Sequence alignment for CL0295

PF08700

Q5KJF4_CRYNJ/98-180--------------------------------------------------------------------EDW---------
EXO84_ASHGO/127-213--------------------------------------------------------------------LSN---------
COG5_MOUSE/37-120--------------------------------------------------------------------FLN---------
EXO84_CRYNJ/142-228--------------------------------------------------------------------LSN---------
Q6BJZ0_DEBHA/76-158--------------------------------------------------------------------IIN---------
Q0U0Z3_PHANO/76-170--------------------------------------------------------------------LDA---------
Q0WQ75_ARATH/43-129--------------------------------------------------------------------INS---------
Q173I8_AEDAE/5-87--------------------------------------------------------------------GNL---------
A2D783_TRIVA/6-88--------------------------------------------------------------------NVN---------
Q7Q6Z6_ANOGA/11-97--------------------------------------------------------------------MDG---------
Q2UQ54_ASPOR/108-197--------------------------------------------------------------------LDS---------
VPS51_YEAST/84-163--------------------------------------------------------------------LKE---------
A2E266_TRIVA/29-115--------------------------------------------------------------------IDG---------
Q2U987_ASPOR/1-88--------------------------------------------------------------------MAL---------
Q6FRQ2_CANGA/66-146--------------------------------------------------------------------DSD---------
Q6CSC3_KLULA/100-179--------------------------------------------------------------------IRL---------
A0A016Q0X2_GIBZA/128-214--------------------------------------------------------------------LRD---------
Q75HJ9_ORYSJ/40-126--------------------------------------------------------------------FKT---------
EXOC8_MOUSE/13-100--------------------------------------------------------------------LES---------
A0A0D1E7D8_USTMA/79-161--------------------------------------------------------------------FDP---------
Q8I2A9_PLAF7/116-202--------------------------------------------------------------------MNC---------
Q6CG64_YARLI/77-166--------------------------------------------------------------------FEA---------
Q4E335_TRYCC/3-85--------------------------------------------------------------------SEE---------
EXO84_YARLI/121-207--------------------------------------------------------------------LLK---------
Q4MZL9_THEPA/63-149--------------------------------------------------------------------FLS---------
COG1_SCHPO/7-89--------------------------------------------------------------------MSS---------
Q59L27_CANAL/17-99--------------------------------------------------------------------DTN---------
Q2UHE7_ASPOR/121-207--------------------------------------------------------------------LRD---------
Q7RZT4_NEUCR/9-91--------------------------------------------------------------------LST---------
E9AC89_LEIMA/3-81--------------------------------------------------------------------MEE---------
A2GBI6_TRIVA/24-110--------------------------------------------------------------------IDS---------
Q4Y221_PLACH/14-100--------------------------------------------------------------------KKS---------
VPS51_DICDI/178-264--------------------------------------------------------------------IDG---------
VPS51_SCHPO/52-138--------------------------------------------------------------------FSD---------
Q9FFF3_ARATH/21-103--------------------------------------------------------------------NGG---------
A0A0D1CLQ0_USTMA/184-270--------------------------------------------------------------------LSQ---------
COG1_DICDI/113-195--------------------------------------------------------------------TKQ---------
A2FRD0_TRIVA/32-118--------------------------------------------------------------------INS---------
A0C9R8_PARTE/6-92--------------------------------------------------------------------IDS---------
EXO84_CANGA/190-276--------------------------------------------------------------------LSD---------
Q754G8_ASHGO/53-137--------------------------------------------------------------------AEG---------
VPS51_CHICK/57-143--------------------------------------------------------------------ING---------
Q95Q35_CAEEL/9-99--------------------------------------------------------------------FQT---------
Q6C0N6_YARLI/24-102--------------------------------------------------------------------MAL---------
Q4DYG1_TRYCC/45-131--------------------------------------------------------------------LDS---------
Q5ZAZ1_ORYSJ/7-89--------------------------------------------------------------------SGG---------
B4QW21_DROSI/4-89--------------------------------------------------------------------FDD---------
Q5KKF4_CRYNJ/54-139--------------------------------------------------------------------IDS---------
Q7S488_NEUCR/124-217--------------------------------------------------------------------LDS---------
Q84K25_ARATH/20-102--------------------------------------------------------------------..L---------

PF06148

Q0TYI9_PHANO/26-159-------------------------------------------------------------APLQRNDFLA.........
Q29BE0_DROPS/22-154-------------------------------------------------------------LCFDKNEFMK.........
Q7QFV1_ANOGA/25-157-------------------------------------------------------------LCFDKNEFMK.........
Q84LH7_ORYSJ/24-156-------------------------------------------------------------PWFKPDSFLR.........
Q01CT5_OSTTA/52-184-------------------------------------------------------------TWFDPRAFEG.........
Q5K8I4_CRYNJ/34-165-------------------------------------------------------------LSHDHPLLTA.........
A1C4Y0_ASPCL/32-165-------------------------------------------------------------EPLSRSSFLA.........
Q2UA29_ASPOR/27-160-------------------------------------------------------------EPLSRSSFLA.........
COG2_HUMAN/15-147-------------------------------------------------------------LCFDKDEFMK.........
Q0C728_AEDAE/17-149-------------------------------------------------------------LCFDKNEFMK.........
A8WN13_CAEBR/23-155-------------------------------------------------------------LCFNKTHFNR.........
Q383M1_TRYB2/46-232-------------------------------------------------------------LCFGEHEFGVVLDSDNTTE
Q4DNE3_TRYCC/72-246-------------------------------------------------------------LCFGEHEFGVALDKDVTDE
Q4Q0F6_LEIMA/80-262-------------------------------------------------------------LCFAEHEFGIIVDENNPTD
A0CKT7_PARTE/12-141-------------------------------------------------------------SEFDVREFIL.........
COG2_DICDI/53-185-------------------------------------------------------------LCFSKDVFTS.........
F4JRR1_ARATH/31-163-------------------------------------------------------------LWFKPSLFLS.........

PF10392

Q5KKM0_CRYNJ/10-154------------------------------------------------------------------KPFLS---------
COG5_HUMAN/66-189------------------------------------------------------------------SDFLN---------
Q6BT79_DEBHA/15-147------------------------------------------------------------------EAFLE---------
Q5B379_EMENI/829-961------------------------------------------------------------------EAFLD---------
Q5APN5_CANAL/17-149------------------------------------------------------------------EAFLE---------
COG5_SCHPO/8-139------------------------------------------------------------------SDYKK---------
COG5_YEAST/14-146------------------------------------------------------------------ESLLE---------
Q9C9V9_ARATH/57-180------------------------------------------------------------------SPFLS---------
Q0U7T7_PHANO/13-145------------------------------------------------------------------EAFLD---------
Q2HI55_CHAGB/25-157------------------------------------------------------------------EAFLD---------
Q6CLE2_KLULA/11-144------------------------------------------------------------------EDFLE---------
COG5_DICDI/63-186------------------------------------------------------------------NQFLG---------
Q6C2T6_YARLI/5-136------------------------------------------------------------------DQFLD---------
Q75B18_ASHGO/11-144------------------------------------------------------------------EVLLE---------
Q6FTM6_CANGA/9-140------------------------------------------------------------------EELID---------
Q65XH1_ORYSJ/52-175------------------------------------------------------------------SAFLS---------

PF04124

COG8_MOUSE/56-394-----------------------------------------------LRELSGSGLDRLRR...EPERLAE---------
COG8_SCHPO/15-354-----------------------------------------------VRDLTMKPYAELEK...RKAELHA---------
COG8_YEAST/28-381-----------------------------------------------ILQSNTKDYESYFSSRAVPGSITE---------
COG8_CAEEL/10-353-----------------------------------------------GDDIRNMGLEEMRR...QKVLLAS---------
Q9LYH5_ARATH/29-412-----------------------------------------------VSELLSFTLDRLHK...EPELLRV---------
COG8_DROME/37-379-----------------------------------------------LAKLGTCKVEQLKK...EQTRLAE---------
Q9P3N9_NEUCS/31-347-----------------------------------------------LTSLSSQPLTALET..TEPQALAQ---------

PF15469

Q5KNA8_CRYNJ/115-308--------------------------------------------------------------SEAVRILVE---------
A7TRG2_VANPO/143-342--------------------------------------------------------------SDELKILVQ---------
G8BMU6_TETPH/145-338--------------------------------------------------------------SKELRMLIQ---------
C5DYM3_ZYGRC/146-354--------------------------------------------------------------SDELKDLVQ---------
G8ZXE8_TORDC/144-345--------------------------------------------------------------SEELKELVQ---------
H2AR86_KAZAF/151-365--------------------------------------------------------------EDNLKHLVQ---------
G0VBU0_NAUCC/150-340--------------------------------------------------------------SGDMKNLVE---------
G0WGP4_NAUDC/153-350--------------------------------------------------------------SNDLKSLVQ---------
Q6FVL5_CANGA/149-372--------------------------------------------------------------AGDLQHLVQ---------
E7QCY0_YEASZ/146-360--------------------------------------------------------------..HLKQLVG---------
C5DMT2_LACTC/144-330--------------------------------------------------------------SEDLKQLVQ---------
G8JTD1_ERECY/120-302--------------------------------------------------------------SNHLKELVQ---------
Q750U7_ASHGO/122-304--------------------------------------------------------------GNDLKNLVQ---------
Q6CQH1_KLULA/148-350--------------------------------------------------------------SYELKQLVQ---------
C4R5S5_PICPG/139-344--------------------------------------------------------------NKDLQLQIE---------
Q6CGI4_YARLI/146-334--------------------------------------------------------------SSALQTLVD---------
W1QF47_OGAPD/153-339--------------------------------------------------------------..RLQRLIG---------
C4YAI9_CLAL4/138-372--------------------------------------------------------------TSQLKSVLD---------
G8Y2A4_PICSO/149-393--------------------------------------------------------------.AQLKSVVN---------
C5MH42_CANTT/104-348--------------------------------------------------------------SENLRMAIE---------
G3AUN6_SPAPN/128-368--------------------------------------------------------------TSELKRAID---------
G8BGG9_CANPC/145-407--------------------------------------------------------------TRDLQSSLD---------
B6K5G3_SCHJY/147-340--------------------------------------------------------------SEMLVSLIN---------
C4M2W7_ENTHI/111-299--------------------------------------------------------------NKEIMHLVE---------
D6W674_TRICA/193-371--------------------------------------------------------------KEGQLSFLK---------
B0W3D0_CULQU/193-383--------------------------------------------------------------KEGQLSFLK---------
B3MVG4_DROAN/193-383--------------------------------------------------------------KEGQLSFLK---------
G6D800_DANPL/194-372--------------------------------------------------------------KEGQLSFLK---------
E2AW35_CAMFO/194-372--------------------------------------------------------------KEGQLSFLK---------
E0VQL4_PEDHC/200-377--------------------------------------------------------------KEGQLSFLK---------
E9G6B5_DAPPU/193-371--------------------------------------------------------------KEGQISFLK---------
B7PR09_IXOSC/148-326--------------------------------------------------------------QEGPSSFLK---------
A8WPA7_CAEBR/200-378--------------------------------------------------------------AKRSEEMHK---------
H3ERJ1_PRIPA/197-373--------------------------------------------------------------EKKSEEMHR---------
A0A0I9R3C5_BRUMA/212-385--------------------------------------------------------------....SDLHR---------
C3XUC7_BRAFL/191-370--------------------------------------------------------------SEGPLAFMK---------
F6YQX0_XENTR/198-380--------------------------------------------------------------NEGNVAYVK---------
F7GSZ8_CALJA/50-227--------------------------------------------------------------..GSLAYVK---------
E4XNP2_OIKDI/201-392--------------------------------------------------------------QSASMSHIK---------
F6Q8U3_CIOIN/201-380--------------------------------------------------------------NNAPLNHVK---------
G4VNQ3_SCHMA/214-394--------------------------------------------------------------PGEPVNVIR---------
H2KP67_CLOSI/214-393--------------------------------------------------------------LDEPVNVIR---------
F2UAY3_SALR5/207-386--------------------------------------------------------------DRNLKQLIN---------
A9RNH0_PHYPA/252-430--------------------------------------------------------------KENLMKLVK---------
A9S1F4_PHYPA/259-437--------------------------------------------------------------KEQLKKLVK---------
D8RD25_SELML/239-417--------------------------------------------------------------KQQLKLLVK---------
D7KJZ0_ARALL/260-438--------------------------------------------------------------NLQRKQLVK---------
Q7XMG2_ORYSJ/263-453--------------------------------------------------------------TQQKKQLVK---------
F0ZXN2_DICPU/132-311--------------------------------------------------------------ALEIKFLVK---------
F4PGL2_DICFS/126-305--------------------------------------------------------------DLEIKYLVK---------
A8PCF2_COPC7/122-323--------------------------------------------------------------SEALRVLVE---------
D8QDB4_SCHCM/114-323--------------------------------------------------------------SEAVRILVE---------
B8P2C9_POSPM/114-312--------------------------------------------------------------SEAVRVLVE---------
G4TT08_PIRID/115-310--------------------------------------------------------------SEAVRILVE---------
A8PUN7_MALGO/110-314--------------------------------------------------------------SEALKVLVD---------
E6ZLD0_SPORE/109-315--------------------------------------------------------------SEALKVLVE---------
E3K655_PUCGT/121-321--------------------------------------------------------------SEALKILVE---------
F4RSS6_MELLP/56-255--------------------------------------------------------------SEALKILVE---------
F4PCT9_BATDJ/225-428--------------------------------------------------------------NEIIKGLVK---------
D5GNN2_TUBMM/147-347--------------------------------------------------------------SGSLKLLVE---------
G1XK06_ARTOA/190-398--------------------------------------------------------------SSALKLLVS---------

PF16528

C5DUD9_ZYGRC/539-743-------------------------------------------------------RVLDDLLEEIEIDLER---------
G0VJV4_NAUCC/543-749-------------------------------------------------------KKLDDSIEEVDIELTR---------
A7TL52_VANPO/508-712-------------------------------------------------------KHIDNTIEEVDIESSR---------
G8ZS82_TORDC/494-698-------------------------------------------------------KFLDDGVEEIDIELGR---------
G8BNG7_TETPH/532-736-------------------------------------------------------KFLENMIEEFDIELAR---------
G0W548_NAUDC/557-766-------------------------------------------------------KRLDDCIEEVDIKLTR---------
EXO84_CANGA/545-749-------------------------------------------------------KLVDNLIEEVDIDLAR---------
H2AXV4_KAZAF/523-731-------------------------------------------------------KDLNDSIEEVDIQIAR---------
G8JS46_ERECY/478-682-------------------------------------------------------KLADEELEELNVPVTR---------
EXO84_KLULA/500-705-------------------------------------------------------KRLDDALEDLDLEIGR---------
G0S6E5_CHATD/457-657-------------------------------------------------------RWVESQMDELDINIAL---------
E3S512_PYRTT/452-652-------------------------------------------------------RWVESQLDDLDIEIAL---------
EXO84_YARLI/444-642-------------------------------------------------------REIDDLVNDLDVKIAH---------
D5GAW7_TUBMM/436-637-------------------------------------------------------RWVEAQMDELDEKIAH---------
C4R6S9_PICPG/506-717-------------------------------------------------------TGLEDTLDEVDIHLVH---------
Q2H152_CHAGB/456-656-------------------------------------------------------RWVESQMDELDIHIAL---------
C9S7T2_VERA1/440-640-------------------------------------------------------RWVEGQMDELDIEIAL---------
B2B2W1_PODAN/463-663-------------------------------------------------------RWVESEMDELDINIAL---------
H2Z9L4_CIOSA/281-487-------------------------------------------------------EWLLEMPEDLDVFIAQ---------
H2MTA2_ORYLA/303-507-------------------------------------------------------EWIQELPEDLDVCIAQ---------
G3JE74_CORMM/450-655-------------------------------------------------------RWVESQMDELDINIAM---------
G0SXF2_RHOG2/870-1071-------------------------------------------------------SWIGDFSDELAVDVST---------
EXO84_CRYNJ/449-651-------------------------------------------------------RWIDEYGDELTMAIAI---------
C5FKA5_ARTOC/433-633-------------------------------------------------------RWVEGQLDELDIDIAI---------
F4P2Q9_BATDJ/415-626-------------------------------------------------------RWLLELPDELDVLVAH---------
G0R9T9_HYPJQ/449-649-------------------------------------------------------RWVEGQMDELDIDIAL---------
C7Z4G1_NECH7/445-645-------------------------------------------------------RWVESEMDDLDIDVAM---------
I1G637_AMPQE/287-497-------------------------------------------------------QWVKDAPENLDVCIAQ---------
E7LRJ5_YEASV/465-668-------------------------------------------------------.FLDEGVEEIDIELAR---------
EXO84_ASPFU/445-645-------------------------------------------------------RWVDGQVDELDIDIAL---------
W4YYJ2_STRPU/291-496-------------------------------------------------------DWILELPEDLDMSIAQ---------

PF06248

ZW10_DROPS/10-571------------------------LPE..................MFQSNGCASLEDTKSTVSKVQTRTERFQERV----
ZW10_ARATH/1-584------------------------MPEIDALFESINVRDLLAGHDLNDPTTPLSAPDLRLLINRLESHSLRIKSKV----
A7SSG2_NEMVE/20-670------------------------L......................QKTGQLEQEDFNKCATKMLKKAEEVKAEV----
A8XRG3_CAEBR/1-605------------------------M..............................PSSEGSYRDLEKKLKDGLTSI----
ZW10_HUMAN/9-621------------------------L......................AHSGRLEKEDLGTRISRLTRRVEEIKGEV----
F1QYH5_DANRE/9-611------------------------L......................ASSGKLEKDDLACKISKLSRKVEETKEEV----
F7EQH5_XENTR/9-617------------------------L......................ANSGRLEKEDLGTKISRLSRRVEELKGEV----
H3CQC8_TETNG/9-607------------------------L......................ASSGKLEKEDLSGKISKMSRKVEETKEEL----

PF04100

VPS53_HUMAN/39-453---------------------------------RA--D--------------------FNAVEYINTLFPT---------
Q9VQY8_DROME/42-434---------------------------------AP--D--------------------FNTVDYINQLFPN---------
VPS53_SCHPO/16-394---------------------------------NN--E--------------------FKFVETLHELLPE---------
VPS53_YEAST/5-369---------------------------------TV--D--------------------YDPLEDITNILFS---------
VPS53_CAEEL/30-390---------------------------------.P--N--------------------MSLMAQINELFPT---------
VP53A_ARATH/1-424---------------------------------MD--K--------------------SSALEYINQMFPT---------

PF10475

Q7QF78_ANOGA/99-388------------------------LESTEAIYFDG..G--------------------SNTGLHELRKLSE---------
Q336V4_ORYSJ/131-419------------------------VDELEEVFFQE..E--------------------FDPIKYILQSIPA---------
Q54MU4_DICDI/72-370------------------------LKITPAGFFDP..K--------------------FDTTQFILDLLPP---------
VPS50_CHICK/54-327------------------------INSIEEVYFSN.DA--------------------FDIVKYELERLPP---------
Q16RR9_AEDAE/70-360------------------------LESTEAIYFDS..G--------------------SNTGLHELKKLSE---------
A1ZAY8_DROME/75-362------------------------LESIEQCYYNP..D--------------------SNPQLYELKKVLN---------
Q54NV0_DICDI/113-401------------------------IDSLDEVYFKE..D--------------------FDPA.FILQNIPK---------
Q8RXC2_ARATH/132-421------------------------VEELEEGFYEE..D--------------------FDPVRHILENVPD---------
Q18602_CAEEL/76-363------------------------INSIDAAYFIDNDE--------------------FDAIDYELKKLCD---------
A8XSD2_CAEBR/80-367------------------------IDSIDASYFIDNDE--------------------FDAIDYELKKLCD---------

PF04048

SEC8_SCHPO/51-191--------------------------DLENLVNEI--E--------------------DEWKDLGREDYQP---------
Q69PQ1_ORYSJ/22-158--------------------------YLKEGLSRI--D--------------------EGWAAARFDSLPH---------
Q59NP0_CANAL/27-168--------------------------SLKEVYNTI--K--------------------YDWPQMLREDANP---------
A5E514_LODEL/26-167--------------------------DLKMIHNEI--K--------------------YDWPQILQSNANP---------
Q6BLA3_DEBHA/30-171--------------------------ELKEVQTTL--R--------------------YEWPQCLQENANP---------
A5DKL1_PICGU/29-170--------------------------ELKEVTNYL--K--------------------YEWPQLLDSKTNP---------
A3LUX9_PICST/29-170--------------------------ELKEVHNTI--K--------------------YDWPQFLVEDANP---------
Q75B87_ASHGO/33-174--------------------------KLQNDLSRI--E--------------------SSWNKVITKDANP---------
Q6CNM5_KLULA/34-175--------------------------KLQADIALL--G--------------------TEWNRIINKDTNP---------
A7TRV6_VANPO/35-176--------------------------NLDMDLAQV--Q--------------------SQWHRIISNDSNP---------
Q6FWA6_CANGA/35-176--------------------------NLRDDLSLV--K--------------------SQWNRVLTEDSNP---------
Q6C3L8_YARLI/34-175--------------------------KIDELCRKV--D--------------------YEWPELGRDNANI---------
Q4WUD2_ASPFU/134-275--------------------------AMEDILQAI--Q--------------------RDWGFVASDDCVP---------
SEC8_NEUCR/82-223--------------------------QIGNVLDLI--K--------------------REWPAMVETDCIP---------
A0A0D1E3Z5_USTMA/441-580--------------------------SINAVLRKV--Q--------------------VEWPFVANDQFNS---------
E7M1P6_YEASV/34-174--------------------------HLQNDLNRI--N--------------------LQWNRILSDNTNP---------
SEC8_ARATH/16-151--------------------------.LREELARI--D--------------------ESWAAARFDSLPH---------

PF06046

Q28ZN5_DROPS/179-731------------------------FEKVDTVSQAL--E--------------------KKLRLILSRTLNT---------
Q5K9B3_CRYNJ/179-740------------------------FEKVDKVAADF--E--------------------AWLWEIAGSVVEL---------
EX3L4_HUMAN/179-709------------------------AMDVCLLYDGL--A--------------------AEIGAIVRETLDS---------
A5DIA8_PICGU/180-832------------------------VLPLQEVVKNF--D--------------------LLLAEIIYSITEA---------
Q0TXU6_PHANO/187-762------------------------FTRLDDVVEWF--D--------------------KHIGETCINLIDL---------
EX3L1_BOVIN/188-722------------------------FEGLGPLAEAL--G--------------------QAVEAAAGAAGQL---------
SEC6_SCHPO/181-743------------------------FSNLNTLSDNF--D--------------------RLVLNFCRNIFQL---------
TNAP2_MOUSE/157-688------------------------QSKVEALYVLL--C--------------------DQVLGVLRRPLEA---------
A5DY39_LODEL/293-930------------------------TIPTAKLIANF--D--------------------ALLVEVINSLTES---------
A0A0D1DY75_USTMA/258-828------------------------FAPLDGLIRAF--D--------------------DYIMSLAERTMDL---------
A4RYX1_OSTLU/92-690------------------------FERVDAAWTTF--E--------------------GVLWNSVRQGILA---------
Q6DJR6_XENTR/177-732------------------------FGKVHPLSEEL--A--------------------KQLWMVIQRSIVT---------
A3LNE6_PICST/180-819------------------------IDPIKRTIGNF--Q--------------------ELLGEAIISLTEV---------
Q8SU74_ENCCU/160-687------------------------LNTIEKNSLDF--T--------------------AKVLEISEEFIE.---------
Q16I77_AEDAE/179-730------------------------FEKVETVSATL--E--------------------KKIRLILQRTLNT---------
Q5RG40_DANRE/161-694------------------------EDKLLRDSEIF--R--------------------ERLKFAI...LDS---------
Q6CU40_KLULA/178-794------------------------FQRVPGCIEKF--N--------------------KLLRDITYDIIEA---------
Q5BBU2_EMENI/183-758------------------------FQGLDAVIDWF--D--------------------DHLGTLCMNLIPL---------
Q6FPK2_CANGA/177-798------------------------FSKVSGLVDKF--D--------------------QLLESLIYDIVEM---------
A7F9Q6_SCLS1/177-755------------------------FARLDDTIDWF--D--------------------ENIGKVALNLIEV---------
Q6C9T6_YARLI/183-804------------------------FAPLDPLIAKF--D--------------------RVVEDVGGNLLEF---------
EX3L1_MOUSE/189-722------------------------FQGLGLLAEAL--G--------------------QAVEAAAGAAGRL---------
EX3L1_DANRE/206-763------------------------FSGVGRLVDAL--A--------------------KELWAVVGSGLSL---------
EXOC3_DICDI/183-774------------------------FSSVPELSHRF--E--------------------NKIWNIVSNSIDI---------
TNAP2_HUMAN/122-651------------------------QSKVEALYELL--R--------------------DQVLGVLRRPLEA---------
Q6BJB6_DEBHA/180-833------------------------VLPVKKTIKKF--D--------------------DLLGEIIISLTEA---------
EX3L4_MOUSE/181-708------------------------AMDLCLHYDGM--A--------------------AEIGAIVREALSS---------
Q5A7K3_CANAL/180-812------------------------VSPIKTTIKLF--D--------------------ELLNEGIQSLTEV---------
A6RAW7_AJECN/390-965------------------------FQRLDSVIEWF--D--------------------DHVGTAIMNLIPL---------
E7KDN6_YEASA/178-797------------------------FSRLSGIISKF--D--------------------KLLDGLTYDIVEM---------
H3DL97_TETNG/187-739------------------------FEDVQGLSDEL--A--------------------KQLWMVLQRSMVT---------
EXOC3_HUMAN/188-743------------------------FGSTQGLSDEL--A--------------------KQLWMVLQRSLVT---------
Q1K527_NEUCR/175-753------------------------FSRLDKYIEWF--D--------------------VNITLVAMSLINL---------
SEC6_ARATH/173-736------------------------FEDVDRTWETF--E--------------------KTLWGHVSNYYKL---------

PF04091

W5E5N0_WHEAT/442-753------------------------YNMNVTAFHLE--PSEVIPE..............FPYVAPFSSSVPE---------
A9S7S7_PHYPA/446-757------------------------YNMNVLAFHLQ--SVDVMPA..............FPYIAPFSATVPD---------
H2WCC2_CAEJA/477-783------------------------FRDIIRQFPFY--KRSMEQEP.............FPRKFPFSRFVIS---------
T1EMI3_HELRO/450-756------------------------YAAVIESYPYK--NPALEREP.............FPKRFPFSQFVPA---------
A9V537_MONBE/417-723------------------------YRELLETYPFE--DGATVGATV............FPRQLLFSNAVPR---------
Q6BHQ3_DEBHA/494-826------------------------YENVMKICWYK--SDAPFA......PQNVH.S..MPISFPFSEDYVH---------
E9G3C4_DAPPU/410-716------------------------YQRVIESFPYR--DGHLEAAP.............FPKRFPFSSLVPK---------
B9GSB7_POPTR/457-761------------------------YSMNVLSFQLQ--TSDIVPA..............FPYVAPFSSTVPD---------
M7NJC8_PNEMU/439-739------------------------YQKILDVSWYK--PNNFSDSIK............FPVTLPFSQVYPL---------
U1HWP6_ENDPU/444-743------------------------FEKVITVSWYC--P....ERAV.DDTK.......FPCVLPFSQMYPL---------
G0VF38_NAUCC/501-841------------------------FQKVSQICWMK--EDEHLEPQEDMSG........FSITLPFSPLYPM---------
K5VZV5_AGABU/444-743------------------------YQAILDTVWIS--ET...ERNHLNNTP.......LPQALPWSQSFYL---------
R9AG66_WALI9/449-747------------------------LESILSICWVD--NSSVSAVYSQK..........PPIHLPFSSIYPD---------
D6X4X0_TRICA/433-740------------------------YEHILSSFPWD--EDLPNDVV.............FPHKFPFSGMVPK---------
C5E4W3_ZYGRC/494-839------------------------YEKMLKICWMK--DDELAKARAEAAEQNGQ....FTITLPFSPLYPM---------
G8ZUB2_TORDC/501-847------------------------YEKVLKICWMK--EDELVKCQDAATNENGE....FFVTLPFSPLYPM---------
G2RB31_THITE/448-748------------------------YDKVLEATWFV--D....ERPP.DQIT.......FPAVFPFSKMYPL---------
U5FMP1_POPTR/442-753------------------------YENNVLSFHLQ--TSDIMPA..............FPYIAPFSSMVPD---------
J9K5H0_ACYPI/421-724------------------------YDNVVRTFPYQ--DDQLESST.............FPRKFPFSSMVPS---------
C4R087_PICPG/447-765------------------------YKSISIISWYR--HTPSNNR..............FPKQLPFSSIYPM---------
Q8S5T3_ORYSJ/442-753------------------------YNMNVTAFHFE--PDDVVPE..............FPYVAPFSSGVPD---------
M4DPW7_BRARP/456-760------------------------YSMNVLSFQLQ--TSDIAPA..............FPYIAPFSTTVPD---------
G6DDP0_DANPL/419-720------------------------YDAVMDTFPYD--GDELETQP.............FPRRFPFTSLVPA---------
M3XK92_LATCH/505-811------------------------YKRTMGQFPFQ--DSNLEKQP.............FPKKFPFSEFVPK---------
D5GMB3_TUBMM/427-725------------------------YDNIVKSVWYN--P....DKDP.EIIQ.......FPTAMPFSRIYPL---------
W1QAD1_OGAPD/459-774------------------------..NVQANCFHK--FKDTITE..............FPVVLPFSIIYVA---------
U9TBU2_RHIID/147-443------------------------YEAVVDACWFK--EDHRISQG.............YPRTLPFSQAYPS---------
A5DMM0_PICGU/482-811------------------------YENVMKVCWYH--PEVSFA......AHKVK.K..MPVSFPFSEDFVD---------
R9P8Q0_PSEHS/445-756------------------------LSKVLSVCWLK--PG...DDVLLKQSG.......FPLSLPFSQTYPL---------
Q6C1W0_YARLI/480-793------------------------YEKITRACWWT--PA...DDEAAGGKPGAATDGVFPKTLPFSPILPL---------
J3PJI4_GAGT3/450-750------------------------YEKVVNVSWFT--P....EKPA.EEMS.......FPCVLPFSQMYPL---------
G8YKH3_PICSO/492-824------------------------YENVMKVCWYR--NDAPFS......PAKLR.Q..LPVTFPFSEDYVH---------
J9EJI0_WUCBA/484-791------------------------.RAVVTQFPFY--RRGMDQEP.............YPRVFPFSKFVPA---------
F6YT74_HORSE/409-715------------------------YKIVISKFPFQ--DPDLEKQS.............FPKKFPMSQSVPH---------
J4KKU7_BEAB2/450-750------------------------FDKVLNVSWYT--P....EHNV.ENIT.......FPCVLPFSQMYPL---------
I4YIZ3_WALMC/449-754------------------------LESVLEVCWVD--SSSFTAAYSQK..........PPIHLPFSSIYPE---------
F8PQ71_SERL3/445-743------------------------.DNVLGMVWLS--PI...EQEELAKGA.......LPMNLPWSQSFYL---------
G1XUE0_ARTOA/508-808------------------------YAKVISVSWFK--D....DKDA.EEIQ.......YPTVLPFSQMYPL---------
A7TQS9_VANPO/506-845------------------------YEKVIKICWMK--EDDEVLSDNQNLSE.......FSVTLPFSPLYPM---------
G3AZR4_CANTC/493-823------------------------YESVTQICWYK--EDAPFA......PRHVK.K..LPISFPFSEDYVH---------
B4R147_DROSI/428-730------------------------YECIIERFPFH--SEQLENTP.............FPKKFPFSRMVPE---------
S8FZN9_FOMPI/445-743------------------------.DSVLDTVWLT--KE...EREQLVKSP.......IPLTMPWSSGFYL---------
K5W5P8_PHACS/445-743------------------------.DSVLDTVWLG--NS...EREQLLESP.......LPINFPWSSGFYL---------
G2YIA1_BOTF4/452-752------------------------FDKIIQVSWYV--P....DRPK.EEYT.......FPGVLPFSQMYPM---------
A8NWX8_COPC7/444-743------------------------..AVLDVVWLE--DH...ERSEIQAQP.......VPQSLPWSQTFYL---------
R4X791_TAPDE/443-739------------------------WDKIKAYCWYR--SSVDSSILT............YPAIFPFSQIYPL---------
S9VV25_SCHCR/436-738------------------------YDELIAPYWTL--PPAP.................FPRMVEFSKMCSL---------
V2X5M8_MONRO/445-743------------------------.NTVLDVVWIS--NE...KTQEIKQSA.......LPQNLPWSQTFYL---------
C5M2I2_CANTT/488-818------------------------YNSIIANAWYK--KDASFV......PANVK.A..LPVTFPFSEDYVH---------
I2H3Y9_TETBL/508-832------------------------YQKIKRICWMK--EEDEQLNGNQEDGQ.......LMINFPFSPLYPM---------
Q17EP0_AEDAE/419-722------------------------YDAVLERFPFH--SEQLEAQQ.............FPKKFPFSRMVPE---------
M2ZTI7_PSEFD/439-745------------------------YTKVISVSWYT--PPP..EQENVEEMT.......YPCVLPFSQMYPL---------
I1MM64_SOYBN/441-752------------------------YENNVLSFNIQ--TSDIMPA..............FPYVAPFSSMVPD---------
B6K595_SCHJY/439-743------------------------...LIQPYWYD--KKVDS................FPVTMPFSKMCYE---------
U4LHC9_PYROM/436-732------------------------YEKVVEVSWFK--D.......PVENRE.......FPTVLPFSQMYPL---------
G3Q4R1_GASAC/450-759------------------------YKHYTAQFPLQ--DPELDKLP.............FPKKLPFSEFVPK---------
Q753S5_ASHGO/494-834------------------------YEKVMKLCWMK--PDSVPIVTQDDANG.......FSVTLPFSPLYPM---------
Q5KPL0_CRYNJ/450-754------------------------FDQVAGVCWLA--KG...EAESLAMQG.......FPQPMPFSQTYPM---------
C4Y6U1_CLAL4/493-821------------------------YDNVMKICWYK--KDANFA......PRNVH.S..MPISFPFSEDYVH---------
E0VNA5_PEDHC/435-739------------------------YDKIMESFPFQ--DDTANNLK.............FPRKLPFSQMVPN---------
Q7RYL2_NEUCR/451-751------------------------YEKVLKVSWYT--E....EKAP.EELT.......FPCVLPFSQMYPL---------
H6BY38_EXODN/444-761------------------------FEKVVNVSWYT--P....DRPV.QEMT.......FPTVFPFSQMYPL---------
J7R131_KAZNA/509-861------------------------YDKVIKICWLT--EDKELRDAGNKSRESGVP...FSVVLPFSPLYPM---------
M0S2D5_MUSAM/444-755------------------------YNMNVVSFHLQ--SSDTLPD..............FPYIAPFSSSVPD---------
H2YEW6_CIOSA/141-441------------------------....LETFPYE--SPGFESEK.............YPRKLPFSRFVPR---------
M7XX30_RHOT1/453-763------------------------FGKVVSVTWLP--SSGEWSAEQLKSSG.......FPLALPFSQTYPL---------
M2RQV4_CERS8/445-743------------------------.DSVLDTVWLA--RQ...ERDQLARSA.......LPLTLPWSQSFYL---------
M2N0E3_BAUCO/446-755------------------------YAKVINVSWYT--PPE..DVPPLEKME.......FPCVLPFSQMYPL---------
F4S5J6_MELLP/471-780------------------------FSKVVEVSFLP--EQGEWAQENLITGG.......YPAALPFSQTYPL---------
H3CIW2_TETNG/458-766------------------------YKYYTSQFPLQ--DPELEKLP.............FPKKLPFSEFVPK---------
I3MQ17_ICTTR/423-732------------------------YKIVTSKFPFQ--DPDLEKQS.............FPKKFPMSQSVPH---------
M1CVC4_SOLTU/449-755------------------------.....LLFHLQ--TSDIMPA..............FPFIAPFSSMVPE---------
H2B145_KAZAF/504-852------------------------.NKVIKICWMK--EADLKLIESVNANQNDEEQ..FVVTLPFSPLYPM---------
C8V0B6_EMENI/444-742------------------------FDKVLNVSWYT--P....SEP..QEQA.......FPCVLPFSQMYPL---------
D7TQV0_VITVI/442-753------------------------YTMNVLSFHLQ--TSDIMPA..............FPYFAPFSSMVPD---------
U5HF68_USTV1/463-770------------------------FDKVVSVSWLP--ASGEWSADELKTPG.......FPLALPFSQTYPL---------
SEC15_SCHPO/436-738------------------------YDHYIAPYWNF--PSEP.................FPRTMSFSKMCPL---------
K2SGN8_MACPH/382-681------------------------YEKVVNVSWYT--S....EKPR.EELT.......FPCVLPFSQMYPL---------
N1JD47_BLUG1/449-748------------------------YDKVLNVSWFK--P....EKSR.ENLT.......FPCVLPFSQMYPL---------
W5C2B9_WHEAT/447-753------------------------.....AACQLE--PIHAVPD..............LPYVAPFSSSVPS---------
U5D3X0_AMBTC/442-753------------------------YNMNVLSFHLQ--TSDIMPA..............FPYIAPFSATVPD---------
A6R9C0_AJECN/444-745------------------------YDKVLNVSWYN--P....EKSR.EQQT.......FPCVLPFSQMYPL---------
Q6CYE5_KLULA/489-828------------------------YEKILKICWLA--DQGSDTSNTTNDN........FSATFPFSPLYPM---------
T1ICC1_RHOPR/422-724------------------------FDQVLSTFPFQ--DDALEAAL.............FPKKFPFSPFVPN---------
U7Q2U4_SPOS1/452-752------------------------YEKVVNVSWFT--Q....EKPL.SELT.......FPYVLPFSQMYPL---------
V5ESV2_PSEBG/448-756------------------------LSKVLSVAWLK--PG...DEGLLRNSQ.......FPLSLPFSQTYPL---------
M9MGV3_PSEA3/448-761------------------------LNKVLSVCWLK--PG...DEAQLRAST.......FPLSLPFSQTYPL---------
M2T372_COCH5/443-742------------------------YDKVVSVSWYS--P....PANS.EQLT.......FPCVLPFSQMYPL---------
B0CXV0_LACBS/444-743------------------------LDMVLDMVWLD--GA...EKDEIKQTP.......VPHLLPWSQTFYL---------
A8Q0J7_MALGO/448-754------------------------LAKVLSVCWLK--PG...EADQLKQLP.......FPLSLPFSQTYPL---------
L8GBJ1_PSED2/444-744------------------------YDKVVNVSWFT--P....DKPR.DELS.......FPCVLPFSQMYPL---------
K1PXL0_CRAGI/475-788------------------------YTAIVTQFPFQ--DEELEQASLPRKEET......FPKRFPFSLFVPN---------
T1K0Q9_TETUR/511-835------------------------YDEIINEFPYY--EAEVVSTGDSD..........YPKKFPFSSFVPK---------
W4YBC1_STRPU/461-764------------------------...LIRSFPFR--DEKIDKAP.............YPRRLPFSEFVPK---------
I2FTP7_USTH4/451-766------------------------LNKVLCVCWLK--SG...DGEMLRSCA.......FPLSLPFSQTYPL---------
M4CSR8_BRARP/401-712------------------------YENNVLSFNLQ--TSEIMPA..............FTYIAPFSSMVPD---------
SEC15_YEAST/521-864------------------------YEKVLKICWMK--EGEHLSLPDPTNGEP......FAVTLPFSPLYPM---------
I1LA00_SOYBN/442-753------------------------YENIILSFNLQ--TSDIMPA..............FPYTAPFSSMVPD---------
D5G5B6_TUBMM/397-695------------------------YDNVVNVSWYK--P....DKER.DQLE.......FPIVLPFSQMYPL---------
S2IZP1_MUCC1/463-761------------------------.KEVMQYTRFR--P....DREFIKRYG.......FPLRLPFSKVFPT---------
K0KMH2_WICCF/500-804------------------------YRKISNISWYE--DSRSENEIK............FPQVLPFSTIYPM---------
A3LS60_PICST/480-811------------------------YENIMRICWYR--EDAPFA......PKNVT.K..MPITFPFSEDYVH---------
C5DLI6_LACTC/498-839------------------------YEKVLKICWLR--TDELEALHSREKTPDES....FFATLPFSPLYPM---------
G3AHA4_SPAPN/460-784------------------------YDSIMKLVWYQ--KDSAFA......PQNVR.S..MPIQLPFSEDYIH---------
G8BTV9_TETPH/518-863------------------------YEKVTKICWMK--DSDDMLVEQNGNDDD......FIVTLPFSPLYPM---------
G4TCP0_PIRID/445-744------------------------LDAIVSGCWLP--SS...VAASLYSLD.......PPCVLPFSQTFYQ---------
G8BIA4_CANPC/483-815------------------------YRDVMKTLFYF--KDAPFA......PERVRNK..FPVKFPFSEDYAT---------
E6ZRP7_SPORE/448-761------------------------LQKVLSVCWLK--PG...DDALLRQSG.......FPLSLPFSQTYPL---------
Q6FRK2_CANGA/501-841------------------------YEKVIKICWMK--ENHQIIDDMDDEN........FSVTLPFSPLYPM---------
G0WGH4_NAUDC/507-859------------------------FEKVAQICWMK--DDENIKPTIDNENTGE.....FMVTLPFSPLYPM---------
E3KWD2_PUCGT/502-831------------------------FSKVVEVSFLP--NHGIWTKAELAKQT.......FPTALPFSQAYPL---------
K7IYQ6_NASVI/422-728------------------------YDKVLASFPYQ--DEELKKAR.............FPKKFPFSAMVPK---------
A0A0D1DRH1_USTMA/446-764------------------------LQKVLSVCWLK--PG...DDAMLRSSG.......FPLSLPFSQTYPL---------
C3ZIQ9_BRAFL/402-708------------------------YSEIIRSFPYQ--DEALEKED.............FPKRFPFSGSVPQ---------
D8PS05_SCHCM/445-743------------------------.DGVLEVILVT--EQ...EKYDIRRAP.......LPQILPWSQTFYL---------
A5E457_LODEL/496-826------------------------YDTIMKRIFYE--SNASFA......PRNVK.S..FPVKFPFSEDYVH---------

PF09763

Q5K9I2_CRYNJ/487-1172KKKGADVIENRLLDELTALDSAI.IHAFLE------------------------------SDDRTAQVLAH---------
Q75AA6_ASHGO/631-1297DG..SDVVLERLLLKVAEAEYQF.NKQLMS------------------------------LPKKASDLKLY---------
A5DBH0_PICGU/595-1282TSDNGDILIKKLSHELSALKYNN.VKQLVT------------------------------LDFGHNSISKD---------
A3GH85_PICST/638-1329ITDDSDSLIKKLTRELNNVKQQN.VRELIG------------------------------LNFGSSNVSKD---------
Q6FRC5_CANGA/652-1329DD..ADTLLEKVNTNLSKTEYMF.NTSLLT------------------------------LSKLSNNLQPY---------
Q2UK85_ASPOR/702-1427KK..IEDLEADIRREIGRVEATSWLGNLEQ------------------------------QEGKIDQLAKL---------
A7TSV5_VANPO/776-1455ED..ADKLVERLDYKLAETEYDF.NNDLLL------------------------------LENLQTTLSGY---------
Q6CQX3_KLULA/540-1218DD..SSSLLEKLHSRLADVDYQL.NKNLLF------------------------------LPKSLGELNPY---------
Q57ZX4_TRYB2/198-1064DD..IRATEKLLSTHQKKAELLS.VNDLVI------------------------------SACAWEEVREH---------
EXOC1_DROME/198-866AIKDAEQFIEQLSRELHDLDGAN.MQSVLA------------------------------SEQKVLKMMEH---------
A7E4X8_SCLS1/708-1443KV..IDGLKDDVERELNKVQAGGWLNRLEE------------------------------EDERVEAIKRG---------
Q6C0U5_YARLI/751-1484KD..AKELEADINRELAQLEESN.ISHVID------------------------------LDTKFGDLTTD---------
Q2GRZ6_CHAGB/575-1334RN..FDEMRTDLDRELSKAQAGGWLARFQE------------------------------EDERVEAIKRG---------
A7RVQ5_NEMVE/163-846AISNIETFTDQLSKDLSVLDGAN.IYSIMA------------------------------SEDQVTSLMDL---------
Q5TMX8_ANOGA/201-872AISNAELFMDDLSHNLLQLDGAN.IQSVLE------------------------------SEKQVQMLMER---------
A0A0D1E5C3_USTMA/474-1173GKGTADMIEARLLDELSALEAAN.IFAIIE------------------------------SDDRVALVVKH---------
A5E4P0_LODEL/994-1796MN..TEVLLKGLTKELNKAKRET.VKRLVS------------------------------VDL.TKTLAQD---------
EXOC1_DICDI/107-855FEKDVDILTERLGKTLSTLETEM.IVGVLD------------------------------SGVGVNEVISQ---------
A3KPP9_DANRE/184-869.N..AEAFAEKLSRELQVLDGAN.IQSIMA------------------------------SEKQVNTLMQL---------
E7LTP8_YEASV/640-1316DD..ADSMIERIDLRLAETEYLF.NQNLLS------------------------------LQKIGPNIRPY---------
V5ILH3_NEUCR/647-1440.N..FDEMRIDVDRELSKAQAGGWLARFQE------------------------------EDERVDAIKKG---------

PF04129

VPS52_YEAST/47-607------------------NKDQS-PFAKLK------------------------------..SLQETHSNN---------
VPS52_SCHPO/1-508------------------MQRAS-TQDVYD------------------------------...GSGDDLNK---------
Q9VMQ8_DROME/42-546------------------VENKS-IEDYIA------------------------------ESQNIANLHNQ---------
VPS52_RAT/94-601------------------IEQKS-IRDYIQ------------------------------ESENIASLHNQ---------
VP52A_ARATH/93-587------------------.....-..DYIK------------------------------ESDNLVSLHDQ---------

PF15278

B6K1Q5_SCHJY/526-611------------------------GKHLFE------------------------------LDWSGEDAFEK---------
YD6C_SCHPO/520-605------------------------ISRLST------------------------------LKWNEGTTIKD---------

PF06419

F4PTE8_DICFS/25-669SLNELTTFYSNNSINA...RRNL-RNDIERRALDINIQFLDQFTALNK............CIEDIQLDYED---------
D7TU00_VITVI/30-688SLNTLSTFYTENTQHA...RRNL-RSTIEKRCLSINHDFLRASDAAQQ............ALDCVEEEVNA---------
K4CMR1_SOLLC/27-689SLNTLSEFYTENTPHS...RRNL-RSTIEKRSLSINEEFLLSSAAAQK............SLDRVEQEVNE---------
T1IZR2_STRMM/42-648ALKTLATYFTENNPRT...RRDL-RSQIERRSLVINEEFVQDFRQVIQ............QLDSVHKDVLA---------
E6ZVT0_SPORE/99-753........GLVDTARA...RRDL-DKDIRQRMLSATDDMIAVLHTVDR............GLVQLSDDVAA---------
E3QI24_COLGM/61-707ALQLLDSRGLKNTAET...RRQL-RLDLQKEVIDSNGEIVSQFGRVAD............QLRRIGATLDK---------
G8ZRY6_TORDC/181-815YVGNLA.............RKSM-RSDLESELLKDHLTILEELTPIIR............RIKRLSTSVEK---------
D0NH36_PHYIT/44-655.LVQLDASETPTLATL...RRNL-RSSLEHQQLALAQKALDGLERTLE............QVSNLANQVDA---------
G2XGZ3_VERDV/42-689ALALLDEKQINNQPRV...RRQV-RLDLQKEMIECNGEIINDFGRVAD............QLRRVRHTLNQ---------
C5M6P2_CANTT/146-753ITGSIS.............RKKF-KGRIEHEIIKNQQSILKQYQPTIR............QLKNIETKLQK---------
S3D9N6_GLAL2/53-695ALDLLDQRNVVNNAET...RRQI-RLDVQKDVIESNGDIIKEFGHVAE............QLRRIGLTIAS---------
K1QJ12_CRAGI/42-639SLKALSTFFNENSLRT...RRNL-RSDIERRSLSINEEFLQTFQGVKE............QLDSVYADVKA---------
E9EWT4_METRA/42-671ALALIDQQEFANDAKN...RRQI-RINLHKDVIDSNGTIIDNFGRVSE............QLHRVRLILEK---------
C1GBA8_PARBD/57-738ALEILDDRGVKNTPEM...RRQL-RLEVQKEVIDSNGKIVQDFGKVAE............QLTRIGTVISS---------
G0VHH4_NAUCC/184-845YVGTLA.............RKSL-RNDLESQLLKEHVLVLEEFRPIVR............RIKRFTSSVDK---------
T1K467_TETUR/31-648AVKILSSCFTDNTITI...RRNL-SNTLEKRSLVIIENFQSCFGEIKR............LMESLHLDLTS---------
B9S1S6_RICCO/31-692SLDALSTFYSDNTPQA...RRNL-RSTIEKRSLHINLQFLQASNAAQL............ALDRVEEEVNS---------
G3J3T2_CORMM/115-739.LALIDQRGIRNDGKT...RRRL-RLELQKDVIEKNGRILDDFSTVSE............QLRRIKTILDK---------
G3B3F3_CANTC/135-733VMGSLS.............RKKL-RSKIEVNLIKNQSVFLKEFSPMVK............QFRSMDNKLTQ---------
COG6_PICGU/138-737ALGSMS.............RRKL-RGEIERTLIRNQTQTLKEYQPVIK............NLRKLEENVDA---------
U1G9I0_ENDPU/55-707SLSILDARGVVNDASA...RRRL-RLDAQKEVIECNGAIVQDFGVVVE............QLERVGTMIAD---------
B7Q1K3_IXOSC/40-604ALKSLSEFFTENNIRT...RRNL-RGDLEKRSLAINEQFLQSFGDVKA............SLDALCTDMSA---------
F1A3Z4_DICPU/25-688ALEELSTFYTANSISA...RRNL-RSEIEKRYLDINIEFLDQFNQLND............SINELIKDFEE---------
A5DUD8_LODEL/174-816FVGAMT.............RKKL-RSQVEFSLTKTQTKMLKEYQPILR............HLKVIESRLKK---------
C5FL60_ARTOC/56-718ALETLDSRGIQNTAET...RRTL-RLDVQKEVIDSNGKIIQDFGRVAE............QLTRISDVIAN---------
X1WYM6_ACYPI/29-624ALKEISEFYTENTLEC...RRGL-RTKIEKRSLALNENFLASFEKVKN............AVNALHDNVNS---------
COG6_CHAGB/47-689ALALLDERGVQNTAET...RRQL-RLDLQKEVIDSNGEIIDEFAKVAE............QLRRIGTTIGR---------
T1EFP4_HELRO/53-656ALKSLSIFFTENNIRT...RRNL-RGDIEKRTLNINEEFIGAFAVVKE............QLDSIYKDVEA---------
G4V7Z1_SCHMA/35-648........MANNSISN...RRTL-RSNLEKIQLNYYQDLLTSFGDVKK............RLDSLDTCINS---------
C1MX75_MICPC/28-699.LRGLSEFYTENTPEA...RRGL-RLSIERRGLDVNREFLDASSNARD............ALSEVDAQLDG---------
COG6_ASPCL/56-753ALETLSLRGIHNTAET...RRQL-RLDVQKEVVDSNAEIVRDFGTVAE............QLQRIGAVISS---------
R9NZP8_PSEHS/106-778........QLVDTARA...RRDL-DKDIRQRMLSATDNIIAVLQTVDN............GLVRLSDDVAA---------
M7T0Y3_EUTLA/61-714ALALLDERGVSNNAET...RRRL-RLDVQKEVIDSNGEIIAEFGRVAE............QLKRIGSTIDK---------
B3N2A1_DROAN/35-627ALSGLSTFFTENTIQN...RRNL-RSQIEHRSVGINENFLKAFREVKL............SLDAVCDDLDK---------
G3AM15_SPAPN/147-779LIGSMN.............RKKL-RGKVESELIRNSSYVLKEYAPLVR............QLKAIETRLNQ---------
COG6_DEBHA/142-759ITGSNS.............RKKL-RGEIENDLIKTQGLMLKEYQPVIK............NLSNLENDLKN---------
COG6_DICDI/25-671ALEELSTFYTSNSIGA...RRNL-RNEIEKRYLDINIQFLDQFDQLNK............NINELVLDFEG---------
D6WE56_TRICA/33-626ALKQLSTFYTENTLQA...RRNL-RSQIEKRSLDINENFLASFREVKL............CFDAVYNDVSE---------
K1Y0X5_MARBU/53-696ALALLDKRNVENNAET...RRQL-RLDVQKEVIESNGDIIKEFSHVAE............QLKRIGLTIAS---------
R0IIQ7_SETT2/55-693ALETLDARQVQNSAET...RRQL-RLDVQKEVIQCNGEIISDFGHVAE............QLKRIGTAISS---------
G2YFW1_BOTF4/53-688ALSLLDKRGTQNTAET...RRQL-RLDVQKEVIESNGDIIREFGHVAE............QLKRIGLTIAT---------
B3RLZ3_TRIAD/43-642ALNALSGFFVRNDLRS...RRNL-RSDIEKRSLAINEQFVDAFGKVYT............SFNTLRSEIEA---------
M2NAU2_BAUCO/56-695ALSILDERELQNTAET...RRNL-RLDVQQELVQCNGEIVRDFGKVAE............QLQRIGASIQR---------
COG6_MAGO7/54-703ALSLLDSRGIQNTAEA...RRRL-RLDLHREVIDSNGEIIDEFGRVAD............QLRRIGNTLEK---------
N1PID3_DOTSN/58-692ALDILDERGLQNTADT...RRNL-RLDVQEELIHCNGEILHDFGRVAE............QLKRIGSAIAN---------
M7NMJ9_PNEMU/26-631...IISQTELKNDEIS...KKKF-KIDNVSNIISINTKIIQEFEKIII............ELKTFKDYIST---------
G0WDG5_NAUDC/220-947YIGILA.............RKTL-RSDLENELLKEHIIVLEEFKPIVR............RIKRFSSSVEN---------
U4LN57_PYROM/30-663ALAVLDTRFVENTAES...RRQL-RVDVQANVIRSNAQIIRDFSQVAE............QLTRIGTALDN---------
F4NVM0_BATDJ/55-674ALSALSDIYPQNTPSA...RRNL-KSHVEKQVSGVSKEFLAAFDALHS............QLIGIESHIDS---------
Q6NMI3_ARATH/31-678SLNALSSFYDENSAHA...RRNL-RSTIEKRALQINSEFLNAADSTQI............ALDRVEEEVNA---------
A9SY28_PHYPA/31-697.LGALSSLYTDNTQQA...RRSL-RATIERRGLSINEEFLRASESAQK............ALDAVELEVAG---------
R4XC07_TAPDE/63-663ALNILEQSGFVNSATS...RREL-APNIAMQELETNKTVLDDYRHLVE............EMRLIKMGLAS---------
COG6_CANGA/184-819YIGTLA.............RKSL-RTDLETQLLKDHVTVLEDFKPIVR............RIKRLAAPVQQ---------
A0A088AU02_APIME/31-620ALKELSTFFTENTLNS...RRNL-RSKIERRSLAINEEFLSAFREVKS............SLDGIYQDVLA---------
M3AVJ9_PSEFD/47-684ALSILHERGLQNTADT...RRNL-RLDVQEELIQCNGDIVHDFGTLSE............QLRRIGLAIAN---------
G8BSH8_TETPH/181-817YVGTLA.............RKTL-KNNVETELLKEHLSVLEAFKPIVT............RIKTLSKSLKN---------
V5EQK1_PSEBG/40-699........HLVDTARA...RRDL-EGDIQSRMLNATDDIIRVLQTVDD............GLVRLSSDVAA---------
COG6_YEAST/190-824YVGTLA.............RRAL-RTDLESQLLKEHITVLEEFKPIIR............RIKRLSSSVEK---------
C4Y1K1_CLAL4/138-736VGGSMA.............RKNL-RGEIEADLLKSQAAVLADYARPMR............GLRSLGDQVAA---------
C5DMM3_LACTC/169-799FVGSLA.............RNSL-RSNLESELLKSHLMILDDIQPIVR............RIKRLSEPVQN---------
J4VQT6_BEAB2/59-673....IDHRGLKHDGRT...RRRL-RLDLQKEVIEKNGKILDDFGFVSD............QLRHIKVVLEK---------
G8BDK2_CANPC/146-760FMGTVS.............RKKL-KSRIEHELIKNQATVLKEYQPIVK............QLKHVEAKLKK---------
A0A0C4DUI8_MAGP6/47-702ALALLDSRGLQNTAET...RRRL-RLDLQKEVIDSNGQIINEFGRVAD............QLRRIGSTIEK---------
COG6_ASHGO/167-791FLGSLS.............RKTL-RSQLEKELLKDHLATLENFQPIAR............RIMRLRQPVKN---------
D8T0Q7_SELML/31-672SLGTLSTFYAENSAQA...RRNL-QATIEKRGLSINEEFLRASEAAQK............ALDAVELEVAG---------
COG6_SCHPO/44-649ALEQLSERKFKNEREA...RKQL-PFEVFSDLIWTNGSIIKELSELSS............QTLSVQSQLLK---------
A4S9H0_OSTLU/72-716....LSEILPLGAHGATTSSVNL-RATVERRGLALNERFLDESMRART............KLSQVEATLEA---------
M0TQE9_MUSAM/30-700SLATLSTFYADNTPQA...RRNL-KSSIEQRALAINHHFLDASLAAQQASISRYSLLLFFALDTVEEEVNA---------
E5ACR4_LEPMJ/80-720AFETLDARGVQNTAET...RRQI-RLDVQKEVIQCNGEIVKDFGQVAE............QLKRIGSAITS---------
Q6C1G5_YARLI/26-595ALVALDDRITDNTASI...RRSL-RANTEAEVIKANGEALKKFAPLVA............QIQASGNTIAD---------
A0A0D2XVZ8_FUSO4/62-692ALALLDERGIQNDAET...RRRV-RLDLQKEVIDSNGEVIAEFGRVAE............QLRRIKTTIDK---------
C5GW18_AJEDR/57-748ALEILDDRGIQNTPET...RRQL-KLDVQKEVIDSNGKIVQDFSKVAE............QLKRIGTVISS---------
C1EEF9_MICSR/30-686.LKGLSEFYGENTPAA...RRGL-RSSIERRGLDINREFLEASGQAQE............ALAVVDAQLEG---------
W1QBZ5_OGAPD/148-758MLGSIA.............RRKL-RGDVESELLRQHFQSLKKFHLVVK............KLNVIKQDLDD---------
A8HUT2_CHLRE/30-678SLQTLSTFYTDNTPAA...RRGL-RTTIEKRGLAINERFIGAAESVIK............ALDEVQRSLDA---------
B0VZV1_CULQU/39-627ALTDLSQFYTENTLQS...RRNL-RSQIERRSLAINENFLAAFREVKL............ALDDICGDIDA---------
G0RKF7_HYPJQ/55-674......QRAVGTNVKN...RRQL-RLDLLGEAIGCNGEIVGEMGLVAE............RLKDVRGVVER---------
Q00T18_OSTTA/88-728..DILSSQHKTTTPCA...SVNV-RAAVERRGLALNESFLDASLMAQT............KLSQVEATLAA---------
COG6_CRYNJ/70-689TLPKRRTLKGQSAAIA...RKYL-KQDIETCLATGSTKFLEAFAEVDQ............KLNVLREHMQE---------
A2E714_TRIVA/27-593.LSSID....DTTFNS...NTSV-RTLLEEKELSELNRFIEQFSQLTT............TIDRVFTTIDL---------
L8G9L6_PSED2/56-700ALQLLDERGVENTVET...RRQL-RLDIQKDVIDSNGLVIKEFGHVAE............QLRRIGQSIAS---------
S2JPX5_MUCC1/49-650.LTSLSNIPDLDEISL...RRNL-RGTIEKKEIETNRKFLLAFEKVVQ............QFERLETQMGQ---------
G9PA30_HYPAI/22-644.IFLADERLSRGSAKT...RRLL-RLELLREAIDCNGEIIEEMGSVVE............RLKLIRGLVEK---------
COG6_PHANO/55-693ALETLDTRGVRNTAET...RRQI-RLDVQKEVIECNGEIVKDFGQVAE............QLKRIGTAISS---------
T5A889_OPHSC/60-688ALSLLDDRGIENNAKT...RRQI-RLSIHKEVIDSNGAIIDEFGHVAE............QLRLIGTTLGR---------
G7XM19_ASPKW/58-742ALETLSLRGIHNTAEV...RRQL-RLDVQKEVVDSNAEIVRDFGLVAE............QLKRIGTVITN---------
N4VJY2_COLOR/52-699ALQLLDGRGLLNTPET...RRQL-RLDLQREVIESNGHVVSHFGRVAD............QLCRIGLTLDK---------
C4R6S3_PICPG/154-788FVGNLA.............RRKL-RNDIEHDVVDANFNFLKQLQPLRK............TLGQIESDLNE---------
G8YLX1_PICSO/140-752FVGLSS.............RKKL-RGEIEYDLTKTQSLILKEYDPHRK............KLYALESDISK---------
E1ZT97_CHLVA/34-681.LATLSDFFEDNSPAA...RRRL-RSTIENQGVRINEQFLEEAQGVIK............MLDVVQGDLDS---------
W1P048_AMBTC/29-693SLNALSTFYVQNNQLA...RRNL-RSTIEKRSLAINEEFLLASEAAQK............ALDRVEEEVNV---------
A0A0D2VZS5_CAPO3/71-723.LRALSTFVEDNTLHT...RRNL-RSAIEAQALSVHRELAASLGQVDA............ALDAAAQEVAL---------
K7J084_NASVI/37-626ALKELSTFFKENTVED...RRNL-RSKIERRSLAINEEFIDAFKEVKS............VLDNMHRDVAG---------
C5DUZ7_ZYGRC/192-819YLGILE.............RKSL-RSDLENELLKDHLTVLEEFRPIVR............RINRWSNSVNN---------
V5HY00_BYSSN/58-733ALETLDRRGVHNTADT...RRQL-RLDVQKEVIDCNGEIVKDFGKVAD............QLQRIGTVITS---------
U9U8S1_RHIID/50-658...ALSEFYSNNNNNSLIIRRNL-RGNIEQKAIEANRNFLEIFGKITE............QLAVIESEVKS---------
I1FMS4_AMPQE/123-704SLKVLSEFLPANTLHA...RRNL-RSDIERRGLILSEEFRDLLGSLAA............QIQDMQNDVHS---------
COG6_PICST/163-782VVGSMS.............RKKL-RGKVENELIKNQSLVLKEYQPVIK............QLKVVEDRLSK---------
Q7QJN1_ANOGA/32-623ALSDLSTFFKENTLQS...RRNL-RSQIEKRSLEINQNFLSAFKEVKE............ALDGICDDINS---------
COG6_ASPOR/122-808ALETLSLRDIHNTPEV...RRQL-RLDVQKEVVDCNAEIVRDFGKVAE............QLKRIGTVITS---------
I1H7V6_BRADI/77-734.LGALSTFYVQNTPQA...RRNL-KSSVEQRALAINRHFLDASLPAHK............ALDRVEGEVHA---------
F9XD71_ZYMTI/57-693ALSILDERGLQNTAET...RRNL-RLDVQEELIQCNGEIVQDFGKVAE............QLKRIGAAIAN---------
J7S8L6_KAZNA/176-802YVGTLS.............RKNL-RNDLETELLKEHIIVLEEFRPIVR............RIKRLSTSIEN---------
COG6_CANAL/150-758IVGSMS.............RKKF-KGRIESELIRNQSNILKQYQPIVK............QLKQIEVKLNK---------
F6SQE9_CIOIN/44-655ALRSVSTFFTENNIRT...RRNL-RGEIERRSLLINQQFADSFSLLVK............DLECIHEDVQA---------
B9N0R1_POPTR/31-709SLNTLSAFYNENTPQS...RRHL-RSTIEDRSLHLNHEFLQASHTAQQ............ALDHVEEEVNA---------
T1I707_RHOPR/34-617ALKELNSYFHENTIQS...RRNL-RSNIEKRSLSINENFLSAFRKVKE............RLDAIYEDVIE---------
COG6_CAEEL/38-623FITPLVEDMNLDSNV....DRKL-HNKLERYELRLNKEYLSEFEKINN............IVQKFDELCVK---------
F7BIB8_HORSE/4-604ALKALSSFFVENSLRT...RRNL-RGDIERRSLAINEEFVSIFKEVKE............ELESINEDVQA---------
COG6_NEUCR/64-712ALFLLDERGLQNVAEN...RRKL-RLDLQKEVIDSNGEIIHEFGKVAE............QLKRIGYTIGK---------
M3D478_SPHMS/53-688ALAVLDERHLQVTADA...RRNL-RLDVQDELIRCNGDIVHDFGKVAD............QLNKIGNAISN---------
G8JRN3_ERECY/172-797FIGLLS.............RKSL-RSDLEKELLKDHLSVLEDFQPIAR............KIKRLHKPVER---------
R1EQ64_BOTPV/49-680ALETLDARGLKNTQDM...RRQL-RLDVQREVVQCNGDI.....................QLRRVGTAIQA---------
I2H727_TETBL/181-823YLGILA.............RKSL-KSDLESELLKDHLLVLEEFKPIAR............RIKRLTDSVQT---------

PF03081

B4LDS3_DROVI/323-697-------------------...Y-LV----------------------------------MLLGLQRLLNW---------
Q5KMS6_CRYNJ/301-670-------------------....-..----------------------------------..EAIMHAAEG---------
J3MBU4_ORYBR/165-513-------------------.VWT-ST----------------------------------MRIVFRALSEM---------
G1XRU1_ARTOA/244-617-------------------DNGI-SH----------------------------------YAQALEGIFSA---------
W1PIG8_AMBTC/268-635-------------------RRWI-RA----------------------------------IKLFVRFILVS---------
S0EBU7_GIBF5/246-629-------------------TNGI-GT----------------------------------YSQAMEGLFVS---------
K4BC35_SOLLC/279-644-------------------RRWI-RA----------------------------------MKIFVRIYLAS---------
Q60EX4_ORYSJ/154-509-------------------QRWT-RG----------------------------------FTVMAEALSAT---------
K3XWI2_SETIT/155-495-------------------..WA-QA----------------------------------LSTMERVFRLR---------
Q6Z421_ORYSJ/101-458-------------------.LWG-RH----------------------------------LEFVVRCLLES---------
C5E0R8_ZYGRC/237-621-------------------TSGL-NS----------------------------------YAEALLGFIAN---------
Q6ES92_ORYSJ/192-594-------------------ERWI-RA----------------------------------LLTMVQVLCIT---------
Q9SIB0_ARATH/210-552-------------------RKWL-RT----------------------------------TTRAVNTLFSG---------
Q9LQP9_ARATH/238-587-------------------KIWV-IV----------------------------------ARVAITTLFNG---------
F6GST9_VITVI/277-640-------------------KKWM-QA----------------------------------VKIVVRVLLWG---------
G8ZSY9_TORDC/245-624-------------------....-.S----------------------------------YTEALSGFVAN---------
I1LFL8_SOYBN/224-593-------------------ATWN-QV----------------------------------VWHCTTVLFNA---------
M4F3N2_BRARP/219-571-------------------KKWL-EA----------------------------------TKIVINNLFDG---------
W1NW13_AMBTC/231-604-------------------KRWV-RA----------------------------------ARASIRLLFAS---------
M0SRF8_MUSAM/218-582-------------------NKWK-QA----------------------------------MCAFIQDFLAR---------
J7REJ7_NAUDC/235-618-------------------.SGM-IS----------------------------------YTEALLGFIAN---------
D2UX81_NAEGR/218-569-------------------...F-IF----------------------------------YMNFYLKLLES---------
M4DQ92_BRARP/206-564-------------------KGWV-RL----------------------------------ANVAFVTLFNG---------
K3Z4M7_SETIT/235-602-------------------AQWM-QF----------------------------------YRIGVKLLFAA---------
B9S3S8_RICCO/351-722-------------------.AWI-KT----------------------------------FKDCAFIYFSK---------
B7P4G4_IXOSC/289-655-------------------....-.T----------------------------------ALTALCKLMQS---------
F6H2V1_VITVI/283-641-------------------AQWG-KH----------------------------------LEFAVKHLFEA---------
Q9FNR3_ARATH/273-622-------------------RKWT-KV----------------------------------VKIITQVYLAS---------
M0THS1_MUSAM/243-589-------------------RSWL-GA----------------------------------SRVALRTLFHG---------
C5XNX2_SORBI/186-525-------------------MRWI-PA----------------------------------IRVVFHILIPS---------
A7TQI9_VANPO/237-621-------------------SSGI-LG----------------------------------YTEALLGFISN---------
Q6L582_ORYSJ/123-524-------------------.RWT-RA----------------------------------LTVMAHALSAT---------
K3XFC8_SETIT/312-653-------------------.IWT-TA----------------------------------MHIMVGFLGEI---------
E9G2G2_DAPPU/324-689-------------------....-..----------------------------------..TALLRLLQS---------
M4ELV2_BRARP/227-592-------------------RSWL-EA----------------------------------VKVSMETLFKG---------
D7MQ70_ARALL/301-664-------------------KKWI-QA----------------------------------VKITVRVLLVG---------
M4E3U0_BRARP/64-418-------------------..WN-KT----------------------------------FKNCSSLFFPG---------
C5E318_LACTC/234-618-------------------SSGF-LN----------------------------------YTEALLGFIAN---------
M0RFS4_MUSAM/240-598-------------------ARWV-KA----------------------------------VNMAFLILVPS---------
M0S9N6_MUSAM/277-655-------------------QDWV-HL----------------------------------MQIAVNLLFAE---------
J3MUP3_ORYBR/158-521-------------------RRWS-HA----------------------------------IRVVVKTLLAG---------
B9I6L2_POPTR/266-620-------------------DKWI-KA----------------------------------ANVSLRILFPS---------
E4X2L8_OIKDI/306-653-------------------....-..----------------------------------..QAFVRLADR---------
D7MSH8_ARALL/228-592-------------------KTWL-KA----------------------------------VKLAVRSLFFG---------
B9IK77_POPTR/253-654-------------------KRRI-QT----------------------------------MKMFMRVYLAS---------
M0RET8_MUSAM/246-597-------------------RSWL-VA----------------------------------SSVAVRTLFHG---------
A9RYU9_PHYPA/273-621-------------------TNWI-QH----------------------------------MRIAIKLLFSA---------
Q69JW6_ORYSJ/346-696-------------------NAWV-RA----------------------------------MRITLNVLTEM---------
M1AX18_SOLTU/275-644-------------------RRWI-RC----------------------------------MNIFVRVYLAS---------
M0ZQS8_SOLTU/207-577-------------------TRWI-NV----------------------------------ARNCSNTLFLA---------
B8MLJ7_TALSN/245-625-------------------TNGI-GV----------------------------------YSSALEGFIVV---------
I1I8W2_BRADI/260-643-------------------RRWN-HG----------------------------------VRPVVRTLMAG---------
K7M841_SOYBN/188-545-------------------ENWI-KT----------------------------------CKAAVKIMFPN---------
M7S7Y8_EUTLA/245-627-------------------TNGI-GM----------------------------------YARAMEGIFLA---------
I1MUP7_SOYBN/290-649-------------------KNWV-QA----------------------------------VKVVVGVLLSG---------
I1LR33_SOYBN/232-587-------------------KSWL-QV----------------------------------VKVAVGTLFHG---------
Q9LIA2_ARATH/266-643-------------------KKWV-RV----------------------------------MRDIVQVYLLS---------
I1MBG5_SOYBN/274-630-------------------EKWI-KA----------------------------------SNVALKILFPS---------
M2MJA4_BAUCO/246-630-------------------SNGI-GS----------------------------------YAHGLLGMYTA---------
B9RAG8_RICCO/276-630-------------------KKWI-QA----------------------------------IKICVRVLLTG---------
U7Q7I3_SPOS1/370-767-------------------TSGI-GM----------------------------------YAQSMEGMFLA---------
Q5TQS7_ANOGA/318-703-------------------...Y-LV----------------------------------LLLGLQKLLVW---------
E0VIX9_PEDHC/327-689-------------------....-..----------------------------------TVMALQKLIQN---------
EXO70_KLULA/234-616-------------------SSGV-NS----------------------------------YTEAMLGFIAN---------
D8RZH2_SELML/269-629-------------------KKWI-QV----------------------------------MDVGVKVLFAS---------
B9HPL3_POPTR/209-568-------------------KAWL-NA----------------------------------VKVAVKTLFYG---------
M7PEF2_PNEMU/241-608-------------------SNGI-II----------------------------------YTQALLGMFKS---------
C4LW49_ENTHI/279-679-------------------....-..----------------------------------.MKHVLSLFQN---------
I1JCY6_SOYBN/322-699-------------------..WI-NT----------------------------------WKECTSVWFPG---------
D6WW45_TRICA/328-692-------------------....-.V----------------------------------CVIALHKLMQI---------
B6K881_SCHJY/235-604-------------------SDEI-SI----------------------------------YSAALVRLLPL---------
F0XF34_GROCL/729-1128-------------------TNGI-ST----------------------------------YTQAMEGMFLS---------
D8SPE6_SELML/233-605-------------------KKCL-KA----------------------------------MKVSFKVLFAS---------
M0REN0_MUSAM/218-570-------------------RRWI-RA----------------------------------ARVCVRIIFAS---------
E0CP16_VITVI/299-657-------------------.LWI-QH----------------------------------FELAVKTVLVS---------
K3Y3Q0_SETIT/194-605-------------------ERWI-KA----------------------------------LKTMVQVLCIT---------
B9HV40_POPTR/282-631-------------------DQWC-KH----------------------------------LQLAVKQVFET---------
J3MH82_ORYBR/80-438-------------------ERWG-RH----------------------------------LEFAVRHLLEA---------
B9GVY9_POPTR/242-613-------------------RRWI-RA----------------------------------AKVCVRILFAS---------
M7UD48_BOTF1/247-635-------------------TNGI-GT----------------------------------YAMGMEGAFLA---------
W1PWG9_AMBTC/231-597-------------------KVWL-HA----------------------------------ARVALKTLFAG---------
N1J6U6_BLUG1/243-631-------------------TNGI-ST----------------------------------YAKGIESSFLA---------
K3XSA8_SETIT/229-593-------------------RRWN-RA----------------------------------MRVFIRVYLAS---------
B9SNP4_RICCO/271-635-------------------KRWV-RA----------------------------------MKIFVRVYLAS---------
M1CZG7_SOLTU/225-591-------------------KIWL-NA----------------------------------VKVAVSTLFYG---------
Q9C8H6_ARATH/254-623-------------------DQWR-LH----------------------------------MEIAVKEIYEF---------
H2ZQN6_CIOSA/276-638-------------------....-.A----------------------------------MVSACAKLIVV---------
K3XFW5_SETIT/237-577-------------------KRWT-TV----------------------------------TKIIGKAIVAM---------
A9TGT7_PHYPA/278-635-------------------RSWN-HT----------------------------------VTVGVKVLFSS---------
M1W138_CLAP2/246-628-------------------TNGI-ST----------------------------------YAQAMEAIFLS---------
A5B8C4_VITVI/267-614-------------------ERWT-KA----------------------------------ATVALRILFPS---------
S3E3U8_GLAL2/246-630-------------------TNGM-AT----------------------------------YAKGMEGAFLA---------
B9T041_RICCO/247-608-------------------KNWL-NA----------------------------------VKIAVKTLFNG---------
H6CBM6_EXODN/248-636-------------------SSGI-GA----------------------------------YANAMEAMFLA---------
I1JWP0_SOYBN/263-614-------------------RKWV-RA----------------------------------MKIIVRVYLVS---------
F4KG58_ARATH/222-573-------------------MNWI-HY----------------------------------IRISVKLLFAA---------
F6GTU7_VITVI/230-591-------------------RHWL-NA----------------------------------VKAAVKTLFYG---------
M4CLF8_BRARP/249-615-------------------KNWI-KA----------------------------------AKIGVTTLFKG---------
W5EWA8_WHEAT/175-531-------------------....-KY----------------------------------LQITVK.LLDG---------
I1MDK3_SOYBN/222-572-------------------KSWL-NA----------------------------------VRFVVRTLFHG---------
M1CA15_SOLTU/267-620-------------------KKWR-QA----------------------------------TKNVIAFYLPS---------
C4R8N1_PICPG/235-620-------------------SNGV-SN----------------------------------YSEAFISFITN---------
Q8VY27_ARATH/245-606-------------------KNWI-KA----------------------------------AKIGIATLFRG---------
Q0CYR3_ASPTN/219-599-------------------TNGI-GI----------------------------------YSNALENFIYT---------
U9SQP1_RHIID/236-607-------------------TCGF-NS----------------------------------YTDAILKMFKT---------
EXO70_EMENI/247-629-------------------TNGI-GT----------------------------------YSDALENFIYA---------
S2J047_MUCC1/214-590-------------------.SEF-LK----------------------------------YTECYTKMLES---------
J3L5F1_ORYBR/344-686-------------------LRWI-PA----------------------------------IRAVFHILIPS---------
K0KAQ4_WICCF/235-607-------------------SNGI-NN----------------------------------YTEAFLGFLSN---------
M0W8E8_HORVD/215-574-------------------RRWN-HA----------------------------------IRVVVRTLLAG---------
R8BPV7_TOGMI/250-634-------------------TNGI-ST----------------------------------YAQSMEGLYLA---------
K3ZHK2_SETIT/304-675-------------------ATWI-KA----------------------------------FRHAVEADLPG---------
M0TX18_MUSAM/52-414-------------------RAWL-AA----------------------------------APIAFRILFSR---------
K4CMD0_SOLLC/278-635-------------------ANWG-KH----------------------------------LEFAVKHLLEA---------
G3JCP3_CORMM/249-631-------------------TNGI-GS----------------------------------YAQAMEGIFVA---------
Q6K647_ORYSJ/301-673-------------------KKWV-QA----------------------------------VKTVVRVLLAG---------
J3N6B0_ORYBR/11-377-------------------ATWI-RA----------------------------------FRHTINVGLSG---------
C5FN52_ARTOC/246-625-------------------TNGI-GV----------------------------------YSNVIEGMFIA---------
J7R1E6_KAZNA/236-614-------------------SNGM-LN----------------------------------YTEALLGFIAN---------
EXOC7_DICDI/437-835-------------------SHPL-IS----------------------------------YVQETLRLYQI---------
K1X101_MARBU/264-643-------------------TNGM-GT----------------------------------YATGMAGSFLA---------
W1NJ63_AMBTC/264-632-------------------.KWV-QA----------------------------------MKVSIHVFFPS---------
G0S641_CHATD/252-645-------------------TNGI-GT----------------------------------YAQAMEGLFSA---------
D5GH85_TUBMM/239-604-------------------SNGI-SV----------------------------------YTNALEAIFEA---------
A9SN89_PHYPA/313-674-------------------HKWC-EH----------------------------------FKIIVKILYAG---------
J9JWJ5_ACYPI/326-687-------------------....-..----------------------------------.VIALQKLMQA---------
W5AN73_WHEAT/1073-1426-------------------KKWT-QA----------------------------------LRVVVQGLLAE---------
W1PHH8_AMBTC/279-635-------------------NQWG-TH----------------------------------LEFAVKHLFEA---------
U5H6T1_USTV1/251-633-------------------RRSL-GR----------------------------------FLDVMFGLLKS---------
S7ZDA9_PENO1/246-625-------------------TNGI-GI----------------------------------YSNALEAFIVA---------
K2RHI9_MACPH/246-628-------------------TNGI-GT----------------------------------YAAGLEGLFIA---------
F6HQX6_VITVI/246-608-------------------KNWL-EG----------------------------------IKISITTLFTG---------
I1NUS0_ORYGL/283-640-------------------KKWI-QA----------------------------------LKVVVRGLLAE---------
M4AQR1_XIPMA/327-700-------------------....-..----------------------------------.ISAFVKLAQS---------
M7XH50_RHOT1/276-657-------------------.RGL-GR----------------------------------VLDVMLALAKS---------
K4DFQ8_SOLLC/257-617-------------------DQWD-KQ----------------------------------LEFVVKYLLDT---------
D7LD39_ARALL/243-607-------------------KNWI-KA----------------------------------AKIGVITLLRG---------
E3S143_PYRTT/247-623-------------------TNGI-GT----------------------------------YVQAIEGLFVA---------
E7LW76_YEASV/236-620-------------------SSGM-NS----------------------------------YTEALLGFIAN---------
M3APZ2_PSEFD/248-629-------------------.CAI-TT----------------------------------YATGIQGMIVA---------
T5A733_OPHSC/248-627-------------------TNGI-GT----------------------------------YAKAMEGIFLS---------
U5CZ65_AMBTC/305-668-------------------SLWI-QH----------------------------------FELALKTVFES---------
Q0U449_PHANO/247-623-------------------TNGI-GT----------------------------------YVAAIEGIFVA---------
I1Q027_ORYGL/148-486-------------------.VWA-QA----------------------------------LSTMDRVFRLR---------
M1CE10_SOLTU/253-614-------------------EKWV-KA----------------------------------VNVALRILFPS---------
M0U7Y4_MUSAM/169-538-------------------RSWL-GA----------------------------------SRVAVSTLFSG---------
EXO70_ASHGO/231-611-------------------SSGF-NS----------------------------------YTEAFITFVSG---------
G2XG72_VERDV/248-627-------------------TNGI-GT----------------------------------YAQAMEGLFLA---------
J3M2U7_ORYBR/269-636-------------------HHWR-QS----------------------------------FRITVKLLFGS---------
L8G7J8_PSED2/268-651-------------------TNGI-GM----------------------------------YAQAIKGAYIA---------
M4CEA6_BRARP/229-593-------------------KSWL-QA----------------------------------AKLAVRKLFFG---------
A9SZG5_PHYPA/276-645-------------------KSWN-QA----------------------------------MKVGVTVLFAS---------
EXO70_YARLI/228-600-------------------SNGI-HI----------------------------------YAEALLKMLQA---------
A0A0D1CBV0_USTMA/294-724-------------------QAGA-VE----------------------------------LFEAYYGMLDN---------
M0TA71_MUSAM/314-686-------------------ATWN-KV----------------------------------FRQTVEVAFPR---------
Q6Z5V5_ORYSJ/164-504-------------------.KWI-YL----------------------------------LEYIHKIVSVS---------
I1N4J9_SOYBN/299-665-------------------KRWI-WA----------------------------------VKIFVRVYLAS---------
A0A068X0P1_HYMMI/337-709-------------------....-..----------------------------------SLSAFLILTNR---------
M3J203_CANMX/209-599-------------------SNGI-TK----------------------------------YTDVFLTEIHD---------
K3ZZ59_SETIT/223-607-------------------RRWI-RA----------------------------------ACAAVRGVFAS---------
F9XKX9_ZYMTI/246-627-------------------.CAI-TT----------------------------------YATAIQGMYTA---------
B9RM96_RICCO/288-654-------------------AAWN-DV----------------------------------LKHCYSILFPS---------
D7L2C4_ARALL/228-595-------------------RKWI-RA----------------------------------AKVCIRVVFSS---------
K7KYU0_SOYBN/278-635-------------------DQWG-CH----------------------------------LELVVKQLLET---------
D7KZD8_ARALL/246-616-------------------RRWI-RA----------------------------------AKICVRVVFAS---------
U5FM28_POPTR/271-621-------------------KKWV-RA----------------------------------VKIIIRVYLAS---------
Q65WW9_ORYSJ/227-582-------------------ARWI-PA----------------------------------FNMVFRILIPS---------
W5AKS6_WHEAT/499-852-------------------REWI-QA----------------------------------LKVVVQGLLAE---------
S9VZ38_SCHCR/246-609-------------------.EEV-AI----------------------------------YLVALARILSA---------
R7YPE8_CONA1/246-628-------------------TNGV-GT----------------------------------YAQGMEGLYVT---------
M1C7K5_SOLTU/253-615-------------------KDWL-RA----------------------------------ADVAVKILFNG---------
E9EGW9_METAQ/241-624-------------------TNGI-GT----------------------------------YAQAMEAIFLS---------
G8YBT4_PICSO/212-624-------------------SNGI-NR----------------------------------YTNELIRELKA---------
M0RE29_MUSAM/266-621-------------------KNWM-QA----------------------------------LKLVVGVI.SA---------
F6H486_VITVI/271-637-------------------RRWV-RA----------------------------------MKIFVRVYLAS---------
W1PQ65_AMBTC/301-663-------------------KKWI-QA----------------------------------IKILVKVLLSG---------
T1K8E7_TETUR/311-683-------------------....-..----------------------------------.VTALYRLMKA---------
J3MTK1_ORYBR/52-443-------------------RRWI-RA----------------------------------ARAAGRGGFAS---------
I2H140_TETBL/236-622-------------------SSGM-MN----------------------------------YSQALLGFVAI---------
M3DCX2_SPHMS/245-628-------------------TCAI-TT----------------------------------YATGLQGMVVA---------
I1N7V8_SOYBN/316-682-------------------.AWI-NT----------------------------------LKQCAAVYFPG---------
K3YBY1_SETIT/269-627-------------------GNWT-HL----------------------------------MQIAVKVLLPG---------
G7YLN0_CLOSI/142-557-------------------....-..----------------------------------..TALVKFMQN---------
J3L4D1_ORYBR/230-594-------------------KKWN-RA----------------------------------MKVFVQVYLAS---------
R4XBR7_TAPDE/254-624-------------------SNGI-GH----------------------------------YTEAIMRMSQS---------
A9RF66_PHYPA/295-650-------------------KKWT-QQ----------------------------------LEVVVKVLYAG---------
A2FJ22_TRIVA/250-590-------------------QHPV-HT----------------------------------VANLVGFFYKR---------
I1MBG8_SOYBN/93-437-------------------LRWI-KA----------------------------------VNVAHRILFPS---------
J3NNQ2_GAGT3/246-625-------------------TNGM-AM----------------------------------YVQAMEGLFLA---------
M4CAS6_BRARP/212-578-------------------RSWI-DA----------------------------------VSVSMKTLFNG---------
G8JUD2_ERECY/232-611-------------------.SGV-NS----------------------------------YTEALVTFLGN---------
G8B940_CANPC/213-611-------------------TKGY-NQ----------------------------------FTDATDNVLKE---------
K4ATI3_SOLLC/271-650-------------------TRWI-RA----------------------------------VKNCSTTLFPG---------
K4D380_SOLLC/270-630-------------------GNWI-HY----------------------------------MRISVRLLFAA---------
K4DB07_SOLLC/238-600-------------------KNWL-GA----------------------------------VKIAVSTLFHG---------
EXO70_NEUCR/252-636-------------------TNGM-GT----------------------------------YAQAMEGLFLA---------
A8XF23_CAEBR/262-600-------------------...C-HV----------------------------------MCSALLSLLEL---------
M4E1D8_BRARP/269-620-------------------GNWI-HY----------------------------------MRISVKLLFAA---------
M0TCN3_MUSAM/206-567-------------------RDWL-AA----------------------------------APIAFRTIFSG---------
D7KLE4_ARALL/242-609-------------------RRWI-RA----------------------------------AKVCVRVVFAS---------
K3Y1F3_SETIT/202-606-------------------ERWI-KA----------------------------------LKTMVQVLRIT---------
J3MD06_ORYBR/268-610-------------------QMWI-QA----------------------------------LRVIVGIVFPE---------
A9S026_PHYPA/305-661-------------------EKWA-QQ----------------------------------LEVIVKMLYTG---------
W1QJT2_OGAPD/249-609-------------------....-.N----------------------------------YSKMLQSLLYG---------
E2BW20_HARSA/356-713-------------------....-..----------------------------------LTAGLHKLMQA---------
K4BUL3_SOLLC/313-670-------------------SLWI-QH----------------------------------FELAIKNVFVS---------
A5E7C7_LODEL/213-654-------------------QFKY-NK----------------------------------FTEVVDQALHN---------
EXO70_CANGA/235-620-------------------SSGF-IN----------------------------------YTEAVLGFIAN---------
C4Y3V1_CLAL4/216-602-------------------SSGI-EK----------------------------------YTEKLLLYAKS---------
U4LH75_PYROM/239-603-------------------SNGI-GM----------------------------------YTSSLEAIFDA---------
D7LJN0_ARALL/216-574-------------------KKWL-EA----------------------------------TKVLIANLFEG---------
K4BJZ5_SOLLC/284-648-------------------KKWI-YA----------------------------------VKVLVRILLSA---------
C5MG62_CANTT/215-605-------------------SNGI-TQ----------------------------------YTDIMINEVGQ---------
EXO70_CANAL/230-665-------------------TNGI-TK----------------------------------YTDVLSGEIEQ---------
M4DQX8_BRARP/251-599-------------------.QWR-VD----------------------------------VEIAVKEVYEF---------
A0A0D2X486_CAPO3/367-717-------------------....-..----------------------------------..TVFLRQMKA---------
F6HBV2_VITVI/280-635-------------------..WS-KH----------------------------------LEYAVKNLLEL---------
I1JPF3_SOYBN/247-610-------------------KSWL-EA----------------------------------TRISVRTLFNG---------
M4D183_BRARP/85-443-------------------SQWG-NH----------------------------------LEFAVKHLFEA---------
F6HRR9_VITVI/232-595-------------------KHWL-SA----------------------------------VRIAVKTLFNG---------
B9RLN4_RICCO/271-620-------------------KKWI-WT----------------------------------MKVIIKGYLAS---------
F6WWX5_CIOIN/361-724-------------------....-VA----------------------------------MVSACAKLFVV---------
I1IU67_BRADI/277-636-------------------.DWT-QF----------------------------------MRIAVKHLLAG---------
A3LWD2_PICST/218-611-------------------SNGI-TS----------------------------------FTTTFMNVIEN---------
U5GI23_POPTR/267-628-------------------KRWV-RT----------------------------------MKIFVRVYLAS---------
G3B334_CANTC/207-579-------------------TNGI-HA----------------------------------YTYELLNLLEK---------
B9HCA8_POPTR/242-605-------------------KNWL-EA----------------------------------IKIAMKTLFFG---------
A9S081_PHYPA/264-622-------------------GSWI-QY----------------------------------MRIAVKLLFSA---------
M0RMY7_MUSAM/168-542-------------------RRWI-RA----------------------------------ARVCVRVVFAS---------
K1R8N3_CRAGI/240-606-------------------....-..----------------------------------..SALLKLIQS---------
M0TDJ2_MUSAM/228-592-------------------EKWK-QA----------------------------------MQVFVRVCLAR---------
A9SEA0_PHYPA/286-643-------------------KKWN-QA----------------------------------MNVGVKVLFAS---------
K3XX39_SETIT/77-423-------------------KLWI-QG----------------------------------LKIFFGTVLPE---------
K7UV86_MAIZE/134-473-------------------..WV-QA----------------------------------LSTMEHVFRLR---------
M1BSP6_SOLTU/313-684-------------------TAWI-AT----------------------------------FRHCTNVLFSS---------
Q7XPT9_ORYSJ/274-639-------------------AEWT-QF----------------------------------SRITVKLLFGA---------
U1GTL6_ENDPU/245-629-------------------TSGI-GA----------------------------------YANGLEGMITA---------
H2AMI9_KAZAF/241-641-------------------SSGM-IN----------------------------------YTEALLGFIAN---------
A9SHU0_PHYPA/294-653-------------------GKWS-EH----------------------------------IEVAVKVLYAS---------
M0X2R1_HORVD/229-589-------------------KRWN-RA----------------------------------MKAFVRVYLAS---------
B9SQM4_RICCO/281-628-------------------..WC-EH----------------------------------LEFAVKHVFKI---------
C5YI28_SORBI/233-588-------------------RRWS-HA----------------------------------VRAVVRTFLAD---------
G2Q2Y8_MYCTT/252-644-------------------TNGI-GT----------------------------------YAQAMEGLFVA---------
B9GMP7_POPTR/287-658-------------------AMWI-TV----------------------------------IKHSSSVLFSG---------
D8QQ88_SELML/278-638-------------------GSWI-QS----------------------------------MKVSVKLLFAA---------
I1IU36_BRADI/316-680-------------------ATWI-KA----------------------------------FRHAINVGLST---------
Q7XVB9_ORYSJ/303-673-------------------KKWV-HG----------------------------------VKTVVRSLLTG---------
M0T4W9_MUSAM/300-646-------------------ATWI-KA----------------------------------FRHTITASFAA---------
C5Y540_SORBI/271-624-------------------GNWI-HF----------------------------------MRIAVKLLLAG---------
Q6YYS2_ORYSJ/156-522-------------------KRWI-RA----------------------------------LLTMVQVLNIT---------
S3C6C9_OPHP1/275-678-------------------TSGI-GM----------------------------------YAQSMEGMFLA---------
Q0DD48_ORYSJ/61-408-------------------EIWI-QA----------------------------------LRVIIGTVLPE---------
D8T120_SELML/259-622-------------------GNWI-QH----------------------------------MRAAVKLLFAA---------
L0PB59_PNEJ8/240-610-------------------SNGF-VV----------------------------------YTQALLGMLKA---------
G0V7P9_NAUCC/234-618-------------------SSGM-IS----------------------------------YTEALLGFMAN---------
S8BBP5_DACHA/239-612-------------------DNGI-TH----------------------------------YAQAIEGIFTA---------
N1PXJ6_DOTSN/246-630-------------------.CAI-GT----------------------------------YAQGIQGMYIA---------
F6I1N2_VITVI/270-640-------------------AKWI-KV----------------------------------VKHCSLILFPG---------
M0UL49_HORVD/11-372-------------------GNWI-HF----------------------------------MRIAVKLLFAG---------
F0ZNQ9_DICPU/422-793-------------------SHPL-IS----------------------------------YVSETLRLYQI---------
D7L7W1_ARALL/228-598-------------------NRWI-EA----------------------------------VKVSMKTLFNG---------
M0SVR7_MUSAM/268-627-------------------QKWC-RH----------------------------------LEFAIKHLFEA---------
M1C5W1_SOLTU/259-619-------------------KHWI-DS----------------------------------TKIAVKTLFYG---------
C5XFH3_SORBI/239-578-------------------KRWT-TV----------------------------------TKIIGKAIVAM---------
K7LHG0_SOYBN/296-660-------------------KSWL-EA----------------------------------VKIAVRTLFAG---------
M0UGE8_HORVD/125-479-------------------.MWI-QA----------------------------------LKVFVSTILPE---------
B9T911_RICCO/241-598-------------------KTWL-NA----------------------------------VKFAVKTLFYG---------
A5DE46_PICGU/208-600-------------------TNGI-NR----------------------------------YNNELIESIKL---------
A2DS47_TRIVA/252-593-------------------EHPI-HT----------------------------------FGYLISFFFKR---------
C5Z4E3_SORBI/185-593-------------------ERWI-KA----------------------------------LKTMVQVLCIT---------
U5CSC4_AMBTC/276-637-------------------GNWI-HY----------------------------------MRIAVKLLFTG---------
M0T8R9_MUSAM/272-640-------------------KKWI-QA----------------------------------MKIVVRALLWG---------
M0T1U3_MUSAM/274-635-------------------GNWI-HH----------------------------------MRIAVKLLFAW---------
Q5N6V1_ORYSJ/25-367-------------------KRWI-LA----------------------------------TKLVAKALAVM---------
G8BXH6_TETPH/237-621-------------------SSGL-LS----------------------------------YTDALLGFISN---------
E9D819_COCPS/246-624-------------------TNGI-GV----------------------------------YATGIEGMFAA---------
Q9LMJ4_ARATH/247-592-------------------DRWI-KA----------------------------------VTLIFHVFFPS---------
D7L7W0_ARALL/233-602-------------------RSWL-KA----------------------------------VKVSMETLFKG---------
E70B1_ARATH/265-614-------------------DRWI-KA----------------------------------ANVALRILFPS---------
E3Q9K9_COLGM/252-632-------------------TNGI-ST----------------------------------YAQAMEGLFLA---------
F6GSY9_VITVI/271-629-------------------KKWI-RA----------------------------------MKIIIRVYLAS---------
G1MYP9_MELGA/336-701-------------------...Y-IH----------------------------------CVSAFVKLAQS---------
D7M573_ARALL/269-636-------------------ASWI-SI----------------------------------VRRCSTVLFPG---------
E1Z8T0_CHLVA/286-659-------------------..WV-AA----------------------------------LRLYVR.LAQE---------
B9GF67_POPTR/330-700-------------------..WI-KA----------------------------------VREYASIYFVK---------
G4MVD0_MAGO7/250-629-------------------TNGI-GT----------------------------------YAQAMERLFQA---------
G9MGQ5_HYPVG/255-640-------------------ANGI-GT----------------------------------YTQAMEGIFIA---------
W1PMJ7_AMBTC/280-638-------------------GKWM-KA----------------------------------FRRIVTFYFPS---------
U5FZC2_POPTR/63-424-------------------KNWL-NA----------------------------------VKIAAKTLFSG---------
W5BVL2_WHEAT/184-551-------------------THWI-RC----------------------------------LQIAVKLLFPS---------
EXO70_SCHPO/249-608-------------------....-SI----------------------------------NLVALSRLLPA---------
B9R6Z3_RICCO/301-666-------------------TFWI-QH----------------------------------FELAVRIVFLS---------
B9SF67_RICCO/265-616-------------------NKWI-KA----------------------------------SNVALRILFPS---------
K4C312_SOLLC/207-568-------------------KNWL-SS----------------------------------VKIAVNALFRG---------
A9T7C4_PHYPA/238-605-------------------SKWN-QR----------------------------------MKVCVRALLAS---------
K7LIX4_SOYBN/109-470-------------------GNWI-HF----------------------------------MRIAVKLLFAA---------
M7ZQD7_TRIUA/1206-1561-------------------KKWT-QA----------------------------------LKVVIQGLLPE---------

PF08700

Q5KJF4_CRYNJ/98-180---------------------------------------ADIE--PD---------EVFR....----------------
EXO84_ASHGO/127-213---------------------------------------PQFQ--AK---------RFVH.EKL----------------
COG5_MOUSE/37-120---------------------------------------EDFD--VK---------TYTS.QSI----------------
EXO84_CRYNJ/142-228---------------------------------------EKVD--AQ---------AYVK.KVL----------------
Q6BJZ0_DEBHA/76-158---------------------------------------EDTS--ID---------DIFT....----------------
Q0U0Z3_PHANO/76-170---------------------------------------ADFD--AE---------AFVN.SLL----------------
Q0WQ75_ARATH/43-129---------------------------------------TSFD--AD---------QYMD.LMI----------------
Q173I8_AEDAE/5-87---------------------------------------LNIN--VD---------KLFE....----------------
A2D783_TRIVA/6-88---------------------------------------INED--PR---------LLFE....----------------
Q7Q6Z6_ANOGA/11-97---------------------------------------SSFD--AD---------RYLQ.KLL----------------
Q2UQ54_ASPOR/108-197---------------------------------------PDFD--AQ---------RYVN.HLL----------------
VPS51_YEAST/84-163---------------------------------------GSED--AE---------EEIK....----------------
A2E266_TRIVA/29-115---------------------------------------NAFE--AE---------PYYK.NLI----------------
Q2U987_ASPOR/1-88---------------------------------------DGPD--PQ---------SLNSWQDA----------------
Q6FRQ2_CANGA/66-146---------------------------------------SQPN--VD---------RPIN....----------------
Q6CSC3_KLULA/100-179---------------------------------------ELEK--GD---------IDVT....----------------
A0A016Q0X2_GIBZA/128-214---------------------------------------PKLK--PD---------RYVQ.AAL----------------
Q75HJ9_ORYSJ/40-126---------------------------------------DNFD--PD---------AYVQ.SKC----------------
EXOC8_MOUSE/13-100---------------------------------------GGFE--AR---------LYVK.Q.L----------------
A0A0D1E7D8_USTMA/79-161---------------------------------------FGTE--PD---------TLFL....----------------
Q8I2A9_PLAF7/116-202---------------------------------------SNFN--VN---------NYFK.ELL----------------
Q6CG64_YARLI/77-166---------------------------------------GSFD--AE---------EIAR.DIL----------------
Q4E335_TRYCC/3-85---------------------------------------AVQE--VR---------RIFT....----------------
EXO84_YARLI/121-207---------------------------------------EDLD--AH---------TFVT.QQL----------------
Q4MZL9_THEPA/63-149---------------------------------------HSFD--VE---------HHFD.QIL----------------
COG1_SCHPO/7-89---------------------------------------HSSN--WK---------EIFR....----------------
Q59L27_CANAL/17-99---------------------------------------LYSD--VD---------EIFT....----------------
Q2UHE7_ASPOR/121-207---------------------------------------PSLP--VD---------RYVA.NLL----------------
Q7RZT4_NEUCR/9-91---------------------------------------LLSS--AQ---------IFSS....----------------
E9AC89_LEIMA/3-81---------------------------------------AAQE--VR---------RILC....----------------
A2GBI6_TRIVA/24-110---------------------------------------PNFN--SD---------KYFA.ENT----------------
Q4Y221_PLACH/14-100---------------------------------------SEFN--AD---------IYFR.RLL----------------
VPS51_DICDI/178-264---------------------------------------PSFN--LN---------SYFD.SIV----------------
VPS51_SCHPO/52-138---------------------------------------PNFD--SN---------AYVS.KFM----------------
Q9FFF3_ARATH/21-103---------------------------------------GQRD--AE---------SLFR....----------------
A0A0D1CLQ0_USTMA/184-270---------------------------------------SDFD--PQ---------AYLR.AKL----------------
COG1_DICDI/113-195---------------------------------------YESD--VK---------ILFE....----------------
A2FRD0_TRIVA/32-118---------------------------------------SIFN--AK---------LLFD.KST----------------
A0C9R8_PARTE/6-92---------------------------------------SKFD--CQ---------KYVS.EFL----------------
EXO84_CANGA/190-276---------------------------------------PQFS--AK---------KFIH.ERL----------------
Q754G8_ASHGO/53-137---------------------------------------GAGD--MA---------VEVP.EKL----------------
VPS51_CHICK/57-143---------------------------------------PHFD--PE---------VFLT.KVR----------------
Q95Q35_CAEEL/9-99---------------------------------------DAFS--PS---------DYIR.DRL----------------
Q6C0N6_YARLI/24-102---------------------------------------GLSS--WQ---------STMS....----------------
Q4DYG1_TRYCC/45-131---------------------------------------EFFN--VS---------KYVT.DLL----------------
Q5ZAZ1_ORYSJ/7-89---------------------------------------GAAD--AE---------ELFR....----------------
B4QW21_DROSI/4-89---------------------------------------FNFS--VE---------KYTK.D.L----------------
Q5KKF4_CRYNJ/54-139---------------------------------------PTFK--PA---------AYYE.DLI----------------
Q7S488_NEUCR/124-217---------------------------------------PDFS--AQ---------PYLA.ELL----------------
Q84K25_ARATH/20-102---------------------------------------ASAT--QQ---------PYVS.ELL----------------

PF06148

Q0TYI9_PHANO/26-159.......................................PDFS--PS---------TYLS-TLS----------------
Q29BE0_DROPS/22-154.......................................ENFS--VD---------EFLH-K.N----------------
Q7QFV1_ANOGA/25-157.......................................KTFS--VD---------EFLH-E.N----------------
Q84LH7_ORYSJ/24-156.......................................PDFD--PD---------AYVA-D.L----------------
Q01CT5_OSTTA/52-184.......................................DDFD--PW---------AYVE-E.T----------------
Q5K8I4_CRYNJ/34-165.......................................PTFD--PD---------AFLL-S..----------------
A1C4Y0_ASPCL/32-165.......................................PNFD--PA---------VYLS-SLT----------------
Q2UA29_ASPOR/27-160.......................................PDFD--PA---------KYLS-SLT----------------
COG2_HUMAN/15-147.......................................EDFD--VD---------HFVS-D.C----------------
Q0C728_AEDAE/17-149.......................................KTFS--VD---------EFLH-E.N----------------
A8WN13_CAEBR/23-155.......................................DDFN--VE---------RFMN-L.A----------------
Q383M1_TRYB2/46-232HDTEGECISAGANYVNASDDAEQMDFEHHNEPGETMLAAFEFD--PV---------QFVQ-NKL----------------
Q4DNE3_TRYCC/72-246RDEKHDGVG............SDLLRQRNKTHQNGVVIAFDFD--PI---------QFVQ-EKL----------------
Q4Q0F6_LEIMA/80-262SRSISSSSDASSL....SSSFDSVNGHDGPQRRRGQRGLPAYD--PL---------SFVK-GKV----------------
A0CKT7_PARTE/12-141.......................................KNFV--QA---------NF..-..E----------------
COG2_DICDI/53-185.......................................NTFE--VD---------QFIS-D.C----------------
F4JRR1_ARATH/31-163.......................................PNFD--SE---------SYIS-E.L----------------

PF10392

Q5KKM0_CRYNJ/10-154---------------------------------------DSFD--VH---------SYTNAILQGRQYTP----------
COG5_HUMAN/66-189---------------------------------------EDFD--VK---------TYTSQSIH......----------
Q6BT79_DEBHA/15-147---------------------------------------TSFQ--PL---------QFANDLLL......----------
Q5B379_EMENI/829-961---------------------------------------PAFS--PA---------AFANSLVV......----------
Q5APN5_CANAL/17-149---------------------------------------TNFD--PQ---------QFANELLL......----------
COG5_SCHPO/8-139---------------------------------------SDFD--PK---------AQAERVLI......----------
COG5_YEAST/14-146---------------------------------------PDFD--AK---------QFGNDLLK......----------
Q9C9V9_ARATH/57-180---------------------------------------SSFS--SA---------SFSSAALA......----------
Q0U7T7_PHANO/13-145---------------------------------------PDFS--AT---------SFANTLVL......----------
Q2HI55_CHAGB/25-157---------------------------------------PSFT--PS---------SFANTLVL......----------
Q6CLE2_KLULA/11-144---------------------------------------ADFQ--PL---------RFANDLLK......----------
COG5_DICDI/63-186---------------------------------------EDFN--VV---------HYTSNALK......----------
Q6C2T6_YARLI/5-136---------------------------------------AEFD--PV---------AYANQLVL......----------
Q75B18_ASHGO/11-144---------------------------------------DNFN--HS---------QFARELIR......----------
Q6FTM6_CANGA/9-140---------------------------------------PEFD--SK---------SYSNSMLK......----------
Q65XH1_ORYSJ/52-175---------------------------------------PSFS--PS---------DFSSAALS......----------

PF04124

COG8_MOUSE/56-394---------------------------------------ERAQ--RL---------QQTRDLAFANYKTF----------
COG8_SCHPO/15-354---------------------------------------QKLK--LV---------QKRQQLLRDNYNVL----------
COG8_YEAST/28-381---------------------------------------DIAE--ID---------AELSALDRKIRKTL----------
COG8_CAEEL/10-353---------------------------------------ELKA--ID---------AQISDLAFNNYGTY----------
Q9LYH5_ARATH/29-412---------------------------------------DAER--IQ---------RQMQEVAVGNYRAF----------
COG8_DROME/37-379---------------------------------------EART--IL---------EQTQDLAISNYRTF----------
Q9P3N9_NEUCS/31-347---------------------------------------TSHG--LL---------LSIQALSKKSHKQV----------

PF15469

Q5KNA8_CRYNJ/115-308---------------------------------------DNFD--RF---------VAVKASSDVVYRDM..........
A7TRG2_VANPO/143-342---------------------------------------DNFT--KY---------VKVKNRLDQIYENF..........
G8BMU6_TETPH/145-338---------------------------------------DNFT--KY---------VKVKNRVDQIYENF..........
C5DYM3_ZYGRC/146-354---------------------------------------TNFT--KY---------VRVKNRLDQIYEQF..........
G8ZXE8_TORDC/144-345---------------------------------------TNFT--RY---------VRIKNRLDEIYEQF..........
H2AR86_KAZAF/151-365---------------------------------------SNFT--KY---------VKIKNRLDLIYKQF..........
G0VBU0_NAUCC/150-340---------------------------------------ENFT--KY---------VRIKNRLDKIYNQF..........
G0WGP4_NAUDC/153-350---------------------------------------LNFT--KY---------VKIKNRLDQIYNQF..........
Q6FVL5_CANGA/149-372---------------------------------------TNFT--KY---------VKIKSRLDQIYSNF..........
E7QCY0_YEASZ/146-360---------------------------------------KNFT--KY---------VKIKNKLDQIYKEF..........
C5DMT2_LACTC/144-330---------------------------------------RNFV--KY---------VRSKNNLDRIYEQF..........
G8JTD1_ERECY/120-302---------------------------------------KNFV--RY---------VRCKSNLDQIYDQF..........
Q750U7_ASHGO/122-304---------------------------------------TNFV--RY---------VRCKSNLDQIYDQF..........
Q6CQH1_KLULA/148-350---------------------------------------TNFA--KY---------VRSKSNLDHIYKRF..........
C4R5S5_PICPG/139-344---------------------------------------SEFL--VY---------IKSKNSLDRIFKQF..........
Q6CGI4_YARLI/146-334---------------------------------------RNFD--KF---------VKSKSYLDSVFKQF..........
W1QF47_OGAPD/153-339---------------------------------------ENFQ--KA---------IDNKKLLDEVYSEY..........
C4YAI9_CLAL4/138-372---------------------------------------ENFE--HF---------VSCKKTIDEILVAF..........
G8Y2A4_PICSO/149-393---------------------------------------ENFS--GF---------VGCKKSIDDVLSWF..........
C5MH42_CANTT/104-348---------------------------------------SNFI--HF---------INTKSKIDDSLIDF..........
G3AUN6_SPAPN/128-368---------------------------------------DNFL--KV---------INSKKSIDDVLVEF..........
G8BGG9_CANPC/145-407---------------------------------------ANIT--HA---------LNVKAEMDGTLQAF..........
B6K5G3_SCHJY/147-340---------------------------------------TRFH--AF---------VAAKEVIDKVYQEM..........
C4M2W7_ENTHI/111-299---------------------------------------SHFD--QF---------INCKDTLDKMQVII..........
D6W674_TRICA/193-371---------------------------------------ANIG--SV---------MDQIDTLVNLKEKI..........
B0W3D0_CULQU/193-383---------------------------------------SNAG--SV---------MDQLDTLMALRDRV..........
B3MVG4_DROAN/193-383---------------------------------------SNAG--SV---------IDQLDTLMNIRDKL..........
G6D800_DANPL/194-372---------------------------------------ANTG--AV---------MDQLDRLVLLKNMY..........
E2AW35_CAMFO/194-372---------------------------------------ANVG--AV---------MEQLDTIMSLKDQF..........
E0VQL4_PEDHC/200-377---------------------------------------SNVG--SV---------IDQIDMLAKFKEKL..........
E9G6B5_DAPPU/193-371---------------------------------------THAG--SV---------IEQMDTLMTLKKVV..........
B7PR09_IXOSC/148-326---------------------------------------SNVN--AI---------VICLDVLHELQKAM..........
A8WPA7_CAEBR/200-378---------------------------------------ANLY--SL---------INCVDTLANLHQAL..........
H3ERJ1_PRIPA/197-373---------------------------------------AHLY--SL---------INCVSTLATLHQQL..........
A0A0I9R3C5_BRUMA/212-385---------------------------------------ANLY--SL---------INCVDTLATLYDKM..........
C3XUC7_BRAFL/191-370---------------------------------------GNLT--SI---------MDCQDALAAMHQDL..........
F6YQX0_XENTR/198-380---------------------------------------GGLS--TF---------FEAQDALAAIHQKL..........
F7GSZ8_CALJA/50-227---------------------------------------GGLS--TF---------FEAQDALSAIHQKL..........
E4XNP2_OIKDI/201-392---------------------------------------DSLP--IF---------FEVHEALNSIHGQMSKG.......
F6Q8U3_CIOIN/201-380---------------------------------------DSLP--VF---------FEVHETLSGIHHKM..........
G4VNQ3_SCHMA/214-394---------------------------------------TNLV--LI---------FRCLDGMDSLRRRL..........
H2KP67_CLOSI/214-393---------------------------------------TNLL--LI---------FRCLEGMDALKNKF..........
F2UAY3_SALR5/207-386---------------------------------------VSSS--TF---------VSAFDAVLNANRRI..........
A9RNH0_PHYPA/252-430---------------------------------------ENFD--CF---------ISCKNTIDDIHSKL..........
A9S1F4_PHYPA/259-437---------------------------------------ENFD--CF---------ISCKNTIDDIHLKL..........
D8RD25_SELML/239-417---------------------------------------ENFE--CF---------VSCKNTIDDIHSKL..........
D7KJZ0_ARALL/260-438---------------------------------------DNFD--CF---------VSCKTTIDDIESKL..........
Q7XMG2_ORYSJ/263-453---------------------------------------ENFD--CF---------VSCKTTIDDIESKL..........
F0ZXN2_DICPU/132-311---------------------------------------ENFE--HF---------VKCKDTVDQVYDLI..........
F4PGL2_DICFS/126-305---------------------------------------DNFE--HF---------VKCKDTVDEVYNLI..........
A8PCF2_COPC7/122-323---------------------------------------DNFD--RF---------VAVKASTDALHAEM..........
D8QDB4_SCHCM/114-323---------------------------------------DNFD--RF---------VAVKNSTDALHAEM..........
B8P2C9_POSPM/114-312---------------------------------------ENFN--RF---------VAVKASTDALYAEM..........
G4TT08_PIRID/115-310---------------------------------------ENFD--RF---------VAVKASTDALYQDM..........
A8PUN7_MALGO/110-314---------------------------------------QNFD--RF---------VTVKATNDSVFREM..........
E6ZLD0_SPORE/109-315---------------------------------------DNFD--RF---------VAVKATTDGVYREM..........
E3K655_PUCGT/121-321---------------------------------------SEFD--RF---------VAVKVANEAVYEQM..........
F4RSS6_MELLP/56-255---------------------------------------SEFD--RF---------VAVKAATETVYEQM..........
F4PCT9_BATDJ/225-428---------------------------------------KHFA--KF---------VSAKGTIDTFYREM..........
D5GNN2_TUBMM/147-347---------------------------------------SNFD--RF---------VAAKGTIEGVYKEMKGDSF....L
G1XK06_ARTOA/190-398---------------------------------------NNFE--RF---------VLAKSTIDSVYKEMRAGSTTINYE

PF16528

C5DUD9_ZYGRC/539-743---------------------------------------LKFD--KA---------VDSLIDLESQLAEL----------
G0VJV4_NAUCC/543-749---------------------------------------LKFD--IA---------VDTLLDIESQLTEI----------
A7TL52_VANPO/508-712---------------------------------------LKFD--KA---------VELILDLESEMNNI----------
G8ZS82_TORDC/494-698---------------------------------------LKFG--KA---------VDALNALETQLKKL----------
G8BNG7_TETPH/532-736---------------------------------------LKFD--KA---------VGILLSLEEENNKL----------
G0W548_NAUDC/557-766---------------------------------------LKFA--VA---------VDTLQTVENQLTQL----------
EXO84_CANGA/545-749---------------------------------------LKFD--SA---------VNTLLEAESQLATM----------
H2AXV4_KAZAF/523-731---------------------------------------VNFE--EA---------VLLLTSIESKLNEY----------
G8JS46_ERECY/478-682---------------------------------------MNFE--YA---------IRKLRSIESILNGI----------
EXO84_KLULA/500-705---------------------------------------QNFD--LA---------ITKLNHIQSSLKSL----------
G0S6E5_CHATD/457-657---------------------------------------QQIE--PA---------VARIE....KLRNL----------
E3S512_PYRTT/452-652---------------------------------------QHFE--EA---------VVKV....DRLRLL----------
EXO84_YARLI/444-642---------------------------------------RRFA--EA---------TDIILE...NIKDD----------
D5GAW7_TUBMM/436-637---------------------------------------RQFE--EA---------V...VGVE.KLRGL----------
C4R6S9_PICPG/506-717---------------------------------------QQFP--DA---------VDSLKQLSSQLNSI----------
Q2H152_CHAGB/456-656---------------------------------------QQIE--PS---------VALIEK....LKSL----------
C9S7T2_VERA1/440-640---------------------------------------QHFE--NA---------VERVE....KLKKL----------
B2B2W1_PODAN/463-663---------------------------------------QQIE--LA---------VARIEKLKSLA...----------
H2Z9L4_CIOSA/281-487---------------------------------------RNFE--QA---------VEVMLKTKDYLAGI----------
H2MTA2_ORYLA/303-507---------------------------------------RDFE--GA---------VDLLDKLNEYLKDQ----------
G3JE74_CORMM/450-655---------------------------------------QRFE--PA---------VAGV...E.KLKSL----------
G0SXF2_RHOG2/870-1071---------------------------------------REFE--DA---------VVLIEKGKSILPKI----------
EXO84_CRYNJ/449-651---------------------------------------RDWE--ES---------VKLVEK....GQAL----------
C5FKA5_ARTOC/433-633---------------------------------------QVFE--TA---------VCRV...E.KLRKL----------
F4P2Q9_BATDJ/415-626---------------------------------------RDFD--NS---------VANLEKGKLVLNFI----------
G0R9T9_HYPJQ/449-649---------------------------------------QGFE--PA---------VARVE....KLKAL----------
C7Z4G1_NECH7/445-645---------------------------------------QRFE--VA---------VVRVE....KLKAI----------
I1G637_AMPQE/287-497---------------------------------------REFE--QA---------VNMIDQVKSFLKDS----------
E7LRJ5_YEASV/465-668---------------------------------------LRFE--SA---------VETLLDIESQLEDL----------
EXO84_ASPFU/445-645---------------------------------------QRFE--EA---------VSGIE....RLRKL----------
W4YYJ2_STRPU/291-496---------------------------------------RNFE--ES---------VDLILKANEYLEQV----------

PF06248

ZW10_DROPS/10-571---------------------------------------RKHI--DE---------NYS..EFMTNHTSPDIFLEESSSL
ZW10_ARATH/1-584---------------------------------------QSYL--VA---------HHS..DFSELFSLCQDTVSRTRLI
A7SSG2_NEMVE/20-670---------------------------------------FNTI--YK---------EYSYAGFQDLSSSTSELNWKVSSL
A8XRG3_CAEBR/1-605---------------------------------------SADI--VD---------KYGNLKVALNINNTAKLIFDRLEN
ZW10_HUMAN/9-621---------------------------------------CNMI--SK---------KYS..EFLPSMQSAQGLITQVDKL
F1QYH5_DANRE/9-611---------------------------------------TDMI--NK---------KYI..EFIPSMEGAEELLDQVESV
F7EQH5_XENTR/9-617---------------------------------------CDMI--NK---------KYD..EFLPSMQCAEDLVTQVHGL
H3CQC8_TETNG/9-607---------------------------------------YEMI--NK---------RYA..DFLPSLQSSEQLMIQVDEV

PF04100

VPS53_HUMAN/39-453---------------------------------------E-----QS-------L-AN------I--DEVV.......NK
Q9VQY8_DROME/42-434---------------------------------------E-----QS-------L-AG------I--DETI.......QK
VPS53_SCHPO/16-394---------------------------------------D-----IT-------Y-DD------L--GSLRLS...LSER
VPS53_YEAST/5-369---------------------------------------K-----ES-------L-NN------I--DELISITRSYKKQ
VPS53_CAEEL/30-390---------------------------------------E-----QS-------L-TQ------L--DSII.......AS
VP53A_ARATH/1-424---------------------------------------E-----AS-------L-TG------V--EPLM.......QK

PF10475

Q7QF78_ANOGA/99-388---------------------------------------SGQL--LD-------C-GS......I--EQSM-------GV
Q336V4_ORYSJ/131-419---------------------------------------EG.D--SS-------Y-........F--DKQS-------TL
Q54MU4_DICDI/72-370---------------------------------------N...--VN-------N-SSSEFSIFL--DSNV-------KQ
VPS50_CHICK/54-327---------------------------------------V...--LS-------L-QE......L--EEYR-------DK
Q16RR9_AEDAE/70-360---------------------------------------TDEL--LN-------C-QC......I--EKAM-------GT
A1ZAY8_DROME/75-362---------------------------------------DG..--ID-------N-EL......I--EVTI-------AQ
Q54NV0_DICDI/113-401---------------------------------------D...--AP-------I-DT......I--DALT-------VK
Q8RXC2_ARATH/132-421---------------------------------------DESE--LA-------Y-........F--EKQA-------TL
Q18602_CAEEL/76-363---------------------------------------IE..--MC-------Y-ED......I--QRER-------FR
A8XSD2_CAEBR/80-367---------------------------------------ID..--MC-------Y-ED......I--QRER-------FR

PF04048

SEC8_SCHPO/51-191---------------------------------------IS----TA-------L-EL------L--DDSSFG..RDYKS
Q69PQ1_ORYSJ/22-158---------------------------------------VV----HI-------L-TS------K--DREG.....EIQF
Q59NP0_CANAL/27-168---------------------------------------IE----MA-------V-AL------L--DDTSVGLAHRLQE
A5E514_LODEL/26-167---------------------------------------IE----VA-------V-AF------L--DDTSVGLAHRLKE
Q6BLA3_DEBHA/30-171---------------------------------------IE----MA-------V-SL------L--DDTSVGMAYKLPE
A5DKL1_PICGU/29-170---------------------------------------ID----LA-------V-SL------L--DRSSVGLAHRLDD
A3LUX9_PICST/29-170---------------------------------------IE----VA-------V-AL------L--DDTSVGLAHRFPE
Q75B87_ASHGO/33-174---------------------------------------LE----LA-------L-QF------L--DDTSVGLGHRYGE
Q6CNM5_KLULA/34-175---------------------------------------LE----LA-------L-RF------L--DETSVGLHHRFDE
A7TRV6_VANPO/35-176---------------------------------------LE----LA-------L-KF------L--DETSVGLGHRYTE
Q6FWA6_CANGA/35-176---------------------------------------LE----LA-------L-AF------L--DDTSVGLGHRYIE
Q6C3L8_YARLI/34-175---------------------------------------LE----VS-------L-SL------M--DTSSIGKARFSKD
Q4WUD2_ASPFU/134-275---------------------------------------VQ----VA-------L-QL------M--DTSTLGKADREPD
SEC8_NEUCR/82-223---------------------------------------VQ----LA-------L-QL------L--DTSSVGRAHEYRN
A0A0D1E3Z5_USTMA/441-580---------------------------------------VA----LA-------L-SM------L--DESSLGASRF..E
E7M1P6_YEASV/34-174---------------------------------------LE----LA-------L-AF------L--DDTSVGLGHRYEE
SEC8_ARATH/16-151---------------------------------------VV----HI-------L-TS------K--DREA.....DIHI

PF06046

Q28ZN5_DROPS/179-731---------------------------------------VRKK--PT-------V-IV.TALRII--EREEKNDQFAVQQ
Q5K9B3_CRYNJ/179-740---------------------------------------LRKG--NG-------G-TVVRLLKII--EVEGKEDEKAVAM
EX3L4_HUMAN/179-709---------------------------------------DGVD--AA-------A-LA.ELARVV--SAEEEAHPSPPDD
A5DIA8_PICGU/180-832---------------------------------------AKEG--NY-------T-LAFKIIKII--EFEANEDLKFSLL
Q0TXU6_PHANO/187-762---------------------------------------VQSG--ND-------G-LVVRLAIIV--EEEEKTDKKVKAL
EX3L1_BOVIN/188-722---------------------------------------AREN--PA-------L-LV.AAVRVA--EVDAGCTTSLEQ.
SEC6_SCHPO/181-743---------------------------------------VKSG--HI-------K-TIVQIFKIV--EAEESSDEVLKSI
TNAP2_MOUSE/157-688---------------------------------------APER--LS-------.-...QALAVV--SQEELEDRRASG.
A5DY39_LODEL/293-930---------------------------------------AKDN--NL-------E-ILFKLIAIV--LFEEKEDMKLQVT
A0A0D1DY75_USTMA/258-828---------------------------------------VREG--RH-------A-VVVKLIKIV--EKESREDERAAAI
A4RYX1_OSTLU/92-690---------------------------------------GESG--SV-------G-LV.RAVRVV--AEQEVLDEEFERD
Q6DJR6_XENTR/177-732---------------------------------------VRRD--PT-------L-LV.SVVRII--EREEKVDRRMMDR
A3LNE6_PICST/180-819---------------------------------------VKDG--NV-------Q-LVHRVVKIV--EYESNEDLKFSLM
Q8SU74_ENCCU/160-687---------------------------------------....--NH-------E-AMDKIVQIV--EKEEARDELTRKV
Q16I77_AEDAE/179-730---------------------------------------VRKE--PT-------V-IV.TALRII--EREEKADAFALQQ
Q5RG40_DANRE/161-694---------------------------------------FNEE--NQ-------E-TLKSALISI--LQEEAQDRRWAEV
Q6CU40_KLULA/178-794---------------------------------------VRTE--NQ-------S-LLIRLFKVI--HVEECEDIKIIAT
Q5BBU2_EMENI/183-758---------------------------------------VQSD--NP-------S-MVVRLAVVV--ANEEKNDETVKAL
Q6FPK2_CANGA/177-798---------------------------------------IRAE--NY-------S-LVVRLFKII--DFEEREDLRIEAI
A7F9Q6_SCLS1/177-755---------------------------------------VVQG--NS-------S-LVVRLAVVI--EAEEKSDKRVMAL
Q6C9T6_YARLI/183-804---------------------------------------IRSG--NT-------S-LVVRLAKII--DLEEREDLKATVL
EX3L1_MOUSE/189-722---------------------------------------ARED--PA-------L-LV.AAIRVA--EVETERTI.LGQ.
EX3L1_DANRE/206-763---------------------------------------AHQN--PT-------P-FV.SAVRIV--EREEALDQFFLEE
EXOC3_DICDI/183-774---------------------------------------AQIK--PA-------V-LV.KVAQII--EREKLHEQKQKEK
TNAP2_HUMAN/122-651---------------------------------------PPER--LR-------.-...QALAVV--AEQEREDRQAAAA
Q6BJB6_DEBHA/180-833---------------------------------------LKEG--NV-------E-LVFKLIKII--EFESNEDMKFELM
EX3L4_MOUSE/181-708---------------------------------------EGVD--RD-------A-LA.ELAQVV--HLEEEAHQTSQAE
Q5A7K3_CANAL/180-812---------------------------------------TKEG--NF-------E-CFFNILGVV--TWEENEDLKVSLL
A6RAW7_AJECN/390-965---------------------------------------VQTD--NR-------S-MVVRLALIV--MNEEKNDSKVRAL
E7KDN6_YEASA/178-797---------------------------------------ARAE--QI-------S-LAIRLFKIY--DLEEREDLRIEAI
H3DL97_TETNG/187-739---------------------------------------VRRD--PT-------M-LV.SVVRII--EREEKIDRRMVDR
EXOC3_HUMAN/188-743---------------------------------------VRRD--PT-------L-LV.SVVRII--EREEKIDRRILDR
Q1K527_NEUCR/175-753---------------------------------------VIAD--NN-------S-LVVRFALII--EAEEKSDQRVLAL
SEC6_ARATH/173-736---------------------------------------SKES--PQ-------T-LV.RALRVV--EMQEILDQQLAEE

PF04091

W5E5N0_WHEAT/442-753---------------------------------------VCRI..VR-------S.FVEDSVSYLSYGGD........MN
A9S7S7_PHYPA/446-757---------------------------------------CCRI..VR-------S.FIEDSVSFLAYGGH........ID
H2WCC2_CAEJA/477-783---------------------------------------AYTQ..AK-------Q.YLIGCLKFM..DNL..QLNT..SA
T1EMI3_HELRO/450-756---------------------------------------IFTE..VK-------R.YISACLEFS..EDL..NISR..TE
A9V537_MONBE/417-723---------------------------------------LYAE..VR-------H.YIDLSHQFL..ENV..GLSS..TE
Q6BHQ3_DEBHA/494-826---------------------------------------YCLG..IR-------S.LLEEIVQFI..SQH..YSYNI.NE
E9G3C4_DAPPU/410-716---------------------------------------VYRQ..IR-------N.YIQACLQFS..QDL..NLAD..QE
B9GSB7_POPTR/457-761---------------------------------------CCRI..VR-------S.FIEDSVSFMSYGGQ........LE
M7NJC8_PNEMU/439-739---------------------------------------CCVD..IR-------N.FVNKYYKFA..EGY..YNHC..HD
U1HWP6_ENDPU/444-743---------------------------------------CCID..IR-------N.FLNQFYFYA..NDD..FPHR..EV
G0VF38_NAUCC/501-841---------------------------------------TCTL..LK-------K.AYSKLTSFI..TMF..YRHDL.PA
K5VZV5_AGABU/444-743---------------------------------------CCQE..IR-------S.FIKNFYGFV..EGV..SRHH..RD
R9AG66_WALI9/449-747---------------------------------------SCRL..LR-------Q.FIEDFYKYT..DGY....AQ..VD
D6X4X0_TRICA/433-740---------------------------------------VYQQ..VK-------E.FIYACLKFS..EDL..NLSQ..VE
C5E4W3_ZYGRC/494-839---------------------------------------TCTL..LK-------K.TYNKLIHFI..GTY..YRHEL.HT
G8ZUB2_TORDC/501-847---------------------------------------TCTL..IK-------K.TYTKLTYFI..GFF..YRHDL.HK
G2RB31_THITE/448-748---------------------------------------CCID..IR-------N.FAEQFLVFT..REN..FDHP..SV
U5FMP1_POPTR/442-753---------------------------------------TCRI..VR-------S.FIKGSVDYLSYGVH........TN
J9K5H0_ACYPI/421-724---------------------------------------VYDQ..VK-------Q.FIFACLKFS..NDL..NFSE..GE
C4R087_PICPG/447-765---------------------------------------TCLQ..IQ-------N.LIKEVNEFI..DDF..YSYQG.RE
Q8S5T3_ORYSJ/442-753---------------------------------------ICRI..VR-------S.FIGDSVSYFSYSAR........TN
M4DPW7_BRARP/456-760---------------------------------------CCRI..VR-------S.FIEDSVSFMSHGGQ........LD
G6DDP0_DANPL/419-720---------------------------------------VYVQ..VK-------E.FIYAWLKYS..AGL..GLGG..GR
M3XK92_LATCH/505-811---------------------------------------VYSQ..IK-------E.FIYACLKFS..EDL..HLSS..TE
D5GMB3_TUBMM/427-725---------------------------------------CCRH..IR-------D.LLEKYYFYA..DEY..FQNQ..GA
W1QAD1_OGAPD/459-774---------------------------------------TCLK..MR-------V.FIHDIYDFV..GKY..YVHQN.SE
U9TBU2_RHIID/147-443---------------------------------------CCLD..IK-------K.FVDQYYTFA..EGD..SRQF..ST
A5DMM0_PICGU/482-811---------------------------------------YCLW..IR-------S.LLDDSLAFI..GRY..YSHEQ.NE
R9P8Q0_PSEHS/445-756---------------------------------------CCMD..MR-------N.LVDQYYIFS..SDF...TSH..RE
Q6C1W0_YARLI/480-793---------------------------------------CCAK..IT-------H.LIHQHYAFL..DEFNVSEV...TQ
J3PJI4_GAGT3/450-750---------------------------------------CCID..IR-------N.FLNQFYFFS..DDH..FQHP..NI
G8YKH3_PICSO/492-824---------------------------------------YCLG..IR-------S.LLEETIQFI..SEH..YSHNS.YE
J9EJI0_WUCBA/484-791---------------------------------------VYCQ..AK-------N.YLVGCLKFM..EHL..QLSP..TE
F6YT74_HORSE/409-715---------------------------------------IYIQ..VK-------E.FIYASLKFS..ESL..HRSS..TE
J4KKU7_BEAB2/450-750---------------------------------------CCID..IQ-------N.FLNQFYFFS..DDH..FQHS..DV
I4YIZ3_WALMC/449-754---------------------------------------ACKL..LR-------R.FIDDFYKYT..EGF....SQ..ID
F8PQ71_SERL3/445-743---------------------------------------CCQD..IR-------T.FVQKFYQFV..EGV..SQHH..AN
G1XUE0_ARTOA/508-808---------------------------------------CCID..LR-------S.FLNKYYFFS..REY..FHHP..HT
A7TQS9_VANPO/506-845---------------------------------------TCTL..IK-------K.TYSKLTAFI..SNH..FRHEL.HR
G3AZR4_CANTC/493-823---------------------------------------FCLG..IR-------S.LMEDIIQFV..KDF..YGYEL.NE
B4R147_DROSI/428-730---------------------------------------VYHQ..AK-------E.FMYACMKFA..EEL..TLSP..NE
S8FZN9_FOMPI/445-743---------------------------------------CCQD..IR-------N.FVQNFYQFL..EGV..SQHH..RN
K5W5P8_PHACS/445-743---------------------------------------CCQD..IR-------N.FVHNFYQFL..EGV..SQHH..RN
G2YIA1_BOTF4/452-752---------------------------------------CCID..IR-------N.FLNRFYFIM..DDH..FQQP..NI
A8NWX8_COPC7/444-743---------------------------------------CCQDPQIR-------L.FIQKFYAFV..EGV..SQHH..RD
R4X791_TAPDE/443-739---------------------------------------CCIE..IR-------N.FINEFYLYA..DEL..TRS...DE
S9VV25_SCHCR/436-738---------------------------------------CCIT..LS-------K.FARHFFMFS..NDS........IT
V2X5M8_MONRO/445-743---------------------------------------CCED..IR-------S.FIQKFYAFV..EGV..SQHH..RN
C5M2I2_CANTT/488-818---------------------------------------FCFH..IR-------K.LIKDILRFI..EDY..YNYEI.GE
I2H3Y9_TETBL/508-832---------------------------------------TCTL..LR-------K.TYTKLISFV..DNA..YRHEL.HK
Q17EP0_AEDAE/419-722---------------------------------------VYHQ..AM-------E.FMYACMKFS..EEL..TLSP..NE
M2ZTI7_PSEFD/439-745---------------------------------------VCID..IR-------N.FLNQIYLFS..DDH..FKHT..TV
I1MM64_SOYBN/441-752---------------------------------------ACRI..VR-------S.FIKGSVDYLSNGVR........TG
B6K595_SCHJY/439-743---------------------------------------CCQN..AD-------S.FIRRFFMFL..NDS........IT
U4LHC9_PYROM/436-732---------------------------------------CCID..IR-------T.FLNKYYFFS..QHY..FQNE..IA
G3Q4R1_GASAC/450-759---------------------------------------VYCQ..LK-------ESYINLCSQLW..EET..SLSS..TE
Q753S5_ASHGO/494-834---------------------------------------TCAL..IK-------K.SYANMLLFL..NTF..FQHDL.SY
Q5KPL0_CRYNJ/450-754---------------------------------------CCIN..IR-------N.FVDQFYQFT..DGV..AQQH..LD
C4Y6U1_CLAL4/493-821---------------------------------------YCLG..IR-------T.LLKDVLEFT..SRH..YSHEL.SD
E0VNA5_PEDHC/435-739---------------------------------------VYNQ..VK-------K.YINACLKFS..EDL..HISQ..AT
Q7RYL2_NEUCR/451-751---------------------------------------CCID..IR-------N.FLNQFYFFS..NDH..FQHP..NI
H6BY38_EXODN/444-761---------------------------------------CCID..IR-------N.FVNQFYFFAAQDDT..TPSPLSSK
J7R131_KAZNA/509-861---------------------------------------TCTL..TK-------K.IYSKLTTFV..ADF..YRHEL.AI
M0S2D5_MUSAM/444-755---------------------------------------ICRV..VR-------S.FIEDSVNYLSYGGP........VN
H2YEW6_CIOSA/141-441---------------------------------------IFGE..MK-------R.FILSCLEYC..EDL..HLSS..TE
M7XX30_RHOT1/453-763---------------------------------------CCVD..IR-------S.FTEQYYQFA..EGF..AEHH..RD
M2RQV4_CERS8/445-743---------------------------------------CCQD..IR-------S.YVQNFYQFI..EGV..SQHH..RN
M2N0E3_BAUCO/446-755---------------------------------------VCID..IR-------N.FLNQIYLFT..DDH..FKHT..NV
F4S5J6_MELLP/471-780---------------------------------------CCID..IR-------N.FVTKYYHFA..DGF..VSAM..RD
H3CIW2_TETNG/458-766---------------------------------------VYCQ..LK-------E.FIYACLKYS..EDL..HLSS..TE
I3MQ17_ICTTR/423-732---------------------------------------IYIQ..VK-------E.FIYASLKFS..ESL..HRSS..TE
M1CVC4_SOLTU/449-755---------------------------------------CCRI..VK-------S.FIKDSVNYLSYGSQ........MN
H2B145_KAZAF/504-852---------------------------------------TCTL..VK-------K.VYSKLASFI..STF..YRHDL.HS
C8V0B6_EMENI/444-742---------------------------------------CCID..IR-------N.FLNQFYFFA..NDD..FTNP..DI
D7TQV0_VITVI/442-753---------------------------------------VCRI..IR-------S.FIKDSVSYLSYGGH........MN
U5HF68_USTV1/463-770---------------------------------------CCID..IR-------S.FTEQYYQFS..DGF..AEQH..RD
SEC15_SCHPO/436-738---------------------------------------CCTT..LS-------K.FVRHFFMFL..NDS........VI
K2SGN8_MACPH/382-681---------------------------------------CCID..IR-------N.FLNQMYLFS..DDN..FQRS..TV
N1JD47_BLUG1/449-748---------------------------------------CCID..IR-------N.FLNQFYFFS..DDY..FQHP..SI
W5C2B9_WHEAT/447-753---------------------------------------ACRI..IR-------S.FIEDLVSYLSYGVV........VN
U5D3X0_AMBTC/442-753---------------------------------------CCRI..VR-------S.FIEDSVSYLSYGAN........MD
A6R9C0_AJECN/444-745---------------------------------------CCID..IR-------N.FLNQFYFFS..NDD..FQHP..SM
Q6CYE5_KLULA/489-828---------------------------------------TCTL..VK-------K.TYSSLHSFI..SIF..YKHDI.SH
T1ICC1_RHOPR/422-724---------------------------------------IYQQ..VK-------E.YIYACLKFS..EDL..NLSQ..GE
U7Q2U4_SPOS1/452-752---------------------------------------CCID..IR-------N.FLNQFYFFS..DDH..FQHA..SV
V5ESV2_PSEBG/448-756---------------------------------------CCMD..IR-------N.LVDQYYHFS..DGFAFT.....RE
M9MGV3_PSEA3/448-761---------------------------------------CCMD..MR-------N.LVDQYYVFS..DGFSFSQNH..RE
M2T372_COCH5/443-742---------------------------------------CCID..IR-------N.FLNQIYLFS..DDY..FQKS..SV
B0CXV0_LACBS/444-743---------------------------------------CCQD..IR-------T.FIQKFYAFV..DGV..SQHH..RD
A8Q0J7_MALGO/448-754---------------------------------------CCMD..IR-------S.LVEQYYSFS..SGM..TQYH..QD
L8GBJ1_PSED2/444-744---------------------------------------CCID..IR-------N.FLNQFYFFS..DDH..FQHP..NV
K1PXL0_CRAGI/475-788---------------------------------------IYTQ..VK-------A.YINACLKFS..ADL..HLSH..TE
T1K0Q9_TETUR/511-835---------------------------------------VFTQ..VK-------R.FINACREFS..QDL..NISQ..TE
W4YBC1_STRPU/461-764---------------------------------------VYRQ..IK-------E.FIYACHKFS..QDL..HLTQ..TE
I2FTP7_USTH4/451-766---------------------------------------CCMD..IR-------N.LVDQYYNFS..EGV...GGY..RE
M4CSR8_BRARP/401-712---------------------------------------VCRI..IR-------S.YIKGSVDYLSYGVN........TN
SEC15_YEAST/521-864---------------------------------------TCTL..AK-------K.TYSKITAFL..SIF..YRHEL.HT
I1LA00_SOYBN/442-753---------------------------------------ACRI..VR-------S.FIKGSVDYLSYGIH........VN
D5G5B6_TUBMM/397-695---------------------------------------CCID..IR-------N.FLNKYYFFS..DEY..FTHQ..SA
S2IZP1_MUCC1/463-761---------------------------------------CCRD..VS-------F.FVHQFYQFA..EGF..SQTH..GE
K0KMH2_WICCF/500-804---------------------------------------TCAQ..VR-------A.YITHQTGFL..KDY..YKYDV.ES
A3LS60_PICST/480-811---------------------------------------YCLG..VR-------S.LLEDIISFI..GQH..YSYEL.NE
C5DLI6_LACTC/498-839---------------------------------------TCTL..VK-------K.TYNKVVACL..SEF..YQYDL.GE
G3AHA4_SPAPN/460-784---------------------------------------YCFG..IR-------N.LINIVIVFI..SEH..YNYEI.TE
G8BTV9_TETPH/518-863---------------------------------------TCTL..IK-------K.TYTKLISFI..SSF..FRHEL.HT
G4TCP0_PIRID/445-744---------------------------------------CCMN..IR-------S.FVQKFYQFV..EGV..SQHH..RD
G8BIA4_CANPC/483-815---------------------------------------FCKI..LH-------K.LILKTLKFI..EVY..YNYEI.NE
E6ZRP7_SPORE/448-761---------------------------------------CCMD..MR-------N.LVDQYYVFS..DGLSFSQNH..RE
Q6FRK2_CANGA/501-841---------------------------------------TCTM..TQ-------K.VYAKLTSFI..SSF..YRHSL.HS
G0WGH4_NAUDC/507-859---------------------------------------TCTL..TK-------K.TYSKLSSFV..TIF..YRHQL.HT
E3KWD2_PUCGT/502-831---------------------------------------CCIH..IR-------N.YVTNHYAYC..ESIT.......RD
K7IYQ6_NASVI/422-728---------------------------------------VYHQ..VK-------E.FIYACLKFS..EDL..NLTQ..TE
A0A0D1DRH1_USTMA/446-764---------------------------------------CCMD..MR-------N.LVDQYYIFS..DGF...QNH..RE
C3ZIQ9_BRAFL/402-708---------------------------------------VYKQ..IK-------E.FAYACIKFS..EDL..NLSH..TE
D8PS05_SCHCM/445-743---------------------------------------SCQD..IR-------G.FIQKFYTFV..EGV..SDHH..RN
A5E457_LODEL/496-826---------------------------------------FCGF..VR-------Q.LINRTLKFL..NEY..YSYEV.SE

PF09763

Q5K9I2_CRYNJ/487-1172---------------------------------------I.DE--AL-------M-ELDDIDLQI--TGYRMQLNAVSDD
Q75AA6_ASHGO/631-1297---------------------------------------K.AK--TV-------Q-ECDRMDPTL--SLFTMELSSISKD
A5DBH0_PICGU/595-1282---------------------------------------M.TD--SL-------N-ELSNLSTVF--KRAELGFKFLSHE
A3GH85_PICST/638-1329---------------------------------------V.GT--SI-------N-EVENLSHIF--KKMEIDFKFLSSE
Q6FRC5_CANGA/652-1329---------------------------------------E.TN--VN-------K-ACDNINPTF--SLFLMEMSNCSED
Q2UK85_ASPOR/702-1427---------------------------------------I.DK--TI-------E-ECEELDNLL--TLYSHELNTLHDD
A7TSV5_VANPO/776-1455---------------------------------------E.QN--VS-------K-ECEKINPTF--SLFLMEMNNLLDD
Q6CQX3_KLULA/540-1218---------------------------------------K.DL--VF-------K-ECDKLDPTL--SLFTMELSSVSND
Q57ZX4_TRYB2/198-1064---------------------------------------I.SS--IM-------E-DVGEMEARI--AQYSKCILSQKEQ
EXOC1_DROME/198-866---------------------------------------I.DN--AI-------S-EADKFENRL--DSYEDILGHVKET
A7E4X8_SCLS1/708-1443---------------------------------------L.DT--CM-------D-ECDELDGLL--TLYLVELGTLNED
Q6C0U5_YARLI/751-1484---------------------------------------L.DQ--AI-------A-QCDELDAIL--TFFSVELGGLGSD
Q2GRZ6_CHAGB/575-1334---------------------------------------I.DL--SI-------S-ECDELDNLL--TLYSVELSTLSDD
A7RVQ5_NEMVE/163-846---------------------------------------L.EA--AL-------V-ELDKLDTRL--THYDDKLRTVREH
Q5TMX8_ANOGA/201-872---------------------------------------I.EE--AI-------K-EAEKVEKRL--DDYDEILCHVRDT
A0A0D1E5C3_USTMA/474-1173---------------------------------------M.EE--AL-------A-DLDMMDSMI--AGFKVQLNARADD
A5E4P0_LODEL/994-1796---------------------------------------V.ET--AS-------G-EIDNMLRVF--QRMDYNLKTLTND
EXOC1_DICDI/107-855---------------------------------------LGDK--DG-------T-HLTGVTAWI--EYYNKQLQDMKKY
A3KPP9_DANRE/184-869---------------------------------------L.DQ--AL-------A-EVDTIEGKL--LSYEEMLQSVKEQ
E7LTP8_YEASV/640-1316---------------------------------------E.DK--VN-------D-ECHRIIPTL--SLFLMEMSNFSND
V5ILH3_NEUCR/647-1440---------------------------------------I.DV--AL-------A-ECDELDNLL--TLYSVELSTLSDD

PF04129

VPS52_YEAST/47-607---------------------------------------E-AA--IN-------I-IIPQLIDYL--TEFTNRLSNYTQD
VPS52_SCHPO/1-508---------------------------------------L-DS--LK-------S-VLNDVLSSL--ERFQVDLDVATSD
Q9VMQ8_DROME/42-546---------------------------------------I-ND--CD-------D-VLERMENML--MSFQSVLNNISTE
VPS52_RAT/94-601---------------------------------------I-TA--CD-------A-VLERMEQML--GAFQSDLSSISCE
VP52A_ARATH/93-587---------------------------------------I-RD--CD-------S-ILSQMETLL--SGFQEEIGSISSD

PF15278

B6K1Q5_SCHJY/526-611---------------------------------------NQQE--LL-------N-SLNE---------------SMREN
YD6C_SCHPO/520-605---------------------------------------VLKQ--TE-------F-SFDG---------------AIISS

PF06419

F4PTE8_DICFS/25-669---------------------------------------IKKG--FS-------E-VRNHLSQSK--SSF..SNVLQEAK
D7TU00_VITVI/30-688---------------------------------------LADC--CD-------R-IAKALNSCN--ATT..GDIISTTE
K4CMR1_SOLLC/27-689---------------------------------------IVEC--CD-------K-IAMALSSCN--ATT..GDIISTTE
T1IZR2_STRMM/42-648---------------------------------------MSNC--CR-------E-MSNRLQSTK--TQT..QDLISQTT
E6ZVT0_SPORE/99-753---------------------------------------MHTS--CN-------A-VQNKLRAAE--ESS..RYLVEHAE
E3QI24_COLGM/61-707---------------------------------------LNNN--YQ-------D-VRNRITAAH--EDT..GPILEEAS
G8ZRY6_TORDC/181-815---------------------------------------IKNV--GH-------T-IIDDTGKTP--TDKKEQTLEKNIE
D0NH36_PHYIT/44-655---------------------------------------LDTK--CD-------H-VHKFLETTK--RET..QQVQTEAA
G2XGZ3_VERDV/42-689---------------------------------------LNET--YD-------E-MRGPIATSH--TQT..APVLQDAA
C5M6P2_CANTT/146-753---------------------------------------LNEL--SK-------E-TNEKVNKNF--ESS..NELNVEIN
S3D9N6_GLAL2/53-695---------------------------------------LNQG--CE-------E-MKRHISSAH--QET..APALEEAS
K1QJ12_CRAGI/42-639---------------------------------------MNDC--CQ-------D-MTSRLKAAK--EQT..HDLISQTT
E9EWT4_METRA/42-671---------------------------------------LKTE--YE-------S-IKTQVALAQ--SET..SPTLREAA
C1GBA8_PARBD/57-738---------------------------------------LNNV--CD-------E-MRRHIALAT--QET..APVLEEAA
G0VHH4_NAUCC/184-845---------------------------------------IESV--AG-------T-ILNKNEGND--HAT..SKVFDEVD
T1K467_TETUR/31-648---------------------------------------MNQS--CL-------Q-TMNKIKNLK--TKN..QNLLEKTH
B9S1S6_RICCO/31-692---------------------------------------LAEC--CD-------K-IAKALNSCS--AST..GDIISTTE
G3J3T2_CORMM/115-739---------------------------------------LNTD--YS-------E-MKRMVAAAH--SEM..EPSLAEAS
G3B3F3_CANTC/135-733---------------------------------------LNKL--SD-------T-NNERLHDIF--QDL..EQFNKEFK
COG6_PICGU/138-737---------------------------------------LRSA--SM-------G-VVDSVNNDF--ESS..EIFNSKME
U1G9I0_ENDPU/55-707---------------------------------------LNKT--CE-------E-MRTQIHKAQ--QES..GSMLEEAS
B7Q1K3_IXOSC/40-604---------------------------------------MSTA--CQ-------G-MMARLQATR--SQT..DTLMSRSA
F1A3Z4_DICPU/25-688---------------------------------------IKTG--CD-------D-ICNHLNSTN--KVS..SKLLTNAN
A5DUD8_LODEL/174-816---------------------------------------LNDL--ND-------E-INTRLNKTA--NGS..TQFTEKVG
C5FL60_ARTOC/56-718---------------------------------------LNTI--CQ-------D-MRSRLAIAH--QET..GPVLEEAS
X1WYM6_ACYPI/29-624---------------------------------------LNTS--VM-------S-MSSQLKDTK--TDT..QNLIELTK
COG6_CHAGB/47-689---------------------------------------LNET--FN-------E-MKTQIGSAQ--KTT..SSTLIEAS
T1EFP4_HELRO/53-656---------------------------------------INAC--CQ-------D-MISRLKKTK--SQT..HDLISQTT
G4V7Z1_SCHMA/35-648---------------------------------------ILET--CL-------R-VNGTLTSVK--SET..VCLVEEAQ
C1MX75_MICPC/28-699---------------------------------------LLAG--CQ-------R-ISSALDSSR--ART..RVLLRETS
COG6_ASPCL/56-753---------------------------------------LNQT--CE-------E-MRQHIFLAK--QDT..TPVLEEAS
R9NZP8_PSEHS/106-778---------------------------------------MHAS--CD-------A-VQDKLRAAE--ESS..RYLVEHAE
M7T0Y3_EUTLA/61-714---------------------------------------LNNS--YQ-------G-MKSHVTAAH--EVT..SITLEETN
B3N2A1_DROAN/35-627---------------------------------------MATS--VE-------T-MKSDLETSK--ALT..KDLIDQTN
G3AM15_SPAPN/147-779---------------------------------------LNEL--NR-------T-TNEKIVKNY--EFS..TEFNSKVS
COG6_DEBHA/142-759---------------------------------------LNGL--RD-------S-ITEKVNKDF--QST..KDLNGEVK
COG6_DICDI/25-671---------------------------------------IKNS--CV-------D-ICDHLNSTN--RVS..SELLKNAH
D6WE56_TRICA/33-626---------------------------------------MSKS--IQ-------E-MTHRLHNAK--MQT..KQLLEQTK
K1Y0X5_MARBU/53-696---------------------------------------LNQG--CE-------E-MKRHISAAH--QET..APVLEEAS
R0IIQ7_SETT2/55-693---------------------------------------LNNY--CA-------D-MRGHIAAAS--KET..DPVLEEAT
G2YFW1_BOTF4/53-688---------------------------------------LNQG--CE-------E-MKRHISAAH--QET..APVIQEAS
B3RLZ3_TRIAD/43-642---------------------------------------MNES--CN-------Q-MTERLMAAK--SET..SDLITKTS
M2NAU2_BAUCO/56-695---------------------------------------LNDT--CT-------E-LRKHVGAAN--RET..GPMLDEAR
COG6_MAGO7/54-703---------------------------------------LNNS--YA-------E-MKTQVTKAH--ECT..SPVLQEAS
N1PID3_DOTSN/58-692---------------------------------------LNSS--CV-------E-MRKHINAAH--REA..GPMLDEAK
M7NMJ9_PNEMU/26-631---------------------------------------IKNL--TN-------E-MEKEADIIS--LKS..THFLKQIT
G0WDG5_NAUDC/220-947---------------------------------------ISKI--SE-------Q-LIDRANETS--NHGTTDSVFNQVE
U4LN57_PYROM/30-663---------------------------------------MSNV--VS-------A-MRIGTSTAS--AEA..APILEEST
F4NVM0_BATDJ/55-674---------------------------------------IGNR--CE-------Q-MDIQLKAAY--KNA..ASVLKHTQ
Q6NMI3_ARATH/31-678---------------------------------------LADC--CD-------K-IAAALSSSA--ATT..SDIISTTE
A9SY28_PHYPA/31-697---------------------------------------LAEC--CE-------R-IAKSLSSCS--STT..SEIVSATE
R4XC07_TAPDE/63-663---------------------------------------MEAA--CD-------Q-MRVQAQAVK--TST..TQLLEQST
COG6_CANGA/184-819---------------------------------------IENI--GE-------E-ILKNDKET.--...FSQKYISDID
A0A088AU02_APIME/31-620---------------------------------------MNNA--VQ-------C-MTNRLQTTK--TQT..SQLIDQTA
M3AVJ9_PSEFD/47-684---------------------------------------LNNS--AA-------E-MRKHIAAST--RDI..GPVVDEAK
G8BSH8_TETPH/181-817---------------------------------------IEEL--GN-------T-VMDETKEIN--EDS.KDGNLNEVY
V5EQK1_PSEBG/40-699---------------------------------------MHTS--CN-------T-VQDKLRAAE--ESS..RYLVEHAE
COG6_YEAST/190-824---------------------------------------IQRT--SE-------K-LLSNETNEV--PTN..NVVLQEID
C4Y1K1_CLAL4/138-736---------------------------------------MQQT--VE-------E-TGQLLGSDD--GDS..ARISAQVA
C5DMM3_LACTC/169-799---------------------------------------IHQM--GD-------A-LLKQGEMAH--DET..KTYMDTVY
J4VQT6_BEAB2/59-673---------------------------------------LNAD--SS-------K-MKRMVAVAH--SGM..ESPLAEAS
G8BDK2_CANPC/146-760---------------------------------------LNDL--NK-------Q-TNDRLQKNF--EFS..HEFNTTVN
A0A0C4DUI8_MAGP6/47-702---------------------------------------LNKS--YA-------E-MKSQITAAQ--DAT..STVLQEAS
COG6_ASHGO/167-791---------------------------------------IQEI--SE-------K-VLDAQEAQN--KSPLQDPLVSEV.
D8T0Q7_SELML/31-672---------------------------------------LAES--CE-------R-IAKSLSSCE--AVT..GDIVATTE
COG6_SCHPO/44-649---------------------------------------VKNS--ID-------S-YKNEWSKKT--NDA..QILLNSYE
A4S9H0_OSTLU/72-716---------------------------------------LDGA--RE-------R-MRTALETSK--QKT..SSLLRETA
M0TQE9_MUSAM/30-700---------------------------------------LAEC--CD-------Q-IAKALSGCS--EST..GDIISTTE
E5ACR4_LEPMJ/80-720---------------------------------------LNSY--CS-------D-MRSHIAAAN--RET..GPVLEEAT
Q6C1G5_YARLI/26-595---------------------------------------LNHK--FT-------L-MQQLVNTCK--NDT..RHVVSEGS
A0A0D2XVZ8_FUSO4/62-692---------------------------------------LNNG--YA-------D-MKSQVVEAH--RQT..LPALSEAS
C5GW18_AJEDR/57-748---------------------------------------LNNA--CE-------E-MRRHIVLAS--QET..APVLEEAT
C1EEF9_MICSR/30-686---------------------------------------LLSG--CR-------R-IANVLDKSR--ERT..GNLLDETA
W1QBZ5_OGAPD/148-758---------------------------------------LNSC--YD-------E-IDGRLSESL--QDT..AEYKKEVK
A8HUT2_CHLRE/30-678---------------------------------------LSGS--CG-------A-ISGVVAATK--SSS..ASLLADTE
B0VZV1_CULQU/39-627---------------------------------------VSDS--VD-------S-MKNLLSSTE--AQQ..KELIQQAN
G0RKF7_HYPJQ/55-674---------------------------------------LNSR--IQ-------D-MKRQIDSAH--DRT..TPALRGMA
Q00T18_OSTTA/88-728---------------------------------------LDGA--RE-------R-MQRALDGSK--QKT..SALLREAE
COG6_CRYNJ/70-689---------------------------------------MQVR--CD-------Q-VQSELDQAN--SGT..KFLLERAD
A2E714_TRIVA/27-593---------------------------------------LDKS--CD-------Q-MLTKLSIGQ--KGV..DEVLDMTT
L8G9L6_PSED2/56-700---------------------------------------LNQG--CE-------E-MRRHITAAH--QET..APVLDEAS
S2JPX5_MUCC1/49-650---------------------------------------MESV--CK-------D-MEQRIVKAE--SHT..ADMIEQAD
G9PA30_HYPAI/22-644---------------------------------------VNSR--IE-------A-IKRQIDLAH--AQT..SPALRDMS
COG6_PHANO/55-693---------------------------------------LNSY--CA-------D-MRSHIAAAN--KET..GPVLEEAT
T5A889_OPHSC/60-688---------------------------------------MDAG--YD-------A-IKSHIISAH--TGT..LPVLTEAA
G7XM19_ASPKW/58-742---------------------------------------LNQT--CD-------E-MRKHIVSAR--QET..APVLEEAS
N4VJY2_COLOR/52-699---------------------------------------LNNN--YQ-------Q-VQTRITAAH--QET..EPMLEEAC
C4R6S3_PICPG/154-788---------------------------------------MNEL--NN-------Q-ITEKLSSRV--EDT..TRLDNSIH
G8YLX1_PICSO/140-752---------------------------------------LNNI--YD-------S-LTSSVEKDF--DLV..KQLVENVG
E1ZT97_CHLVA/34-681---------------------------------------LSAC--CE-------S-MGASLAGSR--SAA..ADLLHDTD
W1P048_AMBTC/29-693---------------------------------------LDEC--CD-------K-IAKALNSCN--ATT..GDIISTTE
A0A0D2VZS5_CAPO3/71-723---------------------------------------MAAC--CS-------Q-MTDRLNAAT--SKT..ATLLEVTN
K7J084_NASVI/37-626---------------------------------------MNDC--VQ-------S-MTNRLQTTK--ART..LQLIDQTT
C5DUZ7_ZYGRC/192-819---------------------------------------IKET--GQ-------Q-LVEETEADQ--SNE.DDSVTDRVN
V5HY00_BYSSN/58-733---------------------------------------LNRT--CE-------E-MRKHISQAK--QET..APVLEEAS
U9U8S1_RHIID/50-658---------------------------------------MNTF--CN-------E-IEKSLESAN--RQI..AVLLEQSD
I1FMS4_AMPQE/123-704---------------------------------------MRSC--CQ-------D-MQNRLADTK--AKT..AGLLNETA
COG6_PICST/163-782---------------------------------------LNDL--NK-------V-TNDNIENKF--KYS..SEFNTKVK
Q7QJN1_ANOGA/32-623---------------------------------------MSQS--VD-------S-MKSQLRNTE--AQT..KDLILQAN
COG6_ASPOR/122-808---------------------------------------LNQT--CD-------E-MRKHISLAR--QDT..APVLEEAS
I1H7V6_BRADI/77-734---------------------------------------LNDS--WK-------K-IEEALSSCS--AST..GDIISTTE
F9XD71_ZYMTI/57-693---------------------------------------LNSS--CV-------E-MRRHISASN--RET..APMLDEAK
J7S8L6_KAZNA/176-802---------------------------------------IRDV--SE-------S-ILPNPSINE--NDT.ETTFLKDID
COG6_CANAL/150-758---------------------------------------LNEL--SV-------Q-TNDKINKNF--DFS..NKLNLEIK
F6SQE9_CIOIN/44-655---------------------------------------MSLC--CK-------D-MTDRLAATK--EQT..QELITQTS
B9N0R1_POPTR/31-709---------------------------------------LAEC--CD-------N-IAKALSSCS--AST..GDIISTTE
T1I707_RHOPR/34-617---------------------------------------MNFA--VQ-------S-MSQQLVATK--AQT..NQLIEQTT
COG6_CAEEL/38-623---------------------------------------MNST--CT-------N-LSKQMETVK--FKS..VDLVQKTA
F7BIB8_HORSE/4-604---------------------------------------MSNC--CQ-------D-MTSRLQAAK--EQT..QDLIVKTT
COG6_NEUCR/64-712---------------------------------------LNES--YN-------D-MRTQIHAAH--AST..ASTLGEAS
M3D478_SPHMS/53-688---------------------------------------LQAS--CV-------E-MRKYVDASS--RET..GPMLDEAK
G8JRN3_ERECY/172-797---------------------------------------IQAL--GQ-------Q-LLEMQDSGH--EEV...IVDSDVV
R1EQ64_BOTPV/49-680---------------------------------------LNRC--CA-------D-MRAQISSAN--RET..RPMLDEAS
I2H727_TETBL/181-823---------------------------------------IRTL--GQ-------S-LTESNDDTP--SDN...QLLLQLN

PF03081

B4LDS3_DROVI/323-697---------------------------------------ERAI--MR.......D-IIP......--.............
Q5KMS6_CRYNJ/301-670---------------------------------------ETML--AE.......S-LFP......--.............
J3MBU4_ORYBR/165-513---------------------------------------QRQL--NQ.......N-DFEI.....--.............
G1XRU1_ARTOA/244-617---------------------------------------EYDN--IQ.......R-LFK......--.............
W1PIG8_AMBTC/268-635---------------------------------------EKYL--CD.......Q-IFGD.....--.............
S0EBU7_GIBF5/246-629---------------------------------------EYDN--VC.......S-VFS......--.............
K4BC35_SOLLC/279-644---------------------------------------EKWL--SD.......Q-IFSE.....--.............
Q60EX4_ORYSJ/154-509---------------------------------------QRHL--QEEGRSTAQV-DR.......--.............
K3XWI2_SETIT/155-495---------------------------------------HREL--TV.......K-QV.......--.............
Q6Z421_ORYSJ/101-458---------------------------------------ERQL--CN.......K-VFGQ.....--.............
C5E0R8_ZYGRC/237-621---------------------------------------EKSF--VD.......D-LYVQ.....--.............
Q6ES92_ORYSJ/192-594---------------------------------------QLEL--RAKKP.TVA.-.GVRRAIQF--FLLR.........
Q9SIB0_ARATH/210-552---------------------------------------EQIL--SD.......H-VFSSS....--.............
Q9LQP9_ARATH/238-587---------------------------------------ERIL--SD.......H-IFS......--.............
F6GST9_VITVI/277-640---------------------------------------EKRL--CD.......Q-AFSG.....--.............
G8ZSY9_TORDC/245-624---------------------------------------EKSL--VD.......D-LYLQ.....--.............
I1LFL8_SOYBN/224-593---------------------------------------EQRL--YD.......S-IFPN.....--.............
M4F3N2_BRARP/219-571---------------------------------------ERIL--CD.......H-VFST.....--.............
W1NW13_AMBTC/231-604---------------------------------------ERLL--CE.......S-VFEG.....--.............
M0SRF8_MUSAM/218-582---------------------------------------ERHL--CN.......L-VFGKL....--.............
J7REJ7_NAUDC/235-618---------------------------------------EKSL--VN.......D-LYSQ.....--.............
D2UX81_NAEGR/218-569---------------------------------------ERKI--AL.......K-VVSV.....--.............
M4DQ92_BRARP/206-564---------------------------------------ERIL--CD.......R-IFSTSSS..--.............
K3Z4M7_SETIT/235-602---------------------------------------ERKL--CD.......Q-IFEG.....--.............
B9S3S8_RICCO/351-722---------------------------------------ERKL--AE.......A-VFSD.....--.............
B7P4G4_IXOSC/289-655---------------------------------------ERTL--LQ.......Q-VLGSA....--.............
F6H2V1_VITVI/283-641---------------------------------------EYKL--CN.......D-VFERI....--.............
Q9FNR3_ARATH/273-622---------------------------------------EKQL--CD.......Q-ILGD.....--.............
M0THS1_MUSAM/243-589---------------------------------------EHVL--LD.......H-VFAG.....--.............
C5XNX2_SORBI/186-525---------------------------------------ERHL--CN.......C-IFEE.....--.............
A7TQI9_VANPO/237-621---------------------------------------EQSL--VD.......D-LYVQ.....--.............
Q6L582_ORYSJ/123-524---------------------------------------QGHL--HDERSAAAAA-AAAVAVVGG--VEFAISQPPHHTA
K3XFC8_SETIT/312-653---------------------------------------QKQL--NG.......Q-DLGY.....--.............
E9G2G2_DAPPU/324-689---------------------------------------ELRL--ML.......G-IVP......--.............
M4ELV2_BRARP/227-592---------------------------------------EKIL--CD.......H-VFEA.....--.............
D7MQ70_ARALL/301-664---------------------------------------EKKI--CD.......E-IFSS.....--.............
M4E3U0_BRARP/64-418---------------------------------------EFKL--AE.......K-IFP......--.............
C5E318_LACTC/234-618---------------------------------------EYMF--TE.......D-ILAK.....--.............
M0RFS4_MUSAM/240-598---------------------------------------ERRL--CD.......R-VFAS.....--.............
M0S9N6_MUSAM/277-655---------------------------------------ERKI--CD.......Q-IFYG.....--.............
J3MUP3_ORYBR/158-521---------------------------------------ERRL--CD.......E-VFAS.....--.............
B9I6L2_POPTR/266-620---------------------------------------ERRL--CD.......R-VFYG.....--.............
E4X2L8_OIKDI/306-653---------------------------------------EIRV--AQ.......E-VLP......--.............
D7MSH8_ARALL/228-592---------------------------------------ERIL--AD.......H-VFAS.....--.............
B9IK77_POPTR/253-654---------------------------------------DKRL--SE.......Q-IFGE.....--.............
M0RET8_MUSAM/246-597---------------------------------------ERVL--LD.......H-VFAG.....--.............
A9RYU9_PHYPA/273-621---------------------------------------ERML--CD.......Q-IWAR.....--.............
Q69JW6_ORYSJ/346-696---------------------------------------RRQL--HK.......Q-NFGA.....--.............
M1AX18_SOLTU/275-644---------------------------------------EKWL--SD.......Q-IFGEL....--.............
M0ZQS8_SOLTU/207-577---------------------------------------ERRL--GE.......S-VFSA.....--.............
B8MLJ7_TALSN/245-625---------------------------------------EHEG--IV.......R-IFT......--.............
I1I8W2_BRADI/260-643---------------------------------------ERLL--CA.......E-VFASDS...--.............
K7M841_SOYBN/188-545---------------------------------------ERRL--SN.......I-VFSG.....--.............
M7S7Y8_EUTLA/245-627---------------------------------------EHEN--IC.......S-IFL......--.............
I1MUP7_SOYBN/290-649---------------------------------------EKRL--CD.......G-LFGD.....--.............
I1LR33_SOYBN/232-587---------------------------------------ERIL--CD.......H-VFASD....--.............
Q9LIA2_ARATH/266-643---------------------------------------EKSL--DN.......Q-IFGD.....--.............
I1MBG5_SOYBN/274-630---------------------------------------ERRL--CD.......R-VFFG.....--.............
M2MJA4_BAUCO/246-630---------------------------------------EYDN--IC.......H-VFS......--.............
B9RAG8_RICCO/276-630---------------------------------------EKRL--CD.......H-IFSG.....--.............
U7Q7I3_SPOS1/370-767---------------------------------------EHEN--IC.......S-IFT......--.............
Q5TQS7_ANOGA/318-703---------------------------------------ERQL--LN.......D-IVP......--.............
E0VIX9_PEDHC/327-689---------------------------------------ERNL--MV.......G-IIP......--.............
EXO70_KLULA/234-616---------------------------------------ENSL--IQ.......D-LYSK.....--.............
D8RZH2_SELML/269-629---------------------------------------ERQL--CD.......Q-VFEGI....--.............
B9HPL3_POPTR/209-568---------------------------------------ERVL--SD.......H-VFSS.....--.............
M7PEF2_PNEMU/241-608---------------------------------------ESLI--IR.......D-VFP......--.............
C4LW49_ENTHI/279-679---------------------------------------ERIF--QQ.......D-ILQ......--.............
I1JCY6_SOYBN/322-699---------------------------------------EWRL--AE.......S-VFGEEKEQD--.............
D6WW45_TRICA/328-692---------------------------------------EQAL--IK.......G-IIA......--.............
B6K881_SCHJY/235-604---------------------------------------EANE--LI.......E-IYG......--.............
F0XF34_GROCL/729-1128---------------------------------------EYDS--IC.......S-VFT......--.............
D8SPE6_SELML/233-605---------------------------------------ERFL--SD.......E-VFAV.....--.............
M0REN0_MUSAM/218-570---------------------------------------ERRL--CE.......H-IFEG.....--.............
E0CP16_VITVI/299-657---------------------------------------EKKL--CK.......Q-VLSGI....--.............
K3Y3Q0_SETIT/194-605---------------------------------------QMEL--RANR...PAA-IGVRKAIRY--FML..........
B9HV40_POPTR/282-631---------------------------------------EYKL--CS.......D-VFEKN....--.............
J3MH82_ORYBR/80-438---------------------------------------ERKL--CV.......A-VFER.....--.............
B9GVY9_POPTR/242-613---------------------------------------EKQL--CE.......E-IFYGI....--.............
M7UD48_BOTF1/247-635---------------------------------------EYDN--IC.......A-LFT......--.............
W1PWG9_AMBTC/231-597---------------------------------------ERIL--CD.......H-VFAS.....--.............
N1J6U6_BLUG1/243-631---------------------------------------EYEN--IC.......A-LFP......--.............
K3XSA8_SETIT/229-593---------------------------------------EKRL--SN.......H-IFGEL....--.............
B9SNP4_RICCO/271-635---------------------------------------EKWL--AE.......Q-ILGE.....--.............
M1CZG7_SOLTU/225-591---------------------------------------ERIL--CD.......Q-VFSI.....--.............
Q9C8H6_ARATH/254-623---------------------------------------ESKL--CY.......D-VFEDI....--.............
H2ZQN6_CIOSA/276-638---------------------------------------EQDM--MQ.......S-VIP......--.............
K3XFW5_SETIT/237-577---------------------------------------RRQL--HAQTPGAFDS-.........--.............
A9TGT7_PHYPA/278-635---------------------------------------EKQL--CD.......E-VFP......--.............
M1W138_CLAP2/246-628---------------------------------------EYDN--IC.......S-IFR......--.............
A5B8C4_VITVI/267-614---------------------------------------ERRL--CD.......R-VFFG.....--.............
S3E3U8_GLAL2/246-630---------------------------------------EYDN--IC.......A-LFS......--.............
B9T041_RICCO/247-608---------------------------------------EKAL--CD.......H-VFSA.....--.............
H6CBM6_EXODN/248-636---------------------------------------EAEN--TS.......R-VFR......--.............
I1JWP0_SOYBN/263-614---------------------------------------EKRL--CK.......Q-VLGD.....--.............
F4KG58_ARATH/222-573---------------------------------------EKEI--CH.......Q-ILDG.....--.............
F6GTU7_VITVI/230-591---------------------------------------ERIL--CD.......R-VFSA.....--.............
M4CLF8_BRARP/249-615---------------------------------------EKLL--CD.......H-VFSA.....--.............
W5EWA8_WHEAT/175-531---------------------------------------ERKI--CD.......E-VFEG.....--.............
I1MDK3_SOYBN/222-572---------------------------------------EKTL--CD.......Y-VFGSP....--.............
M1CA15_SOLTU/267-620---------------------------------------EKNL--FD.......Q-ILCE.....--.............
C4R8N1_PICPG/235-620---------------------------------------ENAF--YE.......E-LFESSR...--.............
Q8VY27_ARATH/245-606---------------------------------------EKLL--CD.......H-VFSA.....--.............
Q0CYR3_ASPTN/219-599---------------------------------------EHDI--IS.......R-IFT......--.............
U9SQP1_RHIID/236-607---------------------------------------EYEI--AE.......K-ILP......--.............
EXO70_EMENI/247-629---------------------------------------EWEA--IK.......R-IFT......--.............
S2J047_MUCC1/214-590---------------------------------------EYKF--AQ.......Q-IMGN.....--.............
J3L5F1_ORYBR/344-686---------------------------------------ERHL--CD.......C-IFEG.....--.............
K0KAQ4_WICCF/235-607---------------------------------------EYAL--LE.......S-ILNE.....--.............
M0W8E8_HORVD/215-574---------------------------------------ERRL--CD.......E-VFAS.....--.............
R8BPV7_TOGMI/250-634---------------------------------------EYDN--IC.......S-IFM......--.............
K3ZHK2_SETIT/304-675---------------------------------------ERDL--CA.......R-VFAS.....--.............
M0TX18_MUSAM/52-414---------------------------------------ERLL--CD.......R-IFAG.....--.............
K4CMD0_SOLLC/278-635---------------------------------------EYKL--CN.......D-VFDRF....--.............
G3JCP3_CORMM/249-631---------------------------------------EYEN--VC.......S-IFS......--.............
Q6K647_ORYSJ/301-673---------------------------------------ERRL--CD.......Q-VLSV.....--.............
J3N6B0_ORYBR/11-377---------------------------------------EHDL--CA.......R-VFAGC....--.............
C5FN52_ARTOC/246-625---------------------------------------EYEN--II.......K-IFP......--.............
J7R1E6_KAZNA/236-614---------------------------------------ERSL--VN.......D-LYSQ.....--.............
EXOC7_DICDI/437-835---------------------------------------EYDL--AS.......E-LF.......--.............
K1X101_MARBU/264-643---------------------------------------EYEN--IC.......G-LFS......--.............
W1NJ63_AMBTC/264-632---------------------------------------EKLL--CD.......R-VFANLSLSS--PCVS.........
G0S641_CHATD/252-645---------------------------------------EYDN--IC.......N-IFT......--.............
D5GH85_TUBMM/239-604---------------------------------------EYEN--IC.......Q-LFP......--.............
A9SN89_PHYPA/313-674---------------------------------------EKRL--AR.......E-VFKFV....--.............
J9JWJ5_ACYPI/326-687---------------------------------------ELSL--MV.......G-IIP......--.............
W5AN73_WHEAT/1073-1426---------------------------------------ERHI--CS.......Q-IFTA.....--.............
W1PHH8_AMBTC/279-635---------------------------------------EYKL--CN.......D-VFEKI....--.............
U5H6T1_USTV1/251-633---------------------------------------EYAL--LS.......T-VFANV....--.............
S7ZDA9_PENO1/246-625---------------------------------------EHGV--IV.......Q-IFP......--.............
K2RHI9_MACPH/246-628---------------------------------------EYEN--IC.......P-IFA......--.............
F6HQX6_VITVI/246-608---------------------------------------ERIL--CD.......H-VFAA.....--.............
I1NUS0_ORYGL/283-640---------------------------------------ERRI--CN.......Q-IFAA.....--.............
M4AQR1_XIPMA/327-700---------------------------------------EYAL--LT.......E-IIP......--.............
M7XH50_RHOT1/276-657---------------------------------------EHAL--LG.......T-VFASL....--.............
K4DFQ8_SOLLC/257-617---------------------------------------EHRL--CV.......E-VFRKA....--.............
D7LD39_ARALL/243-607---------------------------------------EKLL--CD.......H-VFSA.....--.............
E3S143_PYRTT/247-623---------------------------------------EFDN--LN.......Y-VFD......--.............
E7LW76_YEASV/236-620---------------------------------------EKSL--VD.......D-LYSQ.....--.............
M3APZ2_PSEFD/248-629---------------------------------------EYDN--IC.......S-IFQ......--.............
T5A733_OPHSC/248-627---------------------------------------EYNN--VC.......C-IFT......--.............
U5CZ65_AMBTC/305-668---------------------------------------EKKL--CQ.......Q-VFNNI....--.............
Q0U449_PHANO/247-623---------------------------------------EYDN--IT.......N-IFP......--.............
I1Q027_ORYGL/148-486---------------------------------------HREA--RNPANETAAA-QL.......--.............
M1CE10_SOLTU/253-614---------------------------------------ERRL--CD.......R-VFFG.....--.............
M0U7Y4_MUSAM/169-538---------------------------------------ERVL--SD.......H-VFAS.....--.............
EXO70_ASHGO/231-611---------------------------------------VSVL--ID.......D-VFVK.....--.............
G2XG72_VERDV/248-627---------------------------------------EYEN--IC.......N-LFN......--.............
J3M2U7_ORYBR/269-636---------------------------------------ECML--CD.......Q-VFGR.....--.............
L8G7J8_PSED2/268-651---------------------------------------EHEN--VC.......A-LFA......--.............
M4CEA6_BRARP/229-593---------------------------------------ERIL--AD.......H-VFSS.....--.............
A9SZG5_PHYPA/276-645---------------------------------------EKQL--CD.......Q-VFA......--.............
EXO70_YARLI/228-600---------------------------------------EHDN--LR.......C-AFPK.....--.............
A0A0D1CBV0_USTMA/294-724---------------------------------------DYRI--LQ.......G-LMTSAEL..--.............
M0TA71_MUSAM/314-686---------------------------------------EHDL--CE.......A-VFAG.....--.............
Q6Z5V5_ORYSJ/164-504---------------------------------------LKQI--QEQHDGASSG-LT.......--.............
I1N4J9_SOYBN/299-665---------------------------------------ERWL--SD.......Q-IFGE.....--.............
A0A068X0P1_HYMMI/337-709---------------------------------------EQLL--LD.......R-LNLAA....--.............
M3J203_CANMX/209-599---------------------------------------ELEL--LN.......V-CE.......--.............
K3ZZ59_SETIT/223-607---------------------------------------ERRL--CF.......H-IFHDLPLCS--S............
F9XKX9_ZYMTI/246-627---------------------------------------EYDN--IC.......P-VFS......--.............
B9RM96_RICCO/288-654---------------------------------------EQKL--CD.......S-IFSE.....--.............
D7L2C4_ARALL/228-595---------------------------------------EKRL--CE.......Q-LFDGI....--.............
K7KYU0_SOYBN/278-635---------------------------------------ECRL--SA.......I-VFEKI....--.............
D7KZD8_ARALL/246-616---------------------------------------EKLL--CE.......H-VFESV....--.............
U5FM28_POPTR/271-621---------------------------------------EKRF--CN.......Q-ILGD.....--.............
Q65WW9_ORYSJ/227-582---------------------------------------ERRL--CD.......R-VFDG.....--.............
W5AKS6_WHEAT/499-852---------------------------------------ERRI--CN.......Q-IFAA.....--.............
S9VZ38_SCHCR/246-609---------------------------------------TATE--LL.......H-LYD......--.............
R7YPE8_CONA1/246-628---------------------------------------EYEN--VR.......A-VFT......--.............
M1C7K5_SOLTU/253-615---------------------------------------ERIL--CD.......H-VFLS.....--.............
E9EGW9_METAQ/241-624---------------------------------------EYDN--IC.......S-IFK......--.............
G8YBT4_PICSO/212-624---------------------------------------QNSR--LQ.......D-IGNEIG...--.............
M0RE29_MUSAM/266-621---------------------------------------ERQL--CE.......Q-ILAG.....--.............
F6H486_VITVI/271-637---------------------------------------EKWL--SD.......Q-VFGE.....--.............
W1PQ65_AMBTC/301-663---------------------------------------EKNL--LE.......K-VFEY.....--.............
T1K8E7_TETUR/311-683---------------------------------------ELEL--ME.......G-LMEGV....--.............
J3MTK1_ORYBR/52-443---------------------------------------ERRL--CF.......L-IFHDLPISN--ITV..........
I2H140_TETBL/236-622---------------------------------------ESTL--VD.......D-LFSQ.....--.............
M3DCX2_SPHMS/245-628---------------------------------------EYDS--IC.......P-VFQ......--.............
I1N7V8_SOYBN/316-682---------------------------------------ERKL--AE.......A-VFAS.....--.............
K3YBY1_SETIT/269-627---------------------------------------ERKN--CD.......Q-IFDG.....--.............
G7YLN0_CLOSI/142-557---------------------------------------ERRW--LE.......R-LQLTS....--.............
J3L4D1_ORYBR/230-594---------------------------------------EKRL--SN.......H-VFGEL....--.............
R4XBR7_TAPDE/254-624---------------------------------------ERSL--CI.......V-LFG......--.............
A9RF66_PHYPA/295-650---------------------------------------ERRL--AR.......Q-VFKDM....--.............
A2FJ22_TRIVA/250-590---------------------------------------ERAF--AL.......A-VFG......--.............
I1MBG8_SOYBN/93-437---------------------------------------ERRL--CD.......C-IFSR.....--.............
J3NNQ2_GAGT3/246-625---------------------------------------EYEN--IT.......S-IFS......--.............
M4CAS6_BRARP/212-578---------------------------------------EKTL--CD.......E-VFEGC....--.............
G8JUD2_ERECY/232-611---------------------------------------ESAL--IT.......E-LYGK.....--.............
G8B940_CANPC/213-611---------------------------------------EVLV--LK.......Q-CS.......--.............
K4ATI3_SOLLC/271-650---------------------------------------EKRL--GD.......S-VFSE.....--.............
K4D380_SOLLC/270-630---------------------------------------EKKV--SD.......Q-IFEG.....--.............
K4DB07_SOLLC/238-600---------------------------------------EKIL--CD.......H-VFSA.....--.............
EXO70_NEUCR/252-636---------------------------------------EYDN--IC.......S-IFM......--.............
A8XF23_CAEBR/262-600---------------------------------------EEKL--MV.......R-AIPD.....--.............
M4E1D8_BRARP/269-620---------------------------------------EKKI--CD.......Q-ILDG.....--.............
M0TCN3_MUSAM/206-567---------------------------------------ERLL--CD.......R-VFAS.....--.............
D7KLE4_ARALL/242-609---------------------------------------EKRL--CE.......Q-IFE......--.............
K3Y1F3_SETIT/202-606---------------------------------------QLDL--RAK.....KK-PAAGNGIWH--FML..........
J3MD06_ORYBR/268-610---------------------------------------ERQA--CT.......Q-IFGS.....--.............
A9S026_PHYPA/305-661---------------------------------------ERRL--AR.......Q-VFKNV....--.............
W1QJT2_OGAPD/249-609---------------------------------------EPHF--LS.......K-FFDD.....--.............
E2BW20_HARSA/356-713---------------------------------------ERTL--VA.......R-ILP......--.............
K4BUL3_SOLLC/313-670---------------------------------------EKKL--CC.......Q-VLGTV....--.............
A5E7C7_LODEL/213-654---------------------------------------EYSV--LK.......Q-CL.......--.............
EXO70_CANGA/235-620---------------------------------------ERSL--ID.......D-VFSQ.....--.............
C4Y3V1_CLAL4/216-602---------------------------------------VSTV--CE.......E-LR.......--.............
U4LH75_PYROM/239-603---------------------------------------EYEN--IC.......H-LFP......--.............
D7LJN0_ARALL/216-574---------------------------------------ERIL--CD.......H-VFSP.....--.............
K4BJZ5_SOLLC/284-648---------------------------------------EKSL--CD.......Q-VFGD.....--.............
C5MG62_CANTT/215-605---------------------------------------EVNL--LR.......S-CN.......--.............
EXO70_CANAL/230-665---------------------------------------ELII--LN.......E-CQ.......--.............
M4DQX8_BRARP/251-599---------------------------------------ESNL--CN.......E-VFKDVG...--.............
A0A0D2X486_CAPO3/367-717---------------------------------------ERVL--AQ.......R-VLP......--.............
F6HBV2_VITVI/280-635---------------------------------------EYQL--CN.......D-VFEKI....--.............
I1JPF3_SOYBN/247-610---------------------------------------ERIL--CD.......H-VFSY.....--.............
M4D183_BRARP/85-443---------------------------------------EFKL--CN.......D-VFERF....--.............
F6HRR9_VITVI/232-595---------------------------------------ERVL--CD.......H-VFSA.....--.............
B9RLN4_RICCO/271-620---------------------------------------EKRL--CD.......Q-ILGE.....--.............
F6WWX5_CIOIN/361-724---------------------------------------EQSM--IQ.......S-VIP......--.............
I1IU67_BRADI/277-636---------------------------------------ERKI--CD.......Q-VFDC.....--.............
A3LWD2_PICST/218-611---------------------------------------ELRL--LK.......E-LN.......--.............
U5GI23_POPTR/267-628---------------------------------------EKCL--SE.......Q-IFGD.....--.............
G3B334_CANTC/207-579---------------------------------------EYEL--LE.......R-LD.......--.............
B9HCA8_POPTR/242-605---------------------------------------ERFL--CD.......H-VFAV.....--.............
A9S081_PHYPA/264-622---------------------------------------ERKL--CD.......Q-IWYH.....--.............
M0RMY7_MUSAM/168-542---------------------------------------ERRL--CE.......L-VFD......--.............
K1R8N3_CRAGI/240-606---------------------------------------EAQL--MS.......G-IIA......--.............
M0TDJ2_MUSAM/228-592---------------------------------------ERHL--CD.......L-VFGEL....--.............
A9SEA0_PHYPA/286-643---------------------------------------EKQL--CD.......E-LFP......--.............
K3XX39_SETIT/77-423---------------------------------------ERRA--CA.......H-IFGC.....--.............
K7UV86_MAIZE/134-473---------------------------------------HQKL--KA.......A-HV.......--.............
M1BSP6_SOLTU/313-684---------------------------------------ERKL--AD.......A-VFED.....--.............
Q7XPT9_ORYSJ/274-639---------------------------------------ERIL--CD.......Q-VFEG.....--.............
U1GTL6_ENDPU/245-629---------------------------------------EADN--VS.......K-IFP......--.............
H2AMI9_KAZAF/241-641---------------------------------------EKSL--ID.......D-IYSQ.....--.............
A9SHU0_PHYPA/294-653---------------------------------------EKQL--CE.......Q-VLGKV....--.............
M0X2R1_HORVD/229-589---------------------------------------ERRL--SS.......L-VFGDL....--.............
B9SQM4_RICCO/281-628---------------------------------------EYEL--CN.......K-VFDKV....--.............
C5YI28_SORBI/233-588---------------------------------------ERRL--CD.......E-VFAS.....--.............
G2Q2Y8_MYCTT/252-644---------------------------------------EYEN--IC.......N-IFT......--.............
B9GMP7_POPTR/287-658---------------------------------------ERKL--CS.......S-IFSE.....--.............
D8QQ88_SELML/278-638---------------------------------------ERKT--CD.......Q-VFYR.....--.............
I1IU36_BRADI/316-680---------------------------------------EHDL--CL.......R-VFS......--.............
Q7XVB9_ORYSJ/303-673---------------------------------------ERRI--CD.......Q-VLAV.....--.............
M0T4W9_MUSAM/300-646---------------------------------------ERDL--CE.......A-VFAG.....--.............
C5Y540_SORBI/271-624---------------------------------------ERKI--CD.......Q-IFDG.....--.............
Q6YYS2_ORYSJ/156-522---------------------------------------LLEL--PLPVAGSTER-MAA......--.............
S3C6C9_OPHP1/275-678---------------------------------------EYEN--IC.......S-IFT......--.............
Q0DD48_ORYSJ/61-408---------------------------------------ERQA--CT.......Q-IFGS.....--.............
D8T120_SELML/259-622---------------------------------------EWKL--CN.......Q-VFDG.....--.............
L0PB59_PNEJ8/240-610---------------------------------------ESTI--AQ.......N-IFP......--.............
G0V7P9_NAUCC/234-618---------------------------------------EKSL--VD.......D-LYSQ.....--.............
S8BBP5_DACHA/239-612---------------------------------------EYEN--IK.......S-LFS......--.............
N1PXJ6_DOTSN/246-630---------------------------------------EYDS--TC.......P-VFQ......--.............
F6I1N2_VITVI/270-640---------------------------------------ERRF--AE.......S-VFED.....--.............
M0UL49_HORVD/11-372---------------------------------------ERQL--CD.......Q-VFEC.....--.............
F0ZNQ9_DICPU/422-793---------------------------------------ESDL--AS.......E-FF.......--.............
D7L7W1_ARALL/228-598---------------------------------------EKSL--CD.......D-IFES.....--.............
M0SVR7_MUSAM/268-627---------------------------------------EFKV--CI.......E-VFERA....--.............
M1C5W1_SOLTU/259-619---------------------------------------ERFL--CD.......H-VFST.....--.............
C5XFH3_SORBI/239-578---------------------------------------RRQL--YAQNPGAFDG-.........--.............
K7LHG0_SOYBN/296-660---------------------------------------ERIL--CD.......H-VFGA.....--.............
M0UGE8_HORVD/125-479---------------------------------------ERNS--CA.......Q-IFGC.....--.............
B9T911_RICCO/241-598---------------------------------------ERIL--CD.......H-VFSA.....--.............
A5DE46_PICGU/208-600---------------------------------------EIAL--AA.......E-INQN.....--.............
A2DS47_TRIVA/252-593---------------------------------------EKEF--AK.......K-VFG......--.............
C5Z4E3_SORBI/185-593---------------------------------------QQEI--RAKGPTVAVG-GGVRKAIEH--IML..........
U5CSC4_AMBTC/276-637---------------------------------------ERKV--CD.......Q-IFEG.....--.............
M0T8R9_MUSAM/272-640---------------------------------------ERRL--CD.......Q-ILAA.....--.............
M0T1U3_MUSAM/274-635---------------------------------------EREL--CN.......Q-IFEG.....--.............
Q5N6V1_ORYSJ/25-367---------------------------------------QRQL--QAQSCGAFDR-.........--.............
G8BXH6_TETPH/237-621---------------------------------------EQSL--ID.......D-LYGQ.....--.............
E9D819_COCPS/246-624---------------------------------------EYES--VV.......S-IFP......--.............
Q9LMJ4_ARATH/247-592---------------------------------------ERLL--CD.......R-VFSDL....--.............
D7L7W0_ARALL/233-602---------------------------------------EKIL--CD.......H-VFES.....--.............
E70B1_ARATH/265-614---------------------------------------ERRL--CD.......R-VFFG.....--.............
E3Q9K9_COLGM/252-632---------------------------------------EYDN--IC.......S-IFT......--.............
F6GSY9_VITVI/271-629---------------------------------------EKRL--CD.......H-ILGD.....--.............
G1MYP9_MELGA/336-701---------------------------------------EYQL--LT.......E-IVP......--.............
D7M573_ARALL/269-636---------------------------------------ELSL--CN.......A-VFPDQ....--.............
E1Z8T0_CHLVA/286-659---------------------------------------EARL--CA.......A-VFP......--.............
B9GF67_POPTR/330-700---------------------------------------ELKL--AE.......A-IFSN.....--.............
G4MVD0_MAGO7/250-629---------------------------------------EYEN--IT.......R-IFS......--.............
G9MGQ5_HYPVG/255-640---------------------------------------EYDN--IC.......S-IFT......--.............
W1PMJ7_AMBTC/280-638---------------------------------------EQRL--CE.......E-VFGK.....--.............
U5FZC2_POPTR/63-424---------------------------------------EKAL--CD.......H-VFSA.....--.............
W5BVL2_WHEAT/184-551---------------------------------------ERAL--CD.......Q-IFEG.....--.............
EXO70_SCHPO/249-608---------------------------------------VASE--LL.......L-LFD......--.............
B9R6Z3_RICCO/301-666---------------------------------------EKKL--SN.......Q-ILGGI....--.............
B9SF67_RICCO/265-616---------------------------------------ERRL--CD.......R-VFFG.....--.............
K4C312_SOLLC/207-568---------------------------------------ERIL--CN.......Y-VFSS.....--.............
A9T7C4_PHYPA/238-605---------------------------------------EKHL--CE.......S-VFANA....--.............
K7LIX4_SOYBN/109-470---------------------------------------ERKV--CD.......Q-IFEG.....--.............
M7ZQD7_TRIUA/1206-1561---------------------------------------ERRI--CN.......Q-IFAA.....--.............

PF08700

Q5KJF4_CRYNJ/98-180-------------------------------------------------------------------.RLP.....V...
EXO84_ASHGO/127-213-------------------------------------------------------------------GDAT.....A...
COG5_MOUSE/37-120-------------------------------------------------------------------HQAV.........
EXO84_CRYNJ/142-228-------------------------------------------------------------------TGAD.....E...
Q6BJZ0_DEBHA/76-158-------------------------------------------------------------------.HLT.....I...
Q0U0Z3_PHANO/76-170-------------------------------------------------------------------AREG.....L...
Q0WQ75_ARATH/43-129-------------------------------------------------------------------KKSN.....L...
Q173I8_AEDAE/5-87-------------------------------------------------------------------.QNS.....I...
A2D783_TRIVA/6-88-------------------------------------------------------------------.KYD.....V...
Q7Q6Z6_ANOGA/11-97-------------------------------------------------------------------KECS.....L...
Q2UQ54_ASPOR/108-197-------------------------------------------------------------------ATSS.....L...
VPS51_YEAST/84-163-------------------------------------------------------------------.NLP.....F...
A2E266_TRIVA/29-115-------------------------------------------------------------------NNQS.....L...
Q2U987_ASPOR/1-88-------------------------------------------------------------------FQYP.....I...
Q6FRQ2_CANGA/66-146-------------------------------------------------------------------.EQT.....L...
Q6CSC3_KLULA/100-179-------------------------------------------------------------------.KKS.....L...
A0A016Q0X2_GIBZA/128-214-------------------------------------------------------------------SDAT.....E...
Q75HJ9_ORYSJ/40-126-------------------------------------------------------------------HAMN.....E...
EXOC8_MOUSE/13-100-------------------------------------------------------------------SQQS.....DG..
A0A0D1E7D8_USTMA/79-161-------------------------------------------------------------------.SLT.....V...
Q8I2A9_PLAF7/116-202-------------------------------------------------------------------EKSS.....M...
Q6CG64_YARLI/77-166-------------------------------------------------------------------SSRGSGSRVL...
Q4E335_TRYCC/3-85-------------------------------------------------------------------.NNT.....V...
EXO84_YARLI/121-207-------------------------------------------------------------------ATSN.....A...
Q4MZL9_THEPA/63-149-------------------------------------------------------------------RNNS.....I...
COG1_SCHPO/7-89-------------------------------------------------------------------.THS.....I...
Q59L27_CANAL/17-99-------------------------------------------------------------------.KLD.....I...
Q2UHE7_ASPOR/121-207-------------------------------------------------------------------ANAT.....E...
Q7RZT4_NEUCR/9-91-------------------------------------------------------------------.NYP.....L...
E9AC89_LEIMA/3-81-------------------------------------------------------------------.QND.....V...
A2GBI6_TRIVA/24-110-------------------------------------------------------------------KNES.....I...
Q4Y221_PLACH/14-100-------------------------------------------------------------------EKST.....L...
VPS51_DICDI/178-264-------------------------------------------------------------------KSST.....L...
VPS51_SCHPO/52-138-------------------------------------------------------------------EKAT.....P...
Q9FFF3_ARATH/21-103-------------------------------------------------------------------.TKP.....M...
A0A0D1CLQ0_USTMA/184-270-------------------------------------------------------------------SHHS.....E...
COG1_DICDI/113-195-------------------------------------------------------------------.RNT.....P...
A2FRD0_TRIVA/32-118-------------------------------------------------------------------KTLS.....I...
A0C9R8_PARTE/6-92-------------------------------------------------------------------KNHS.....V...
EXO84_CANGA/190-276-------------------------------------------------------------------SEAS.....A...
Q754G8_ASHGO/53-137-------------------------------------------------------------------AEST.....L...
VPS51_CHICK/57-143-------------------------------------------------------------------SECR.....L...
Q95Q35_CAEEL/9-99-------------------------------------------------------------------KGVK.....IGDE
Q6C0N6_YARLI/24-102-------------------------------------------------------------------.KYS.....I...
Q4DYG1_TRYCC/45-131-------------------------------------------------------------------RRES.....L...
Q5ZAZ1_ORYSJ/7-89-------------------------------------------------------------------.TRR.....I...
B4QW21_DROSI/4-89-------------------------------------------------------------------TREC.....VG..
Q5KKF4_CRYNJ/54-139-------------------------------------------------------------------AKST.....L...
Q7S488_NEUCR/124-217-------------------------------------------------------------------QSST.....L...
Q84K25_ARATH/20-102-------------------------------------------------------------------S.FT.....L...

PF06148

Q0TYI9_PHANO/26-159-------------------------------------------------------------------NRHQ---------
Q29BE0_DROPS/22-154-------------------------------------------------------------------RNAP---------
Q7QFV1_ANOGA/25-157-------------------------------------------------------------------RNAG---------
Q84LH7_ORYSJ/24-156-------------------------------------------------------------------RSYV---------
Q01CT5_OSTTA/52-184-------------------------------------------------------------------SSFV---------
Q5K8I4_CRYNJ/34-165-------------------------------------------------------------------RIHI---------
A1C4Y0_ASPCL/32-165-------------------------------------------------------------------NRHQ---------
Q2UA29_ASPOR/27-160-------------------------------------------------------------------NRHQ---------
COG2_HUMAN/15-147-------------------------------------------------------------------RKRV---------
Q0C728_AEDAE/17-149-------------------------------------------------------------------RKAG---------
A8WN13_CAEBR/23-155-------------------------------------------------------------------RQKA---------
Q383M1_TRYB2/46-232-------------------------------------------------------------------SHGV---------
Q4DNE3_TRYCC/72-246-------------------------------------------------------------------DHGV---------
Q4Q0F6_LEIMA/80-262-------------------------------------------------------------------QHGV---------
A0CKT7_PARTE/12-141-------------------------------------------------------------------INYK---------
COG2_DICDI/53-185-------------------------------------------------------------------RKRV---------
F4JRR1_ARATH/31-163-------------------------------------------------------------------RTFV---------

PF10392

Q5KKM0_CRYNJ/10-154------------------------------------------------------------DQSQQNNNKED-----NDKA
COG5_HUMAN/66-189------------------------------------------------------------...........-----....
Q6BT79_DEBHA/15-147------------------------------------------------------------.......ATND-----KNGS
Q5B379_EMENI/829-961------------------------------------------------------------.......ATNN-----ATDT
Q5APN5_CANAL/17-149------------------------------------------------------------.......ATNG-----QENP
COG5_SCHPO/8-139------------------------------------------------------------.......SVHA-----DSDV
COG5_YEAST/14-146------------------------------------------------------------.......ATNN-----NDTT
Q9C9V9_ARATH/57-180------------------------------------------------------------...........-----....
Q0U7T7_PHANO/13-145------------------------------------------------------------.......STNN-----PSDT
Q2HI55_CHAGB/25-157------------------------------------------------------------.......ATNN-----AADT
Q6CLE2_KLULA/11-144------------------------------------------------------------......VTNNG-----TDTD
COG5_DICDI/63-186------------------------------------------------------------...........-----....
Q6C2T6_YARLI/5-136------------------------------------------------------------.......QTSS-----SRDE
Q75B18_ASHGO/11-144------------------------------------------------------------......AINNK-----FDTT
Q6FTM6_CANGA/9-140------------------------------------------------------------........AMN-----TTSN
Q65XH1_ORYSJ/52-175------------------------------------------------------------...........-----....

PF04124

COG8_MOUSE/56-394------------------------------------------------------------IRGAECTERIHRLFGDVEAS
COG8_SCHPO/15-354------------------------------------------------------------VDYARNQDAFYQLLENSRHD
COG8_YEAST/28-381------------------------------------------------------------LDNTSQIIGNILENDD.RAQ
COG8_CAEEL/10-353------------------------------------------------------------ADAGRATHDCSKTFGEMRDK
Q9LYH5_ARATH/29-412------------------------------------------------------------ITAADALLAIRQEVSSIDKH
COG8_DROME/37-379------------------------------------------------------------ITTAENSRSIFSEFLRSEQQ
Q9P3N9_NEUCS/31-347------------------------------------------------------------IESATHHSTLRTSLPALAAS

PF15469

Q5KNA8_CRYNJ/115-308....KE...EFLA.DESD.......................HGIRELRE---IF-----.KV...AAHRADQVFLPVLEN
A7TRG2_VANPO/143-342....ASSSSTSNSNKNNDFN...................NRINIEHLSE---KI-----.DD...QVKFTNLKLKPLLDR
G8BMU6_TETPH/145-338....SS...QDRSNSRNS.......................IDIEALNG---KL-----.DD...AVKATNQRLKPLYES
C5DYM3_ZYGRC/146-354....SMRYTPSLAPGSIDAN..................GGQLDVNELGD---KV-----.DD...AIRATTLKLKPLLET
G8ZXE8_TORDC/144-345....SE...KSNTGALNDDD...................NQLDVDRLSS---KV-----.DE...SITATTLKLKPMLKT
H2AR86_KAZAF/151-365....SE...SNN.............................SNLAQLSE---KV-----.DE...SIRATTLTLKPLLDT
G0VBU0_NAUCC/150-340....GEMKGNES.............................LDVDRLNE---KV-----.DE...SIRITNLKLKPLIDT
G0WGP4_NAUDC/153-350....ST...TTTQTNDNEDYT................EDPVLNIDQLHE---KV-----.DE...SIRSINLKLKPLIDT
Q6FVL5_CANGA/149-372....SE...GGEQENQNI.......................MKVEKLKE---EL-----.DE...TIRFTTQKLNPVINY
E7QCY0_YEASZ/146-360....DE...KTNEKNQCDSPK.................ENQINVESLNK---KV-----.DE...VIRTTTFKLKPLMDN
C5DMT2_LACTC/144-330....NK...FSLG.ESRD.......................FGTDDLGE---TV-----.DE...SIREITIKVKPILDI
G8JTD1_ERECY/120-302....NK...RMNG.SDNF.......................LGIYHLDE---SL-----.NN...MVRATTMKLLPLVDQ
Q750U7_ASHGO/122-304....NK...RMSG.NENF.......................LGIDHLDE---SV-----.NN...MVRGTTMKVIPLVDQ
Q6CQH1_KLULA/148-350....DTLMNSADAETYDED.....................ELSVQRLNE---NL-----.NE...TMKQTSLKLQPLLSN
C4R5S5_PICPG/139-344....DN...MKLI.GKGDANG.................GKEAAVDYLKN---LI-----.EE...TMARSNELLKPVLEE
Q6CGI4_YARLI/146-334....KS...SGFT.QENE.......................WGMGELTQ---SL-----.DE...GNSKAAILMNPVFNT
W1QF47_OGAPD/153-339....SM...SNLS.A...........................NITALSE---SI-----.AK...ANTSSTMMLNPVFDG
C4YAI9_CLAL4/138-372....RN...SKSQ.AQQDREKSKVFNP....RSRSSLSDGSGLLSELEK---SI-----.NN...LNLSSTLMIRPIMDH
G8Y2A4_PICSO/149-393....KE...QKTH.SQKVMERSTVFNP....QRHKKKAHDESLVSSLEE---SV-----.NN...VNMATSLVIRPIMDH
C5MH42_CANTT/104-348....MR...SKTK.AQQDRSNSRVFNPQRRNMVSTNSNGKEDLTSELEE---NI-----.SN...LMNSTSASIQPINES
G3AUN6_SPAPN/128-368....KQ...QKSK.AQADKESSKVFNP.....TKQRLDVQQDLCSELDS---AI-----.NN...MNTTTSLMIRPISEL
G8BGG9_CANPC/145-407....SQ...SKTK.SQEDKETSKYFNPQRHRLNVSDNNGNGDISSELES---SL-----.NN...MATTTTLMIKPIVEN
B6K5G3_SCHJY/147-340....VN...HLESSNDQN.......................TPWKKIDT---DL-----.DK...VLSTFQSSS..LISS
C4M2W7_ENTHI/111-299....NS...AKAE.AVKN.......................GVYLNVVI---KM-----.QEKYNELLNSLSSIKQLTDL
D6W674_TRICA/193-371....EG...DVAK.FGTE.......................PT.LKLEK---SI-----.KE...SEREGRKLFDDVLAR
B0W3D0_CULQU/193-383....SQ...DTKL.YGKD.......................QV.KDLEV---AI-----.QK...SIDASHELFKDVLSR
B3MVG4_DROAN/193-383....QE...DVKL.HGNE.......................PL.NILEA---SI-----.EN...SITESQKIFTDVLVR
G6D800_DANPL/194-372....ED...DQRK.NGKE.......................PL.PSLQS---AI-----.EE...SITLADSLFSEILTR
E2AW35_CAMFO/194-372....EA...DMKS.YGSD.......................PT.EKLEK---AI-----.RQ...SMSEANKLFDDVLAR
E0VQL4_PEDHC/200-377....EG...DLK...GKD.......................EFGEELEI---KI-----.QI...SKEEACRLFQEVLTK
E9G6B5_DAPPU/193-371....EE...NKTK.YGPD.......................MT.ASLEN---SI-----.LS...AKTEAGRLFDDVLKR
B7PR09_IXOSC/148-326....EK...DKQE.MGSD.......................LT.EKLSE---AV-----.LR...SKEEAENIFESILAR
A8WPA7_CAEBR/200-378....EK...GQNA.DHFA.......................AL.GNISK---LI-----.KD...SKLKAESVFADVLKR
H3ERJ1_PRIPA/197-373....EE...HKGEM...........................AVTKIIGD---KV-----.SQ...AREKAESVFKDVLAR
A0A0I9R3C5_BRUMA/212-385....QL...ERNV.C..G......................WPLTKNISE---KL-----.TE...SHTAANAVFYDVLTR
C3XUC7_BRAFL/191-370....LK...DEST.SEGG.......................SITEKLET---LL-----.NN...ANDKANAMYQDVLGR
F6YQX0_XENTR/198-380....EA...DGTE.KVEG.......................SMTQVLEK---VL-----KTR...SKNVHFLLFSLVFGK
F7GSZ8_CALJA/50-227....EA...DGTE.KVEG.......................SMTQKLEN---VL-----.NR...ASNTADTLFQEVLGR
E4XNP2_OIKDI/201-392.GQSSG...MQNA.QQVK......................PDMTDNLLG---LL-----.KK...AESRSYNLFEDVLTQ
F6Q8U3_CIOIN/201-380....QR...DEGG.RKNG.......................NLTDKLES---TL-----.NE...ASENANKLFDTVLSC
G4VNQ3_SCHMA/214-394....DN...EKKS.IETN......................DSNDLRLES---IL-----.YD...TRTLGHRLFEDILKR
H2KP67_CLOSI/214-393....LY...EKIS.SSGR.......................QFELPFEA---SL-----.SE...SRNLGYELFEGVLKR
F2UAY3_SALR5/207-386....KF...HKRT.LNSA.......................SITSKLAE---SI-----.SK...LEETTHATYDAILER
A9RNH0_PHYPA/252-430.........EQIECAKEG.......................TGTEHLHN---AI-----.AE...VVVVAKRAFAPLLEL
A9S1F4_PHYPA/259-437.........QQIESPKEG.......................TGTVHLNN---AI-----.GE...VDVFAKRAFAPLLER
D8RD25_SELML/239-417.........QQIESDAEG.......................AGTAHLTH---AI-----.QD...LDEVAKRAFGPLLER
D7KJZ0_ARALL/260-438.........KRIEDDPDG.......................SGTTHLFN---CM-----.KS...VTSRANRAFEPLFER
Q7XMG2_ORYSJ/263-453....RQ...IEED..PEG.......................AGTAHLYS---VT-----.QK...ISGVANRAFEPLFER
F0ZXN2_DICPU/132-311.........SKSK.ILED............................MSS---SF-----.TK...IINKSSDVYHPLLMN
F4PGL2_DICFS/126-305.........TSSK.MLDD............................MSG---SF-----.KK...IIDKSEVVYDPLLQG
A8PCF2_COPC7/122-323....KD...GILA.PSTE.......................YASKPLKD---QL-----.KQ...AAQKANQVFLPVLEN
D8QDB4_SCHCM/114-323....KE...GLLA.PASD.......................YASKPLRD---QL-----.KE...AAIKADQVFLPVLEN
B8P2C9_POSPM/114-312....QE...GLLA.GQTE.......................FASRPLKD---HL-----.KL...SAQKADQVFLPVLEN
G4TT08_PIRID/115-310....KD...GLLA.EDSE.......................FATKKLKE---HL-----.KN...ATTKADTVFLPVLEN
A8PUN7_MALGO/110-314....SESMGGPFG.SAPD.......................EGVEGLRT---SV-----.TS...ANSQADDVFRPVLEN
E6ZLD0_SPORE/109-315....RDTESGPLQ.PQAD.......................YGVASLNT---IL-----.AN...ASAKADQVFMPVLEN
E3K655_PUCGT/121-321....KA...GPLR.SECD.......................YGTADLKE---SL-----.RL...CTSKADQVYTPLLEN
F4RSS6_MELLP/56-255....KN...GPLR.PEED.......................YSIGPLRE---SL-----.KS...ATSKAEQVYTPILEN
F4PCT9_BATDJ/225-428....CQ...KNLV.SSSN.......................YGIAPFAK---AL-----.EE...LESNANNLYGPVLGR
D5GNN2_TUBMM/147-347DKDR...........ESE.......................WGVGKIRG---YL-----.ND...AGAKADEVFGPAMRG
G1XK06_ARTOA/190-398GEEEAT...FRLI.KEEE.......................WGLKTIRT---PL-----.NA...AQAQAETLFGPVMEN

PF16528

C5DUD9_ZYGRC/539-743-----------------------------------------...S..SQ.V.D.-----.R...EDIILHSFFVLKSERS
G0VJV4_NAUCC/543-749-----------------------------------------...F..DK.I.N.-----.D...EDLMLHKLISLKVDQR
A7TL52_VANPO/508-712-----------------------------------------...S..DK.V.Y.-----.D...ENEILHSLISLKINQR
G8ZS82_TORDC/494-698-----------------------------------------...A..DQ.G.E.-----.D...DDMMLHGLITLKINQR
G8BNG7_TETPH/532-736-----------------------------------------...P..NE.I.D.-----.R...DEELLHRLLFVRIAQR
G0W548_NAUDC/557-766-----------------------------------------...V..DN.MNN.-----.D...EEMMLYNVLILKIQQR
EXO84_CANGA/545-749-----------------------------------------...K..DP.T.K.-----.E...EDAIILNVLTLKLDQR
H2AXV4_KAZAF/523-731-----------------------------------------FAAN..QS.I.S.-----.K...NESMFYNLILLNLNQK
G8JS46_ERECY/478-682-----------------------------------------...V..AG...T.-----.E...EEVMLLDLLKMKCNQN
EXO84_KLULA/500-705-----------------------------------------...Y..SS.A.T.-----.F...DESVMVELLSLKCSQR
G0S6E5_CHATD/457-657-----------------------------------------...A..QG.L.K.-----.H....NVIAQDFISFKVDER
E3S512_PYRTT/452-652-----------------------------------------...A..KN.I.R.-----.S...NEM.AKAIVTYKVNER
EXO84_YARLI/444-642-----------------------------------------...K..ES...T.-----.D......ITQQVLDIKLHQR
D5GAW7_TUBMM/436-637-----------------------------------------...G..RA.L.T.-----.S...NNALVAELINFKVDER
C4R6S9_PICPG/506-717-----------------------------------------...L..PT.I.NL-----NDKLSEGTVLFDLLKVKLTMR
Q2H152_CHAGB/456-656-----------------------------------------...A..YG.L.K.-----.N....NVIAQDFISFKVDER
C9S7T2_VERA1/440-640-----------------------------------------...A..RG.L.K.-----.S...N.AVAQDFINFKVEER
B2B2W1_PODAN/463-663-----------------------------------------......LG.L.R.-----.K....NAIAHDFITFKVEER
H2Z9L4_CIOSA/281-487-----------------------------------------...R..EC.P.A.-----.KA.VVEEQLYNRTTQLVDVL
H2MTA2_ORYLA/303-507-----------------------------------------...P..ST.Q.K.-----.V...KE..LRSKVDERVRQL
G3JE74_CORMM/450-655-----------------------------------------...S..RG.L.K.-----.S...N.AVAQDFISFKVDER
G0SXF2_RHOG2/870-1071-----------------------------------------...S..GD.A.H.-----.A...SQLFRSKLDS.RTSEL
EXO84_CRYNJ/449-651-----------------------------------------...S..KS.I.E.-----.S...NSS.AHSLLVSRLEQL
C5FKA5_ARTOC/433-633-----------------------------------------...A..KG.L.K.-----.G...NQT.AQDAINSGVDSR
F4P2Q9_BATDJ/415-626-----------------------------------------...NTTRKIL.SG-----VD...IKTPRVQMLRASVENR
G0R9T9_HYPJQ/449-649-----------------------------------------...A..RG.L.K.-----.G...N.TVAQDFINFEVEER
C7Z4G1_NECH7/445-645-----------------------------------------...A..RG.L.K.-----.N...N.AIAQDFINFKVGER
I1G637_AMPQE/287-497-----------------------------------------...S..DQ.L.VL-----RN...TRARVNHRINLLGEVL
E7LRJ5_YEASV/465-668-----------------------------------------...S..ER.I.S.-----.D...EELMLLNLISLKIEQR
EXO84_ASPFU/445-645-----------------------------------------...A..RG.L.K.-----.G...N.SYAQQIINSKVDER
W4YYJ2_STRPU/291-496-----------------------------------------...P..VG.P.S.-----.L...KEMR..ARVDHRVKQL

PF06248

ZW10_DROPS/10-571GREINDLLET.VGTEGLAALNGSSTQLADHSRELRELMLGLQVSEHILKIDELF.....QCVEEAKGTKDYLVVLDLVGR
ZW10_ARATH/1-584SDDVSDVLQLVSDRPIDVEIRSVVDEITEKTKEVKLKRESLDLVNAIVGICEAL.....QETKEALKNGRFRFAAERIRE
A7SSG2_NEMVE/20-670LKEI.DATTKKVKGSILPDLDAAAEEHANLVQQLKETDMVRVILIRLGKIHLGL.....ETLPGTLKSKAFCKAAKLLED
A8XRG3_CAEBR/1-605LEDTAEMSSRELSNLIEQTEKDSPEMLAEIKTQARSCENLVEFLQSMKKVEEQLIIMRSKTTNRIEWGNAILACKDYLNE
ZW10_HUMAN/9-621SEDI.DLLKSRIESEVRRDLHVSTGEFTDLKQQLERDSVVLSLLKQLQEFSTAI.....EEYNCALTEKKYVTGAQRLEE
F1QYH5_DANRE/9-611SKDI.DLLKSCIENEVQQNLHDAVTEYAKLKQQLEKNTAVIDLLQHLQEFDTAI.....EEYHRALQEKNYVVAAKQHGT
F7EQH5_XENTR/9-617ASDV.DVLKSRIETEVKSDLKVAVNEFTELKQQLEKNTVILGVLEQLQEVVSWV.....EKRH.TSITIVFLVTSAFLPQ
H3CQC8_TETNG/9-607SKEM.EALKNCIKNEVQQNIQGAVTEYAKLKQQLEKNTVIIEVLGHLKEYKNAM.....EEFDKALPNKDYVEAANMLER

PF04100

VPS53_HUMAN/39-453IRLKIR------------------------------------------------------------------RLDDNIRT
Q9VQY8_DROME/42-434MQCEVS------------------------------------------------------------------LIDDNIRS
VPS53_SCHPO/16-394LQESVK------------------------------------------------------------------KLDANKKT
VPS53_YEAST/5-369LQEDIL------------------------------------------------------------------KEENELKE
VPS53_CAEEL/30-390VEGEIG------------------------------------------------------------------ELDNELAY
VP53A_ARATH/1-424IQGEIR------------------------------------------------------------------RVDASILS

PF10475

Q7QF78_ANOGA/99-388LRRQHR------------------------------------------------------------------VISKKVLQ
Q336V4_ORYSJ/131-419RLAQLD------------------------------------------------------------------KIAERLSH
Q54MU4_DICDI/72-370FTRAMD------------------------------------------------------------------YVNSKLYN
VPS50_CHICK/54-327LKQQQ.------------------------------------------------------------------........
Q16RR9_AEDAE/70-360LKQQHK------------------------------------------------------------------VISKKVLQ
A1ZAY8_DROME/75-362LRTQQK------------------------------------------------------------------VLTKQVLQ
Q54NV0_DICDI/113-401ISGYHE------------------------------------------------------------------AVDSRFND
Q8RXC2_ARATH/132-421RLVQLD------------------------------------------------------------------KVAETLSH
Q18602_CAEEL/76-363LKSQHT------------------------------------------------------------------VVSKKIST
A8XSD2_CAEBR/80-367LKSQHT------------------------------------------------------------------VVSKKIST

PF04048

SEC8_SCHPO/51-191FLNVYD------------------------------------------------------------------RISAALQT
Q69PQ1_ORYSJ/22-158LKEQSD------------------------------------------------------------------LIEDVVDE
Q59NP0_CANAL/27-168FNMLKE------------------------------------------------------------------SSEQALRS
A5E514_LODEL/26-167FSGFKR------------------------------------------------------------------RTEGVLRH
Q6BLA3_DEBHA/30-171FQDLSK------------------------------------------------------------------QTKTALRH
A5DKL1_PICGU/29-170FHDISK------------------------------------------------------------------QTQQALRN
A3LUX9_PICST/29-170FQHIMK------------------------------------------------------------------GTETALRH
Q75B87_ASHGO/33-174FHQLKS------------------------------------------------------------------QIANNLQE
Q6CNM5_KLULA/34-175FIELKS------------------------------------------------------------------RFAKDLQE
A7TRV6_VANPO/35-176FNQLKK------------------------------------------------------------------QIGSDLQA
Q6FWA6_CANGA/35-176FNQLKE------------------------------------------------------------------QIGSHLQE
Q6C3L8_YARLI/34-175YEKLTS------------------------------------------------------------------DISNVLKD
Q4WUD2_ASPFU/134-275FLNMNQ------------------------------------------------------------------QIQKTLKS
SEC8_NEUCR/82-223FQQTHQ------------------------------------------------------------------FLQESLKN
A0A0D1E3Z5_USTMA/441-580FDQVKQ------------------------------------------------------------------MIETALQG
E7M1P6_YEASV/34-174FNQLKS------------------------------------------------------------------QIGSHLQD
SEC8_ARATH/16-151LKEQSD------------------------------------------------------------------VVEEVVDE

PF06046

Q28ZN5_DROPS/179-731QKVTGFLPP..................................................GRPKAWRKMILD.VLQSSVAT
Q5K9B3_CRYNJ/179-740RLVRKV.TT...TDAASKFKSMQ.................................ANARVIKNYRHKFLD.VMKSTVQR
EX3L4_HUMAN/179-709GDFL.......................................................RTPRRWRQHWEE.AVRRSAQE
A5DIA8_PICGU/180-832NKLDLLKARDMRIINYGNFR.......................................GSKRNYRKFFYD.KLQESLDE
Q0TXU6_PHANO/187-762QDAQRE.YK....DLASRFRSIN.................................SGPKELRGYKDKFIK.SIEYVCQA
EX3L1_BOVIN/188-722............................................................APRDWRQRCLR.ALQQGLER
SEC6_SCHPO/181-743RDAKSSLPD....SQDGPFLSLQ.................................GMTRQLRNFRLRVLE.EFQGAAAE
TNAP2_MOUSE/157-688GPLAAALEA..................................................TRPRRWLQRWRG.VVAEVAAE
A5DY39_LODEL/293-930RNLGILTHNI.IQ.DYKNFR.......................................SNERHYKKFFME.KFKVYFQG
A0A0D1DY75_USTMA/258-828RLAKRA.NL....EGAARFRSVV.................................ANARVIKLYRPKFVE.AIDRSTAE
A4RYX1_OSTLU/92-690ALTFEP.ELDAATNKVINVA......................................PPEPKRWKTKVLE.QMSIAVEA
Q6DJR6_XENTR/177-732KKQTGFIPP..................................................GRPKKWKDKMFD.VLDKTIIT
A3LNE6_PICST/180-819QSLGLNQSRDVKTIDYASFR.......................................GRRRNYRKFFYD.KLEENLSE
Q8SU74_ENCCU/160-687QEGEKS.DNPVLKEFYRMYRMY...................................ATRKTKKLKDKVIK.SIEVSVKG
Q16I77_AEDAE/179-730QKQTGFIPP..................................................GRPKEWRKKALQ.VLNEAVVQ
Q5RG40_DANRE/161-694SENQRP....................................................IWRPTECRQKIHDPLLKTLVET
Q6CU40_KLULA/178-794RNIIKA.KELESESKKSKKVSDKMSAFDTNNKKYTEY....PTALGIATEINKGTIQTRTLPRGYKTFFLS.TIHKGIQE
Q5BBU2_EMENI/183-758QEAQKD.HQ....DLAGRFKSMN.................................VGPKTVRGYKEKFIQ.AIEFYAQN
Q6FPK2_CANGA/177-798RNIIKK.KEIEAEKSTFKKLPSSKNIGRLELESNSKALE.YPTDQGLYQEIINGTITTRVQSRGYKNLLYN.KIKQSIQE
A7F9Q6_SCLS1/177-755QEALKD.HK....EMAARFKSIT.................................DGAKSTRGYKEKFLM.AIKLKAEG
Q6C9T6_YARLI/183-804LEVNGK.AKQQNGGTGGGFRSPHMNGNSNNKN..............NSMSVTLGNNVAPRSPRGYPTLFLR.AMEKSIKD
EX3L1_MOUSE/189-722............................................................APRDWRQRCLR.ALQEGLER
EX3L1_DANRE/206-763RRSTSGHNIPMPA..............................................GRPRNWRDRFFK.VMEEAVSA
EXOC3_DICDI/183-774KSQNSLISSEGIHDDDDDDDDTEVNLNNSNKQQNNENEN.SSSNNNNNYDINNEDEGYDRNRSNYGDRFLE.VLIQSISG
TNAP2_HUMAN/122-651GPGTSGLAA..................................................TRPRRWLQLWRR.GVAEAAEE
Q6BJB6_DEBHA/180-833SNLKLMENRSISSIDYANFR.......................................GAKRNYKKFFYK.KLEESLVD
EX3L4_MOUSE/181-708GDFL.......................................................STPRHWRMHWED.AVRLSAQE
Q5A7K3_CANAL/180-812KSLDMV.SADPKTVNYKTFR.......................................GRSRNYKKFFFD.KLRTHLYE
A6RAW7_AJECN/390-965QEAQKD.HK....ALASRFKSMN.................................LGPKTVRGYKENFLK.SIELYAQT
E7KDN6_YEASA/178-797RNIIKK.KEIEIEK.SS.IKKLPNSKNTARLQDETPKVIEYPTNKGLYQEIMSGTISTRTAPRGYKHFLIN.GINNSISE
H3DL97_TETNG/187-739RKQTGFIPP..................................................GRPKRWKDKMFD.VLEATVST
EXOC3_HUMAN/188-743KKQTGFVPP..................................................GRPKNWKEKMFT.ILERTVTT
Q1K527_NEUCR/175-753QEALKD.HK....EMATRFQSIT.................................DGAKTVRGYKDKFLK.AIKTFAED
SEC6_ARATH/173-736AAEAEG.EGA..MASVANPRRPGKKSTTTSA.................SSKGLAQQKLKVQGKGYKDKCYE.QIRKAVED

PF04091

W5E5N0_WHEAT/442-753LYEVVK---------------------------------------------------------AYLDRLLIEVLNDCLLN
A9S7S7_PHYPA/446-757YYDLVK---------------------------------------------------------RYLDKLLVTVLNEALLR
H2WCC2_CAEJA/477-783VDDTVR---------------------------------------------------------RCANVLLGR.WAGILKS
T1EMI3_HELRO/450-756IDDTIR---------------------------------------------------------KFANTLLTRTLGGCLAI
A9V537_MONBE/417-723VDELLR---------------------------------------------------------QSTNHLFSKVLSSILMK
Q6BHQ3_DEBHA/494-826INNFI.---------------------------------------------------------..VNDIFEKVLGNEKGV
E9G3C4_DAPPU/410-716IDDTLR---------------------------------------------------------RYTNLLLTRTLSGCLST
B9GSB7_POPTR/457-761FFDVVK---------------------------------------------------------KYLDRFLSEVLDEALLK
M7NJC8_PNEMU/439-739IDDILK---------------------------------------------------------QILDELLVGHVKKKLIE
U1HWP6_ENDPU/444-743VDEALR---------------------------------------------------------VALDDLLCEEVCGSLVQ
G0VF38_NAUCC/501-841LNRLLV---------------------------------------------------------NAIDKIFIDIVNKKIRA
K5VZV5_AGABU/444-743IDELLG---------------------------------------------------------KSLDNLFIKGIGETIVQ
R9AG66_WALI9/449-747TNSLIV---------------------------------------------------------DGLDSVMRDGVVKALSV
D6X4X0_TRICA/433-740VDEMIR---------------------------------------------------------KSMNLLLTRTFSGCLSS
C5E4W3_ZYGRC/494-839LNNILV---------------------------------------------------------KTMESIFSKIINEKIRA
G8ZUB2_TORDC/501-847LSNTLV---------------------------------------------------------ATIDTIFSKVVNEKIRA
G2RB31_THITE/448-748VDETLR---------------------------------------------------------KTLDELLTDIVCQSLLE
U5FMP1_POPTR/442-753IYDVVR---------------------------------------------------------KYLDKLLIDVLNEVILS
J9K5H0_ACYPI/421-724VDEMVQ---------------------------------------------------------KSTKLLLSRTFSGCLSS
C4R087_PICPG/447-765ILRITI---------------------------------------------------------ETIDSVLNNIVIKNLRH
Q8S5T3_ORYSJ/442-753IYEIVK---------------------------------------------------------GYLDRLLIEVLNDSLLN
M4DPW7_BRARP/456-760FYDVVK---------------------------------------------------------KYLDRLLGEVLDEALLK
G6DDP0_DANPL/419-720RAAAAR---------------------------------------------------------HSASLLLSRSFTGCLSA
M3XK92_LATCH/505-811IDDMIR---------------------------------------------------------KSTNLLLSRTLSNCLQA
D5GMB3_TUBMM/427-725IDRELQ---------------------------------------------------------KSLDELLCEHVCGTLVE
W1QAD1_OGAPD/459-774ILKLIG---------------------------------------------------------KSVDHVLINIVLKDLKT
U9TBU2_RHIID/147-443VDDIAK---------------------------------------------------------QTLDNLLIEHVNGVLTS
A5DMM0_PICGU/482-811INSII.---------------------------------------------------------..VNEIFERALGKEKNF
R9P8Q0_PSEHS/445-756IDEILK---------------------------------------------------------SSLDQLLITQVSTAIRK
Q6C1W0_YARLI/480-793TEDYVQ---------------------------------------------------------QAMDSLLNDIICDTLLH
J3PJI4_GAGT3/450-750IDETLR---------------------------------------------------------KSLDSLLTEKVCQSLVE
G8YKH3_PICSO/492-824IVNIV.---------------------------------------------------------..VNEIFERVLGPETGI
J9EJI0_WUCBA/484-791VDDTVR---------------------------------------------------------RYANVLLAR.WSGSLKS
F6YT74_HORSE/409-715IDDMLR---------------------------------------------------------KSTNLLLTRTLCSCLLN
J4KKU7_BEAB2/450-750IDESLR---------------------------------------------------------QSLDELLTEKVCRSLVE
I4YIZ3_WALMC/449-754TDSLIA---------------------------------------------------------SALDRLIKEGVVKTLSV
F8PQ71_SERL3/445-743IDELLS---------------------------------------------------------KSLDQLLSDHVSESVGK
G1XUE0_ARTOA/508-808IDETLR---------------------------------------------------------VSLDEMLMEQVCKSLHE
A7TQS9_VANPO/506-845LNSILV---------------------------------------------------------KTVDSLFNNVVNQKIRD
G3AZR4_CANTC/493-823LNNII.---------------------------------------------------------..VEQIFERVLGDEKGV
B4R147_DROSI/428-730VAAMVR---------------------------------------------------------KAANLLLTRSFSGCLSV
S8FZN9_FOMPI/445-743IDDLLS---------------------------------------------------------KTLDNILANFIGSNIAK
K5W5P8_PHACS/445-743IDDLLS---------------------------------------------------------KSLENLLTKHIAENMAR
G2YIA1_BOTF4/452-752IDETLK---------------------------------------------------------KSIDELLSEDICDPLVE
A8NWX8_COPC7/444-743IDEILS---------------------------------------------------------KSLDNLLIKYISESIAR
R4X791_TAPDE/443-739VEDLLR---------------------------------------------------------RSLDDILVKCVNRTLSS
S9VV25_SCHCR/436-738LALDVQ---------------------------------------------------------EKIPRFYRRFILHSLLD
V2X5M8_MONRO/445-743IDELLS---------------------------------------------------------KSLDGLLITHISETIGQ
C5M2I2_CANTT/488-818LNNII.---------------------------------------------------------..VNNIIEVVLSGEKGS
I2H3Y9_TETBL/508-832VNNILV---------------------------------------------------------KTIDSILNDTVNKQIRS
Q17EP0_AEDAE/419-722IAAMVR---------------------------------------------------------KAANLLLTRSFSGCLSA
M2ZTI7_PSEFD/439-745IDKTLK---------------------------------------------------------ESLDELLVDKVCRSLVE
I1MM64_SOYBN/441-752FFDFLR---------------------------------------------------------KYLDKFLIEVLNETLLD
B6K595_SCHJY/439-743LAVEVN---------------------------------------------------------ERAPRLFRRFIKFGFVN
U4LHC9_PYROM/436-732IDDELK---------------------------------------------------------ASLDELLCSQVCKQLVD
G3Q4R1_GASAC/450-759VDDMIR---------------------------------------------------------KSTNLLLTRTLSHCLQY
Q753S5_ASHGO/494-834LNIVLV---------------------------------------------------------RTVDDIFIKVVNNKIRS
Q5KPL0_CRYNJ/450-754VDEVLR---------------------------------------------------------RSLDGLLSDHVSKQIAK
C4Y6U1_CLAL4/493-821LNHII.---------------------------------------------------------..VNDIFEKVLGNEPGI
E0VNA5_PEDHC/435-739NNDMVI---------------------------------------------------------KSTTLLLTRTFSGSLLS
Q7RYL2_NEUCR/451-751VDETLR---------------------------------------------------------KSLDELLTEKVCRTLVE
H6BY38_EXODN/444-761IDAELL---------------------------------------------------------TSLDDLLTTKVCASLVS
J7R131_KAZNA/509-861VNRILV---------------------------------------------------------GTIETIFNNIVNKKIRE
M0S2D5_MUSAM/444-755FDDVLK---------------------------------------------------------KYLNKLMIDDLNKALLK
H2YEW6_CIOSA/141-441VDDMIR---------------------------------------------------------KSTNLLLTRTLASSLQT
M7XX30_RHOT1/453-763IDDVLR---------------------------------------------------------KALDNLLIKQVSENIQR
M2RQV4_CERS8/445-743IDDLLS---------------------------------------------------------KSLDTILSTHISESIAR
M2N0E3_BAUCO/446-755IDQTLK---------------------------------------------------------DSLDELLVNKVCQSLTD
F4S5J6_MELLP/471-780TDDVLR---------------------------------------------------------KSLDKLLIKHINGHIRS
H3CIW2_TETNG/458-766VDDMIR---------------------------------------------------------KSTNLLLTRTLSHCLQY
I3MQ17_ICTTR/423-732IDDMLR---------------------------------------------------------KSTNLLLTRTLNSCLLN
M1CVC4_SOLTU/449-755FFDFVK---------------------------------------------------------KYLDKLLIDVLNEVLLE
H2B145_KAZAF/504-852LNNILV---------------------------------------------------------KTIDSIFTDVVNNKIRS
C8V0B6_EMENI/444-742IDATLK---------------------------------------------------------DALDELLSSKVCDTLVE
D7TQV0_VITVI/442-753FYDIVK---------------------------------------------------------KYLDKLLIDVFNEAILK
U5HF68_USTV1/463-770IDDVLR---------------------------------------------------------KALDNLLIKQVSENIQR
SEC15_SCHPO/436-738LATEVN---------------------------------------------------------EKAPRFYRRFILRSLVD
K2SGN8_MACPH/382-681IDETLR---------------------------------------------------------KSLDELLCEKVCQMLVD
N1JD47_BLUG1/449-748IDNTLR---------------------------------------------------------TSLDSLLSEKVCNSLVE
W5C2B9_WHEAT/447-753SYDVVK---------------------------------------------------------GYLDKLLIEVLNDGLLK
U5D3X0_AMBTC/442-753VYDVVK---------------------------------------------------------KYLDKLLIDVLNEALLK
A6R9C0_AJECN/444-745IDETLR---------------------------------------------------------ESLDSLLSDKVCETLVE
Q6CYE5_KLULA/489-828LNLIVI---------------------------------------------------------KAIDNIFDRVVNDNIKS
T1ICC1_RHOPR/422-724VDDMIR---------------------------------------------------------KSTNLLLTRTFTGCLSS
U7Q2U4_SPOS1/452-752IDETLR---------------------------------------------------------KSLDELLNDKICKSLVE
V5ESV2_PSEBG/448-756IDEILS---------------------------------------------------------KSLDSLLIQQVSNGIRQ
M9MGV3_PSEA3/448-761IDEILK---------------------------------------------------------KSLDELLIQQVSTGIRR
M2T372_COCH5/443-742IDETLR---------------------------------------------------------TSLDELLCEKVCGSLVE
B0CXV0_LACBS/444-743IDELLS---------------------------------------------------------KSLNNLLIKSISESIGH
A8Q0J7_MALGO/448-754IDLILT---------------------------------------------------------QSLDDLLIQQISINIRD
L8GBJ1_PSED2/444-744IDETLR---------------------------------------------------------KSLDQLLSEKVCRSLVE
K1PXL0_CRAGI/475-788IDDMIR---------------------------------------------------------KSTNLLLTRTLGSCLSS
T1K0Q9_TETUR/511-835IEDMVR---------------------------------------------------------KSTNLLLTRTLSGCLSV
W4YBC1_STRPU/461-764RDDMIR---------------------------------------------------------KSTNVLLTRTLSGCLNA
I2FTP7_USTH4/451-766IDEILK---------------------------------------------------------QTLDHLLIHQVSNGIRK
M4CSR8_BRARP/401-712FFSVLR---------------------------------------------------------KYLDKILIDVLNEVILE
SEC15_YEAST/521-864LNNILV---------------------------------------------------------KTMDDIFNDIVNKKIRS
I1LA00_SOYBN/442-753FFGVVR---------------------------------------------------------KYLDMFLIDVLNVTLLE
D5G5B6_TUBMM/397-695IDEELK---------------------------------------------------------SSLDELLCGQVCTSLVE
S2IZP1_MUCC1/463-761MDDILK---------------------------------------------------------KAVDSLLIKKVNAILLK
K0KMH2_WICCF/500-804LNKLVI---------------------------------------------------------ENVDNLLISVINSYFKE
A3LS60_PICST/480-811LNHII.---------------------------------------------------------..VNDIFERVLGDEKGV
C5DLI6_LACTC/498-839LNNIIV---------------------------------------------------------KTVDDIFGKIVDAKIAS
G3AHA4_SPAPN/460-784INNII.---------------------------------------------------------..VNDIVELVLSNKKGF
G8BTV9_TETPH/518-863VNSILV---------------------------------------------------------TTVDHLFNDIVNHKIRA
G4TCP0_PIRID/445-744IDELLG---------------------------------------------------------TSLDRLMTKNICQKISS
G8BIA4_CANPC/483-815IINVI.---------------------------------------------------------..VNDIFEQFLGEKKGF
E6ZRP7_SPORE/448-761IDEILQ---------------------------------------------------------KSLDELLIQQVSTGIRR
Q6FRK2_CANGA/501-841LNNILV---------------------------------------------------------NTIDGILDGVVNKQIRA
G0WGH4_NAUDC/507-859LNKLMV---------------------------------------------------------KTIDRIFTDVVNKKIRS
E3KWD2_PUCGT/502-831ADDSIR---------------------------------------------------------KCLDSLLISHVGLHMFS
K7IYQ6_NASVI/422-728IDEMIC---------------------------------------------------------KSTNLLLTRTFSGCLSS
A0A0D1DRH1_USTMA/446-764IDEILK---------------------------------------------------------KSLDELLITQVSTAIRK
C3ZIQ9_BRAFL/402-708IDDMVR---------------------------------------------------------KSTNLLLTRTLSGCLTS
D8PS05_SCHCM/445-743IDDLLS---------------------------------------------------------KSLDSLLKDHISEPVAQ
A5E457_LODEL/496-826INDII.---------------------------------------------------------..VNQIVEVFLGDKKGF

PF09763

Q5K9I2_CRYNJ/487-1172ISYIES-----------------------------------------------------QGKGLQVQTSNQQVLLNELRQ
Q75AA6_ASHGO/631-1297IEYVER-----------------------------------------------------QSNGLQVNCVNKKLLSKDLSG
A5DBH0_PICGU/595-1282INSIEN-----------------------------------------------------DSKGLQVKSINKKLLYNDLKG
A3GH85_PICST/638-1329VDTIEN-----------------------------------------------------NSQGLQVKSINRKLLYNDLRG
Q6FRC5_CANGA/652-1329IDYVES-----------------------------------------------------QNNGLQIESANKKQLWSTLDN
Q2UK85_ASPOR/702-1427VSYIET-----------------------------------------------------QSQGLQVQTANQKLLHNELQN
A7TSV5_VANPO/776-1455IEYVER-----------------------------------------------------QNNGLQVESANKKLLWSLLTD
Q6CQX3_KLULA/540-1218IEFVES-----------------------------------------------------QQNGLQVRVANRKLLWKELNE
Q57ZX4_TRYB2/198-1064LQRIEH-----------------------------------------------------QHNTLQRKQQNLHKLQEQLQV
EXOC1_DROME/198-866MEKIGG-----------------------------------------------------KNAMIEIANNNNIKLMKELNK
A7E4X8_SCLS1/708-1443IAYIEA-----------------------------------------------------QSQGLQVQTANQKLLQAELQS
Q6C0U5_YARLI/751-1484IDYIES-----------------------------------------------------QGHGLQVQTTNQKILWEELNS
Q2GRZ6_CHAGB/575-1334IAYIEA-----------------------------------------------------QGHGLQVQAANQKLLRKELES
A7RVQ5_NEMVE/163-846MEQMED-----------------------------------------------------KDRHMETESTNRQKLLKQVEF
Q5TMX8_ANOGA/201-872MEKMGE-----------------------------------------------------KNQMIEIANTNNVRLLLELEK
A0A0D1E5C3_USTMA/474-1173ISHIES-----------------------------------------------------QNRGLQVQTSNQRTLMAEIEM
A5E4P0_LODEL/994-1796VNAIDE-----------------------------------------------------KSKGLQLKFVNEKLLYNDLHE
EXOC1_DICDI/107-855IEHIEG-----------------------------------------------------KNNKMEIVSRNQKLLYSELNN
A3KPP9_DANRE/184-869MDQISQ-----------------------------------------------------SNRLIQISNTNNGKLLDEIQF
E7LTP8_YEASV/640-1316IENVES-----------------------------------------------------QDNGLQVESANKKLLWNTLDE
V5ILH3_NEUCR/647-1440IAYIEA-----------------------------------------------------QGQGLQVQAANQKLLKKELES

PF04129

VPS52_YEAST/47-607LDFIKK-----------------------------------------------------KSNELQSLLEYNSTKLAHISP
VPS52_SCHPO/1-508IYKVSE-----------------------------------------------------RSNKIQVNLNNLKAVESALGA
Q9VMQ8_DROME/42-546ITQLQR-----------------------------------------------------KSVSMSLQLTNRQSVKAQLSQ
VPS52_RAT/94-601IRTLQE-----------------------------------------------------QSGAMNIRLRNRQAVRGKLGE
VP52A_ARATH/93-587IKILQE-----------------------------------------------------KSMDMGLRLKNRRVAESKLAK

PF15278

B6K1Q5_SCHJY/526-611VEELFR-----------------------------------------------------QKMQAK-----------EVQD
YD6C_SCHPO/520-605VENLAE-----------------------------------------------------EEIELQ-----------NIKS

PF06419

F4PTE8_DICFS/25-669KLSYDL-----------------------------------------------------KEIEEKEKMVNDFLVKFKLSD
D7TU00_VITVI/30-688RLKQEL-----------------------------------------------------EITTQRQEIASCFLRDYQLSN
K4CMR1_SOLLC/27-689RLKQEF-----------------------------------------------------EVTTQRQEIVSCFLRDYQLSP
T1IZR2_STRMM/42-648QLKTDS-----------------------------------------------------QRLQMRHEIATEFLQTFQLQP
E6ZVT0_SPORE/99-753GLEKQR-----------------------------------------------------AAALTQAQVATLFLSRFTLCE
E3QI24_COLGM/61-707NLMKER-----------------------------------------------------AEVESKQHLLKALRSHFVLSD
G8ZRY6_TORDC/181-815SLQSDI-----------------------------------------------------KHLKLKRQILFAIKDQFTLNQ
D0NH36_PHYIT/44-655ALATKR-----------------------------------------------------DKVQEAWKETKTFLDRYQLTE
G2XGZ3_VERDV/42-689LLIQQR-----------------------------------------------------EDVATKQQLLAAFCGHFLFTN
C5M6P2_CANTT/146-753DLNKSK-----------------------------------------------------QLIGLKKNLLINFKEKFTLNE
S3D9N6_GLAL2/53-695ELMKQK-----------------------------------------------------SQVEEKQQLLKAFSTHFVMSE
K1QJ12_CRAGI/42-639KLHAES-----------------------------------------------------QKVQMKLQVADVFLDKFQLKP
E9EWT4_METRA/42-671SLLEKR-----------------------------------------------------EEVFVKQRVLSAFKEYFLLTE
C1GBA8_PARBD/57-738TLMNQR-----------------------------------------------------QEVETKHKLLEAFSKHFTMSE
G0VHH4_NAUCC/184-845QLKNQM-----------------------------------------------------EWLRLKRQLLINLKEKFTLNQ
T1K467_TETUR/31-648YLKNER-----------------------------------------------------KTVDIQQAIVDKFLDRFHLKP
B9S1S6_RICCO/31-692RLKQEL-----------------------------------------------------EVTTQRQEIVSCFLRDYQLSN
G3J3T2_CORMM/115-739ALLEKR-----------------------------------------------------RNTERRRHLLQALRDRFVLSE
G3B3F3_CANTC/135-733ALNEQK-----------------------------------------------------TLVSLKKNLLVNFKKKFILNE
COG6_PICGU/138-737NLHRKK-----------------------------------------------------TAVVVKKQLLSAFRAKFTLNE
U1G9I0_ENDPU/55-707TLTAQK-----------------------------------------------------QAVETKQQSLNAFNNHFIVSE
B7Q1K3_IXOSC/40-604ALRAQA-----------------------------------------------------QRLDERQKLAGAFLHAFQLTP
F1A3Z4_DICPU/25-688MLTENL-----------------------------------------------------KDIEEKEKLLNEFYKKFKLSQ
A5DUD8_LODEL/174-816LMSSER-----------------------------------------------------TAVEIKQGLLTAFKSQFTLNE
C5FL60_ARTOC/56-718TLRAQK-----------------------------------------------------EDAETKQALLNAFNTHFILPE
X1WYM6_ACYPI/29-624RLQLER-----------------------------------------------------KSVSNQQLLANAYVKTFQLNS
COG6_CHAGB/47-689QLMIQR-----------------------------------------------------RQVEQKQALLGAFNTNFVLSE
T1EFP4_HELRO/53-656TLKAET-----------------------------------------------------HKLQLRNRLVDAFLLKFQLTE
G4V7Z1_SCHMA/35-648QLKSDS-----------------------------------------------------KVAEIKAYLLELLVGSYQISA
C1MX75_MICPC/28-699RLAEEK-----------------------------------------------------RAIEERKRTIKTFSVDFQLKD
COG6_ASPCL/56-753ALVSQK-----------------------------------------------------QESETKQQLLDAFAKHFIIPE
R9NZP8_PSEHS/106-778GLERQR-----------------------------------------------------AAALTQVQVAKLFLSRFTLSE
M7T0Y3_EUTLA/61-714HLVTQR-----------------------------------------------------RNVETKQQLLKSFRDQFVLSE
B3N2A1_DROAN/35-627TMQQER-----------------------------------------------------DRLEVHQQIAQAFLARFQLSG
G3AM15_SPAPN/147-779ELNQEK-----------------------------------------------------QLVGLQKNLLIVFKEKFTLNE
COG6_DEBHA/142-759NLNDTK-----------------------------------------------------SLINLKKGLLISFQNKFALDV
COG6_DICDI/25-671ELSCGL-----------------------------------------------------KEIKEKENTLQQFFKKFKLTP
D6WE56_TRICA/33-626SLQESG-----------------------------------------------------EKNDMQQQIVHAFLETFQLTP
K1Y0X5_MARBU/53-696ELMKQK-----------------------------------------------------AQVESKQELLKAFNTHFIMSD
R0IIQ7_SETT2/55-693SLMGQK-----------------------------------------------------KQVESKQQVLNAFSAHFLITE
G2YFW1_BOTF4/53-688ELMKQK-----------------------------------------------------EQMQAKQELLNAFNAHFIMSD
B3RLZ3_TRIAD/43-642KLHNEK-----------------------------------------------------QQLQMRARLANLFLEKFQLSP
M2NAU2_BAUCO/56-695AILAEK-----------------------------------------------------QQVEKKQRLLDAFRAHFVVSD
COG6_MAGO7/54-703TLIAQK-----------------------------------------------------RQVEIKQRLLKSFSGHFLLPE
N1PID3_DOTSN/58-692TILTGK-----------------------------------------------------QQAETKQQLLDALMTHFVVTD
M7NMJ9_PNEMU/26-631TIYDRK-----------------------------------------------------ILINTKQSLLKSFNNNFIIEN
G0WDG5_NAUDC/220-947ALQNQV-----------------------------------------------------NLLRLKHQLLTNIQKNFTLTQ
U4LN57_PYROM/30-663QLLTQK-----------------------------------------------------KVIEDKQMLLSAFTDHFTVSD
F4NVM0_BATDJ/55-674DMKTKS-----------------------------------------------------EQASYRKVVVDALLERFTLSD
Q6NMI3_ARATH/31-678RLKQEL-----------------------------------------------------EVTTQRQEIVNCFLRDYQLSN
A9SY28_PHYPA/31-697RLKQEL-----------------------------------------------------EHTTQRQELITAFLNNYQLRP
R4XC07_TAPDE/63-663FLQAQK-----------------------------------------------------KKVETKTVVLDAFRAKFLLEE
COG6_CANGA/184-819DCRNHL-----------------------------------------------------LKLEIKKKILKALQSKFTLNQ
A0A088AU02_APIME/31-620KLQNKS-----------------------------------------------------QTLSMQQEVANAFIKNFQLTS
M3AVJ9_PSEFD/47-684TVLADR-----------------------------------------------------RHVETKQQLLHACKAHFVLSD
G8BSH8_TETPH/181-817QLYQEI-----------------------------------------------------DNLKQKKILLTAIKDEYTLTQ
V5EQK1_PSEBG/40-699GLERQR-----------------------------------------------------AAALTQVEVANLFLSRFTLSE
COG6_YEAST/190-824QYRLKA-----------------------------------------------------EQLKLKKKILLSIRDRFTLNQ
C4Y1K1_CLAL4/138-736ALTREN-----------------------------------------------------QLLGVKKALLASFRRQFTLNE
C5DMM3_LACTC/169-799ILQNAL-----------------------------------------------------LKHRLKKRILVMLRDKLTLNQ
J4VQT6_BEAB2/59-673ALLEKR-----------------------------------------------------RGIEGKRHLLQILRERFVLSD
G8BDK2_CANPC/146-760KLYEEK-----------------------------------------------------QLIGIKKELLSAFKNKFTLSE
A0A0C4DUI8_MAGP6/47-702SLMAEK-----------------------------------------------------RQVETKQRLLRAFQSHFLLSE
COG6_ASHGO/167-791..REKL-----------------------------------------------------EMLKLKKRVLVGIRESLTLNQ
D8T0Q7_SELML/31-672KLRLDL-----------------------------------------------------DNTKQHQEIVASFLHNYQLSP
COG6_SCHPO/44-649TFCEEE-----------------------------------------------------ALIEEKLKNIEIFEKNFVIMD
A4S9H0_OSTLU/72-716RAKEEL-----------------------------------------------------SVIESRRELVNSFAVDFQLTK
M0TQE9_MUSAM/30-700RLKQEL-----------------------------------------------------ELTTQRQEIVSCFLRDYQLSN
E5ACR4_LEPMJ/80-720SLMNQR-----------------------------------------------------KQVESKQQILHAFTSHFLISD
Q6C1G5_YARLI/26-595ELMAQQ-----------------------------------------------------ENISKKRDLLKRYTDAFVLTE
A0A0D2XVZ8_FUSO4/62-692SLLEQK-----------------------------------------------------RQVEVKQELLGAFKKHFVMSE
C5GW18_AJEDR/57-748ILMSQR-----------------------------------------------------REVETKQKLLDAFNKHFIMSE
C1EEF9_MICSR/30-686RFNNNL-----------------------------------------------------AKIEERKKMLETFLVDYQLTD
W1QBZ5_OGAPD/148-758DLIQKR-----------------------------------------------------DLVKIKKSLLVGFRSTFTLSA
A8HUT2_CHLRE/30-678RLARDL-----------------------------------------------------EAVERKQGLVAQFLDTYQLTP
B0VZV1_CULQU/39-627TLQEDN-----------------------------------------------------NKLLLQQRIATGFLSRFQLSV
G0RKF7_HYPJQ/55-674SLFEQR-----------------------------------------------------LAIERKQEILGAIESYFIMTD
Q00T18_OSTTA/88-728RASEDL-----------------------------------------------------RSIESRRELVKSFAVDFQITK
COG6_CRYNJ/70-689VLRSQR-----------------------------------------------------DSAQLRAHLITLFLSRFTLSN
A2E714_TRIVA/27-593SLYIQQ-----------------------------------------------------EKQRNQLTKIHSFIEEYYLSE
L8G9L6_PSED2/56-700DLMARK-----------------------------------------------------KDVEMKQKLLQAFNTHFVMSD
S2JPX5_MUCC1/49-650IMQEHS-----------------------------------------------------NACSTQIAIVDRFLAKFTLSE
G9PA30_HYPAI/22-644SLFEQH-----------------------------------------------------KEIERKQETLSAVESYFVLTE
COG6_PHANO/55-693GLINQR-----------------------------------------------------KQVESKQQILQAFNSHFLISD
T5A889_OPHSC/60-688SLLQRR-----------------------------------------------------GEVEMKQRVFTAFRDHFVMSD
G7XM19_ASPKW/58-742ALMKQK-----------------------------------------------------KEAETKQELLEAFTQHFIVPD
N4VJY2_COLOR/52-699ALIQKR-----------------------------------------------------AEADSKQHLLKLVRLQFILSD
C4R6S3_PICPG/154-788ELHATS-----------------------------------------------------KIISIKKKLLQNFQNRYTLSH
G8YLX1_PICSO/140-752DLNRQN-----------------------------------------------------TILLVKKRLLSEFKSRFVLNE
E1ZT97_CHLVA/34-681KLQRAL-----------------------------------------------------QVSETRSQLVGRFLEQYQLTP
W1P048_AMBTC/29-693RLKQEH-----------------------------------------------------ENTTQRQEIISCFLRDYQLSS
A0A0D2VZS5_CAPO3/71-723KLNSES-----------------------------------------------------ARVELRSEVIARFLQRFQLTA
K7J084_NASVI/37-626KLQNES-----------------------------------------------------KKLTMQQEIANAFIKRFQLNA
C5DUZ7_ZYGRC/192-819QLRADA-----------------------------------------------------KSLELKKQLLIALRDQFTLNQ
V5HY00_BYSSN/58-733ALMSQK-----------------------------------------------------QDTETKQRLLDAFTRHFIVPD
U9U8S1_RHIID/50-658SLKSQR-----------------------------------------------------ETCKTRKILIDAFLKRFTLSE
I1FMS4_AMPQE/123-704ELKARG-----------------------------------------------------RRLEMRGVVIDVFLKKLQLTP
COG6_PICST/163-782ELNSEK-----------------------------------------------------RLINLKKNLLINFKAKFTLNE
Q7QJN1_ANOGA/32-623TLQEEN-----------------------------------------------------AKLQIQQKIASGFLSRFQLSV
COG6_ASPOR/122-808TLMNQK-----------------------------------------------------KEAETKQQLLDAFTKHFVVPD
I1H7V6_BRADI/77-734RLQQEL-----------------------------------------------------EVITQRQEIVSCFLRDYQLSN
F9XD71_ZYMTI/57-693SLLASK-----------------------------------------------------REVETKQQLLNAFQAHFVVSD
J7S8L6_KAZNA/176-802KIRAQM-----------------------------------------------------DQLKLKKELLLAIKDKFTIDQ
COG6_CANAL/150-758DLNDNK-----------------------------------------------------RLIGLKKNLLISFKEKFTLNE
F6SQE9_CIOIN/44-655ELKTEG-----------------------------------------------------KKLDLQAKIADAFLDRFQLKP
B9N0R1_POPTR/31-709RLKEEL-----------------------------------------------------EITTQRQDIVSCFLRDYQLSN
T1I707_RHOPR/34-617KLQAEN-----------------------------------------------------EKLTLEEKIASAMINTFQLTE
COG6_CAEEL/38-623SLKEKK-----------------------------------------------------ASIESRCNMINEFLENYSLSS
F7BIB8_HORSE/4-604KLQAES-----------------------------------------------------QRLEIRAQVADAFLSKFQLTS
COG6_NEUCR/64-712QLMTQK-----------------------------------------------------RQIESKQKLLSTFKTHFILTQ
M3D478_SPHMS/53-688SMLAEK-----------------------------------------------------RRVETRQQLLDALKAHFVVSD
G8JRN3_ERECY/172-797DLRKRL-----------------------------------------------------DHLKLKRKILIGIRDSLILNQ
R1EQ64_BOTPV/49-680TLMTQK-----------------------------------------------------ADTEKKQRLLDALKAHFLLGD
I2H727_TETBL/181-823SLNKKL-----------------------------------------------------NALTLQKKILIALKDKFTLNQ

PF03081

B4LDS3_DROVI/323-697......-----------------------------------------------------...........PSKHNEVFAR
Q5KMS6_CRYNJ/301-670......-----------------------------------------------------...........NHPPQTILTQ
J3MBU4_ORYBR/165-513......-----------------------------------------------------..........FSSLKEDYFSA
G1XRU1_ARTOA/244-617......-----------------------------------------------------...........SNVWLKVYTQ
W1PIG8_AMBTC/268-635......-----------------------------------------------------..........LGSTSEACFVE
S0EBU7_GIBF5/246-629......-----------------------------------------------------...........REDWGVVFQS
K4BC35_SOLLC/279-644......-----------------------------------------------------..........LEAVGSVCFAE
Q60EX4_ORYSJ/154-509......-----------------------------------------------------.............DDDLRLVR
K3XWI2_SETIT/155-495......-----------------------------------------------------.............EALGELAA
Q6Z421_ORYSJ/101-458......-----------------------------------------------------..........RKDDASACFAD
C5E0R8_ZYGRC/237-621......-----------------------------------------------------..........ESDMKPIVFCN
Q6ES92_ORYSJ/192-594......-----------------------------------------------------..RDSKTAHADYVQQVVQFAR
Q9SIB0_ARATH/210-552......-----------------------------------------------------..........SSTIRESAFAE
Q9LQP9_ARATH/238-587......-----------------------------------------------------...........SSVAESCFVD
F6GST9_VITVI/277-640......-----------------------------------------------------..........SDLIKEVCFTE
G8ZSY9_TORDC/245-624......-----------------------------------------------------..........ELELKPKVFTG
I1LFL8_SOYBN/224-593......-----------------------------------------------------..........QPSISQKLFGD
M4F3N2_BRARP/219-571......-----------------------------------------------------..........SPSVAESCFSE
W1NW13_AMBTC/231-604......-----------------------------------------------------..........AKGIGDACFME
M0SRF8_MUSAM/218-582......-----------------------------------------------------..........PRSARESCFVE
J7REJ7_NAUDC/235-618......-----------------------------------------------------..........YTKYKPIVINS
D2UX81_NAEGR/218-569......-----------------------------------------------------...........DYQKNQIYGD
M4DQ92_BRARP/206-564......-----------------------------------------------------........SSSVSIAESTFVE
K3Z4M7_SETIT/235-602......-----------------------------------------------------..........KHALKDHCFAQ
B9S3S8_RICCO/351-722......-----------------------------------------------------..........RPSISSFLFSN
B7P4G4_IXOSC/289-655......-----------------------------------------------------.........DGKEPAALPLER
F6H2V1_VITVI/283-641......-----------------------------------------------------..........GLDVWMGCFAK
Q9FNR3_ARATH/273-622......-----------------------------------------------------..........FESISTACFIE
M0THS1_MUSAM/243-589......-----------------------------------------------------..........SDTVREALFAY
C5XNX2_SORBI/186-525......-----------------------------------------------------..........FTSYTKLAFAT
A7TQI9_VANPO/237-621......-----------------------------------------------------..........QPDFKPHILSS
Q6L582_ORYSJ/123-524PAVASS-----------------------------------------------------SDHELLLRGVVGGGDDLCLVR
K3XFC8_SETIT/312-653......-----------------------------------------------------..........FNRLKEDYFLA
E9G2G2_DAPPU/324-689......-----------------------------------------------------...........LPHQKAVLSI
M4ELV2_BRARP/227-592......-----------------------------------------------------..........SDSIRESCFSE
D7MQ70_ARALL/301-664......-----------------------------------------------------..........SESSKEVCFNE
M4E3U0_BRARP/64-418......-----------------------------------------------------............GDEGSLFCI
C5E318_LACTC/234-618......-----------------------------------------------------..........KPSFRDQVFAN
M0RFS4_MUSAM/240-598......-----------------------------------------------------..........LPPFADIAFAA
M0S9N6_MUSAM/277-655......-----------------------------------------------------..........VTFNKDLCFAE
J3MUP3_ORYBR/158-521......-----------------------------------------------------..........DEELGHECFAD
B9I6L2_POPTR/266-620......-----------------------------------------------------..........LGSVSDLSFME
E4X2L8_OIKDI/306-653......-----------------------------------------------------...........EASVEDVLDK
D7MSH8_ARALL/228-592......-----------------------------------------------------..........SGLIVESSFTE
B9IK77_POPTR/253-654......-----------------------------------------------------..........LGTVNLVSFTE
M0RET8_MUSAM/246-597......-----------------------------------------------------..........SDAVREVVFAD
A9RYU9_PHYPA/273-621......-----------------------------------------------------..........LDPHREKCFAD
Q69JW6_ORYSJ/346-696......-----------------------------------------------------..........FNSFKHDYFMV
M1AX18_SOLTU/275-644......-----------------------------------------------------..........DHSVSSVCFVE
M0ZQS8_SOLTU/207-577......-----------------------------------------------------..........SPMISQSLFNN
B8MLJ7_TALSN/245-625......-----------------------------------------------------...........GENQGRALQA
I1I8W2_BRADI/260-643......-----------------------------------------------------.........GAENLGRECFAD
K7M841_SOYBN/188-545......-----------------------------------------------------..........FHRAADVSFTE
M7S7Y8_EUTLA/245-627......-----------------------------------------------------...........RQDWGPVFQT
I1MUP7_SOYBN/290-649......-----------------------------------------------------..........LDDLKEICFNE
I1LR33_SOYBN/232-587......-----------------------------------------------------.........SGKRIAESCFAE
Q9LIA2_ARATH/266-643......-----------------------------------------------------..........LNEIGLTCFVD
I1MBG5_SOYBN/274-630......-----------------------------------------------------..........FASAADFSFME
M2MJA4_BAUCO/246-630......-----------------------------------------------------...........REQWPVILLA
B9RAG8_RICCO/276-630......-----------------------------------------------------..........SDSAKDVCFNE
U7Q7I3_SPOS1/370-767......-----------------------------------------------------...........RDDWAPVFQG
Q5TQS7_ANOGA/318-703......-----------------------------------------------------...........PSRHNEVFSR
E0VIX9_PEDHC/327-689......-----------------------------------------------------...........LQHQSKIFEI
EXO70_KLULA/234-616......-----------------------------------------------------..........ETSRQPVIYAK
D8RZH2_SELML/269-629......-----------------------------------------------------..........PGGVEESCFAE
B9HPL3_POPTR/209-568......-----------------------------------------------------..........SPSLKESCFAD
M7PEF2_PNEMU/241-608......-----------------------------------------------------............KNYQNVLLI
C4LW49_ENTHI/279-679......-----------------------------------------------------............NDFDKFFVG
I1JCY6_SOYBN/322-699......-----------------------------------------------------......SSLSTNNIAASLFAN
D6WW45_TRICA/328-692......-----------------------------------------------------...........PRHQPRVFEL
B6K881_SCHJY/235-604......-----------------------------------------------------...........LADAKQLYPL
F0XF34_GROCL/729-1128......-----------------------------------------------------...........REDWGPVFQA
D8SPE6_SELML/233-605......-----------------------------------------------------..........DLEESDTCFAE
M0REN0_MUSAM/218-570......-----------------------------------------------------..........LGIADDAPFIE
E0CP16_VITVI/299-657......-----------------------------------------------------.........MEGLIWTECFVK
K3Y3Q0_SETIT/194-605......-----------------------------------------------------...LATGKMAEREQEVAQFAR
B9HV40_POPTR/282-631......-----------------------------------------------------..........GPEVWMDCFAK
J3MH82_ORYBR/80-438......-----------------------------------------------------..........RPEAVSSCFAE
B9GVY9_POPTR/242-613......-----------------------------------------------------..........GTAIDDACFME
M7UD48_BOTF1/247-635......-----------------------------------------------------...........RDEWGKVFNL
W1PWG9_AMBTC/231-597......-----------------------------------------------------..........SDSIRQSCYSE
N1J6U6_BLUG1/243-631......-----------------------------------------------------...........QDEWGKAFNA
K3XSA8_SETIT/229-593......-----------------------------------------------------..........TDSTADLCFYE
B9SNP4_RICCO/271-635......-----------------------------------------------------..........IGTVNLVCFTE
M1CZG7_SOLTU/225-591......-----------------------------------------------------..........SDSIRESCFTG
Q9C8H6_ARATH/254-623......-----------------------------------------------------..........GEDVPLRCFGE
H2ZQN6_CIOSA/276-638......-----------------------------------------------------...........EKYRRKVFDN
K3XFW5_SETIT/237-577......-----------------------------------------------------.............FRDEYLLA
A9TGT7_PHYPA/278-635......-----------------------------------------------------...........LPLSADIFNG
M1W138_CLAP2/246-628......-----------------------------------------------------...........REDWGSVFQA
A5B8C4_VITVI/267-614......-----------------------------------------------------..........FSSAANLSFME
S3E3U8_GLAL2/246-630......-----------------------------------------------------...........RDEWKKVFNL
B9T041_RICCO/247-608......-----------------------------------------------------..........SETLRESCFSE
H6CBM6_EXODN/248-636......-----------------------------------------------------...........GGDAGKVLSM
I1JWP0_SOYBN/263-614......-----------------------------------------------------..........FGSFYQCCFSE
F4KG58_ARATH/222-573......-----------------------------------------------------..........VEPFRDQSFAE
F6GTU7_VITVI/230-591......-----------------------------------------------------..........SDSIRESCFSE
M4CLF8_BRARP/249-615......-----------------------------------------------------..........SLTIGQSCFNQ
W5EWA8_WHEAT/175-531......-----------------------------------------------------..........ISFNKDQCFSE
I1MDK3_SOYBN/222-572......-----------------------------------------------------..........ERKIAESCFAA
M1CA15_SOLTU/267-620......-----------------------------------------------------..........FGSVSSTCFIE
C4R8N1_PICPG/235-620......-----------------------------------------------------.........NKSQLISDTLVA
Q8VY27_ARATH/245-606......-----------------------------------------------------..........SNSTRESCFYE
Q0CYR3_ASPTN/219-599......-----------------------------------------------------...........GDQRGLALQT
U9SQP1_RHIID/236-607......-----------------------------------------------------...........SESVMPGYRD
EXO70_EMENI/247-629......-----------------------------------------------------...........GDHRGLALQM
S2J047_MUCC1/214-590......-----------------------------------------------------...........EQRRAAALKG
J3L5F1_ORYBR/344-686......-----------------------------------------------------..........STSCSDLAFAT
K0KAQ4_WICCF/235-607......-----------------------------------------------------..........NNDQIITIYQK
M0W8E8_HORVD/215-574......-----------------------------------------------------..........DEELGHECFAD
R8BPV7_TOGMI/250-634......-----------------------------------------------------...........RDDWGPVFQA
K3ZHK2_SETIT/304-675......-----------------------------------------------------..........ADGLARSIFAD
M0TX18_MUSAM/52-414......-----------------------------------------------------..........SDAVRESCFAD
K4CMD0_SOLLC/278-635......-----------------------------------------------------..........GLDVWMGCFAK
G3JCP3_CORMM/249-631......-----------------------------------------------------...........REDWGPVFQA
Q6K647_ORYSJ/301-673......-----------------------------------------------------..........SDELREECFIE
J3N6B0_ORYBR/11-377......-----------------------------------------------------.........DDPAIGRAIFVD
C5FN52_ARTOC/246-625......-----------------------------------------------------...........PDQQGKALQA
J7R1E6_KAZNA/236-614......-----------------------------------------------------..........YTALQPNVLIS
EXOC7_DICDI/437-835......-----------------------------------------------------...............GNQYQL
K1X101_MARBU/264-643......-----------------------------------------------------...........RDEWGKVFNL
W1NJ63_AMBTC/264-632......-----------------------------------------------------..LSSPKGYLSSPVSDLCFME
G0S641_CHATD/252-645......-----------------------------------------------------...........REDWGPVFEA
D5GH85_TUBMM/239-604......-----------------------------------------------------...........TPEWSRVYIA
A9SN89_PHYPA/313-674......-----------------------------------------------------.........GHSVWV.ECLRN
J9JWJ5_ACYPI/326-687......-----------------------------------------------------...........IKHHHQVFQI
W5AN73_WHEAT/1073-1426......-----------------------------------------------------..........DAVTEEECFTE
W1PHH8_AMBTC/279-635......-----------------------------------------------------..........GPDVWLGCFAR
U5H6T1_USTV1/251-633......-----------------------------------------------------..........PPSTRREIYSN
S7ZDA9_PENO1/246-625......-----------------------------------------------------...........GDQQGLTLQA
K2RHI9_MACPH/246-628......-----------------------------------------------------...........REDWARVYSQ
F6HQX6_VITVI/246-608......-----------------------------------------------------..........SDSMRESCFAE
I1NUS0_ORYGL/283-640......-----------------------------------------------------..........DAEAEEDCFTE
M4AQR1_XIPMA/327-700......-----------------------------------------------------...........EHHQKKTFDS
M7XH50_RHOT1/276-657......-----------------------------------------------------..........PASQRTSLYSS
K4DFQ8_SOLLC/257-617......-----------------------------------------------------.........TFKDRCMECFAR
D7LD39_ARALL/243-607......-----------------------------------------------------..........SSTIRESCFYE
E3S143_PYRTT/247-623......-----------------------------------------------------...........RDEWSDVYVA
E7LW76_YEASV/236-620......-----------------------------------------------------..........YTESKPHVLSQ
M3APZ2_PSEFD/248-629......-----------------------------------------------------...........RDEWASVLQA
T5A733_OPHSC/248-627......-----------------------------------------------------...........REDSGTLFQF
U5CZ65_AMBTC/305-668......-----------------------------------------------------.........MEGSMWPECFVK
Q0U449_PHANO/247-623......-----------------------------------------------------...........REEWSSVCEA
I1Q027_ORYGL/148-486......-----------------------------------------------------.............AALGELAS
M1CE10_SOLTU/253-614......-----------------------------------------------------..........FNSVSDLSFME
M0U7Y4_MUSAM/169-538......-----------------------------------------------------..........SDSIREAVFAD
EXO70_ASHGO/231-611......-----------------------------------------------------..........LPDRRPAVFCK
G2XG72_VERDV/248-627......-----------------------------------------------------...........RGDWGAIFQV
J3M2U7_ORYBR/269-636......-----------------------------------------------------..........KCTWKDNCFAE
L8G7J8_PSED2/268-651......-----------------------------------------------------...........RDDWGRVFNL
M4CEA6_BRARP/229-593......-----------------------------------------------------..........STNIVEASFTD
A9SZG5_PHYPA/276-645......-----------------------------------------------------...........PPLNDICFND
EXO70_YARLI/228-600......-----------------------------------------------------..........DEARVKQYFTQ
A0A0D1CBV0_USTMA/294-724......-----------------------------------------------------........DKQTLLLASTFSQ
M0TA71_MUSAM/314-686......-----------------------------------------------------..........HSAIAYSIFHN
Q6Z5V5_ORYSJ/164-504......-----------------------------------------------------..................LEG
I1N4J9_SOYBN/299-665......-----------------------------------------------------..........GEPVGLSCFVD
A0A068X0P1_HYMMI/337-709......-----------------------------------------------------..........NSHEAHFAYSL
M3J203_CANMX/209-599......-----------------------------------------------------.............LSPKLLDA
K3ZZ59_SETIT/223-607......-----------------------------------------------------.....TATSAGTATHDAPFAE
F9XKX9_ZYMTI/246-627......-----------------------------------------------------...........RDEWGAVLSA
B9RM96_RICCO/288-654......-----------------------------------------------------..........YPSISQRLFSD
D7L2C4_ARALL/228-595......-----------------------------------------------------..........CTAMDETCFME
K7KYU0_SOYBN/278-635......-----------------------------------------------------..........GPEAWMGCFAK
D7KZD8_ARALL/246-616......-----------------------------------------------------.........GAVNIHEACFME
U5FM28_POPTR/271-621......-----------------------------------------------------..........FGSLDSYCFVE
Q65WW9_ORYSJ/227-582......-----------------------------------------------------..........LAPFGDLAFVA
W5AKS6_WHEAT/499-852......-----------------------------------------------------..........NADTVDECFTW
S9VZ38_SCHCR/246-609......-----------------------------------------------------...........AETSQALYQR
R7YPE8_CONA1/246-628......-----------------------------------------------------...........QDEWSRVFKA
M1C7K5_SOLTU/253-615......-----------------------------------------------------..........NDSIRESCFTE
E9EGW9_METAQ/241-624......-----------------------------------------------------...........REDWGPVFQG
G8YBT4_PICSO/212-624......-----------------------------------------------------.........MTNGTRKQLLRD
M0RE29_MUSAM/266-621......-----------------------------------------------------..........SDDLKEECFDE
F6H486_VITVI/271-637......-----------------------------------------------------..........VGSVSSACFVE
W1PQ65_AMBTC/301-663......-----------------------------------------------------..........TEEVRHACFIE
T1K8E7_TETUR/311-683......-----------------------------------------------------.........IPIKCQKVIFSR
J3MTK1_ORYBR/52-443......-----------------------------------------------------...TAAATAAAPATHDTPFAE
I2H140_TETBL/236-622......-----------------------------------------------------..........QADFRPLVFKS
M3DCX2_SPHMS/245-628......-----------------------------------------------------...........REEWGAVLRA
I1N7V8_SOYBN/316-682......-----------------------------------------------------..........CPSVAAGLFGS
K3YBY1_SETIT/269-627......-----------------------------------------------------..........ITFNKDQCFVE
G7YLN0_CLOSI/142-557......-----------------------------------------------------..........DLDETQVSLDV
J3L4D1_ORYBR/230-594......-----------------------------------------------------..........SESTADLCFYE
R4XBR7_TAPDE/254-624......-----------------------------------------------------...........EGEGLEIHHT
A9RF66_PHYPA/295-650......-----------------------------------------------------.........GQPVWV.ECLNY
A2FJ22_TRIVA/250-590......-----------------------------------------------------............DKYQTPFNS
I1MBG8_SOYBN/93-437......-----------------------------------------------------..........FSSVAALCFNE
J3NNQ2_GAGT3/246-625......-----------------------------------------------------...........RDDWGPLFQT
M4CAS6_BRARP/212-578......-----------------------------------------------------..........SVSLRESCFRD
G8JUD2_ERECY/232-611......-----------------------------------------------------..........QPEKRAIVLNK
G8B940_CANPC/213-611......-----------------------------------------------------.............LPPELIAQ
K4ATI3_SOLLC/271-650......-----------------------------------------------------..........SPMNSQTLFSN
K4D380_SOLLC/270-630......-----------------------------------------------------..........QDSLRDQCFAE
K4DB07_SOLLC/238-600......-----------------------------------------------------..........SDAIRETCFAE
EXO70_NEUCR/252-636......-----------------------------------------------------...........REDWGPVFQA
A8XF23_CAEBR/262-600......-----------------------------------------------------...........TSKRAQVFRE
M4E1D8_BRARP/269-620......-----------------------------------------------------..........VESLRDQCFGE
M0TCN3_MUSAM/206-567......-----------------------------------------------------..........SDAIRESCFAD
D7KLE4_ARALL/242-609......-----------------------------------------------------...........GTMEETCFME
K3Y1F3_SETIT/202-606......-----------------------------------------------------...LATGKTAEHEQEVAQFTR
J3MD06_ORYBR/268-610......-----------------------------------------------------..........DNKVEVDCFAS
A9S026_PHYPA/305-661......-----------------------------------------------------.........GQAVWV.EILYD
W1QJT2_OGAPD/249-609......-----------------------------------------------------...........FNDINQLLFE
E2BW20_HARSA/356-713......-----------------------------------------------------...........TSLQAQVLEA
K4BUL3_SOLLC/313-670......-----------------------------------------------------.........MDGVIWPECFVK
A5E7C7_LODEL/213-654......-----------------------------------------------------.............LSTLFINP
EXO70_CANGA/235-620......-----------------------------------------------------..........FAEIKPRVLRN
C4Y3V1_CLAL4/216-602......-----------------------------------------------------............VSGSPILSN
U4LH75_PYROM/239-603......-----------------------------------------------------...........SSSWSAVYHG
D7LJN0_ARALL/216-574......-----------------------------------------------------..........SVSVAESCFTE
K4BJZ5_SOLLC/284-648......-----------------------------------------------------..........SELIKEVCFME
C5MG62_CANTT/215-605......-----------------------------------------------------.............LPVTFIGT
EXO70_CANAL/230-665......-----------------------------------------------------.............LSTHLIGP
M4DQX8_BRARP/251-599......-----------------------------------------------------.........EEHDVPLHCFGA
A0A0D2X486_CAPO3/367-717......-----------------------------------------------------...........AAHFDVTFST
F6HBV2_VITVI/280-635......-----------------------------------------------------..........GSDVSMDCFAR
I1JPF3_SOYBN/247-610......-----------------------------------------------------..........SDSVRESCFAE
M4D183_BRARP/85-443......-----------------------------------------------------..........GSNVWMDCFSK
F6HRR9_VITVI/232-595......-----------------------------------------------------..........SDSIRESSFAE
B9RLN4_RICCO/271-620......-----------------------------------------------------..........STAANSYCFVE
F6WWX5_CIOIN/361-724......-----------------------------------------------------...........EKNRRQVFDS
I1IU67_BRADI/277-636......-----------------------------------------------------..........ISFNKDQCFAE
A3LWD2_PICST/218-611......-----------------------------------------------------............LPRSEVVGP
U5GI23_POPTR/267-628......-----------------------------------------------------..........LGTVNLVSFAE
G3B334_CANTC/207-579......-----------------------------------------------------..............RVDLFGL
B9HCA8_POPTR/242-605......-----------------------------------------------------..........SESIRESCFSE
A9S081_PHYPA/264-622......-----------------------------------------------------..........LDPHREKCFAD
M0RMY7_MUSAM/168-542......-----------------------------------------------------...........GLTDDAPFTE
K1R8N3_CRAGI/240-606......-----------------------------------------------------...........DKHHRSVFDN
M0TDJ2_MUSAM/228-592......-----------------------------------------------------..........PGSIREPCFVD
A9SEA0_PHYPA/286-643......-----------------------------------------------------...........LSLSENIFNE
K3XX39_SETIT/77-423......-----------------------------------------------------..........NSMVEKDCFTR
K7UV86_MAIZE/134-473......-----------------------------------------------------.............VAMGEFAA
M1BSP6_SOLTU/313-684......-----------------------------------------------------..........QPSISETIFSN
Q7XPT9_ORYSJ/274-639......-----------------------------------------------------..........KYTWKDHCFAE
U1GTL6_ENDPU/245-629......-----------------------------------------------------...........TSEVGQAIEA
H2AMI9_KAZAF/241-641......-----------------------------------------------------..........YPNLKESVVTT
A9SHU0_PHYPA/294-653......-----------------------------------------------------.........ANGAYIDECLYK
M0X2R1_HORVD/229-589......-----------------------------------------------------..........SGTAVDLCFYE
B9SQM4_RICCO/281-628......-----------------------------------------------------..........ESNVWMGCFAK
C5YI28_SORBI/233-588......-----------------------------------------------------..........DEDLGHECFAD
G2Q2Y8_MYCTT/252-644......-----------------------------------------------------...........REDWGPVLEA
B9GMP7_POPTR/287-658......-----------------------------------------------------..........HPSISQRLFCH
D8QQ88_SELML/278-638......-----------------------------------------------------..........LEPHREECIVA
I1IU36_BRADI/316-680......-----------------------------------------------------...........SGVGRAVFAD
Q7XVB9_ORYSJ/303-673......-----------------------------------------------------..........SDELRDECFVE
M0T4W9_MUSAM/300-646......-----------------------------------------------------..........HPAVSDRLFRR
C5Y540_SORBI/271-624......-----------------------------------------------------..........VNFNRGHCFAE
Q6YYS2_ORYSJ/156-522......-----------------------------------------------------............AADHAQFTG
S3C6C9_OPHP1/275-678......-----------------------------------------------------...........RDDWGPAFQN
Q0DD48_ORYSJ/61-408......-----------------------------------------------------..........DSKVEEDCFAR
D8T120_SELML/259-622......-----------------------------------------------------..........LDPYREACFAE
L0PB59_PNEJ8/240-610......-----------------------------------------------------............ENYGNILLT
G0V7P9_NAUCC/234-618......-----------------------------------------------------..........YPSYKPIIMKN
S8BBP5_DACHA/239-612......-----------------------------------------------------...........SENWLKVYTL
N1PXJ6_DOTSN/246-630......-----------------------------------------------------...........REEWGAVFEA
F6I1N2_VITVI/270-640......-----------------------------------------------------..........YPEIFSSQFSN
M0UL49_HORVD/11-372......-----------------------------------------------------..........SQSLRDKCFSA
F0ZNQ9_DICPU/422-793......-----------------------------------------------------...............GNQYHT
D7L7W1_ARALL/228-598......-----------------------------------------------------..........SVSLRESCFRD
M0SVR7_MUSAM/268-627......-----------------------------------------------------.........GPRDVALSCFAE
M1C5W1_SOLTU/259-619......-----------------------------------------------------..........SKTINETCFSD
C5XFH3_SORBI/239-578......-----------------------------------------------------.............FRDEYLLA
K7LHG0_SOYBN/296-660......-----------------------------------------------------..........SQSISEACFAE
M0UGE8_HORVD/125-479......-----------------------------------------------------..........DRKVEEDCFAR
B9T911_RICCO/241-598......-----------------------------------------------------..........SASITESCFAE
A5DE46_PICGU/208-600......-----------------------------------------------------..........IAIDHHKIVSS
A2DS47_TRIVA/252-593......-----------------------------------------------------............DKYKSPFQN
C5Z4E3_SORBI/185-593......-----------------------------------------------------..LATGKIMAERE........
U5CSC4_AMBTC/276-637......-----------------------------------------------------..........IDSLRDQCFAE
M0T8R9_MUSAM/272-640......-----------------------------------------------------..........SEELRDECFSE
M0T1U3_MUSAM/274-635......-----------------------------------------------------..........IGSVKDQCFSE
Q5N6V1_ORYSJ/25-367......-----------------------------------------------------.............FKNDYFMA
G8BXH6_TETPH/237-621......-----------------------------------------------------..........KNDYKSFVIGD
E9D819_COCPS/246-624......-----------------------------------------------------...........PDQQGKALQS
Q9LMJ4_ARATH/247-592......-----------------------------------------------------.........PVSSVTDLSFME
D7L7W0_ARALL/233-602......-----------------------------------------------------..........SDAIRESCFSD
E70B1_ARATH/265-614......-----------------------------------------------------..........FSSAADLSFME
E3Q9K9_COLGM/252-632......-----------------------------------------------------...........REDWGPLFQA
F6GSY9_VITVI/271-629......-----------------------------------------------------..........FGSINPICFVE
G1MYP9_MELGA/336-701......-----------------------------------------------------...........EHHQKKTFDS
D7M573_ARALL/269-636......-----------------------------------------------------.........DHASIRKRLFTG
E1Z8T0_CHLVA/286-659......-----------------------------------------------------...........PSEQAAVLSQ
B9GF67_POPTR/330-700......-----------------------------------------------------..........YSSISSSLFSN
G4MVD0_MAGO7/250-629......-----------------------------------------------------...........REDWAPLFQA
G9MGQ5_HYPVG/255-640......-----------------------------------------------------...........REDWGPILQA
W1PMJ7_AMBTC/280-638......-----------------------------------------------------...........GAMADSLFQN
U5FZC2_POPTR/63-424......-----------------------------------------------------..........SQTIRESCFSE
W5BVL2_WHEAT/184-551......-----------------------------------------------------..........KHAWKDHCFAA
EXO70_SCHPO/249-608......-----------------------------------------------------...........QVTAKALYPK
B9R6Z3_RICCO/301-666......-----------------------------------------------------.........MDGVVWLECFVK
B9SF67_RICCO/265-616......-----------------------------------------------------..........FSSAADLSFME
K4C312_SOLLC/207-568......-----------------------------------------------------..........SVNIRDSCFSE
A9T7C4_PHYPA/238-605......-----------------------------------------------------..........PVSVACSCFNE
K7LIX4_SOYBN/109-470......-----------------------------------------------------..........FDSLSDQCFAE
M7ZQD7_TRIUA/1206-1561......-----------------------------------------------------..........DAATEEECFTE

PF08700

Q5KJF4_CRYNJ/98-180.R------------------------------------------------------------------------------
EXO84_ASHGO/127-213.L------------------------------------------------------------------------------
COG5_MOUSE/37-120..------------------------------------------------------------------------------
EXO84_CRYNJ/142-228.E------------------------------------------------------------------------------
Q6BJZ0_DEBHA/76-158.Q------------------------------------------------------------------------------
Q0U0Z3_PHANO/76-170.K------------------------------------------------------------------------------
Q0WQ75_ARATH/43-129.E------------------------------------------------------------------------------
Q173I8_AEDAE/5-87.A------------------------------------------------------------------------------
A2D783_TRIVA/6-88.A------------------------------------------------------------------------------
Q7Q6Z6_ANOGA/11-97.K------------------------------------------------------------------------------
Q2UQ54_ASPOR/108-197.S------------------------------------------------------------------------------
VPS51_YEAST/84-163.K------------------------------------------------------------------------------
A2E266_TRIVA/29-115.P------------------------------------------------------------------------------
Q2U987_ASPOR/1-88.P------------------------------------------------------------------------------
Q6FRQ2_CANGA/66-146.K------------------------------------------------------------------------------
Q6CSC3_KLULA/100-179.K------------------------------------------------------------------------------
A0A016Q0X2_GIBZA/128-214.D------------------------------------------------------------------------------
Q75HJ9_ORYSJ/40-126.K------------------------------------------------------------------------------
EXOC8_MOUSE/13-100DR------------------------------------------------------------------------------
A0A0D1E7D8_USTMA/79-161.K------------------------------------------------------------------------------
Q8I2A9_PLAF7/116-202.Y------------------------------------------------------------------------------
Q6CG64_YARLI/77-166.K------------------------------------------------------------------------------
Q4E335_TRYCC/3-85.E------------------------------------------------------------------------------
EXO84_YARLI/121-207.E------------------------------------------------------------------------------
Q4MZL9_THEPA/63-149.S------------------------------------------------------------------------------
COG1_SCHPO/7-89.A------------------------------------------------------------------------------
Q59L27_CANAL/17-99.S------------------------------------------------------------------------------
Q2UHE7_ASPOR/121-207.E------------------------------------------------------------------------------
Q7RZT4_NEUCR/9-91.P------------------------------------------------------------------------------
E9AC89_LEIMA/3-81.E------------------------------------------------------------------------------
A2GBI6_TRIVA/24-110.H------------------------------------------------------------------------------
Q4Y221_PLACH/14-100.D------------------------------------------------------------------------------
VPS51_DICDI/178-264.N------------------------------------------------------------------------------
VPS51_SCHPO/52-138.A------------------------------------------------------------------------------
Q9FFF3_ARATH/21-103.S------------------------------------------------------------------------------
A0A0D1CLQ0_USTMA/184-270.S------------------------------------------------------------------------------
COG1_DICDI/113-195.E------------------------------------------------------------------------------
A2FRD0_TRIVA/32-118.H------------------------------------------------------------------------------
A0C9R8_PARTE/6-92.Q------------------------------------------------------------------------------
EXO84_CANGA/190-276.V------------------------------------------------------------------------------
Q754G8_ASHGO/53-137.D------------------------------------------------------------------------------
VPS51_CHICK/57-143.G------------------------------------------------------------------------------
Q95Q35_CAEEL/9-99TR------------------------------------------------------------------------------
Q6C0N6_YARLI/24-102.A------------------------------------------------------------------------------
Q4DYG1_TRYCC/45-131.K------------------------------------------------------------------------------
Q5ZAZ1_ORYSJ/7-89.P------------------------------------------------------------------------------
B4QW21_DROSI/4-89GS------------------------------------------------------------------------------
Q5KKF4_CRYNJ/54-139.S------------------------------------------------------------------------------
Q7S488_NEUCR/124-217.A------------------------------------------------------------------------------
Q84K25_ARATH/20-102.D------------------------------------------------------------------------------

PF06148

Q0TYI9_PHANO/26-159--------------------------------------------------------------------------------
Q29BE0_DROPS/22-154--------------------------------------------------------------------------------
Q7QFV1_ANOGA/25-157--------------------------------------------------------------------------------
Q84LH7_ORYSJ/24-156--------------------------------------------------------------------------------
Q01CT5_OSTTA/52-184--------------------------------------------------------------------------------
Q5K8I4_CRYNJ/34-165--------------------------------------------------------------------------------
A1C4Y0_ASPCL/32-165--------------------------------------------------------------------------------
Q2UA29_ASPOR/27-160--------------------------------------------------------------------------------
COG2_HUMAN/15-147--------------------------------------------------------------------------------
Q0C728_AEDAE/17-149--------------------------------------------------------------------------------
A8WN13_CAEBR/23-155--------------------------------------------------------------------------------
Q383M1_TRYB2/46-232--------------------------------------------------------------------------------
Q4DNE3_TRYCC/72-246--------------------------------------------------------------------------------
Q4Q0F6_LEIMA/80-262--------------------------------------------------------------------------------
A0CKT7_PARTE/12-141--------------------------------------------------------------------------------
COG2_DICDI/53-185--------------------------------------------------------------------------------
F4JRR1_ARATH/31-163--------------------------------------------------------------------------------

PF10392

Q5KKM0_CRYNJ/10-154DL------------------------------------------------------------------------------
COG5_HUMAN/66-189QA------------------------------------------------------------------------------
Q6BT79_DEBHA/15-147EL------------------------------------------------------------------------------
Q5B379_EMENI/829-961PL------------------------------------------------------------------------------
Q5APN5_CANAL/17-149HL------------------------------------------------------------------------------
COG5_SCHPO/8-139NE------------------------------------------------------------------------------
COG5_YEAST/14-146IL------------------------------------------------------------------------------
Q9C9V9_ARATH/57-180SG------------------------------------------------------------------------------
Q0U7T7_PHANO/13-145PL------------------------------------------------------------------------------
Q2HI55_CHAGB/25-157PL------------------------------------------------------------------------------
Q6CLE2_KLULA/11-144VL------------------------------------------------------------------------------
COG5_DICDI/63-186VS------------------------------------------------------------------------------
Q6C2T6_YARLI/5-136DI------------------------------------------------------------------------------
Q75B18_ASHGO/11-144KL------------------------------------------------------------------------------
Q6FTM6_CANGA/9-140EL------------------------------------------------------------------------------
Q65XH1_ORYSJ/52-175SG------------------------------------------------------------------------------

PF04124

COG8_MOUSE/56-394LG------------------------------------------------------------------------------
COG8_SCHPO/15-354FK------------------------------------------------------------------------------
COG8_YEAST/28-381LD------------------------------------------------------------------------------
COG8_CAEEL/10-353TV------------------------------------------------------------------------------
Q9LYH5_ARATH/29-412LE------------------------------------------------------------------------------
COG8_DROME/37-379LD------------------------------------------------------------------------------
Q9P3N9_NEUCS/31-347TA------------------------------------------------------------------------------

PF15469

Q5KNA8_CRYNJ/115-308AV------------------------------------------------------------------------------
A7TRG2_VANPO/143-342ST------------------------------------------------------------------------------
G8BMU6_TETPH/145-338AN------------------------------------------------------------------------------
C5DYM3_ZYGRC/146-354NR------------------------------------------------------------------------------
G8ZXE8_TORDC/144-345SK------------------------------------------------------------------------------
H2AR86_KAZAF/151-365TT------------------------------------------------------------------------------
G0VBU0_NAUCC/150-340SK------------------------------------------------------------------------------
G0WGP4_NAUDC/153-350SQ------------------------------------------------------------------------------
Q6FVL5_CANGA/149-372EK------------------------------------------------------------------------------
E7QCY0_YEASZ/146-360YQ------------------------------------------------------------------------------
C5DMT2_LACTC/144-330ST------------------------------------------------------------------------------
G8JTD1_ERECY/120-302ST------------------------------------------------------------------------------
Q750U7_ASHGO/122-304AS------------------------------------------------------------------------------
Q6CQH1_KLULA/148-350ND------------------------------------------------------------------------------
C4R5S5_PICPG/139-344AR------------------------------------------------------------------------------
Q6CGI4_YARLI/146-334RL------------------------------------------------------------------------------
W1QF47_OGAPD/153-339ME------------------------------------------------------------------------------
C4YAI9_CLAL4/138-372RS------------------------------------------------------------------------------
G8Y2A4_PICSO/149-393KN------------------------------------------------------------------------------
C5MH42_CANTT/104-348KH------------------------------------------------------------------------------
G3AUN6_SPAPN/128-368KA------------------------------------------------------------------------------
G8BGG9_CANPC/145-407KA------------------------------------------------------------------------------
B6K5G3_SCHJY/147-340QS------------------------------------------------------------------------------
C4M2W7_ENTHI/111-299KN------------------------------------------------------------------------------
D6W674_TRICA/193-371RD------------------------------------------------------------------------------
B0W3D0_CULQU/193-383KE------------------------------------------------------------------------------
B3MVG4_DROAN/193-383KE------------------------------------------------------------------------------
G6D800_DANPL/194-372KE------------------------------------------------------------------------------
E2AW35_CAMFO/194-372RD------------------------------------------------------------------------------
E0VQL4_PEDHC/200-377RE------------------------------------------------------------------------------
E9G6B5_DAPPU/193-371KE------------------------------------------------------------------------------
B7PR09_IXOSC/148-326KD------------------------------------------------------------------------------
A8WPA7_CAEBR/200-378KD------------------------------------------------------------------------------
H3ERJ1_PRIPA/197-373KD------------------------------------------------------------------------------
A0A0I9R3C5_BRUMA/212-385KD------------------------------------------------------------------------------
C3XUC7_BRAFL/191-370KD------------------------------------------------------------------------------
F6YQX0_XENTR/198-380AK------------------------------------------------------------------------------
F7GSZ8_CALJA/50-227KD------------------------------------------------------------------------------
E4XNP2_OIKDI/201-392KD------------------------------------------------------------------------------
F6Q8U3_CIOIN/201-380KD------------------------------------------------------------------------------
G4VNQ3_SCHMA/214-394RD------------------------------------------------------------------------------
H2KP67_CLOSI/214-393RD------------------------------------------------------------------------------
F2UAY3_SALR5/207-386QK------------------------------------------------------------------------------
A9RNH0_PHYPA/252-430QS------------------------------------------------------------------------------
A9S1F4_PHYPA/259-437QA------------------------------------------------------------------------------
D8RD25_SELML/239-417QA------------------------------------------------------------------------------
D7KJZ0_ARALL/260-438QA------------------------------------------------------------------------------
Q7XMG2_ORYSJ/263-453QA------------------------------------------------------------------------------
F0ZXN2_DICPU/132-311KK------------------------------------------------------------------------------
F4PGL2_DICFS/126-305KQ------------------------------------------------------------------------------
A8PCF2_COPC7/122-323AS------------------------------------------------------------------------------
D8QDB4_SCHCM/114-323AS------------------------------------------------------------------------------
B8P2C9_POSPM/114-312AL------------------------------------------------------------------------------
G4TT08_PIRID/115-310AE------------------------------------------------------------------------------
A8PUN7_MALGO/110-314YV------------------------------------------------------------------------------
E6ZLD0_SPORE/109-315NL------------------------------------------------------------------------------
E3K655_PUCGT/121-321RK------------------------------------------------------------------------------
F4RSS6_MELLP/56-255RR------------------------------------------------------------------------------
F4PCT9_BATDJ/225-428RS------------------------------------------------------------------------------
D5GNN2_TUBMM/147-347RG------------------------------------------------------------------------------
G1XK06_ARTOA/190-398QE------------------------------------------------------------------------------

PF16528

C5DUD9_ZYGRC/539-743RE------------------------------------------------------------------------------
G0VJV4_NAUCC/543-749RE------------------------------------------------------------------------------
A7TL52_VANPO/508-712RQ------------------------------------------------------------------------------
G8ZS82_TORDC/494-698RD------------------------------------------------------------------------------
G8BNG7_TETPH/532-736RE------------------------------------------------------------------------------
G0W548_NAUDC/557-766RE------------------------------------------------------------------------------
EXO84_CANGA/545-749RD------------------------------------------------------------------------------
H2AXV4_KAZAF/523-731RE------------------------------------------------------------------------------
G8JS46_ERECY/478-682RN------------------------------------------------------------------------------
EXO84_KLULA/500-705KT------------------------------------------------------------------------------
G0S6E5_CHATD/457-657RM------------------------------------------------------------------------------
E3S512_PYRTT/452-652AA------------------------------------------------------------------------------
EXO84_YARLI/444-642QD------------------------------------------------------------------------------
D5GAW7_TUBMM/436-637AS------------------------------------------------------------------------------
C4R6S9_PICPG/506-717QE------------------------------------------------------------------------------
Q2H152_CHAGB/456-656RA------------------------------------------------------------------------------
C9S7T2_VERA1/440-640CV------------------------------------------------------------------------------
B2B2W1_PODAN/463-663CA------------------------------------------------------------------------------
H2Z9L4_CIOSA/281-487SR------------------------------------------------------------------------------
H2MTA2_ORYLA/303-507TE------------------------------------------------------------------------------
G3JE74_CORMM/450-655CS------------------------------------------------------------------------------
G0SXF2_RHOG2/870-1071VS------------------------------------------------------------------------------
EXO84_CRYNJ/449-651VP------------------------------------------------------------------------------
C5FKA5_ARTOC/433-633AS------------------------------------------------------------------------------
F4P2Q9_BATDJ/415-626IE------------------------------------------------------------------------------
G0R9T9_HYPJQ/449-649CA------------------------------------------------------------------------------
C7Z4G1_NECH7/445-645CA------------------------------------------------------------------------------
I1G637_AMPQE/287-497MK------------------------------------------------------------------------------
E7LRJ5_YEASV/465-668RE------------------------------------------------------------------------------
EXO84_ASPFU/445-645AA------------------------------------------------------------------------------
W4YYJ2_STRPU/291-496TD------------------------------------------------------------------------------

PF06248

ZW10_DROPS/10-571LR------------------------------------------------------------------------------
ZW10_ARATH/1-584LK------------------------------------------------------------------------------
A7SSG2_NEMVE/20-670VK------------------------------------------------------------------------------
A8XRG3_CAEBR/1-605TN------------------------------------------------------------------------------
ZW10_HUMAN/9-621AQ------------------------------------------------------------------------------
F1QYH5_DANRE/9-611AR------------------------------------------------------------------------------
F7EQH5_XENTR/9-617AH------------------------------------------------------------------------------
H3CQC8_TETNG/9-607AR------------------------------------------------------------------------------

PF04100

VPS53_HUMAN/39-453VV----------RGQTNVG--------------------QDGRQA-----L-EEAQKA----IQQLFG------------
Q9VQY8_DROME/42-434VV----------RGQTNTG--------------------QDGQLA-----L-CEAQKV----ISSLFS------------
VPS53_SCHPO/16-394YE----------DAKLSMG--------------------EK....-----M-DDLNSS----IVSLLQ------------
VPS53_YEAST/5-369HP----------KNSA...--------------------......-----.-.EIEAS----LRKVFQ------------
VPS53_CAEEL/30-390LV----------ETNANVS--------------------ERGEEA-----L-KHAQDA----MIELEK------------
VP53A_ARATH/1-424AV----------RQQSNSG--------------------TKAKED-----L-ADATRA----VEELSH------------

PF10475

Q7QF78_ANOGA/99-388LI----------LEQRAAC--------------------DGEFQR-----I-RDTERL----LRDTVT------------
Q336V4_ORYSJ/131-419HV----------MGHHEEM--------------------VKGMQL-----V-MELEQD----LKVANV------------
Q54MU4_DICDI/72-370RV----------RENYTEF--------------------VQGMSQ-----I-HEIGVE----LQRSTV------------
VPS50_CHICK/54-327..----------.......--------------------AAELER-----V-TSLQNG----LQLAAV------------
Q16RR9_AEDAE/70-360LI----------LEQRPAC--------------------NEEFQR-----I-QETEGL----LRETIA------------
A1ZAY8_DROME/75-362NI----------LEQRNAC--------------------SSEFAA-----I-NDTQKK----LEESLW------------
Q54NV0_DICDI/113-401LI----------RKSYNGF--------------------VQGMSQ-----V-YEIEKD----LTHSAR------------
Q8RXC2_ARATH/132-421HV----------MEHHEVM--------------------VKGMNL-----V-RELEKD----LKIANV------------
Q18602_CAEEL/76-363LI----------MQKSSSY--------------------TAQVGE-----M-EKIRDE----VGSVIN------------
A8XSD2_CAEBR/80-367LI----------MQKSSSY--------------------TNQVGE-----M-ENIREK----VNGVVD------------

PF04048

SEC8_SCHPO/51-191IA----------HTHKDDF--------------------TRGISA-----Y-GEIMEG----IQKCNS------------
Q69PQ1_ORYSJ/22-158VV----------HAYHHGF--------------------NKAIQN-----Y-SQILRL----FSESAE------------
Q59NP0_CANAL/27-168VV----------NEHYDLF--------------------NKSMGS-----Y-NTLLST----MKNSQE------------
A5E514_LODEL/26-167VV----------DEHYELF--------------------SNSIGS-----Y-HMLLSS----LNQSKQ------------
Q6BLA3_DEBHA/30-171VV----------NEHHDIF--------------------NNSIGS-----Y-HVLLST----LQDSQH------------
A5DKL1_PICGU/29-170VV----------SQHHEVF--------------------NNSIGS-----Y-HLLLSN----IDNSQA------------
A3LUX9_PICST/29-170VV----------NEHHELF--------------------NNSIGS-----Y-HLLLST----LQDSHS------------
Q75B87_ASHGO/33-174AA----------NEHYQTF--------------------ANSIAS-----Y-GQTVKY----LNDSRG------------
Q6CNM5_KLULA/34-175VA----------NDHYQAF--------------------NDSIAS-----F-SKTVYC----ITDAQD------------
A7TRV6_VANPO/35-176AV----------NEHYQAF--------------------NSNVAS-----Y-SVAVDS----ITVAQN------------
Q6FWA6_CANGA/35-176VV----------NQHSQAF--------------------NSNVAS-----Y-TQAVNA----ITKSQQ------------
Q6C3L8_YARLI/34-175VV----------NDNYQGF--------------------NSSVGS-----Y-RSIAQS----IAESHD------------
Q4WUD2_ASPFU/134-275VV----------NEHHQGF--------------------NSSIGT-----Y-HKIQSN----IQSSQN------------
SEC8_NEUCR/82-223IV----------HDHHQGF--------------------NSSIGT-----F-HKIQGS----IQSSQK------------
A0A0D1E3Z5_USTMA/441-580TV----------DDHYESF--------------------ASAITT-----H-NSVLQS----LTVAQT------------
E7M1P6_YEASV/34-174VV----------NEHSQVF--------------------NTNVAS-----Y-GKAVSS----IMQAQE------------
SEC8_ARATH/16-151VV----------HAYHGGF--------------------NKAIQN-----Y-SQILRL----FSESTE------------

PF06046

Q28ZN5_DROPS/179-731RI----------EGSKLEE--------------------RTDNKMWLVRDL-EIL...----RQNILE------------
Q5K9B3_CRYNJ/179-740SF----------EEYFLDN--------------------QHDF.......L-GFI.EG----LGWVYK------------
EX3L4_HUMAN/179-709RV----------RRPGAGW--------------------AFGEAEGASGLA-QLLAEL----GGLVRR------------
A5DIA8_PICGU/180-832IF----------DKCVEHF--------------------AHD........K-ILVFDN----LNWLED------------
Q0TXU6_PHANO/187-762QM----------DEAREKF--------------------NEDPEK.....I-D...KY----FKWYFN------------
EX3L1_BOVIN/188-722VH----------FGTSLQP--------------------GPGELAKWLEAL-RVA...----...LPA------------
SEC6_SCHPO/181-743NF----------QRAWVSY--------------------LEDGSG....E.-....LN----LDFIFE------------
TNAP2_MOUSE/157-688RL----------DAQPATA--------------------PEGRSEAESRFL-HMG...----.RTMKE------------
A5DY39_LODEL/293-930TF----------ARCEEHF--------------------SND........R-MALYDN----LDWLYE------------
A0A0D1DY75_USTMA/258-828LF----------DECWSRF--------------------GAKDSS.....L-EFL.AH----LDWIYD------------
A4RYX1_OSTLU/92-690RL----------ALIAEGF--------------------SGLDDKE..SIE-HVV.GA----LDESLV------------
Q6DJR6_XENTR/177-732RI----------EGSQADT--------------------RESDKMWLVRHL-EII...----RRYMLE------------
A3LNE6_PICST/180-819TF----------NACINHF--------------------SED........R-MLVYEN----LDWLED------------
Q8SU74_ENCCU/160-687KF----------DRLRN..--------------------...........E-EIFVNR----MDFVLK------------
Q16I77_AEDAE/179-730RI----------EGSKLEE--------------------RSDNKLWLVRDL-ELT...----RQFLLE------------
Q5RG40_DANRE/161-694RL----------KNADGQE--------------------NKADKLSTSLKR-EVC.RT----GKQVQK------------
Q6CU40_KLULA/178-794MF----------TEVRNEY--------------------SGDKK......F-DVL.NN----LDWVFN------------
Q5BBU2_EMENI/183-758QF----------EDTKEKF--------------------LDDPEG.....L-E...KS----FRWFFN------------
Q6FPK2_CANGA/177-798MF----------IEVRKEY--------------------DGDKK......F-DVL.NN----LDWVFN------------
A7F9Q6_SCLS1/177-755NL----------EGTKQAF--------------------LEDPTK.....L-E...KG----LRWFFN------------
Q6C9T6_YARLI/183-804SF----------EACIESF--------------------PG..DC.....I-TLL.EN----LAWIYT------------
EX3L1_MOUSE/189-722VH----------FASPVLP--------------------EPGALAGWLEAL-QVA...----...LPA------------
EX3L1_DANRE/206-763RF----------RSVSYLH--------------------TRG..PGLASHL-SAL...----QHCIMG------------
EXOC3_DICDI/183-774KF----------EPMFLNS--------------------HNDL.......V-QTL.KD----VNKMVD------------
TNAP2_HUMAN/122-651RM----------GQRPAA.--------------------..GAEVPESVFL-HLG...----.RTMKE------------
Q6BJB6_DEBHA/180-833TF----------DKCVEHF--------------------SYD........R-ILVYDN----LNWLED------------
EX3L4_MOUSE/181-708SV----------QQAGAKV--------------------IPGAAEGSSDLA-QLLAEL----GGVVRH------------
Q5A7K3_CANAL/180-812IF----------DSCVEYY--------------------GND........K-ILVYDG----LYWLED------------
A6RAW7_AJECN/390-965QF----------EKSKETF--------------------LDDPEK.....L-E...KS----FKWFFN------------
E7KDN6_YEASA/178-797MF----------GEMREKY--------------------VGDQK......F-DVL.DN----MDWIFN------------
H3DL97_TETNG/187-739RI----------EGTQSVT--------------------REVDKMWLVRLL-EI...T----RKYVLD------------
EXOC3_HUMAN/188-743RI----------EGTQADT--------------------RESDKMWLVRHL-EII...----RKYVLD------------
Q1K527_NEUCR/175-753QF----------KESKEKF--------------------LGDPDM.....L-D...KS----LKWYFN------------
SEC6_ARATH/173-736RF----------NRLLTLV--------------------FED........L-KAALEE----ARMIGE------------

PF04091

W5E5N0_WHEAT/442-753RM..........YAR..SL--------------------AMSQ..-----M-MQLAGN....ISVLEH------------
A9S7S7_PHYPA/446-757LV..........RSP..TL--------------------GVSH..-----A-MQIAAN....MTVLET------------
H2WCC2_CAEJA/477-783FV..........DKR...L--------------------SMIQ..-----L-VQITIN....LGYLEK------------
T1EMI3_HELRO/450-756LI..........KKP..YL--------------------TLPQ..-----L-IQISIN....MEHLDQ------------
A9V537_MONBE/417-723LV..........RSA..GL--------------------NVQQ..-----L-TQISLN....TTQLEL------------
Q6BHQ3_DEBHA/494-826GINNDIQEFIDKNAN....--------------------NKEV..-----M-AQSYTN....LEYYLF------------
E9G3C4_DAPPU/410-716LI..........RKP..SL--------------------SLLQ..-----L-IQISIN....TNYLEE------------
B9GSB7_POPTR/457-761LI..........STS..VH--------------------GVSQ..-----A-MQVAAN....MAVLER------------
M7NJC8_PNEMU/439-739RL..........SLN....--------------------NLSQ..-----L-VQIIIN....LEHFEK------------
U1HWP6_ENDPU/444-743KL..........SVQ....--------------------YIGQ..-----I-VQILIN....LEHFET------------
G0VF38_NAUCC/501-841KL..........QST....--------------------SREE..-----I-AQILIN....LDYFIV------------
K5VZV5_AGABU/444-743QL..........ATT...T--------------------TVPQ..-----I-AQIVTN....VEHFQI------------
R9AG66_WALI9/449-747IA..........EGV...F--------------------NLSQ..-----A-VQLAVD....VSYFEF------------
D6X4X0_TRICA/433-740TF..........RSP..HI--------------------NLQE..-----I-IQIIID....TGYLEE------------
C5E4W3_ZYGRC/494-839KL..........DST....--------------------SREE..-----I-AQILIN....LDYFVI------------
G8ZUB2_TORDC/501-847KL..........DTT....--------------------SREE..-----I-AQILIN....LDYFII------------
G2RB31_THITE/448-748RL..........NSQ....--------------------YLGQ..-----I-VQILTN....LEHFEI------------
U5FMP1_POPTR/442-753TI..........HGG..AV--------------------GVSQ..-----A-MQIAAN....ISVLER------------
J9K5H0_ACYPI/421-724AF..........HQP..RL--------------------GLLQ..-----V-IQIIVD....TGYLEK------------
C4R087_PICPG/447-765KI..........EST....--------------------IKEV..-----I-AQNLIN....LEFFST------------
Q8S5T3_ORYSJ/442-753MV..........YAR..SL--------------------AMSQ..-----M-MQLAGN....ISVLEQ------------
M4DPW7_BRARP/456-760LI..........NTS..VH--------------------GVSQ..-----A-MQVAAN....MSVFER------------
G6DDP0_DANPL/419-720LF..........RRP...L--------------------PLTQ..-----L-VQIIVD....TQYLED------------
M3XK92_LATCH/505-811VI..........KKK..NV--------------------GLTE..-----L-VQIIIN....TTHLEQ------------
D5GMB3_TUBMM/427-725HL..........NSQ....--------------------YLGQ..-----I-VQILIN....LEHFEY------------
W1QAD1_OGAPD/459-774KI..........DSS....--------------------YKEE..-----V-SQNLIN....LEFFSR------------
U9TBU2_RHIID/147-443KL..........ESQ....--------------------NMSQ..-----I-VQIIIN....LEYFHD------------
A5DMM0_PICGU/482-811GISNDIKDFIDENSH....--------------------NKEV..-----I-SQTYVN....LEYYLY------------
R9P8Q0_PSEHS/445-756SL..........DST.ASI--------------------NLSQ..-----I-AQIIVN....AEHFNL------------
Q6C1W0_YARLI/480-793RL..........MTT....--------------------TREQ..-----I-VQILID....LQQFER------------
J3PJI4_GAGT3/450-750RL..........NSQ....--------------------YLGQ..-----I-VQILIN....LEHFET------------
G8YKH3_PICSO/492-824GISNDIKEFITKNQT....--------------------NKEV..-----V-SQSYTN....LEYYLF------------
J9EJI0_WUCBA/484-791FV..........ANK..KR--------------------TLIQ..-----L-VQITIN....IGYLEK------------
F6YT74_HORSE/409-715LI..........RKP..HI--------------------GLTE..-----L-VQIIIN....TTHLEQ------------
J4KKU7_BEAB2/450-750RL..........SSQ....--------------------YLGQ..-----I-VQILIN....LEHFET------------
I4YIZ3_WALMC/449-754IS..........EGI...Y--------------------NLSQ..-----A-VQLAVD....TSHLEL------------
F8PQ71_SERL3/445-743RL..........AGT...S--------------------TLSQ..-----I-AQIVTN....LEHFQV------------
G1XUE0_ARTOA/508-808RL..........TSK....--------------------YLGQ..-----I-VQILIN....LEHFET------------
A7TQS9_VANPO/506-845KL..........DTT....--------------------SREE..-----I-AQILIN....LDYFII------------
G3AZR4_CANTC/493-823GIVYDLRDFITKNSS....--------------------NKEI..-----L-SQSYTN....FEYYLF------------
B4R147_DROSI/428-730VF..........RQP..SI--------------------TLTQ..-----L-IQIIID....TQYLEK------------
S8FZN9_FOMPI/445-743RA..........QST...S--------------------NLSQ..-----I-VQIVAN....IEHLEI------------
K5W5P8_PHACS/445-743RA..........EAT...S--------------------NLSQ..-----L-AQIITN....LEHFEV------------
G2YIA1_BOTF4/452-752KL..........STQ....--------------------YLGQ..-----I-VQILIN....LEYFES------------
A8NWX8_COPC7/444-743RL..........AGT...S--------------------TLTQ..-----I-AQIVAN....LEHFQH------------
R4X791_TAPDE/443-739RL..........PRQ....--------------------RLEQ..-----V-VQMIIN....LENFEG------------
S9VV25_SCHCR/436-738RL..........KHLYPKL--------------------NLSQ..-----M-AQLVKN....FYAFEE------------
V2X5M8_MONRO/445-743RL..........AGT...S--------------------TLSQ..-----I-AQIVTN....VEHFQT------------
C5M2I2_CANTT/488-818GIGYEIEQFINRNEN....--------------------NKEI..-----T-AQTYTN....LEYYLL------------
I2H3Y9_TETBL/508-832KL..........DTT....--------------------SREE..-----L-AQILIN....LDYFII------------
Q17EP0_AEDAE/419-722VF..........RSP..SL--------------------ALMQ..-----V-IQIIID....TQYLEK------------
M2ZTI7_PSEFD/439-745RL..........SSQ....--------------------YPGQ..-----I-VQILTN....LDHFEQ------------
I1MM64_SOYBN/441-752TI..........NSG..NI--------------------SVSQ..-----A-MQLAAN....ITVLER------------
B6K595_SCHJY/439-743QL..........TDRLPRL--------------------GISQ..-----V-AQVVQN....FDAFEE------------
U4LHC9_PYROM/436-732RL..........QSN....--------------------NLGQ..-----L-VQILIN....LEQFET------------
G3Q4R1_GASAC/450-759AI..........KKK..NV--------------------GLAE..-----L-VQVIIN....TTHLEQ------------
Q753S5_ASHGO/494-834KL..........DTT....--------------------SREE..-----I-AQILIN....LDYFIV------------
Q5KPL0_CRYNJ/450-754KL..........QTM...L--------------------NLSQ..-----I-AQVVIN....LEHFCT------------
C4Y6U1_CLAL4/493-821GICNDIKEFISKNSN....--------------------NKEI..-----V-AQSYTN....LEYYLF------------
E0VNA5_PEDHC/435-739LF..........RKP..GL--------------------GLLQ..-----V-VQIIID....IGYLEK------------
Q7RYL2_NEUCR/451-751RL..........NSQ....--------------------YLGQ..-----I-VQILIN....LEHFEE------------
H6BY38_EXODN/444-761KL..........SSQ....--------------------YLGQ..-----I-VQILIN....LSHFTT------------
J7R131_KAZNA/509-861KL..........DSK....--------------------SREE..-----I-SQILIN....LDYFII------------
M0S2D5_MUSAM/444-755VI..........HTG..NL--------------------DVSQ..-----A-MQIAAN....IAVLEC------------
H2YEW6_CIOSA/141-441LV..........QKP..SL--------------------GLTE..-----L-VQIIVN....TTHLEN------------
M7XX30_RHOT1/453-763RL..........NMI...S--------------------NLSQ..-----L-AQIVVN....VLFFQT------------
M2RQV4_CERS8/445-743RA..........QST...S--------------------NFSQ..-----I-TQIATN....LEHFEV------------
M2N0E3_BAUCO/446-755RL..........KSQ....--------------------YPGQ..-----I-VQILTN....VDHFEQ------------
F4S5J6_MELLP/471-780RV..........QNT...R--------------------NLSQ..-----L-SQIVIN....LQFFQT------------
H3CIW2_TETNG/458-766AI..........KKK..NV--------------------GLAE..-----L-VQVIIN....TTHLEQ------------
I3MQ17_ICTTR/423-732LI..........RKP..HI--------------------GLTEEY-----F-IELIINHLLIPSNFKN------------
M1CVC4_SOLTU/449-755TI..........YSG..TT--------------------GVSQ..-----A-MQIAAN....IAVFER------------
H2B145_KAZAF/504-852KL..........DST....--------------------SREE..-----I-SQILIN....LDYFII------------
C8V0B6_EMENI/444-742RL..........NSQ....--------------------YLGQ..-----I-VQILIN....LEHFEH------------
D7TQV0_VITVI/442-753TI..........NSG..TT--------------------GVSQ..-----A-MQIAAN....IAVLEK------------
U5HF68_USTV1/463-770RL..........RMI...S--------------------NLSQ..-----L-SQIVVN....VLFFQT------------
SEC15_SCHPO/436-738RL..........KSLYPKL--------------------ALSQ..-----M-SQLVKN....FYAFED------------
K2SGN8_MACPH/382-681RL..........SSQ....--------------------YPGQ..-----I-VQILTN....LEHFET------------
N1JD47_BLUG1/449-748RL..........SVQ....--------------------YLGQ..-----I-VQILIN....LEHFEI------------
W5C2B9_WHEAT/447-753LI..........HNG..SL--------------------EIAQ..-----L-VQIAGN....IAILER------------
U5D3X0_AMBTC/442-753AI..........YGN..TS--------------------VVSQ..-----A-MQMAAN....ITVLER------------
A6R9C0_AJECN/444-745RL..........GSQ....--------------------YLGQ..-----I-VQILIN....LEHFEV------------
Q6CYE5_KLULA/489-828KL..........DTT....--------------------SREE..-----I-AQILVN....LDYFVI------------
T1ICC1_RHOPR/422-724VF..........RKP..GL--------------------GLMQ..-----V-IQIIID....TRYLED------------
U7Q2U4_SPOS1/452-752RL..........SSQ....--------------------YLGQ..-----I-VQILIN....LEHFET------------
V5ESV2_PSEBG/448-756SL..........SST..EV--------------------NLPQ..-----I-AQIVVN....AEHFNL------------
M9MGV3_PSEA3/448-761SL..........DNT.AAI--------------------NLSQ..-----I-AQIVVN....AEHFNL------------
M2T372_COCH5/443-742RL..........SSQ....--------------------YPGQ..-----I-VQILTN....LEHFEN------------
B0CXV0_LACBS/444-743RL..........GGT...P--------------------TLNQ..-----I-GQIITN....LEHFQV------------
A8Q0J7_MALGO/448-754TV..........EQS...T--------------------NLSQ..-----I-AQIIVN....IEHFQL------------
L8GBJ1_PSED2/444-744RL..........NSQ....--------------------YLGQ..-----I-VQILIN....LEHFET------------
K1PXL0_CRAGI/475-788LI..........KRR..DL--------------------TLLQ..-----L-IQIAIN....MNYLEK------------
T1K0Q9_TETUR/511-835LI..........KKP..SL--------------------GLLQ..-----L-IQIAIN....TNYLED------------
W4YBC1_STRPU/461-764LI..........RKR..CL--------------------GLTE..-----L-VQVTVN....TIHLEN------------
I2FTP7_USTH4/451-766SL..........DDT.KGN--------------------SLAQ..-----I-SQIVVN....AEHFNL------------
M4CSR8_BRARP/401-712TI..........NNN..SI--------------------GVAQ..-----A-MQIAAN....ISFLEK------------
SEC15_YEAST/521-864KL..........EST....--------------------SREE..-----I-AQILVN....LDYFII------------
I1LA00_SOYBN/442-753KI..........NSD..HV--------------------TVPQ..-----L-MQIAAN....IAVLER------------
D5G5B6_TUBMM/397-695RL..........TSK....--------------------YLGQ..-----I-VQILIN....LEQFEY------------
S2IZP1_MUCC1/463-761KL..........QST....--------------------NLSQ..-----I-VQIIIN....IEYFES------------
K0KMH2_WICCF/500-804KL..........KLI....--------------------TREE..-----L-SQNLIN....LEYFLI------------
A3LS60_PICST/480-811GICRDIQDFIAKNEN....--------------------NKEV..-----T-SQSYTN....LEYYLF------------
C5DLI6_LACTC/498-839KL..........DTT....--------------------SREE..-----I-AQILIN....LDYFIV------------
G3AHA4_SPAPN/460-784GIAYDIEDFVKRNAT....--------------------NKEI..-----V-AQTYTN....LEYYLF------------
G8BTV9_TETPH/518-863KL..........DTT....--------------------SREE..-----I-AQILIN....LDYFII------------
G4TCP0_PIRID/445-744KV..........KES...Q--------------------GFSQ..-----I-AQSVIT....LEYFEN------------
G8BIA4_CANPC/483-815GIAWEIEDFIRKNST....--------------------NKEV..-----T-AQSFVN....LEHYII------------
E6ZRP7_SPORE/448-761SL..........DNT.AAI--------------------NLSQ..-----I-AQIVVN....AEHFHL------------
Q6FRK2_CANGA/501-841KL..........ETT....--------------------SREE..-----I-AQLLIN....LDYFVI------------
G0WGH4_NAUDC/507-859KL..........EST....--------------------SREE..-----I-AQILIN....LDYFII------------
E3KWD2_PUCGT/502-831QI..........NLT...K--------------------NLSQ..-----L-AQIVIN....TLFFLT------------
K7IYQ6_NASVI/422-728LF..........RKP..SL--------------------ALLQ..-----V-VQIIIN....TEYLEK------------
A0A0D1DRH1_USTMA/446-764SL..........DNTRASI--------------------NLSQ..-----I-AQIVVN....AEHFNL------------
C3ZIQ9_BRAFL/402-708HI..........KKQ..TL--------------------GMAE..-----L-VQISIN....TTHLET------------
D8PS05_SCHCM/445-743RL..........AGT...S--------------------TFSQ..-----I-AQIITN....LEYFQG------------
A5E457_LODEL/496-826GVAWEIEDFINKNAN....--------------------NKEV..-----I-AQSFVN....SEYYLL------------

PF09763

Q5K9I2_CRYNJ/487-1172LL----------QIVE-----------------------VPAD-------D-LHTLIK----.EPPSS--EQGVKAL..E
Q75AA6_ASHGO/631-1297IL----------DSVS-----------------------LAES-------S-LEELLN----.LSLVE--KN.LDKI..E
A5DBH0_PICGU/595-1282VL----------SKIS-----------------------INAD-------D-LRDIES----FTQFDR--LNLLEPL..E
A3GH85_PICST/638-1329IL----------SKVS-----------------------VNSD-------D-LRIIEG----FTEFDR--LNKLENL..E
Q6FRC5_CANGA/652-1329LL----------KIVS-----------------------LDEE-------T-LNKLLN----.CPIRE--KN.LPWI..E
Q2UK85_ASPOR/702-1427LL----------KTLS-----------------------ISSV-------E-LRSLKE----.ASLSN--PDGLRDT..E
A7TSV5_VANPO/776-1455LL----------NTVS-----------------------LDEN-------A-LNELLS----.STISE--RS.LPRI..E
Q6CQX3_KLULA/540-1218IL----------NSVS-----------------------IDEK-------S-LHELLR----.LPMSK--TS.IERM..E
Q57ZX4_TRYB2/198-1064VR----------GQLN-----------------------LPPQ-------V-TALLQR----VGEARS--EDLEEFLSNE
EXOC1_DROME/198-866VI----------SQLD-----------------------LPHS-------Q-QQALDE----.PDLKT--ANGRKAA..I
A7E4X8_SCLS1/708-1443LL----------DTIS-----------------------ISSS-------Q-LESLKT----.ASLER--PHDLELV..E
Q6C0U5_YARLI/751-1484IL----------DTMS-----------------------VPQR-------E-MEIIRR----.VRLDS--AQDVAYA..E
Q2GRZ6_CHAGB/575-1334LL----------ETCA-----------------------ISES-------D-LDALKM----.APLET--AAGVEDI..E
A7RVQ5_NEMVE/163-846LV----------NTLD-----------------------IPER-------H-IIALQE----.GDLSK--GLAVKEC..T
Q5TMX8_ANOGA/201-872VV----------TQLD-----------------------LPHV-------H-QLALTD----.TDL.T--PKGLPAA..I
A0A0D1E5C3_USTMA/474-1173LI----------NTIN-----------------------VDED-------A-IHSLTA----.GRLES--PEGVAQL..E
A5E4P0_LODEL/994-1796IL----------SKVS-----------------------INTS-------H-LQEIGS----FKEFSN--LNRIEDL..E
EXOC1_DICDI/107-855LI----------GLMT-----------------------LSDN-------T-ISTLTA----.PQFND--TKGLKMA..I
A3KPP9_DANRE/184-869LV----------NYMD-----------------------LSKG-------H-IKALQE----.GDLSS--PKGIEAC..I
E7LTP8_YEASV/640-1316LL----------KTVS-----------------------LDEI-------S-LNQLLE----.CPIRE--KN.LPWM..E
V5ILH3_NEUCR/647-1440LL----------ATCA-----------------------ISES-------D-LAALKV----.APLET--ATGVEEI..E

PF04129

VPS52_YEAST/47-607MV----------NDLM-----------------------IPPE-------L-IDDIIK-----GKINESWQDNITFI---
VPS52_SCHPO/1-508EI----------DGAI-----------------------LPPD-------L-IKTIST-----GDMDH......PSW---
Q9VMQ8_DROME/42-546FI----------EDMA-----------------------VSEE-------M-INIIME-----TPVTE......RDF---
VPS52_RAT/94-601LV----------DGLV-----------------------VPSA-------L-VTAILE-----APVTE......PRF---
VP52A_ARATH/93-587FV----------EDII-----------------------VPPK-------M-IDVIVD-----GEVNE......EYM---

PF15278

B6K1Q5_SCHJY/526-611IL----------NDSI-----------------------AGCD-------T-LFSTLN----------------------
YD6C_SCHPO/520-605QL----------QDCA-----------------------LGCE-------S-INSTIN----------------------

PF06419

F4PTE8_DICFS/25-669EQ----------EQALQKKD...................IDAS-------F-FEALKR----LSDIHK-----------E
D7TU00_VITVI/30-688EE----------ISALREED...................LNEN-------F-FKALSH----VQEIHA-----------N
K4CMR1_SOLLC/27-689EE----------INALREED...................LDDN-------F-FKALAH----VQEIHA-----------N
T1IZR2_STRMM/42-648EE----------VKSLRGTREGT................IDDN-------F-FAALKR----VKQIHD-----------D
E6ZVT0_SPORE/99-753AE----------RASIYSREVR.................VGEE-------L-FRAMDK----LQRIRS-----------E
E3QI24_COLGM/61-707NE----------IALLTSTAEP.................VDDS-------F-FAALHK----AKRVSK-----------D
G8ZRY6_TORDC/181-815VE----------DDIVTNGP...................VGAQ-------F-FDVVAK----AMNIKE-----------K
D0NH36_PHYIT/44-655EE----------VRVLYTENLADE...............DMDA-------F-FSTLER----VRQVKA-----------D
G2XGZ3_VERDV/42-689DE----------IATLTSSAEP.................VNED-------F-FAALAR----AKKISS-----------D
C5M6P2_CANTT/146-753YE----------EFVLNSGD...................LNDE-------F-FEILKR----AEQINE-----------N
S3D9N6_GLAL2/53-695DD----------VASLTSTAEP.................VDDR-------F-FAVLSR----AKRIQT-----------D
K1QJ12_CRAGI/42-639NE----------VKALRGNRDGS................LSQE-------F-FNSLNK----VKTIHN-----------D
E9EWT4_METRA/42-671PE----------LVALTSTAEP.................VDER-------F-FDALSK----ARKISK-----------D
C1GBA8_PARBD/57-738DE----------LISLTSSAEP.................VDDR-------F-YNALAR----MKQIHK-----------D
G0VHH4_NAUCC/184-845VE----------DDLIVNSP...................INAD-------F-FVVINK----VLKIKE-----------N
T1K467_TETUR/31-648HE----------IAILKGLPSKEDPHQPLP.........MTET-------F-FELLGK----CRQIHE-----------D
B9S1S6_RICCO/31-692EE----------INALREEE...................LNEN-------F-FKALSH----VQEIHA-----------N
G3J3T2_CORMM/115-739DE----------ELALTSTVEP.................VNDA-------F-FAALAK----AKKITQ-----------D
G3B3F3_CANTC/135-733YE----------EFSISSNE...................VNEE-------F-FKALVK----LDAINE-----------A
COG6_PICGU/138-737YE----------EYTLENGD...................ISDE-------F-FTVLAK----AEQVDQ-----------N
U1G9I0_ENDPU/55-707DD----------LTTLTNSTKP.................VDDR-------F-FQIMNR----VKQVRK-----------D
B7Q1K3_IXOSC/40-604DE----------LQALRTGSP..................GDDR-------F-FDALSR----AGRIHA-----------D
F1A3Z4_DICPU/25-688QE----------EYSLTNSTD..................IDSN-------F-YRALDR----LSEIQL-----------E
A5DUD8_LODEL/174-816YE----------EFILASGD...................LNHD-------F-FEALAK----AEQIVE-----------R
C5FL60_ARTOC/56-718ED----------VQALTSLAGP.................VDER-------F-FHILSR----VKQIHK-----------D
X1WYM6_ACYPI/29-624SE----------VACLRSNN...................VTPE-------F-FTALRK----TQNISN-----------N
COG6_CHAGB/47-689DE----------TAALTLTSEP.................VDDL-------F-FAVLAK----AKRISK-----------D
T1EFP4_HELRO/53-656EE----------KQALKTGRDGQ................LRSD-------F-FTALVR----VKQIHN-----------D
G4V7Z1_SCHMA/35-648KD----------AQILSSKISH.................ADDT-------F-FSALLR----GKEIKN-----------M
C1MX75_MICPC/28-699EE----------IALLKSDD...................VTGA-------F-FDALAR----VQEIHA-----------N
COG6_ASPCL/56-753EE----------LPVLTSLEEP.................IDDH-------F-FNVLAR----VKQVHH-----------D
R9NZP8_PSEHS/106-778AE----------RASIYSREVR.................VGND-------L-FQAMDK----LERIRS-----------E
M7T0Y3_EUTLA/61-714DE----------TASLTLTSEP.................VDDR-------F-FAVLAK----AKRIRK-----------D
B3N2A1_DROAN/35-627AE----------HQLLYGAAKDAP...............IVAD-------F-FKVLDR----VQSIHA-----------D
G3AM15_SPAPN/147-779YE----------EFVLSQGE...................LNEE-------F-FVTLKK----AESINE-----------N
COG6_DEBHA/142-759YE----------EYVLQNGE...................INDE-------F-FQVLIK----CEKIHE-----------N
COG6_DICDI/25-671QE----------EQSLVKKE...................IDSS-------F-YQTLDR----LSEIQN-----------E
D6WE56_TRICA/33-626DE----------LVALHGNKQKRDAP.............LTND-------I-FSALDH----IQKIHS-----------D
K1Y0X5_MARBU/53-696DD----------VATLTSSAEP.................VNDK-------F-FYNLAR----AKKIQN-----------D
R0IIQ7_SETT2/55-693ED----------VTVLTSTAEP.................VNEE-------F-FQILTR----VKKIHH-----------D
G2YFW1_BOTF4/53-688DD----------IALLTSTAEP.................VNDK-------F-FSILNR----AKKIQN-----------D
B3RLZ3_TRIAD/43-642SE----------IKILHGSRNDP................IKEE-------F-FDALDR----VKQIHN-----------D
M2NAU2_BAUCO/56-695AE----------LSILTASTEP.................VNDD-------F-FRVLTR----VKRIHH-----------D
COG6_MAGO7/54-703DE----------VAILTLTSEP.................VDDR-------F-FNVLAK----ARRIRK-----------D
N1PID3_DOTSN/58-692VD----------LATLTSTAQP.................VNGD-------F-FRILTR----VKKIHG-----------D
M7NMJ9_PNEMU/26-631ED----------LEILSSISKP.................VDER-------F-FKILFK----VKQIYL-----------N
G0WDG5_NAUDC/220-947IE----------DDIIINGP...................IDLE-------F-FKVINK----VLKIKK-----------N
U4LN57_PYROM/30-663ED----------IAILTSSVEP.................VDDR-------F-FNILQN----VKRIHN-----------D
F4NVM0_BATDJ/55-674TE----------IRLLATSSET.................VNTA-------F-FAALSR----VQNIQT-----------D
Q6NMI3_ARATH/31-678EE----------IKALREDE...................LNEN-------F-FQALSH----VQEIHS-----------N
A9SY28_PHYPA/31-697EE----------VTALREED...................ISEN-------F-FKALMR----VQEIHT-----------N
R4XC07_TAPDE/63-663SE----------VQVLSSQSI..................VNED-------F-FKCLHR----INAIHE-----------D
COG6_CANGA/184-819LE----------DDLIENGP...................LKEE-------I-FDIVDK----LTKMKE-----------H
A0A088AU02_APIME/31-620SE----------QNILHGSTRESP...............ITEE-------F-FSVVNR----VQEIHS-----------S
M3AVJ9_PSEFD/47-684PD----------LSSLTSTAEP.................VNDD-------F-FRILTR----VKKIHQ-----------D
G8BSH8_TETPH/181-817VE----------ENIIENGP...................VNAE-------I-FAVINK----IMLIKE-----------R
V5EQK1_PSEBG/40-699AE----------RASIYSREVR.................VAQD-------L-FGAMDK----LQRIRS-----------E
COG6_YEAST/190-824VE----------DDVITNGT...................IDNI-------F-FEVVKK----VINIKD-----------E
C4Y1K1_CLAL4/138-736YE----------EYVLSAND...................INDD-------F-FAALAR----AEAISE-----------R
C5DMM3_LACTC/169-799VE----------EDALINSN...................VGPE-------F-FEVMKK----LMRLKE-----------T
J4VQT6_BEAB2/59-673EE----------ELALTSAAEP.................VDEV-------F-FACLAK----AKRITQ-----------E
G8BDK2_CANPC/146-760YE----------EYMLVQGD...................LNDD-------F-FVALRK----AERIVE-----------D
A0A0C4DUI8_MAGP6/47-702DE----------VAILTLSAEP.................VDDH-------F-FSVLSK----ARRISK-----------D
COG6_ASHGO/167-791LE----------DEQLRNGE...................IEDS-------Y-LDVLDK----MMEIKE-----------R
D8T0Q7_SELML/31-672EE----------VYALREEE...................LNQN-------F-FKALSR----VQKIHA-----------N
COG6_SCHPO/44-649DD----------LIHLTSSTD..................VDDR-------F-YLILDK----AQEIHD-----------S
A4S9H0_OSTLU/72-716AH----------VDALTTVENASGENTEGASTAATAAPTLPSV-------F-FQALER----VKVIQG-----------N
M0TQE9_MUSAM/30-700DE----------INALREEE...................LGEN-------F-FKALVH----VQEIHA-----------N
E5ACR4_LEPMJ/80-720EE----------STILTSTAEP.................VNEE-------F-FQALTR----VKKIHH-----------D
Q6C1G5_YARLI/26-595RE----------MDILKGNDEV.................PFET-------F-KQVFIK----AQKIHK-----------D
A0A0D2XVZ8_FUSO4/62-692NE----------VAALTQTAEP.................VDDR-------F-FDALSK----AKKISK-----------D
C5GW18_AJEDR/57-748NE----------LASLTSTAEP.................VNDH-------F-FHALAR----MKQIHK-----------D
C1EEF9_MICSR/30-686EE----------ISALRTDDQ..................ITEK-------F-FSALAR----VQEIHG-----------N
W1QBZ5_OGAPD/148-758YE----------EHVLQNGD...................VDQE-------F-FNVVQK----VEKIYA-----------N
A8HUT2_CHLRE/30-678EE----------VAALQGEE...................VSPA-------F-FAALSR----VRAIHD-----------N
B0VZV1_CULQU/39-627TE----------HQTLYGATRDEP...............ITGE-------F-FNVLDH----VQLIHA-----------D
G0RKF7_HYPJQ/55-674DE----------IESLTSTMRP.................VDTS-------F-FSHLQK----ARRITL-----------G
Q00T18_OSTTA/88-728AQ----------VDALTTVEDDSAASVD...........LPAA-------F-FPALER----VKVIQS-----------N
COG6_CRYNJ/70-689SE----------LTALTSREVT.................IGQP-------L-FDALDH----VEKIRT-----------D
A2E714_TRIVA/27-593ED----------FACLEKGD...................IDDK-------F-FDAFSH----LEASQE-----------R
L8G9L6_PSED2/56-700DD----------IATVTSTAEP.................VNDE-------F-FIVLNR----AKQIQV-----------D
S2JPX5_MUCC1/49-650QE----------IKILSNMSEP.................VDNE-------F-FDALQH----LQQIHS-----------D
G9PA30_HYPAI/22-644DE----------IDLLTSTLKP.................VDDA-------F-FTCLQK----AKKITL-----------G
COG6_PHANO/55-693EE----------ATVLTSTAEP.................VNEE-------F-FQVLTR----VKKIHH-----------D
T5A889_OPHSC/60-688AE----------VAALTSTAEP.................VDER-------F-FQSLAR----AKRIIQ-----------D
G7XM19_ASPKW/58-742ED----------LLILTHAEEP.................IDDH-------F-FEVLAR----VKQVYR-----------D
N4VJY2_COLOR/52-699DE----------VASLTSTAEP.................VDDR-------F-FASLTK----AKRISK-----------D
C4R6S3_PICPG/154-788FE----------AHQLEFGE...................IDDS-------F-LEILKK----AESIHD-----------D
G8YLX1_PICSO/140-752YE----------EFILQNET...................VNDE-------F-FGVLNK----AEKMQQ-----------D
E1ZT97_CHLVA/34-681SE----------AAALQGEE...................MGDA-------F-FQALAH----VRQIHG-----------N
W1P048_AMBTC/29-693EE----------VNALREED...................LNEN-------F-FKALAH----VQEIHA-----------N
A0A0D2VZS5_CAPO3/71-723AE----------TAALSSSSAGSGAGSGSAGAAAAVPV.VNEA-------L-FSALAR----VREIHA-----------E
K7J084_NASVI/37-626DE----------LAVLHGSSREAP...............ITEE-------F-FIVINR----VQEIHS-----------S
C5DUZ7_ZYGRC/192-819LE----------DDIIANGE...................VDLE-------F-FKIVDK----ALQIKE-----------R
V5HY00_BYSSN/58-733ED----------LIVLTSAEEP.................VGDH-------F-FDVLAR----VKRVHH-----------D
U9U8S1_RHIID/50-658KE----------VTVITSPNSI.................IGQE-------F-FDALKH----LQQIHG-----------D
I1FMS4_AMPQE/123-704EE----------VGILAGGV...................VGEE-------L-FSVLHR----VKSIHE-----------D
COG6_PICST/163-782YE----------EFVLDSGD...................INDE-------F-FTVLKK----AEEINA-----------N
Q7QJN1_ANOGA/32-623AE----------HQMLYGAKRDAP...............ITAE-------F-FQVLDR----VQRIHT-----------D
COG6_ASPOR/122-808DD----------ILVLTSLEDP.................INDQ-------F-FEVLAR----VKQVHR-----------D
I1H7V6_BRADI/77-734EE----------IHALREED...................IDDK-------F-FKALLH----VQEIHS-----------N
F9XD71_ZYMTI/57-693AD----------LATLTSTAEP.................VNDD-------F-FRILTR----VKKIHE-----------D
J7S8L6_KAZNA/176-802VE----------DDIIQNSP...................VDER-------F-FEVVEK----VELIKD-----------N
COG6_CANAL/150-758YE----------EFVLNSGD...................LNNE-------F-FTTLAR----AERINE-----------N
F6SQE9_CIOIN/44-655EE----------VKIFRGSRDGN................LHPG-------F-FKVLEK----VQRIHS-----------D
B9N0R1_POPTR/31-709QE----------INALRDED...................LDDN-------F-FKALSH----VQQIHA-----------N
T1I707_RHOPR/34-617SE----------VTSLREGD...................INEE-------F-FRVLER----AATIHN-----------D
COG6_CAEEL/38-623EE----------LRELDECEQSGH...............LSEF-------F-FKVLER----CHEIRE-----------N
F7BIB8_HORSE/4-604DE----------MSLLRGTREGP................ITED-------F-FKALGR----VKQIHN-----------D
COG6_NEUCR/64-712DE----------VDALTLTSEP.................VDDL-------F-FTVLAK----AKKISR-----------D
M3D478_SPHMS/53-688ED----------LATLTSTAEP.................VNDD-------F-FRIMTR----VKKIHE-----------D
G8JRN3_ERECY/172-797LE----------VEQLDNGV...................IDES-------Y-FQIVNK----LMNIKE-----------R
R1EQ64_BOTPV/49-680DE----------LFTLTSTTEP.................VNDE-------F-FQLLTR----VKRIHH-----------D
I2H727_TETBL/181-823IE----------EDIITNSP...................VAKP-------F-FEIINK----VMTIKE-----------N

PF03081

B4LDS3_DROVI/323-697LA----------YNAIELV--------------------V..K-------D.AEAITQ----..RILR-----------C
Q5KMS6_CRYNJ/301-670TL----------ASPITLA--------------------N..K-------A.LSPTLS----..TLKK-----------Y
J3MBU4_ORYBR/165-513IG----------KVSV...--------------------M..K-------L.LN.YAK----..VLCI-----------K
G1XRU1_ARTOA/244-617TT----------QQALTVF--------------------S..N-------T.VRQLNK----..HIVS-----------F
W1PIG8_AMBTC/268-635IT----------KGPI...--------------------M..Q-------L.LN.FGE----..AVA.-----------I
S0EBU7_GIBF5/246-629TC----------QAAMAEL--------------------A..R-------T.LRELNA----..HIKS-----------H
K4BC35_SOLLC/279-644AS----------KASI...--------------------L..Q-------L.LN.FGE----..AIA.-----------I
Q60EX4_ORYSJ/154-509FV----------EATVCKM--------------------L..A-------F.ANSLVA----.VADKT-----------W
K3XWI2_SETIT/155-495AS----------AGAMLKL--------------------A..A-------A.VAALGS----......-----------.
Q6Z421_ORYSJ/101-458VA----------AHAG..I--------------------L..D-------F.LS.FGR----..AAA.-----------D
C5E0R8_ZYGRC/237-621IV----------IPLITAY--------------------T..R-------L.VNLNLD----..YVRS-----------N
Q6ES92_ORYSJ/192-594FA----------EESILRM--------------------L..A-------F.VDAATL----.AVVEE-----------D
Q9SIB0_ARATH/210-552IT----------SQTA...--------------------L..A-------L.FT.FPE----..KMA.-----------K
Q9LQP9_ARATH/238-587IT----------LQSA...--------------------L..N-------L.FI.FSL----..TVA.-----------K
F6GST9_VITVI/277-640TA----------KSCV...--------------------M..Q-------L.LN.FGE----..AVA.-----------I
G8ZSY9_TORDC/245-624TI----------KPLLGAY--------------------V..K-------L.VETNLA----..YVRK-----------N
I1LFL8_SOYBN/224-593LA----------RYVI...--------------------I..R-------L.LN.FAQ----..GAV.-----------L
M4F3N2_BRARP/219-571IT----------LDSA...--------------------L..T-------L.FI.FPV----..SVA.-----------R
W1NW13_AMBTC/231-604VV----------KGAT...--------------------L..Q-------L.FN.FAE----..AIS.-----------I
M0SRF8_MUSAM/218-582IS----------KSSI...--------------------L..Q-------L.LG.IAM----..AIA.-----------I
J7REJ7_NAUDC/235-618II----------TPLINSY--------------------C..K-------I.FNSNMK----..SIRN-----------D
D2UX81_NAEGR/218-569VV----------SPSLKIF--------------------K..E-------Q.AEDLAD----......-----------.
M4DQ92_BRARP/206-564IT----------LQSA...--------------------L..K-------L.FI.FPI----..TVA.-----------K
K3Z4M7_SETIT/235-602LT----------AKSL...--------------------S..I-------L.LS.FGD----..AVA.-----------K
B9S3S8_RICCO/351-722LV----------RGVM...--------------------I..Q-------L.LN.FTE----..GIA.-----------M
B7P4G4_IXOSC/289-655VV----------LPALEAT--------------------T..A-------E.GEALAN----..RVKR-----------C
F6H2V1_VITVI/283-641IA----------AQAG..I--------------------L..A-------F.LQ.FGK----..TVT.-----------E
Q9FNR3_ARATH/273-622IS----------KDAI...--------------------L..S-------L.LN.FGE----..AVV.-----------L
M0THS1_MUSAM/243-589IA----------GDAA...--------------------L..H-------F.LS.FPV----..SVA.-----------K
C5XNX2_SORBI/186-525AC----------KP.F...--------------------L..Q-------L.LS.FGK----..VIA.-----------A
A7TQI9_VANPO/237-621IV----------KPLLNAY--------------------V..R-------L.FNINIS----..MIKN-----------N
Q6L582_ORYSJ/123-524FT----------DTTISKM--------------------I..A-------F.AAALAA----..AGKA-----------G
K3XFC8_SETIT/312-653IA----------KQSV...--------------------M..K-------L.LK.AAS----..A...-----------.
E9G2G2_DAPPU/324-689IL----------RDALEMI--------------------C..H-------D.AESLSG----..RARR-----------S
M4ELV2_BRARP/227-592IS----------RERA...--------------------I..L-------L.FT.FPE----..IVAL-----------R
D7MQ70_ARALL/301-664TT----------KSCV...--------------------M..Q-------M.LN.FGE----..AVA.-----------I
M4E3U0_BRARP/64-418VT----------HSLA...--------------------I..Q-------L.LG.FYE----..AVA.-----------M
C5E318_LACTC/234-618IV----------TPVLNNY--------------------V..K-------L.VKLNIS----..LIKK-----------N
M0RFS4_MUSAM/240-598AC----------RPAA...--------------------A..G-------L.LS.FAY----..VVA.-----------A
M0S9N6_MUSAM/277-655VT----------VNSV...--------------------S..M-------L.LS.FGD----..SVA.-----------K
J3MUP3_ORYBR/158-521VA----------RGCV...--------------------L..Q-------L.IG.FVE----..AVA.-----------M
B9I6L2_POPTR/266-620VC----------RGAV...--------------------V..Q-------I.LN.FAD----..AIA.-----------I
E4X2L8_OIKDI/306-653IV----------SNSVAQL--------------------N..M-------T.AEKLLA----..ELNR-----------C
D7MSH8_ARALL/228-592IT----------QEGA...--------------------L..I-------L.FT.FPE----..YAA.-----------K
B9IK77_POPTR/253-654..----------.PLV...--------------------L..Q-------L.LTYFGE----..AIS.-----------T
M0RET8_MUSAM/246-597IA----------GEAA...--------------------L..Q-------F.LG.FPE----..SVA.-----------K
A9RYU9_PHYPA/273-621VT----------DSSV...--------------------H..M-------L.LS.FGE----..AIA.-----------R
Q69JW6_ORYSJ/346-696IA----------TQSI...--------------------K..K-------L.VA.CGS----..SMC.-----------.
M1AX18_SOLTU/275-644SS----------KGSI...--------------------L..H-------L.LK.FAE----..SVA.-----------I
M0ZQS8_SOLTU/207-577LA----------RSIV...--------------------I..Q-------I.LD.FAE----..AVS.-----------W
B8MLJ7_TALSN/245-625TC----------RSSLAEF--------------------S..K-------T.LRELNQ----..YIKS-----------N
I1I8W2_BRADI/260-643VC----------RGPV...--------------------L..Q-------L.LG.FAD----..AVA.-----------M
K7M841_SOYBN/188-545VC----------MKLT...--------------------I..C-------L.VS.FAD----.TIITT-----------T
M7S7Y8_EUTLA/245-627TC----------QAPLSEM--------------------T..R-------T.IRELNN----..HIKA-----------H
I1MUP7_SOYBN/290-649TA----------KGCV...--------------------M..Q-------L.LN.FGE----..AIA.-----------I
I1LR33_SOYBN/232-587IT----------KDGA...--------------------V..S-------L.FG.FPE----..MVA.-----------K
Q9LIA2_ARATH/266-643TV----------KAPM...--------------------M..Q-------L.LN.FGE----..AVS.-----------L
I1MBG5_SOYBN/274-630VC----------RGSA...--------------------I..Q-------L.LN.FAD----..AVA.-----------I
M2MJA4_BAUCO/246-630TC----------QNSLVAF--------------------A..S-------T.MRDLDA----..HVRE-----------N
B9RAG8_RICCO/276-630TA----------KGCV...--------------------M..Q-------L.LN.FGE----..AVS.-----------I
U7Q7I3_SPOS1/370-767TC----------QNALNEL--------------------A..R-------T.LRELNS----..HIKT-----------H
Q5TQS7_ANOGA/318-703LS----------QPSIEMV--------------------V..K-------D.AEQITS----..KVMR-----------S
E0VIX9_PEDHC/327-689II----------KSSMDMI--------------------V..Q-------D.GENIAS----..RAKK-----------C
EXO70_KLULA/234-616LC----------SPIIQNY--------------------L..K-------I.IRHNRQ----..LLKD-----------N
D8RZH2_SELML/269-629LA----------KGIM...--------------------M..Q-------L.LC.FGE----..AVA.-----------I
B9HPL3_POPTR/209-568IT----------REGA...--------------------L..S-------L.FV.FPE----..NVA.-----------K
M7PEF2_PNEMU/241-608LI----------YPAIVTY--------------------C..D-------T.VQKLNQ----..HIHQ-----------N
C4LW49_ENTHI/279-679TT----------DEPFTAF--------------------I..D-------L.YTSFVS----..TLQT-----------L
I1JCY6_SOYBN/322-699LS----------RGIM...--------------------I..Q-------L.LN.FAE----..SVA.-----------M
D6WW45_TRICA/328-692IV----------REAMDTI--------------------V..Q-------D.GENIVS----..RAKK-----------C
B6K881_SCHJY/235-604IV----------NRVVDMV--------------------N..T-------V.FQQVFQ----..IYND-----------R
F0XF34_GROCL/729-1128AC----------QPALTEL--------------------A..R-------T.LRELNG----..HIKA-----------H
D8SPE6_SELML/233-605MA----------NDAALEV--------------------L..D-------M.IRVFA.----......-----------.
M0REN0_MUSAM/218-570TV----------KGAS...--------------------I..Q-------L.FG.FAE----..AIS.-----------I
E0CP16_VITVI/299-657IA----------DKIM...--------------------A..V-------F.FR.FGE----..GVA.-----------R
K3Y3Q0_SETIT/194-605FA----------EASILRM--------------------L..D-------F.VDAVVD----.AALD.-----------.
B9HV40_POPTR/282-631IV----------TQSG..I--------------------L..S-------F.LR.FGK----..KIT.-----------G
J3MH82_ORYBR/80-438IA----------SRAG..I--------------------L..D-------F.LK.FGR----..AVC.-----------D
B9GVY9_POPTR/242-613TV----------KGPA...--------------------I..Q-------L.FN.FAE----..AIS.-----------I
M7UD48_BOTF1/247-635TC----------QGAIAEL--------------------S..R-------T.LRELNN----..HIKS-----------N
W1PWG9_AMBTC/231-597IA----------AEAA...--------------------L..S-------L.FS.FPE----..SIA.-----------K
N1J6U6_BLUG1/243-631TC----------QGSITEL--------------------M..R-------T.LRDVNN----..HIKA-----------N
K3XSA8_SETIT/229-593IS----------FNSV...--------------------I..Q-------L.LS.FYV----..SVA.-----------I
B9SNP4_RICCO/271-635AS----------KASI...--------------------L..Q-------L.LN.FGE----..AVS.-----------I
M1CZG7_SOLTU/225-591IA----------KDSA...--------------------L..T-------L.FT.FPE----..MVA.-----------K
Q9C8H6_ARATH/254-623IA----------SNSV..I--------------------L..Q-------L.LR.FGS----..RIS.-----------K
H2ZQN6_CIOSA/276-638II----------TEPLETV--------------------E..Q-------T.GTKIVE----..YSKQ-----------C
K3XFW5_SETIT/237-577IA----------ENRTLIL--------------------L..E-------F.ADGFTT----......-----------.
A9TGT7_PHYPA/278-635IG----------KAAM...--------------------M..Q-------L.LS.FGD----..AIA.-----------I
M1W138_CLAP2/246-628TC----------RGAVSEL--------------------A..R-------T.VRELNA----..HIKS-----------H
A5B8C4_VITVI/267-614VC----------RGST...--------------------I..Q-------L.LN.FAD----..AVA.-----------I
S3E3U8_GLAL2/246-630TC----------QGAISEL--------------------A..R-------T.IRELNT----..HIKN-----------N
B9T041_RICCO/247-608IT----------KEGA...--------------------I..N-------L.FR.FPE----..LIV.-----------K
H6CBM6_EXODN/248-636TC----------AKALSTF--------------------S..R-------T.LSELNS----..VIKS-----------R
I1JWP0_SOYBN/263-614IS----------QSFM...--------------------L..H-------L.LN.FGE----..AVA.-----------M
F4KG58_ARATH/222-573IT----------TISF...--------------------G..M-------L.LS.FGY----..AIA.-----------I
F6GTU7_VITVI/230-591IT----------KEGA...--------------------L..S-------L.FG.FPE----..HVA.-----------R
M4CLF8_BRARP/249-615IA----------KEAG...--------------------L..N-------L.FT.LPE----..LVAH-----------K
W5EWA8_WHEAT/175-531LA----------GTGVSVA--------------------K..T-------L.LS.FGD----..AVA.-----------K
I1MDK3_SOYBN/222-572VC----------REGA...--------------------E..S-------L.FA.FPE----..KVA.-----------K
M1CA15_SOLTU/267-620VS----------KDAM...--------------------M..C-------L.LN.FGQ----..AVA.-----------I
C4R8N1_PICPG/235-620VF----------EKLIDNF--------------------I..R-------L.IKELTD----..FIET-----------H
Q8VY27_ARATH/245-606IA----------NEAA...--------------------T..N-------L.FK.FPE----..FVA.-----------K
Q0CYR3_ASPTN/219-599TC----------RPALAEY--------------------S..K-------T.LRELNQ----..YIKA-----------N
U9SQP1_RHIID/236-607TI----------QIPLDNY--------------------V..E-------T.GRTLTN----..RIKK-----------N
EXO70_EMENI/247-629TC----------RSAIAEY--------------------S..K-------T.IRELND----..YIRT-----------N
S2J047_MUCC1/214-590SI----------VPATVEY--------------------I..A-------A.GKQLNA----..VAKR-----------L
J3L5F1_ORYBR/344-686AS----------QP.F...--------------------L..Q-------L.LS.FGN----..FIA.-----------A
K0KAQ4_WICCF/235-607LI----------RNSIENY--------------------S..K-------I.ITNLIN----..SIEN-----------S
M0W8E8_HORVD/215-574VS----------RGCV...--------------------L..Q-------L.LG.FAD----..AVA.-----------M
R8BPV7_TOGMI/250-634TC----------QASLAEL--------------------S..R-------T.LRELNS----..HIKA-----------H
K3ZHK2_SETIT/304-675LA----------RGAM...--------------------L..H-------M.LS.FTE----..AVV.-----------L
M0TX18_MUSAM/52-414VA----------RDAA...--------------------A..A-------L.LA.FPE----..SAA.-----------R
K4CMD0_SOLLC/278-635IA----------SQAS..I--------------------L..A-------F.IQ.FGK----..TVT.-----------E
G3JCP3_CORMM/249-631AC----------QSSLAEL--------------------A..R-------T.LRELNA----..HIKQ-----------H
Q6K647_ORYSJ/301-673ST----------KGCI...--------------------M..Q-------I.LS.FGD----..AVA.-----------V
J3N6B0_ORYBR/11-377LA----------RCVM...--------------------L..Q-------M.LN.FTE----..AVA.-----------M
C5FN52_ARTOC/246-625TC----------RPALAEF--------------------S..K-------T.MRELNM----..YIKS-----------N
J7R1E6_KAZNA/236-614II----------TPLLKVY--------------------S..K-------L.FLTNIT----..AVQD-----------N
EXOC7_DICDI/437-835IL----------DEIIDPA--------------------H..E-------L.LLETTE----.PIIKV-----------R
K1X101_MARBU/264-643TC----------QGAISEL--------------------A..R-------T.LRELNS----..HIRA-----------N
W1NJ63_AMBTC/264-632VC----------RGAM...--------------------T..Q-------L.LT.FAD----..AVS.-----------I
G0S641_CHATD/252-645TC----------QPSLMEL--------------------G..R-------T.LRELNN----..HIKA-----------H
D5GH85_TUBMM/239-604TT----------AMPMGVF--------------------K..K-------T.VADLNV----..FVKQ-----------N
A9SN89_PHYPA/313-674LA----------ENEM...--------------------D..A-------F.MR.FGL----..SVV.-----------R
J9JWJ5_ACYPI/326-687II----------QESLANI--------------------V..H-------E.GESIAT----..RAKR-----------C
W5AN73_WHEAT/1073-1426VA----------KGCV...--------------------L..Q-------L.LR.FGD----..AIA.-----------I
W1PHH8_AMBTC/279-635IA----------IQAG..M--------------------L..E-------F.LK.FGE----..AVA.-----------R
U5H6T1_USTV1/251-633IL----------PPSLSLF--------------------Y..T-------T.GTQLNG----..VVKK-----------A
S7ZDA9_PENO1/246-625TF----------LGAMGEY--------------------S..K-------T.LRELNQ----..YIKA-----------N
K2RHI9_MACPH/246-628TC----------QMALNEF--------------------A..K-------T.LRELNN----..HVKS-----------N
F6HQX6_VITVI/246-608IS----------KEGA...--------------------T..L-------L.FE.FPR----.LLVS.-----------K
I1NUS0_ORYGL/283-640AA----------KGCV...--------------------L..Q-------L.LN.FGD----..AIA.-----------I
M4AQR1_XIPMA/327-700LI----------QEALDNL--------------------M..L-------E.GDNIVS----..AARR-----------A
M7XH50_RHOT1/276-657LL----------RPSLTLL--------------------T..N-------T.GQSLNS----..LIKK-----------S
K4DFQ8_SOLLC/257-617VA----------VQSG..I--------------------H..S-------F.IK.FGN----..TIT.-----------K
D7LD39_ARALL/243-607IV----------NEAG...--------------------I..N-------L.FR.FPE----..LVAN-----------K
E3S143_PYRTT/247-623TC----------QFPLQDF--------------------T..K-------T.LRELNG----..HIQK-----------N
E7LW76_YEASV/236-620IL----------SPLISAY--------------------A..K-------L.FGANLK----..IVRS-----------N
M3APZ2_PSEFD/248-629TC----------SETLRAF--------------------Q..S-------T.LRDLDA----..HVRN-----------H
T5A733_OPHSC/248-627TC----------QAALTEL--------------------A..R-------T.VRELNA----..HIKA-----------H
U5CZ65_AMBTC/305-668IA----------DKIM...--------------------A..V-------F.FR.FGE----..GVA.-----------R
Q0U449_PHANO/247-623TC----------QEPLGEF--------------------S..K-------T.LRELNG----..HIQK-----------N
I1Q027_ORYGL/148-486AS----------AGAMLRL--------------------A..T-------A.VAALGA----......-----------.
M1CE10_SOLTU/253-614VS----------RGST...--------------------I..Q-------L.LN.FAD----..AVA.-----------I
M0U7Y4_MUSAM/169-538IS----------GDAA...--------------------V..Q-------F.LR.FPE----..SVA.-----------K
EXO70_ASHGO/231-611IV----------APILHNY--------------------T..K-------I.LRYNID----..LVKD-----------D
G2XG72_VERDV/248-627TC----------QAALAEL--------------------A..R-------A.VRELNV----..HIKA-----------H
J3M2U7_ORYBR/269-636VT----------TKSL...--------------------S..T-------L.LS.FGE----..AVV.-----------Q
L8G7J8_PSED2/268-651AC----------QGAMDDV--------------------G..R-------T.LRELNV----..HIRA-----------H
M4CEA6_BRARP/229-593IT----------QEGA...--------------------L..T-------L.FS.FPE----..HAA.-----------K
A9SZG5_PHYPA/276-645FA----------KSAM...--------------------M..H-------L.LS.FGG----..AIA.-----------I
EXO70_YARLI/228-600LA----------QTPLQTY--------------------Q..A-------A.GEEISN----..HVQR-----------N
A0A0D1CBV0_USTMA/294-724LA----------SQPLTAL--------------------I..E-------S.LGTVQS----..HVRR-----------H
M0TA71_MUSAM/314-686FA----------RGVT...--------------------V..L-------L.LG.FAE----..AVA.-----------T
Q6Z5V5_ORYSJ/164-504LS----------DAATKPI--------------------N..R-------L.LT.FAS----..TVS.-----------.
I1N4J9_SOYBN/299-665AS----------KASM...--------------------L..Q-------L.LN.FGE----..AMS.-----------I
A0A068X0P1_HYMMI/337-709IC----------RNAVNDL--------------------M..T-------E.GGAYVR----..LMSR-----------V
M3J203_CANMX/209-599IT----------QEPMFKY--------------------N..E-------I.ITRYNQ----.FFDAP-----------S
K3ZZ59_SETIT/223-607AV----------KGAA...--------------------L..Q-------L.FG.FAE----..AIS.-----------I
F9XKX9_ZYMTI/246-627TC----------QDSLRSF--------------------S..N-------T.LRDLDS----..HVRS-----------H
B9RM96_RICCO/288-654LA----------LAVT...--------------------V..R-------F.LN.FAE----..AVA.-----------L
D7L2C4_ARALL/228-595TV----------KASA...--------------------L..R-------L.FT.FPE----..AIS.-----------I
K7KYU0_SOYBN/278-635IA----------MESG..I--------------------L..S-------F.IR.FGK----..IIT.-----------D
D7KZD8_ARALL/246-616TV----------KGPA...--------------------I..Q-------L.FN.FAE----..AIS.-----------I
U5FM28_POPTR/271-621IS----------RASV...--------------------L..Y-------L.LS.FGE----..AIA.-----------M
Q65WW9_ORYSJ/227-582AV----------RTQA...--------------------L..Q-------L.IS.FGD----..AIS.-----------S
W5AKS6_WHEAT/499-852AA----------KGCV...--------------------L..Q-------L.</