---SL
G0S6E5_CHATD/457-657--------------------------------...A..QG.L.K.------------.H....N-VIAQ---DFI---SF
E3S512_PYRTT/452-652--------------------------------...A..KN.I.R.------------.S...NE-M.AK---AIV---TY
EXO84_YARLI/444-642--------------------------------...K..ES...T.------------.D.....-.ITQ---QVL---DI
D5GAW7_TUBMM/436-637--------------------------------...G..RA.L.T.------------.S...NN-ALVA---ELI---NF
C4R6S9_KOMPG/506-717--------------------------------...L..PT.I.NL------------NDKLSEG-TVLF---DLL---KV
Q2H152_CHAGB/456-656--------------------------------...A..YG.L.K.------------.N....N-VIAQ---DFI---SF
C9S7T2_VERA1/440-640--------------------------------...A..RG.L.K.------------.S...N.-AVAQ---DFI---NF
B2B2W1_PODAN/463-663--------------------------------......LG.L.R.------------.K....N-AIAH---DFI---TF
H2Z9L4_CIOSA/281-487--------------------------------...R..EC.P.A.------------.KA.VVE-EQLY---NRT---TQ
H2MTA2_ORYLA/303-507--------------------------------...P..ST.Q.K.------------.V...KE-..LR---SKV---DE
G3JE74_CORMM/450-655--------------------------------...S..RG.L.K.------------.S...N.-AVAQ---DFI---SF
G0SXF2_RHOT2/870-1071--------------------------------...S..GD.A.H.------------.A...SQ-LFRS---KLD---S.
EXO84_CRYNJ/449-651--------------------------------...S..KS.I.E.------------.S...NS-S.AH---SLL---VS
C5FKA5_ARTOC/433-633--------------------------------...A..KG.L.K.------------.G...NQ-T.AQ---DAI---NS
F4P2Q9_BATDJ/415-626--------------------------------...NTTRKIL.SG------------VD...IK-TPRV---QML---RA
G0R9T9_HYPJQ/449-649--------------------------------...A..RG.L.K.------------.G...N.-TVAQ---DFI---NF
C7Z4G1_NECH7/445-645--------------------------------...A..RG.L.K.------------.N...N.-AIAQ---DFI---NF
I1G637_AMPQE/287-497--------------------------------...S..DQ.L.VL------------RN...TR-ARVN---HRI---NL
E7LRJ5_YEASV/465-668--------------------------------...S..ER.I.S.------------.D...EE-LMLL---NLI---SL
EXO84_ASPFU/445-645--------------------------------...A..RG.L.K.------------.G...N.-SYAQ---QII---NS
W4YYJ2_STRPU/291-496--------------------------------...P..VG.P.S.------------.L...KE-MR..---ARV---DH

PF06248

ZW10_DROPS/10-571NGSSTQLADHS-R----------ELRELMLGLQVSEHILKIDELF....-------.QCVEEAK-GTKD---YLV---VL
ZW10_ARATH/1-584RSVVDEITEKT-K----------EVKLKRESLDLVNAIVGICEAL....-------.QETKEAL-KNGR---FRF---AA
A7SSG2_NEMVE/20-670DAAAEEHANLV-Q----------QLKETDMVRVILIRLGKIHLGL....-------.ETLPGTL-KSKA---FCK---AA
A8XRG3_CAEBR/1-605KDSPEMLAEIK-T----------QARSCENLVEFLQSMKKVEEQLIIMR-------SKTTNRIE-WGNA---ILA---CK
ZW10_HUMAN/9-621HVSTGEFTDLK-Q----------QLERDSVVLSLLKQLQEFSTAI....-------.EEYNCAL-TEKK---YVT---GA
F1QYH5_DANRE/9-611HDAVTEYAKLK-Q----------QLEKNTAVIDLLQHLQEFDTAI....-------.EEYHRAL-QEKN---YVV---AA
F7EQH5_XENTR/9-617KVAVNEFTELK-Q----------QLEKNTVILGVLEQLQEVVSWV....-------.EKRH.TS-ITIV---FLV---TS
H3CQC8_TETNG/9-607QGAVTEYAKLK-Q----------QLEKNTVIIEVLGHLKEYKNAM....-------.EEFDKAL-PNKD---YVE---AA

PF11988

C5DYW5_ZYGRC/14-364LTKQSFSFQQS-V----------FSHVDTMHLQLVGKLYEIISQWFWQV.......N.GDSITF-KRLV...ELG---ED
A7TF57_VANPO/11-362LVRQNIRLQQS-V----------ATYVDSLHVQLVDKLFDLISNHFWNF.......K.EHTISH-KDEI...VYG---KD
Q6CUS2_KLULA/12-352ISGESFRFQQS-V----------ATYIDCLHLNVLERFKEV.SNMFYTI.......S.GNEMMF-KKTI.....E---LD
G0WD68_NAUDC/10-396FARQNYHFQRS-V----------IVYIDSLHLDLISRIFEIITLKFWNI.......T.SESISF-NPKLNVQTTD---GL
I2GW53_TETBL/23-390ILVKNYHLKQS-L----------SSYADGLHVQLIEAIHSLVSKGFWKIPTVSASDNQNVSIEF-QKII...HWG---NG
C5DK93_LACTC/23-365FPIQ...FQGL-L----------KVHIDSLHVDLLSRIDKVMRQ.FWDI.......S.ARSVTF-NQKI...AVD---RD
E7KT96_YEASL/5-360YLKQSFNFQQS-I----------STYVDTLHLELVSTLYKILTNGFWKI.......T.ENSIQF-TPTV...EWG---KD
G8ZQK5_TORDC/17-366ILSQSYGLQRS-V----------ATYVDNMHLDLVNSLYSILNDGFWKI.......G.SDFVSF-QEKV...AFG---ND
Q752C3_ASHGO/45-390VSAHGVRFEQA-F----------NTYLSGLHAVFVRKLQGLLEE.VWHI.......H.DDGFSF-QQQVSEKLDD---AR
J8Q396_SACAR/5-358FLKQSFNFQQS-V----------SSYVDTLHLELVNALHKILTTGFWKI.......T.ENSIQF-TPTV...KWG---KN
G8BQ21_TETPH/12-363LAKQNIRFQQS-V----------ITYVESLHLKLIEKVSDLLTEKFWNI.......T.SNSVVY-NASV.....E---LN
H2AUI4_KAZAF/5-354FIKQTYRFQRS-T----------ALYIDSLHSKLIDSIHEVITTKFWNI.......T.SNTIKF-NPKI...KIG---DD
Q6FNZ0_CANGA/3-351FLKQSLHFQRS-V----------AVHVDELRIKLLSTIYDILATKFWSI.......S.ESSFEF-HPDI...KWK---EE
G0V593_NAUCC/12-369FLKQSFHFQRS-V----------AVYVDTMHSTLIDKIFEIITTKFWQI.......NDTGSIAF-HKKI...TYG---PE
J7S867_KAZNA/7-376FVKQPLHFQRS-L----------MNYIDELHLTLIERIYEIISTDFWSV.......T.HDSITF-HNKI..VCSE---GS

PF06419

F4PTE8_DICFS/25-669DLKEIEEKEKM-V----------NDFLVKFKLSDEQEQALQKKD...................I-DASFFEALKR---LS
D7TU00_VITVI/30-688ELEITTQRQEI-A----------SCFLRDYQLSNEEISALREED...................L-NENFFKALSH---VQ
K4CMR1_SOLLC/27-689EFEVTTQRQEI-V----------SCFLRDYQLSPEEINALREED...................L-DDNFFKALAH---VQ
T1IZR2_STRMM/42-648DSQRLQMRHEI-A----------TEFLQTFQLQPEEVKSLRGTREGT................I-DDNFFAALKR---VK
E6ZVT0_SPORE/99-753QRAAALTQAQV-A----------TLFLSRFTLCEAERASIYSREVR.................V-GEELFRAMDK---LQ
E3QI24_COLGM/61-707ERAEVESKQHL-L----------KALRSHFVLSDNEIALLTSTAEP.................V-DDSFFAALHK---AK
G8ZRY6_TORDC/181-815DIKHLKLKRQI-L----------FAIKDQFTLNQVEDDIVTNGP...................V-GAQFFDVVAK---AM
D0NH36_PHYIT/44-655KRDKVQEAWKE-T----------KTFLDRYQLTEEEVRVLYTENLADE...............D-MDAFFSTLER---VR
G2XGZ3_VERDV/42-689QREDVATKQQL-L----------AAFCGHFLFTNDEIATLTSSAEP.................V-NEDFFAALAR---AK
C5M6P2_CANTT/146-753SKQLIGLKKNL-L----------INFKEKFTLNEYEEFVLNSGD...................L-NDEFFEILKR---AE
S3D9N6_GLAL2/53-695QKSQVEEKQQL-L----------KAFSTHFVMSEDDVASLTSTAEP.................V-DDRFFAVLSR---AK
K1QJ12_CRAGI/42-639ESQKVQMKLQV-A----------DVFLDKFQLKPNEVKALRGNRDGS................L-SQEFFNSLNK---VK
E9EWT4_METRA/42-671KREEVFVKQRV-L----------SAFKEYFLLTEPELVALTSTAEP.................V-DERFFDALSK---AR
C1GBA8_PARBD/57-738QRQEVETKHKL-L----------EAFSKHFTMSEDELISLTSSAEP.................V-DDRFYNALAR---MK
G0VHH4_NAUCC/184-845QMEWLRLKRQL-L----------INLKEKFTLNQVEDDLIVNSP...................I-NADFFVVINK---VL
T1K467_TETUR/31-648ERKTVDIQQAI-V----------DKFLDRFHLKPHEIAILKGLPSKEDPHQPLP.........M-TETFFELLGK---CR
B9S1S6_RICCO/31-692ELEVTTQRQEI-V----------SCFLRDYQLSNEEINALREEE...................L-NENFFKALSH---VQ
G3J3T2_CORMM/115-739KRRNTERRRHL-L----------QALRDRFVLSEDEELALTSTVEP.................V-NDAFFAALAK---AK
G3B3F3_CANTC/135-733QKTLVSLKKNL-L----------VNFKKKFILNEYEEFSISSNE...................V-NEEFFKALVK---LD
COG6_PICGU/138-737KKTAVVVKKQL-L----------SAFRAKFTLNEYEEYTLENGD...................I-SDEFFTVLAK---AE
U1G9I0_ENDPU/55-707QKQAVETKQQS-L----------NAFNNHFIVSEDDLTTLTNSTKP.................V-DDRFFQIMNR---VK
B7Q1K3_IXOSC/40-604QAQRLDERQKL-A----------GAFLHAFQLTPDELQALRTGSP..................G-DDRFFDALSR---AG
F1A3Z4_DICPU/25-688NLKDIEEKEKL-L----------NEFYKKFKLSQQEEYSLTNSTD..................I-DSNFYRALDR---LS
A5DUD8_LODEL/174-816ERTAVEIKQGL-L----------TAFKSQFTLNEYEEFILASGD...................L-NHDFFEALAK---AE
C5FL60_ARTOC/56-718QKEDAETKQAL-L----------NAFNTHFILPEEDVQALTSLAGP.................V-DERFFHILSR---VK
X1WYM6_ACYPI/29-624ERKSVSNQQLL-A----------NAYVKTFQLNSSEVACLRSNN...................V-TPEFFTALRK---TQ
COG6_CHAGB/47-689QRRQVEQKQAL-L----------GAFNTNFVLSEDETAALTLTSEP.................V-DDLFFAVLAK---AK
T1EFP4_HELRO/53-656ETHKLQLRNRL-V----------DAFLLKFQLTEEEKQALKTGRDGQ................L-RSDFFTALVR---VK
G4V7Z1_SCHMA/35-648DSKVAEIKAYL-L----------ELLVGSYQISAKDAQILSSKISH.................A-DDTFFSALLR---GK
C1MX75_MICPC/28-699EKRAIEERKRT-I----------KTFSVDFQLKDEEIALLKSDD...................V-TGAFFDALAR---VQ
COG6_ASPCL/56-753QKQESETKQQL-L----------DAFAKHFIIPEEELPVLTSLEEP.................I-DDHFFNVLAR---VK
R9NZP8_PSEHS/106-778QRAAALTQVQV-A----------KLFLSRFTLSEAERASIYSREVR.................V-GNDLFQAMDK---LE
M7T0Y3_EUTLA/61-714QRRNVETKQQL-L----------KSFRDQFVLSEDETASLTLTSEP.................V-DDRFFAVLAK---AK
B3N2A1_DROAN/35-627ERDRLEVHQQI-A----------QAFLARFQLSGAEHQLLYGAAKDAP...............I-VADFFKVLDR---VQ
G3AM15_SPAPN/147-779EKQLVGLQKNL-L----------IVFKEKFTLNEYEEFVLSQGE...................L-NEEFFVTLKK---AE
COG6_DEBHA/142-759TKSLINLKKGL-L----------ISFQNKFALDVYEEYVLQNGE...................I-NDEFFQVLIK---CE
COG6_DICDI/25-671GLKEIKEKENT-L----------QQFFKKFKLTPQEEQSLVKKE...................I-DSSFYQTLDR---LS
D6WE56_TRICA/33-626SGEKNDMQQQI-V----------HAFLETFQLTPDELVALHGNKQKRDAP.............L-TNDIFSALDH---IQ
K1Y0X5_MARBU/53-696QKAQVESKQEL-L----------KAFNTHFIMSDDDVATLTSSAEP.................V-NDKFFYNLAR---AK
R0IIQ7_SETT2/55-693QKKQVESKQQV-L----------NAFSAHFLITEEDVTVLTSTAEP.................V-NEEFFQILTR---VK
G2YFW1_BOTF4/53-688QKEQMQAKQEL-L----------NAFNAHFIMSDDDIALLTSTAEP.................V-NDKFFSILNR---AK
B3RLZ3_TRIAD/43-642EKQQLQMRARL-A----------NLFLEKFQLSPSEIKILHGSRNDP................I-KEEFFDALDR---VK
M2NAU2_BAUCO/56-695EKQQVEKKQRL-L----------DAFRAHFVVSDAELSILTASTEP.................V-NDDFFRVLTR---VK
COG6_MAGO7/54-703QKRQVEIKQRL-L----------KSFSGHFLLPEDEVAILTLTSEP.................V-DDRFFNVLAK---AR
N1PID3_DOTSN/58-692GKQQAETKQQL-L----------DALMTHFVVTDVDLATLTSTAQP.................V-NGDFFRILTR---VK
M7NMJ9_PNEMU/26-631RKILINTKQSL-L----------KSFNNNFIIENEDLEILSSISKP.................V-DERFFKILFK---VK
G0WDG5_NAUDC/220-947QVNLLRLKHQL-L----------TNIQKNFTLTQIEDDIIINGP...................I-DLEFFKVINK---VL
U4LN57_PYROM/30-663QKKVIEDKQML-L----------SAFTDHFTVSDEDIAILTSSVEP.................V-DDRFFNILQN---VK
F4NVM0_BATDJ/55-674KSEQASYRKVV-V----------DALLERFTLSDTEIRLLATSSET.................V-NTAFFAALSR---VQ
Q6NMI3_ARATH/31-678ELEVTTQRQEI-V----------NCFLRDYQLSNEEIKALREDE...................L-NENFFQALSH---VQ
A9SY28_PHYPA/31-697ELEHTTQRQEL-I----------TAFLNNYQLRPEEVTALREED...................I-SENFFKALMR---VQ
R4XC07_TAPDE/63-663QKKKVETKTVV-L----------DAFRAKFLLEESEVQVLSSQSI..................V-NEDFFKCLHR---IN
COG6_CANGA/184-819HLLKLEIKKKI-L----------KALQSKFTLNQLEDDLIENGP...................L-KEEIFDIVDK---LT
A0A088AU02_APIME/31-620KSQTLSMQQEV-A----------NAFIKNFQLTSSEQNILHGSTRESP...............I-TEEFFSVVNR---VQ
M3AVJ9_PSEFD/47-684DRRHVETKQQL-L----------HACKAHFVLSDPDLSSLTSTAEP.................V-NDDFFRILTR---VK
G8BSH8_TETPH/181-817EIDNLKQKKIL-L----------TAIKDEYTLTQVEENIIENGP...................V-NAEIFAVINK---IM
V5EQK1_KALBG/40-699QRAAALTQVEV-A----------NLFLSRFTLSEAERASIYSREVR.................V-AQDLFGAMDK---LQ
COG6_YEAST/190-824KAEQLKLKKKI-L----------LSIRDRFTLNQVEDDVITNGT...................I-DNIFFEVVKK---VI
C4Y1K1_CLAL4/138-736ENQLLGVKKAL-L----------ASFRRQFTLNEYEEYVLSAND...................I-NDDFFAALAR---AE
C5DMM3_LACTC/169-799ALLKHRLKKRI-L----------VMLRDKLTLNQVEEDALINSN...................V-GPEFFEVMKK---LM
J4VQT6_BEAB2/59-673KRRGIEGKRHL-L----------QILRERFVLSDEEELALTSAAEP.................V-DEVFFACLAK---AK
G8BDK2_CANPC/146-760EKQLIGIKKEL-L----------SAFKNKFTLSEYEEYMLVQGD...................L-NDDFFVALRK---AE
A0A0C4DUI8_MAGP6/47-702EKRQVETKQRL-L----------RAFQSHFLLSEDEVAILTLSAEP.................V-DDHFFSVLSK---AR
COG6_ASHGO/167-791KLEMLKLKKRV-L----------VGIRESLTLNQLEDEQLRNGE...................I-EDSYLDVLDK---MM
D8T0Q7_SELML/31-672DLDNTKQHQEI-V----------ASFLHNYQLSPEEVYALREEE...................L-NQNFFKALSR---VQ
COG6_SCHPO/44-649EEALIEEKLKN-I----------EIFEKNFVIMDDDLIHLTSSTD..................V-DDRFYLILDK---AQ
A4S9H0_OSTLU/72-716ELSVIESRREL-V----------NSFAVDFQLTKAHVDALTTVENASGENTEGASTAATAAPTL-PSVFFQALER---VK
M0TQE9_MUSAM/30-700ELELTTQRQEI-V----------SCFLRDYQLSNDEINALREEE...................L-GENFFKALVH---VQ
E5ACR4_LEPMJ/80-720QRKQVESKQQI-L----------HAFTSHFLISDEESTILTSTAEP.................V-NEEFFQALTR---VK
Q6C1G5_YARLI/26-595QQENISKKRDL-L----------KRYTDAFVLTEREMDILKGNDEV.................P-FETFKQVFIK---AQ
A0A0D2XVZ8_FUSO4/62-692QKRQVEVKQEL-L----------GAFKKHFVMSENEVAALTQTAEP.................V-DDRFFDALSK---AK
C5GW18_AJEDR/57-748QRREVETKQKL-L----------DAFNKHFIMSENELASLTSTAEP.................V-NDHFFHALAR---MK
C1EEF9_MICCC/30-686NLAKIEERKKM-L----------ETFLVDYQLTDEEISALRTDDQ..................I-TEKFFSALAR---VQ
W1QBZ5_OGAPD/148-758KRDLVKIKKSL-L----------VGFRSTFTLSAYEEHVLQNGD...................V-DQEFFNVVQK---VE
A8HUT2_CHLRE/30-678DLEAVERKQGL-V----------AQFLDTYQLTPEEVAALQGEE...................V-SPAFFAALSR---VR
B0VZV1_CULQU/39-627DNNKLLLQQRI-A----------TGFLSRFQLSVTEHQTLYGATRDEP...............I-TGEFFNVLDH---VQ
G0RKF7_HYPJQ/55-674QRLAIERKQEI-L----------GAIESYFIMTDDEIESLTSTMRP.................V-DTSFFSHLQK---AR
Q00T18_OSTTA/88-728DLRSIESRREL-V----------KSFAVDFQITKAQVDALTTVEDDSAASVD...........L-PAAFFPALER---VK
COG6_CRYNJ/70-689QRDSAQLRAHL-I----------TLFLSRFTLSNSELTALTSREVT.................I-GQPLFDALDH---VE
A2E714_TRIVA/27-593QQEKQRNQLTK-I----------HSFIEEYYLSEEDFACLEKGD...................I-DDKFFDAFSH---LE
L8G9L6_PSED2/56-700RKKDVEMKQKL-L----------QAFNTHFVMSDDDIATVTSTAEP.................V-NDEFFIVLNR---AK
S2JPX5_MUCC1/49-650HSNACSTQIAI-V----------DRFLAKFTLSEQEIKILSNMSEP.................V-DNEFFDALQH---LQ
G9PA30_HYPAI/22-644QHKEIERKQET-L----------SAVESYFVLTEDEIDLLTSTLKP.................V-DDAFFTCLQK---AK
COG6_PHANO/55-693QRKQVESKQQI-L----------QAFNSHFLISDEEATVLTSTAEP.................V-NEEFFQVLTR---VK
T5A889_OPHSC/60-688RRGEVEMKQRV-F----------TAFRDHFVMSDAEVAALTSTAEP.................V-DERFFQSLAR---AK
G7XM19_ASPKW/58-742QKKEAETKQEL-L----------EAFTQHFIVPDEDLLILTHAEEP.................I-DDHFFEVLAR---VK
N4VJY2_COLOR/52-699KRAEADSKQHL-L----------KLVRLQFILSDDEVASLTSTAEP.................V-DDRFFASLTK---AK
C4R6S3_KOMPG/154-788TSKIISIKKKL-L----------QNFQNRYTLSHFEAHQLEFGE...................I-DDSFLEILKK---AE
G8YLX1_PICSO/140-752QNTILLVKKRL-L----------SEFKSRFVLNEYEEFILQNET...................V-NDEFFGVLNK---AE
E1ZT97_CHLVA/34-681ALQVSETRSQL-V----------GRFLEQYQLTPSEAAALQGEE...................M-GDAFFQALAH---VR
W1P048_AMBTC/29-693EHENTTQRQEI-I----------SCFLRDYQLSSEEVNALREED...................L-NENFFKALAH---VQ
A0A0D2VZS5_CAPO3/71-723ESARVELRSEV-I----------ARFLQRFQLTAAETAALSSSSAGSGAGSGSAGAAAAVPV.V-NEALFSALAR---VR
K7J084_NASVI/37-626ESKKLTMQQEI-A----------NAFIKRFQLNADELAVLHGSSREAP...............I-TEEFFIVINR---VQ
C5DUZ7_ZYGRC/192-819DAKSLELKKQL-L----------IALRDQFTLNQLEDDIIANGE...................V-DLEFFKIVDK---AL
V5HY00_BYSSN/58-733QKQDTETKQRL-L----------DAFTRHFIVPDEDLIVLTSAEEP.................V-GDHFFDVLAR---VK
U9U8S1_RHIID/50-658QRETCKTRKIL-I----------DAFLKRFTLSEKEVTVITSPNSI.................I-GQEFFDALKH---LQ
I1FMS4_AMPQE/123-704RGRRLEMRGVV-I----------DVFLKKLQLTPEEVGILAGGV...................V-GEELFSVLHR---VK
COG6_PICST/163-782EKRLINLKKNL-L----------INFKAKFTLNEYEEFVLDSGD...................I-NDEFFTVLKK---AE
Q7QJN1_ANOGA/32-623ENAKLQIQQKI-A----------SGFLSRFQLSVAEHQMLYGAKRDAP...............I-TAEFFQVLDR---VQ
COG6_ASPOR/122-808QKKEAETKQQL-L----------DAFTKHFVVPDDDILVLTSLEDP.................I-NDQFFEVLAR---VK
I1H7V6_BRADI/77-734ELEVITQRQEI-V----------SCFLRDYQLSNEEIHALREED...................I-DDKFFKALLH---VQ
F9XD71_ZYMTI/57-693SKREVETKQQL-L----------NAFQAHFVVSDADLATLTSTAEP.................V-NDDFFRILTR---VK
J7S8L6_KAZNA/176-802QMDQLKLKKEL-L----------LAIKDKFTIDQVEDDIIQNSP...................V-DERFFEVVEK---VE
COG6_CANAL/150-758NKRLIGLKKNL-L----------ISFKEKFTLNEYEEFVLNSGD...................L-NNEFFTTLAR---AE
F6SQE9_CIOIN/44-655EGKKLDLQAKI-A----------DAFLDRFQLKPEEVKIFRGSRDGN................L-HPGFFKVLEK---VQ
B9N0R1_POPTR/31-709ELEITTQRQDI-V----------SCFLRDYQLSNQEINALRDED...................L-DDNFFKALSH---VQ
T1I707_RHOPR/34-617ENEKLTLEEKI-A----------SAMINTFQLTESEVTSLREGD...................I-NEEFFRVLER---AA
COG6_CAEEL/38-623KKASIESRCNM-I----------NEFLENYSLSSEELRELDECEQSGH...............L-SEFFFKVLER---CH
F7BIB8_HORSE/4-604ESQRLEIRAQV-A----------DAFLSKFQLTSDEMSLLRGTREGP................I-TEDFFKALGR---VK
COG6_NEUCR/64-712QKRQIESKQKL-L----------STFKTHFILTQDEVDALTLTSEP.................V-DDLFFTVLAK---AK
M3D478_SPHMS/53-688EKRRVETRQQL-L----------DALKAHFVVSDEDLATLTSTAEP.................V-NDDFFRIMTR---VK
G8JRN3_ERECY/172-797RLDHLKLKRKI-L----------IGIRDSLILNQLEVEQLDNGV...................I-DESYFQIVNK---LM
R1EQ64_BOTPV/49-680QKADTEKKQRL-L----------DALKAHFLLGDDELFTLTSTTEP.................V-NDEFFQLLTR---VK
I2H727_TETBL/181-823KLNALTLQKKI-L----------IALKDKFTLNQIEEDIITNSP...................V-AKPFFEIINK---VM

PF03081

B4LDS3_DROVI/323-697NAIELVV..KD.A----------EAITQ..RILRCI.....................SRKE--W-TSALGIF.SA...LK
Q5KMS6_CRYNJ/301-670SPITLAN..KA.L----------SPTLS..TLKKYL.........................--.-SRHTFTALDL...YA
J3MBU4_ORYBR/165-513VSV...M..KL.L----------N.YAK..VLCIKVSPSNDPS......CKDTNAAVKH..--D-ISKMVNVLTM...FQ
G1XRU1_ARTOA/244-617QALTVFS..NT.V----------RQLNK..HIVSFM.........................--I-TDCYLAF.DV...IE
W1PIG8_AMBTC/268-635GPI...M..QL.L----------N.FGE..AVA.IT.....................HR..--S-TDRLYCVIDM...YE
S0EBU7_GIBF5/246-629AAMAELA..RT.L----------RELNA..HIKSHL.........................--N-TDCYLAY.EI...TE
K4BC35_SOLLC/279-644ASI...L..QL.L----------N.FGE..AIA.IG.....................PH..--Q-PEKLIRILDM...YE
K3XWI2_SETIT/155-495GAMLKLA..AA.V----------AALGS.................................--S-PSKLLAALDV...YV
C5E0R8_ZYGRC/237-621PLITAYT..RL.V----------NLNLD..YVRSNL.........................--A-NTGILIF.EL...AD
Q6ES92_ORYSJ/192-594ESILRML..AF.V----------DAATL.AVVEEDD.....................DDHR--V-AEALPGMLQV...YA
Q9SIB0_ARATH/210-552QTA...L..AL.F----------T.FPE..KMA.KC.....................RK..--S-PEKIFLTLDV...YQ
Q9LQP9_ARATH/238-587QSA...L..NL.F----------I.FSL..TVA.KS.....................RK..--T-AEKIFPTLDV...YQ
F6GST9_VITVI/277-640SCV...M..QL.L----------N.FGE..AVA.IG.....................RR..--S-SEKLFRILDM...YD
G8ZSY9_TORDC/245-624PLLGAYV..KL.V----------ETNLA..YVRKNL.........................--E-NAGILSF.EL...AD
I1LFL8_SOYBN/224-593YVI...I..RL.L----------N.FAQ..GAV.LT.....................KW..--S-AEKLFKFLDM...YE
M4F3N2_BRARP/219-571DSA...L..TL.F----------I.FPV..SVA.RC.....................RK..--T-AEKIFLTLDV...YQ
W1NW13_AMBTC/231-604GAT...L..QL.F----------N.FAE..AIS.IG.....................RR..--S-PEKLFKILDL...HD
M0SRF8_MUSAM/218-582SSI...L..QL.L----------G.IAM..AIA.IA.....................PP..--K-PERLFQILNT...YE
J7REJ7_NAUDC/235-618PLINSYC..KI.F----------NSNMK..SIRNDL.........................--D-NMGLFSF.EL...VE
D2UX81_NAEGR/218-569PSLKIFK..EQ.A----------EDLAD..............................KNR--T-SEKVFVMLDI...LE
M4DQ92_BRARP/206-564QSA...L..KL.F----------I.FPI..TVA.KC.....................KK..--T-AEKIFPTLDV...YQ
K3Z4M7_SETIT/235-602KSL...S..IL.L----------S.FGD..AVA.KS.....................QG..--S-PEKLFVLLDM...FE
B9S3S8_RICCO/351-722GVM...I..QL.L----------N.FTE..GIA.MT.....................NH..--S-AEKLFKLLDM...YE
B7P4G4_IXOSC/289-655PALEATT..AE.G----------EALAN..RVKRCV.....................ARHD--F-VTVLCLF.PV...LQ
F6H2V1_VITVI/283-641QAG..IL..AF.L----------Q.FGK..TVT.ES.....................KK..--D-PIKLLKLLDI...FA
Q9FNR3_ARATH/273-622DAI...L..SL.L----------N.FGE..AVV.LR.....................SC..--K-PEMLERFLSM...YE
M0THS1_MUSAM/243-589DAA...L..HF.L----------S.FPV..SVA.KS.....................KR..--S-PEKLFRLLDL...YD
C5XNX2_SORBI/186-525P.F...L..QL.L----------S.FGK..VIA.AA.....................GH..--N-PESLFRIVDM...YD
A7TQI9_VANPO/237-621PLLNAYV..RL.F----------NINIS..MIKNNL.........................--E-NAGVFSF.EL...ID
K3XFC8_SETIT/312-653QSV...M..KL.L----------K.AAS..A.....SIDSVY........KDTYSTLKP..--D-LSKMVNMVMM...YQ
E9G2G2_DAPPU/324-689DALEMIC..HD.A----------ESLSG..RARRSV.....................SRQE--F-GPVLLLF.PA...LR
M4ELV2_BRARP/227-592ERA...I..LL.F----------T.FPE..IVALRT....................SKKNP--P-KDIIFRLLDM...YN
D7MQ70_ARALL/301-664SCV...M..QM.L----------N.FGE..AVA.IG.....................RR..--S-SEKLFRILDM...YD
M4E3U0_BRARP/64-418SLA...I..QL.L----------G.FYE..AVA.MT.....................KR..--S-TEKLFKILDI...YE
C5E318_LACTC/234-618PVLNNYV..KL.V----------KLNIS..LIKKNV.........................--L-NVGLFTF.EL...SD
M0RFS4_MUSAM/240-598PAA...A..GL.L----------S.FAY..VVA.AG.....................PR..--D-PVRLFRLIDM...YE
M0S9N6_MUSAM/277-655NSV...S..ML.L----------S.FGD..SVA.KS.....................KR..--S-PEKIFPLLDM...YE
J3MUP3_ORYBR/158-521GCV...L..QL.I----------G.FVE..AVA.MS.....................PP..--A-TEKLYRMLGM...YE
B9I6L2_POPTR/266-620GAV...V..QI.L----------N.FAD..AIA.IG.....................SR..--S-PERLFKVLDL...FE
E4X2L8_OIKDI/306-653NSVAQLN..MT.A----------EKLLA..ELNRCD.........................--.-NEEFGVFIELCPFIK
D7MSH8_ARALL/228-592EGA...L..IL.F----------T.FPE..YAA.KI.....................KK.L--T-PEKMFRFLDM...YE
B9IK77_POPTR/253-654PLV...L..QL.L----------TYFGE..AIS.TG.....................PG..--N-PGKLFHLLDM...YE
M0RET8_MUSAM/246-597EAA...L..QF.L----------G.FPE..SVA.KS.....................KR..--S-PEKLFRLLDL...YD
A9RYU9_PHYPA/273-621SSV...H..ML.L----------S.FGE..AIA.RS.....................KK..--T-PEKLFVLLDM...YE
Q69JW6_ORYSJ/346-696QSI...K..KL.V----------A.CGS..SMC...SWQQNSQDDPSTQSCAARESTKH..--T-TQMILNLVMM...YR
M1AX18_SOLTU/275-644GSI...L..HL.L----------K.FAE..SVA.IG.....................SH..--Q-PEKLIRILDM...YE
M0ZQS8_SOLTU/207-577SIV...I..QI.L----------D.FAE..AVS.WT.....................KR..--S-AEKLFKYLDI...YD
B8MLJ7_TALSN/245-625SSLAEFS..KT.L----------RELNQ..YIKSNL.........................--M-TDCFLAF.EI...IE
I1I8W2_BRADI/260-643GPV...L..QL.L----------G.FAD..AVA.MC.....................PR..--A-TEKLYRTLGM...YE
K7M841_SOYBN/188-545KLT...I..CL.V----------S.FAD.TIITTTT.........................--T-TTDQSYLLPS...F.
M7S7Y8_EUTLA/245-627APLSEMT..RT.I----------RELNN..HIKAHL.........................--S-TDCNLAY.EI...TE
I1MUP7_SOYBN/290-649GCV...M..QL.L----------N.FGE..AIA.IC.....................KR..--S-PEKLFRILDM...YE
I1LR33_SOYBN/232-587DGA...V..SL.F----------G.FPE..MVA.KC.....................KK..--T-PEKMFRILDL...YE
Q9LIA2_ARATH/266-643APM...M..QL.L----------N.FGE..AVS.LG.....................PR..--Q-PEKLLRILEM...YE
I1MBG5_SOYBN/274-630GSA...I..QL.L----------N.FAD..AVA.IG.....................SR..--S-PERLFRILDV...FE
M2MJA4_BAUCO/246-630NSLVAFA..ST.M----------RDLDA..HVRENL.........................--F-TDCFLAY.EI...VE
B9RAG8_RICCO/276-630GCV...M..QL.L----------N.FGE..AVS.IA.....................RR..--S-SEKLFRILDM...FD
U7Q7I3_SPOS1/370-767NALNELA..RT.L----------RELNS..HIKTHP.........................--Q-TDCYLAY.EV...VE
Q5TQS7_ANOGA/318-703PSIEMVV..KD.A----------EQITS..KVMRSI.....................GRKE--W-SAALGIF.SA...LK
E0VIX9_PEDHC/327-689SSMDMIV..QD.G----------ENIAS..RAKKCI.....................NKHD--F-AAVLIIF.PI...LK
EXO70_KLULA/234-616PIIQNYL..KI.I----------RHNRQ..LLKDNR.........................--E-NIGLFSF.EL...SD
D8RZH2_SELML/269-629GIM...M..QL.L----------C.FGE..AVA.IG.....................KR..--E-TDKLITILDM...YE
B9HPL3_POPTR/209-568EGA...L..SL.F----------V.FPE..NVA.KC.....................KK..--A-PERIFRTLDL...YE
M7PEF2_PNEMU/241-608PAIVTYC..DT.V----------QKLNQ..HIHQNM.........................--S-TDFALSY.EI...IE
C4LW49_ENTHI/279-679EPFTAFI..DL.Y----------TSFVS..TLQTLD.........................--T-PFIVFPLLDI...LE
I1JCY6_SOYBN/322-699GIM...I..QL.L----------N.FAE..SVA.MT.....................KR..--A-SEKLFKFLDM...YE
D6WW45_TRICA/328-692EAMDTIV..QD.G----------ENIVS..RAKKCI.....................SRHD--F-GTVLVVF.PI...LK
B6K881_SCHJY/235-604RVVDMVN..TV.F----------QQVFQ..IYNDRY.....................V...--.-YDNYILF.PM...VG
F0XF34_GROCL/729-1128PALTELA..RT.L----------RELNG..HIKAHP.........................--Q-TDCYLAY.EI...VE
D8SPE6_SELML/233-605DAALEVL..DM.I----------RVFA........T.....................PD..--K-PEKLFRLLDM...YE
M0REN0_MUSAM/218-570GAS...I..QL.F----------G.FAE..AIS.IG.....................RR..--S-PEKLFKILDL...HD
E0CP16_VITVI/299-657KIM...A..VF.F----------R.FGE..GVA.RS.....................NK..--E-PQKLFKLLDM...FD
K3Y3Q0_SETIT/194-605ASILRML..DF.V----------DAVVD.AALD........................DDQA--A-AEALPGMLQV...YT
B9HV40_POPTR/282-631QSG..IL..SF.L----------R.FGK..KIT.GC.....................KN..--D-PVKLMKLLDI...FS
J3MH82_ORYBR/80-438RAG..IL..DF.L----------K.FGR..AVC.DA.....................RK..--D-PIKLLRLLDV...FD
B9GVY9_POPTR/242-613GPA...I..QL.F----------N.FAE..AIS.IS.....................RR..--S-PEKMFKILDL...HD
M7UD48_BOTF1/247-635GAIAELS..RT.L----------RELNN..HIKSNL.........................--T-TDCYLAY.EI...VE
W1PWG9_AMBTC/231-597EAA...L..SL.F----------S.FPE..SIA.KG.....................KR..--A-PERMFRMLDM...YD
N1J6U6_BLUG1/243-631GSITELM..RT.L----------RDVNN..HIKANI.........................--T-TDCFLAY.EV...LE
K3XSA8_SETIT/229-593NSV...I..QL.L----------S.FYV..SVA.IG.....................PP..--K-TEKLFRLLDM...YE
B9SNP4_RICCO/271-635ASI...L..QL.L----------N.FGE..AVS.IG.....................PH..--K-PEKLFPILDM...YE
M1CZG7_SOLTU/225-591DSA...L..TL.F----------T.FPE..MVA.KY.....................KK.L--S-LEKMFRILDL...YD
Q9C8H6_ARATH/254-623NSV..IL..QL.L----------R.FGS..RIS.KC.....................KR..--E-PPKLIKLLDC...FS
H2ZQN6_CIOSA/276-638EPLETVE..QT.G----------TKIVE..YSKQCI.....................ARHD--H-PSIVNVF.PA...IK
K3XFW5_SETIT/237-577NRTLILL..EF.A----------DGFTT...............................IM--S-HEKLVYMLGM...YE
A9TGT7_PHYPA/278-635AAM...M..QL.L----------S.FGD..AIA.IS.....................RR..--S-PEKLVRVLDM...YE
M1W138_CLAP2/246-628GAVSELA..RT.V----------RELNA..HIKSHL.........................--N-TDCYLAY.EI...IE
A5B8C4_VITVI/267-614GST...I..QL.L----------N.FAD..AVA.IG.....................SR..--S-PERLFKVLDV...FE
S3E3U8_GLAL2/246-630GAISELA..RT.I----------RELNT..HIKNNL.........................--P-TDCFLAY.EI...VE
B9T041_RICCO/247-608EGA...I..NL.F----------R.FPE..LIV.KS.....................KK..--S-PERIFPLMEL...HE
H6CBM6_EXODN/248-636KALSTFS..RT.L----------SELNS..VIKSRI.........................--L-TDCFLAY.EI...LD
I1JWP0_SOYBN/263-614SFM...L..HL.L----------N.FGE..AVA.MG.....................MH..--T-PEKMFRLLDM...YE
F4KG58_ARATH/222-573ISF...G..ML.L----------S.FGY..AIA.IS.....................RR..--S-PEKVFVILDM...YE
F6GTU7_VITVI/230-591EGA...L..SL.F----------G.FPE..HVA.RC.....................KK..--T-PEKMFRILDL...YE
M4CLF8_BRARP/249-615EAG...L..NL.F----------T.LPE..LVAHKE.....................KKQH--H-HERIFKLMDL...YA
W5EWA8_WHEAT/175-531TGVSVAK..TL.L----------S.FGD..AVA.KS.....................KR..--S-PEKLFVLLDM...YE
I1MDK3_SOYBN/222-572EGA...E..SL.F----------A.FPE..KVA.KC.....................KK..--T-PEKMFRTLDL...YE
M1CA15_SOLTU/267-620DAM...M..CL.L----------N.FGQ..AVA.IG.....................PL..--L-PERLFCLLDM...YE
C4R8N1_KOMPG/235-620KLIDNFI..RL.I----------KELTD..FIETHL.........................--D-THGFLSF.EV...IE
Q8VY27_ARATH/245-606EAA...T..NL.F----------K.FPE..FVA.KE.....................KK..--S-HERIFPLMDL...QA
Q0CYR3_ASPTN/219-599PALAEYS..KT.L----------RELNQ..YIKANL.........................--M-TDCFLAF.EI...IE
U9SQP1_RHIID/236-607IPLDNYV..ET.G----------RTLTN..RIKKNM.........................--Q-TDVFLAF.DM...ME
EXO70_EMENI/247-629SAIAEYS..KT.I----------RELND..YIRTNL.........................--L-TDCFLAF.EI...ID
S2J047_MUCC1/214-590PATVEYI..AA.G----------KQLNA..VAKRLN.........................--Y-TETTFVF.DI...IE
J3L5F1_ORYBR/344-686P.F...L..QL.L----------S.FGN..FIA.AA.....................GK..--N-PECLFRIVDM...YD
K0KAQ4_WICCF/235-607NSIENYS..KI.I----------TNLIN..SIENSI.........................--T-NLGSLSF.EL...IN
M0W8E8_HORVD/215-574GCV...L..QL.L----------G.FAD..AVA.MS.....................AR..--A-TEKLYRTLGM...YE
R8BPV7_TOGMI/250-634ASLAELS..RT.L----------RELNS..HIKAHL.........................--N-TDCYLAY.EV...VE
K3ZHK2_SETIT/304-675GAM...L..HM.L----------S.FTE..AVV.LM.....................KR..--A-AEKLFKVLDM...YE
M0TX18_MUSAM/52-414DAA...A..AL.L----------A.FPE..SAA.RS.....................KR..--S-PEKLFRILDL...YD
K4CMD0_SOLLC/278-635QAS..IL..AF.I----------Q.FGK..TVT.ES.....................KK..--D-PIKMLKLLDI...FA
G3JCP3_CORMM/249-631SSLAELA..RT.L----------RELNA..HIKQHL.........................--A-TDCYLAY.EV...TE
Q6K647_ORYSJ/301-673GCI...M..QI.L----------S.FGD..AVA.VC.....................PR..--S-PEKLSRILDM...YE
J3N6B0_ORYBR/11-377CVM...L..QM.L----------N.FTE..AVA.MT.....................KR..--A-AEKLFKVLDM...YE
C5FN52_ARTOC/246-625PALAEFS..KT.M----------RELNM..YIKSNL.........................--I-TDCFLAF.EI...ID
J7R1E6_KAZNA/236-614PLLKVYS..KL.F----------LTNIT..AVQDNL.........................--Q-NIGIYSF.EL...VE
EXOC7_DICDI/437-835EIIDPAH..EL.L----------LETTE.PIIKVRK.....................TPGD--K-IFSIFPLLDL...FD
K1X101_MARBU/264-643GAISELA..RT.L----------RELNS..HIRANL.........................--P-TDCFLAY.EI...IE
W1NJ63_AMBTC/264-632GAM...T..QL.L----------T.FAD..AVS.IG.....................IR..--S-PEKLFKALDM...FE
G0S641_CHATD/252-645PSLMELG..RT.L----------RELNN..HIKAHL.........................--T-TDCYLAY.EI...VE
D5GH85_TUBMM/239-604MPMGVFK..KT.V----------ADLNV..FVKQNM.........................--A-TDCFLAF.DV...IE
A9SN89_PHYPA/313-674NEM...D..AF.M----------R.FGL..SVV.RG.....................ER..--Y-PEKLSKLLEM...FE
J9JWJ5_ACYPI/326-687ESLANIV..HE.G----------ESIAT..RAKRCI.....................HRKE--F-ANLFVMF.PI...LK
W5AN73_WHEAT/1073-1426GCV...L..QL.L----------R.FGD..AIA.IV.....................KR..--S-PEKLFRILGM...YE
W1PHH8_AMBTC/279-635QAG..ML..EF.L----------K.FGE..AVA.RS.....................KK..--D-PIKLLKLLDI...FA
U5H6T1_USTV1/251-633PSLSLFY..TT.G----------TQLNG..VVKKAL......................DAL--V-PIAFSTFSEL...QE
S7ZDA9_PENO1/246-625GAMGEYS..KT.L----------RELNQ..YIKANL.........................--M-TDCFLAF.EI...IE
K2RHI9_MACPH/246-628MALNEFA..KT.L----------RELNN..HVKSNL.........................--T-TDCFLAY.EI...ID
F6HQX6_VITVI/246-608EGA...T..LL.F----------E.FPR.LLVS.KS.....................KR..--S-PDMAFRTLDV...YT
I1NUS0_ORYGL/283-640GCV...L..QL.L----------N.FGD..AIA.IG.....................KR..--S-SEKLFRILGM...YE
M4AQR1_XIPMA/327-700EALDNLM..LE.G----------DNIVS..AARRAI.....................MRHD--Y-SAVLTIF.PI...LR
M7XH50_RHOT1/276-657PSLTLLT..NT.G----------QSLNS..LIKKSA.....................HYAL--V-PIAFATFQEL...QE
K4DFQ8_SOLLC/257-617QSG..IH..SF.I----------K.FGN..TIT.KG.....................KK..--E-AIKLLKLLDM...FG
D7LD39_ARALL/243-607EAG...I..NL.F----------R.FPE..LVANKE.....................KK.S--S-PERIFRLMDL...YA
E3S143_PYRTT/247-623FPLQDFT..KT.L----------RELNG..HIQKNF.........................--L-TDCFLGF.EI...CG
E7LW76_YEASV/236-620PLISAYA..KL.F----------GANLK..IVRSNL.........................--E-NFGFFSF.EL...VE
M3APZ2_PSEFD/248-629ETLRAFQ..ST.L----------RDLDA..HVRNHL.........................--I-TDCYLAY.EI...ID
T5A733_OPHSC/248-627AALTELA..RT.V----------RELNA..HIKAHL.........................--G-TDCFLAY.EV...TE
U5CZ65_AMBTC/305-668KIM...A..VF.F----------R.FGE..GVA.RS.....................SK..--E-PQKLFKLLDM...YE
Q0U449_PHANO/247-623EPLGEFS..KT.L----------RELNG..HIQKNL.........................--L-TDCFLGY.EI...CG
I1Q027_ORYGL/148-486GAMLRLA..TA.V----------AALGA.................................--S-PSALLAALDV...YV
M1CE10_SOLTU/253-614GST...I..QL.L----------N.FAD..AVA.IS.....................SR..--A-PERLFKVLDV...YE
M0U7Y4_MUSAM/169-538DAA...V..QF.L----------R.FPE..SVA.KC.....................KR..--S-TEKMFRILDL...CE
EXO70_ASHGO/231-611PILHNYT..KI.L----------RYNID..LVKDDI.........................--N-NYGLFSF.EL...SE
G2XG72_VERDV/248-627AALAELA..RA.V----------RELNV..HIKAHL.........................--T-TDCYLAY.EI...TE
J3M2U7_ORYBR/269-636KSL...S..TL.L----------S.FGE..AVV.QS.....................QT..--S-PDKLGVLLDM...YE
L8G7J8_PSED2/268-651GAMDDVG..RT.L----------RELNV..HIRAHL.........................--T-TDCFLAY.EI...LE
M4CEA6_BRARP/229-593EGA...L..TL.F----------S.FPE..HAA.KI.....................KK.L--S-PEKMFRFLDM...YE
A9SZG5_PHYPA/276-645SAM...M..HL.L----------S.FGG..AIA.IS.....................RR..--A-PEKLFKLLNM...YE
EXO70_YARLI/228-600TPLQTYQ..AA.G----------EEISN..HVQRNI.........................--S-TDALLIF.EL...IE
A0A0D1CBV0_USTMA/294-724QPLTALI..ES.L----------GTVQS..HVRRHL.........................--.-ATHTSFLLDL...IG
M0TA71_MUSAM/314-686GVT...V..LL.L----------G.FAE..AVA.TT.....................KR..--S-AEKLFKVLDM...YE
I1N4J9_SOYBN/299-665ASM...L..QL.L----------N.FGE..AMS.IG.....................PH..--Q-PEKLFRVLDI...YE
A0A068X0P1_HYMMI/337-709NAVNDLM..TE.G----------GAYVR..LMSRVI.........................--S-RHEFYMIVSLLTIMR
M3J203_CANMX/209-599EPMFKYN..EI.I----------TRYNQ.FFDAPSV.........................--I-TENIVLILEI...LD
K3ZZ59_SETIT/223-607GAA...L..QL.F----------G.FAE..AIS.IG.....................RR..--S-PEKLFKIIDL...HD
F9XKX9_ZYMTI/246-627DSLRSFS..NT.L----------RDLDS..HVRSHL.........................--L-TDCYLAY.EI...VD
B9RM96_RICCO/288-654AVT...V..RF.L----------N.FAE..AVA.LT.....................KR..--S-AEKLFKFLDM...YE
D7L2C4_ARALL/228-595ASA...L..RL.F----------T.FPE..AIS.IS.....................RR..--S-PEKLFKILDL...HD
K7KYU0_SOYBN/278-635ESG..IL..SF.I----------R.FGK..IIT.DR.....................KN..--D-PLKLLNLLSI...FK
D7KZD8_ARALL/246-616GPA...I..QL.F----------N.FAE..AIS.IS.....................RR..--S-PEKLFKILDL...HD
U5FM28_POPTR/271-621ASV...L..YL.L----------S.FGE..AIA.MG.....................PY..--N-PEKLFRFLDM...YE
W5AKS6_WHEAT/499-852GCV...L..QL.L----------N.FGD..AIT.IE.....................KR..--S-SEKLFRILDM...YE
S9VZ38_SCHCR/246-609NVISTVT..NI.I----------HQREA..VYEKQS.....................A...--.-LDNHVLF.PL...IH
R7YPE8_CONA1/246-628GSLNEFS..RT.L----------RELNT..FIQHNL.........................--M-TDCFLAY.EI...IE
M1C7K5_SOLTU/253-615DGS...M..IL.F----------S.FPE.IVAK.NC.....................KK..--S-PEKVFRLLDM...YT
E9EGW9_METAQ/241-624AALSELA..RT.V----------RELNA..HIKGHL.........................--G-TDCYLAY.EI...TE
G8YBT4_PICSO/212-624KGVEDSY..SGVL----------AEFQR..FFSGSE.........................--I-VSNDTLMLEV...IE
M0RE29_MUSAM/266-621FCV...M..HL.L----------K.FGE..AIA.EG.....................QR..--S-PERLFGILGM...YE
F6H486_VITVI/271-637ASI...F..QL.L----------N.FGE..AIV.IG.....................PH..--K-PEKLMRILDM...YE
W1PQ65_AMBTC/301-663GSV...M..QL.L----------N.FGE..AIA.IG.....................RR..--K-PEKLFRILDM...YD
T1K8E7_TETUR/311-683PALDFVV..NE.G----------ESIAG..RVKKCT.....................AKHD--F-TSALNLF.PI...LR
J3MTK1_ORYBR/52-443GAA...L..QL.F----------G.FAE..AIS.IG.....................RR..--S-PEKLFKIVDL...HD
I2H140_TETBL/236-622PVLDGYS..NL.F----------DSNVT..YVKNNL.........................--Q-DADVFSF.EL...ID
M3DCX2_SPHMS/245-628EAMKTFT..GT.L----------RDLDA..HIRNHL.........................--L-TDCYLGY.EI...ID
I1N7V8_SOYBN/316-682GVV...I..QL.L----------N.FAE..GAA.MT.....................KR..--A-AEKLFKLLDM...YE
K3YBY1_SETIT/269-627SSV...M..TL.L----------S.FGD..TIA.KS.....................KR..--S-HGNLFVLLEM...YG
G7YLN0_CLOSI/142-557VASNEIL..TE.L----------HNLVR..LLQLAE.........................--K-RAEFHMVLSLLLVMK
J3L4D1_ORYBR/230-594SSV...M..QL.L----------N.FYE..SVA.IG.....................PP..--K-PEKLFRLLDM...YE
R4XBR7_TAPDE/254-624AAFADYT..SA.I----------KAMIG..HIRSRI.........................--N-TDCYLGF.EA...LE
A9RF66_PHYPA/295-650PGM...S..AF.F----------Q.FGE..SFS.TT.....................SR..--S-PEKLCNLLEM...LE
A2FJ22_TRIVA/250-590PCFAMFI..KI.I----------DALQA..NVQAHI.........................--.-........DILLEID
I1MBG8_SOYBN/93-437GAL...I..QL.L----------N.FAE..AVA........................SGSP--S-EWRLSKILDM...FE
J3NNQ2_GAGT3/246-625ASLAEFS..RT.L----------RELNA..HIKAHL.........................--N-TDCFLAY.EI...VE
M4CAS6_BRARP/212-578EGA...L..LL.L----------G.FPE..SVAVRD.....................KKTP--N-PKKIFTLLDM...YG
G8JUD2_ERECY/232-611PILHNYA..KI.V----------KHNIQ..LTIDDL.........................--N-NYGLFVF.EL...GE
G8B940_CANPC/213-611YAIREYN..QV.M----------QSLAT..RLSTSL.......................GA--S-NDNYLILLEI...ID
K4ATI3_SOLLC/271-650AIV...I..QL.L----------D.FAE..AVT.MT.....................KR..--S-AEKLFKYLDM...YE
K4D380_SOLLC/270-630NSV...A..VL.L----------S.FGE..AIA.KS.....................KR..--S-PEKLFVLLDM...YE
K4DB07_SOLLC/238-600ESA...L..TL.F----------T.FPE..MVA.KY.....................KK.L--S-LEKMFTVLDL...YN
EXO70_NEUCR/252-636PALVELG..RT.L----------RELNS..HIKSHI.........................--T-TDCYLAY.EI...VE
A8XF23_CAEBR/262-600RPLAYVV..LQ.T----------QKVVN..EKDIGI.....................I...--.-........PL...LP
M4E1D8_BRARP/269-620NSV...A..IL.L----------S.FGE..AIA.KS.....................KR..--S-PEKLFVLLDM...YE
M0TCN3_MUSAM/206-567DAA...A..SL.L----------A.FPE..TVA.RS.....................KR..--S-PEKLFRILDL...YD
D7KLE4_ARALL/242-609GSA...L..EL.F----------N.FPE..AIS.IS.....................RR..--S-PEKLFKILDL...HD
K3Y1F3_SETIT/202-606VSLLRML..DF.V----------DAVAD.AAL.........................NDDH--S-PETLPGMLQV...YT
J3MD06_ORYBR/268-610RVI...Q..QL.L----------A.FGS..LITNVK........................E--Q-YEKLPLLIQM...HD
A9S026_PHYPA/305-661PEM...D..TF.L----------R.FGE..SVA.AS.....................ER..--S-PEKLCKLLEM...YE
W1QJT2_OGAPD/249-609PSLENFV..NQ.F----------NNFSS..FVEIHQSS................YSSMYFE--I-DHGLSLILSA...FR
E2BW20_HARSA/356-713DAMDLVA..HD.G----------DSIAT..RAKRCI.....................SRRD--F-SAVLVVF.PI...LK
K4BUL3_SOLLC/313-670KIM...A..VF.F----------R.FGE..GVA.RS.....................KK..--E-PQKLFKLLDM...FE
A5E7C7_LODEL/213-654YAITEYN..QT.I----------ISLSQ..QLQSQQQV.................TAQENT--R-NKSIFVTLEV...LD
EXO70_CANGA/235-620PIVAAFC..KV.L----------MSDLI..FVKSNI.........................--D-NAGLFSF.EL...TE
C4Y3V1_CLAL4/216-602GYLDNRL..TPIL----------IRYNT..SLDQSG.........................--P-LTYDIATLEL...LD
U4LH75_PYROM/239-603QAMSVFK..RT.V----------QDLNT..FISRNM.........................--S-TDMFLAY.EV...IE
D7LJN0_ARALL/216-574DSA...L..TL.F----------I.FPV..SVA.RC.....................KK..--T-VEKIFLTLDI...YQ
K4BJZ5_SOLLC/284-648GCV...M..QL.L----------N.FGE..AVA.IG.....................RR..--S-SEKLFRILDM...HD
C5MG62_CANTT/215-605EQIFKYN..EI.I----------MKYNQ.VFSSPSL.........................--I-IDNIVLILEI...LD
EXO70_CANAL/230-665ESISRYN..GI.I----------NKYNQVYFKTPQE.........................--I-VDNVILILEV...LN
M4DQX8_BRARP/251-599NSG..IL..QL.L----------R.FGS..RIR.KC.....................KK..--G-PPKLLKLLEC...FS
A0A0D2X486_CAPO3/367-717APLEHFI..TS.I----------ESIAS..KGKRQL........................G--K-GDCAIVF.ELLNILE
F6HBV2_VITVI/280-635QSG..FL..AF.I----------Q.FGN..TVT.ES.....................KK..--D-AVKLFKLLKI...FH
I1JPF3_SOYBN/247-610DGA...A..LL.F----------G.FPE..LVA.KT.....................KK.S--S-PEKLFRVLDM...HA
M4D183_BRARP/85-443QAG..ML..AF.L----------Q.FGK..TVT.DS.....................KK..--D-PIKLLKLLDI...FT
F6HRR9_VITVI/232-595EGA...I..NL.F----------K.FPE..LVA.RT.....................KR.S--S-PHKIFCFLDL...YE
B9RLN4_RICCO/271-620DSI...L..GL.L----------N.FGQ..AVA.MG.....................PR..--K-LEKLIRLLDM...YE
F6WWX5_CIOIN/361-724ESLKSVE..QA.G----------NKIVE..YAKQCI.....................TRHD--H-PSIVNVF.PA...IK
I1IU67_BRADI/277-636TGV...L..TL.L----------S.FGD..AVA.KS.....................KS..--F-PQKSFLLLEM...YE
A3LWD2_PICST/218-611RSVGEIYNHGI.I----------NRFSH.FFNSSSA.........................--I-IQNDILLLEF...ID
U5GI23_POPTR/267-628ASM...L..RL.L----------N.FGE..AVS.IG.....................PH..--K-PEKLFPILDM...YE
G3B334_CANTC/207-579HQMDSLN..EVMQ----------KNYVA..YFNNEN.........................--L-VTNDILVLEL...TQ
B9HCA8_POPTR/242-605EGA...T..LL.F----------G.FPE..LVA.KS.....................KKPS--S-SDKMFRALDM...YT
A9S081_PHYPA/264-622SSV...H..IL.L----------S.FGE..AIA.RS.....................KK..--S-PEKLFVLLDM...YE
M0RMY7_MUSAM/168-542SAA...L..QL.F----------G.FAE..AVS.TG.....................CR..--S-PEKLFKMLDL...HD
K1R8N3_CRAGI/240-606EGLDSVI..KN.G----------ELLAV..NAKKSI.....................AKHD--F-INVLSVF.PV...LK
M0TDJ2_MUSAM/228-592SSI...L..QL.L----------S.IAM..AIA.LA.....................PR..--K-PERLFQTLNT...YE
A9SEA0_PHYPA/286-643GAM...M..QL.L----------S.FGE..AIA.IS.....................RR..--S-PEKLFKVLDM...YE
K3XX39_SETIT/77-423GCT...K..QL.F----------V.VGS..AIAQ.......................AKDQ--D-YEKVPLILEM...YE
K7UV86_MAIZE/134-473GAMLKLA..GA.V----------AALGS.................................--S-PSKLLATLDV...YV
M1BSP6_SOLTU/313-684GMM...I..QL.L----------N.FAE..AVS.MT.....................KR..--A-AEKLFKFLDI...YE
U1GTL6_ENDPU/245-629NAMAVFA..NT.L----------MELNT..FIKSRI.........................--L-TDCFLAF.EI...ID
H2AMI9_KAZAF/241-641PLLNNYA..KL.F----------QTNLN..LIEQNL.........................--D-NVLFFTF.EM...VE
A9SHU0_PHYPA/294-653IGM...G..QF.I----------S.FGE..GVA.RS.....................QR..--A-PEKLFKLLDM...YD
M0X2R1_HORVD/229-589SSV...M..QL.L----------S.FYE..SVA.IG.....................PC..--K-PEKLFRILDM...YE
B9SQM4_RICCO/281-628QSG..IL..SF.L----------S.FGT..RVT.EC.....................KK..--D-PVKLLKLLDM...FS
C5YI28_SORBI/233-588GCV...L..QL.L----------A.FAD..AVA.VS.....................PR..--A-TEKLYRTLGM...YE
G2Q2Y8_MYCTT/252-644SSLVEFG..RT.L----------RELNS..HIKAHL.........................--T-TDCYLAY.EI...VE
B9GMP7_POPTR/287-658AVA...V..RF.V----------N.FSD..AIA.LT.....................KR..--S-AEKLFKILDM...YE
D8QQ88_SELML/278-638PNF...N..LL.A----------S.FGE..AVA.KS.....................KR..--S-PEKLFVLLDM...YE
I1IU36_BRADI/316-680CVM...L..QM.L----------G.FTD..AVA.AT.....................KR..--S-AERLFKVLDM...YE
Q7XVB9_ORYSJ/303-673GCI...M..QI.L----------N.FGD..AVA.VC.....................SR..--S-PEKLSRILDM...YE
M0T4W9_MUSAM/300-646GAT...V..QL.I----------T.FAE..AVS.IT.....................KR..--S-AEKLFKVLDI...YE
C5Y540_SORBI/271-624NSI...I..TL.F----------S.FGD..AVA.KS.....................KR..--S-PEKLFVLLDM...YE
Q6YYS2_ORYSJ/156-522ESILRML..AF.V----------DAVTL.SALNVND....................DHRHR--T-PELLPGMLQL...YA
S3C6C9_OPHP1/275-678SALNELA..RT.L----------RELNS..HIKGHL.........................--H-TDCYLAY.EV...VE
A0A0E0PVZ0_ORYRU/61-408RFI...Q..QL.F----------A.FGS..LIANVK.......................DE--Q-YEKVPLLVQM...LE
D8T120_SELML/259-622NSF...S..VL.S----------S.TGE..AIA.RS.....................KK..--S-PEKLFVLLDM...FE
L0PB59_PNEJ8/240-610STIVTYC..DT.I----------QKLDH..HIHQNM.........................--V-TDFTLSY.EI...IE
G0V7P9_NAUCC/234-618PLLNAYT..KL.F----------NTNLK..LVRNNL.........................--E-NIGIFSF.EL...VE
S8BBP5_DACHA/239-612PALTVFS..NT.I----------RQLNK..HIVTYM.........................--I-SDCFLAY.DV...IE
N1PXJ6_DOTSN/246-630ESLRTFT..NT.L----------RDLDA..HVRNHV.........................--V-TDCYLAY.EI...ID
F6I1N2_VITVI/270-640ATV...I..HF.L----------N.FAE..AVA.MT.....................KR..--S-AEKLFKFLDM...YE
M0UL49_HORVD/11-372NSL...A..TL.L----------S.FGE..AIA.TS.....................KR..--S-PEKLFVLLDM...YE
F0ZNQ9_DICPU/422-793EIIDPAH..EL.L----------LETTE.PIIKVKK.....................TPGD--K-VFSIFPLLDL...FD
D7L7W1_ARALL/228-598EGA...L..LL.F----------G.FPE..TIALRD.....................KKNP--N-PEKIFPLLDM...YC
M0SVR7_MUSAM/268-627HAG..ML..AF.L----------R.FGK..TVT.ET.....................RK..--D-PIKLLKLLDI...FA
M1C5W1_SOLTU/259-619EGG...I..VL.L----------K.FPE..VVA.KT.....................KK..--S-HEKIFLLMDL...HE
C5XFH3_SORBI/239-578NRILILL..DF.A----------NGFTS...............................IT--S-HEKLVYMLGM...YE
K7LHG0_SOYBN/296-660SGA...N..LL.F----------G.FPE..LVA.KT.....................KK.S--P-PEKIFRMIDM...YA
M0UGE8_HORVD/125-479RCT...G..EL.L----------T.FGS..MMANVK.....................VNDQ--Q-HHKVPLLLQM...HE
B9T911_RICCO/241-598EGA...L..AL.F----------A.FPE..NVA.KC.....................KK..--T-PEKMFKTLDL...YE
A5DE46_PICGU/208-600RVVNDSY..TSVV----------DTLNE..FVSSQG.........................--V-LDNDIMLLEV...IE
A2DS47_TRIVA/252-593PLFQHFK..KT.C----------VNVSD.PDLKSHV.........................--.-........DVLFDVD
U5CSC4_AMBTC/276-637NSV...T..ML.L----------S.FGE..AIA.KS.....................KR..--S-PEKLFVLLDM...YE
M0T8R9_MUSAM/272-640GCV...M..QL.L----------N.FGD..AIA.IC.....................QR..--S-SEKLFRILDM...YE
M0T1U3_MUSAM/274-635NSM...L..VL.L----------S.FGE..AIA.KS.....................KR..--S-PEKLFVLLDM...YE
G8BXH6_TETPH/237-621PLLDAYV..RI.F----------NNNME..LVKSNL.........................--E-NAGLFSF.EM...ID
E9D819_COCPS/246-624SALAEFS..KT.L----------RELNM..YIKSNL.........................--M-TDCFLAF.EI...IE
Q9LMJ4_ARATH/247-592GTT...T..QL.L----------N.FAD..AIA.LG.....................SR..--L-PERLFKVVDL...YE
D7L7W0_ARALL/233-602DGA...L..LL.F----------G.FPE..IIATKT....................CKKHS--P-PEKLFRLLDM...YT
E70B1_ARATH/265-614GST...I..QL.L----------N.FAD..AIA.IG.....................SR..--S-PERLFKVLDV...FE
E3Q9K9_COLGM/252-632AAMAELA..RT.L----------RELNS..HIKGHL.........................--N-TDCYLAY.EI...TE
F6GSY9_VITVI/271-629VSM...L..RL.L----------N.FGE..AVA.IG.....................QH..--L-PEKLFSLLNM...YE
G1MYP9_MELGA/336-701ESLDNLI..ME.G----------DNIVS..AARKAI.....................IRHD--Y-SAVLTIF.PI...LK
D7M573_ARALL/269-636AVT...I..RF.L----------D.FSG..AVV.LT.....................KR..--S-SEKLFKFLDM...YE
E1Z8T0_CHLVA/286-659GGAASLL..EA.A----------DVVLA..............................ARR--V-PEKLFGVLDM...HD
B9GF67_POPTR/330-700SVL...I..QL.L----------N.FAE..AVA.MT.....................KR..--S-AEKLFKFLDV...YE
G4MVD0_MAGO7/250-629NAIVELS..RT.L----------REINA..HIKVHL.........................--N-TDCFLAY.EI...VE
G9MGQ5_HYPVG/255-640AAVTELA..RT.L----------RELNT..HIKSHL.........................--T-TDCYMAY.EV...TE
W1PMJ7_AMBTC/280-638GVV...I..QL.L----------N.FAE..AVA.MS.....................KR..--S-AEKLFKFLDM...YE
U5FZC2_POPTR/63-424.GG...L..NL.F----------R.FPE..LVA.KC.....................KK..--L-PERIFPLLDL...YE
W5BVL2_WHEAT/184-551KSL...L..NL.L----------S.FGQ..AIS.KS.....................KT..--S-PDKVFLLLDM...FD
EXO70_SCHPO/249-608PAINTVT..NA.T----------RQLEG..VYEKRG.....................A...--.-AENFVLL.SL...ID
B9R6Z3_RICCO/301-666KIM...A..VF.F----------R.FGE..GVA.RS.....................NK..--E-PQKLFKLLDM...FD
B9SF67_RICCO/265-616VST...V..QI.L----------N.FAD..AVA.IG.....................SR..--S-PERLFKILDL...FE
K4C312_SOLLC/207-568DGA...L..TL.F----------L.FPE..MVM.KF.....................KK.L--S-PEKMFRVLDM...YE
A9T7C4_PHYPA/238-605GPM...M..QL.L----------S.FGE..AVA.IS.....................RR..--S-PEKLFKILDM...YE
K7LIX4_SOYBN/109-470NSI...S..ML.L----------S.FGE..AIA.KS.....................KR..--S-PEKLFVLLDM...YE
M7ZQD7_TRIUA/1206-1561GCV...L..QL.L----------R.FGD..AIA.IG.....................KR..--S-SEMLFRILDM...YE

PF04100

VPS53_HUMAN/39-453--RLDDNIRTV-V----------RGQTNVGQDGRQA---------------------------L-EEAQKA-------IQ
Q9VQY8_DROME/42-434--LIDDNIRSV-V----------RGQTNTGQDGQLA---------------------------L-CEAQKV-------IS
VPS53_SCHPO/16-394--KLDANKKTY-E----------DAKLSMGEK....---------------------------M-DDLNSS-------IV
VPS53_YEAST/5-369--KEENELKEH-P----------KNSA.........---------------------------.-.EIEAS-------LR
VPS53_CAEEL/30-390--ELDNELAYL-V----------ETNANVSERGEEA---------------------------L-KHAQDA-------MI
VP53A_ARATH/1-424--RVDASILSA-V----------RQQSNSGTKAKED---------------------------L-ADATRA-------VE

PF10475

Q7QF78_ANOGA/99-388--VISKKVLQL-I----------LEQRAACDGEFQR---------------------------I-RDTERL-------LR
Q336V4_ORYSJ/131-419--KIAERLSHH-V----------MGHHEEMVKGMQL---------------------------V-MELEQD-------LK
Q54MU4_DICDI/72-370--YVNSKLYNR-V----------RENYTEFVQGMSQ---------------------------I-HEIGVE-------LQ
VPS50_CHICK/54-327--.........-.----------.......AAELER---------------------------V-TSLQNG-------LQ
Q16RR9_AEDAE/70-360--VISKKVLQL-I----------LEQRPACNEEFQR---------------------------I-QETEGL-------LR
A1ZAY8_DROME/75-362--VLTKQVLQN-I----------LEQRNACSSEFAA---------------------------I-NDTQKK-------LE
Q54NV0_DICDI/113-401--AVDSRFNDL-I----------RKSYNGFVQGMSQ---------------------------V-YEIEKD-------LT
Q8RXC2_ARATH/132-421--KVAETLSHH-V----------MEHHEVMVKGMNL---------------------------V-RELEKD-------LK
Q18602_CAEEL/76-363--VVSKKISTL-I----------MQKSSSYTAQVGE---------------------------M-EKIRDE-------VG
A8XSD2_CAEBR/80-367--VVSKKISTL-I----------MQKSSSYTNQVGE---------------------------M-ENIREK-------VN

PF04048

SEC8_SCHPO/51-191--RISAALQTI-A----------HTHKDDFTRGISA---------------------------Y-GEIMEG-------IQ
Q69PQ1_ORYSJ/22-158--LIEDVVDEV-V----------HAYHHGFNKAIQN---------------------------Y-SQILRL-------FS
Q59NP0_CANAL/27-168--SSEQALRSV-V----------NEHYDLFNKSMGS---------------------------Y-NTLLST-------MK
A5E514_LODEL/26-167--RTEGVLRHV-V----------DEHYELFSNSIGS---------------------------Y-HMLLSS-------LN
Q6BLA3_DEBHA/30-171--QTKTALRHV-V----------NEHHDIFNNSIGS---------------------------Y-HVLLST-------LQ
A5DKL1_PICGU/29-170--QTQQALRNV-V----------SQHHEVFNNSIGS---------------------------Y-HLLLSN-------ID
A3LUX9_PICST/29-170--GTETALRHV-V----------NEHHELFNNSIGS---------------------------Y-HLLLST-------LQ
Q75B87_ASHGO/33-174--QIANNLQEA-A----------NEHYQTFANSIAS---------------------------Y-GQTVKY-------LN
Q6CNM5_KLULA/34-175--RFAKDLQEV-A----------NDHYQAFNDSIAS---------------------------F-SKTVYC-------IT
A7TRV6_VANPO/35-176--QIGSDLQAA-V----------NEHYQAFNSNVAS---------------------------Y-SVAVDS-------IT
Q6FWA6_CANGA/35-176--QIGSHLQEV-V----------NQHSQAFNSNVAS---------------------------Y-TQAVNA-------IT
Q6C3L8_YARLI/34-175--DISNVLKDV-V----------NDNYQGFNSSVGS---------------------------Y-RSIAQS-------IA
Q4WUD2_ASPFU/134-275--QIQKTLKSV-V----------NEHHQGFNSSIGT---------------------------Y-HKIQSN-------IQ
SEC8_NEUCR/82-223--FLQESLKNI-V----------HDHHQGFNSSIGT---------------------------F-HKIQGS-------IQ
A0A0D1E3Z5_USTMA/441-580--MIETALQGT-V----------DDHYESFASAITT---------------------------H-NSVLQS-------LT
E7M1P6_YEASV/34-174--QIGSHLQDV-V----------NEHSQVFNTNVAS---------------------------Y-GKAVSS-------IM
SEC8_ARATH/16-151--VVEEVVDEV-V----------HAYHGGFNKAIQN---------------------------Y-SQILRL-------FS

PF06046

Q28ZN5_DROPS/179-731D.VLQSSVATR-I----------EGSKLEERTDNKMWLVRD----------------------L-EIL...-------RQ
Q5K9B3_CRYNJ/179-740D.VMKSTVQRS-F----------EEYFLDNQHDF.......----------------------L-GFI.EG-------LG
EX3L4_HUMAN/179-709E.AVRRSAQER-V----------RRPGAGWAFGEAEGASGL----------------------A-QLLAEL-------GG
A5DIA8_PICGU/180-832D.KLQESLDEI-F----------DKCVEHFAHD........----------------------K-ILVFDN-------LN
Q0TXU6_PHANO/187-762K.SIEYVCQAQ-M----------DEAREKFNEDPEK.....----------------------I-D...KY-------FK
EX3L1_BOVIN/188-722R.ALQQGLERV-H----------FGTSLQPGPGELAKWLEA----------------------L-RVA...-------..
SEC6_SCHPO/181-743E.EFQGAAAEN-F----------QRAWVSYLEDGSG....E----------------------.-....LN-------LD
TNAP2_MOUSE/157-688G.VVAEVAAER-L----------DAQPATAPEGRSEAESRF----------------------L-HMG...-------.R
A5DY39_LODEL/293-930E.KFKVYFQGT-F----------ARCEEHFSND........----------------------R-MALYDN-------LD
A0A0D1DY75_USTMA/258-828E.AIDRSTAEL-F----------DECWSRFGAKDSS.....----------------------L-EFL.AH-------LD
A4RYX1_OSTLU/92-690E.QMSIAVEAR-L----------ALIAEGFSGLDDKE..SI----------------------E-HVV.GA-------LD
Q6DJR6_XENTR/177-732D.VLDKTIITR-I----------EGSQADTRESDKMWLVRH----------------------L-EII...-------RR
A3LNE6_PICST/180-819D.KLEENLSET-F----------NACINHFSED........----------------------R-MLVYEN-------LD
Q8SU74_ENCCU/160-687K.SIEVSVKGK-F----------DRLRN.............----------------------E-EIFVNR-------MD
Q16I77_AEDAE/179-730Q.VLNEAVVQR-I----------EGSKLEERSDNKLWLVRD----------------------L-ELT...-------RQ
Q5RG40_DANRE/161-694DPLLKTLVETR-L----------KNADGQENKADKLSTSLK----------------------R-EVC.RT-------GK
Q6CU40_KLULA/178-794S.TIHKGIQEM-F----------TEVRNEYSGDKK......----------------------F-DVL.NN-------LD
Q5BBU2_EMENI/183-758Q.AIEFYAQNQ-F----------EDTKEKFLDDPEG.....----------------------L-E...KS-------FR
Q6FPK2_CANGA/177-798N.KIKQSIQEM-F----------IEVRKEYDGDKK......----------------------F-DVL.NN-------LD
A7F9Q6_SCLS1/177-755M.AIKLKAEGN-L----------EGTKQAFLEDPTK.....----------------------L-E...KG-------LR
Q6C9T6_YARLI/183-804R.AMEKSIKDS-F----------EACIESFPG..DC.....----------------------I-TLL.EN-------LA
EX3L1_MOUSE/189-722R.ALQEGLERV-H----------FASPVLPEPGALAGWLEA----------------------L-QVA...-------..
EX3L1_DANRE/206-763K.VMEEAVSAR-F----------RSVSYLHTRG..PGLASH----------------------L-SAL...-------QH
EXOC3_DICDI/183-774E.VLIQSISGK-F----------EPMFLNSHNDL.......----------------------V-QTL.KD-------VN
TNAP2_HUMAN/122-651R.GVAEAAEER-M----------GQRPAA...GAEVPESVF----------------------L-HLG...-------.R
Q6BJB6_DEBHA/180-833K.KLEESLVDT-F----------DKCVEHFSYD........----------------------R-ILVYDN-------LN
EX3L4_MOUSE/181-708D.AVRLSAQES-V----------QQAGAKVIPGAAEGSSDL----------------------A-QLLAEL-------GG
Q5A7K3_CANAL/180-812D.KLRTHLYEI-F----------DSCVEYYGND........----------------------K-ILVYDG-------LY
A6RAW7_AJECN/390-965K.SIELYAQTQ-F----------EKSKETFLDDPEK.....----------------------L-E...KS-------FK
E7KDN6_YEASA/178-797N.GINNSISEM-F----------GEMREKYVGDQK......----------------------F-DVL.DN-------MD
H3DL97_TETNG/187-739D.VLEATVSTR-I----------EGTQSVTREVDKMWLVRL----------------------L-EI...T-------RK
EXOC3_HUMAN/188-743T.ILERTVTTR-I----------EGTQADTRESDKMWLVRH----------------------L-EII...-------RK
Q1K527_NEUCR/175-753K.AIKTFAEDQ-F----------KESKEKFLGDPDM.....----------------------L-D...KS-------LK
SEC6_ARATH/173-736E.QIRKAVEDR-F----------NRLLTLVFED........----------------------L-KAALEE-------AR

PF04091

W5E5N0_WHEAT/442-753IEVLNDCLLNR-M..........YAR..SLAMSQ..---------------------------M-MQLAGN....---IS
A9S7S7_PHYPA/446-757VTVLNEALLRL-V..........RSP..TLGVSH..---------------------------A-MQIAAN....---MT
H2WCC2_CAEJA/477-783GR.WAGILKSF-V..........DKR...LSMIQ..---------------------------L-VQITIN....---LG
T1EMI3_HELRO/450-756TRTLGGCLAIL-I..........KKP..YLTLPQ..---------------------------L-IQISIN....---ME
A9V537_MONBE/417-723SKVLSSILMKL-V..........RSA..GLNVQQ..---------------------------L-TQISLN....---TT
Q6BHQ3_DEBHA/494-826EKVLGNEKGVG-INNDIQEFIDKNAN....NKEV..---------------------------M-AQSYTN....---LE
E9G3C4_DAPPU/410-716TRTLSGCLSTL-I..........RKP..SLSLLQ..---------------------------L-IQISIN....---TN
B9GSB7_POPTR/457-761SEVLDEALLKL-I..........STS..VHGVSQ..---------------------------A-MQVAAN....---MA
M7NJC8_PNEMU/439-739VGHVKKKLIER-L..........SLN....NLSQ..---------------------------L-VQIIIN....---LE
U1HWP6_ENDPU/444-743CEEVCGSLVQK-L..........SVQ....YIGQ..---------------------------I-VQILIN....---LE
G0VF38_NAUCC/501-841IDIVNKKIRAK-L..........QST....SREE..---------------------------I-AQILIN....---LD
K5VZV5_AGABU/444-743IKGIGETIVQQ-L..........ATT...TTVPQ..---------------------------I-AQIVTN....---VE
R9AG66_WALI9/449-747RDGVVKALSVI-A..........EGV...FNLSQ..---------------------------A-VQLAVD....---VS
D6X4X0_TRICA/433-740TRTFSGCLSST-F..........RSP..HINLQE..---------------------------I-IQIIID....---TG
C5E4W3_ZYGRC/494-839SKIINEKIRAK-L..........DST....SREE..---------------------------I-AQILIN....---LD
G8ZUB2_TORDC/501-847SKVVNEKIRAK-L..........DTT....SREE..---------------------------I-AQILIN....---LD
G2RB31_THITE/448-748TDIVCQSLLER-L..........NSQ....YLGQ..---------------------------I-VQILTN....---LE
U5FMP1_POPTR/442-753IDVLNEVILST-I..........HGG..AVGVSQ..---------------------------A-MQIAAN....---IS
J9K5H0_ACYPI/421-724SRTFSGCLSSA-F..........HQP..RLGLLQ..---------------------------V-IQIIVD....---TG
C4R087_KOMPG/447-765NNIVIKNLRHK-I..........EST....IKEV..---------------------------I-AQNLIN....---LE
Q8S5T3_ORYSJ/442-753IEVLNDSLLNM-V..........YAR..SLAMSQ..---------------------------M-MQLAGN....---IS
M4DPW7_BRARP/456-760GEVLDEALLKL-I..........NTS..VHGVSQ..---------------------------A-MQVAAN....---MS
G6DDP0_DANPL/419-720SRSFTGCLSAL-F..........RRP...LPLTQ..---------------------------L-VQIIVD....---TQ
M3XK92_LATCH/505-811SRTLSNCLQAV-I..........KKK..NVGLTE..---------------------------L-VQIIIN....---TT
D5GMB3_TUBMM/427-725CEHVCGTLVEH-