Sequence alignment for CL0297

PF01865

Y1799_ARCFU/7-225VGEVFGYSPFRSLAQHARMCG-RAVGLLQQQ-FEALRRG-NYEEVEELR-EEI-D--ELEHHADQIKEEI--------RG
PITX_RHIME/3-212GLFRKLLPREDRFFDLFADHS-RTVMGAAEA-LNALLAG-G.PDIESHC-DRI-V--ALENEADEITREV--------LL
Y629_METJA/7-212SIFLFERDNEKSVIDNLRLLI-QMSLKSIEL-LKDYMN.-..SKDEKIL-KEI-I--KIEEEGDETTKNI--------RI
Y691_CHLTR/4-223LASLFGQSPFAPLQAHLELVS-STINVLFPL-FSALKEG-DYERVGVLA-QLV-S--SKERQADGMKNDV--------RR
Y1603_HAEIN/6-225ILGLFAHSPLKPLQKHSEKVT-ECSDLLIPF-FQTTFSK-NWEQAEEKR-LEI-S--QCEREADSLKREI--------RL
Y1689_METTH/2-214KFFLKESKVEKHGRQHLEKVM-ECYLKFEEL-MEAFYRG-DCRLVSELT-KEI-A--IKEHEADEIRRKM--------EL
Y2149_ARCFU/6-209KKIVFGGEREREVVELIGKQV-ELIIDTCEL-MKSIIE.-..RSDEAVV-GDV-C--EAEKLGDAIRRDI--------VL

PF01895

Q03SN9_LACBA/120-205------------IGQMGHLTT.QMVKDVLSA.Y...VNK.D..E..HEA.REL.A..AV....DRQLDDL........NH
Q0C0L6_HYPNA/20-108------------IMRMGGIVE.TMIADSCRA.L...SIN.D..P..VLA.REV.I..AR....DPQVDVI........EA
Q1AXT8_RUBXD/17-105------------VLDLGREVL.GSLDDMVEA.L...ETG.D..I..GAANREIGV........DARYKAR........GT
Q2NHW3_METST/19-107------------TEKLSTLTI.DNYKESIEL.F...HNY.N....DEQY.KII.E..EN....TNRIVKE........SK
A1RZ38_THEPD/147-240------------ITKMRDAVT.GMLEDVKAA.L...GGG.D..V..EKIASEI.V..SR....DDIVDKL........YL
A3DN16_STAMF/16-108------------LNDMKDIIY.KILDYTGKL.F...SEP.N.....EYIRRDI..........RKSIEELINTIEIIRHD
Q3A6T9_PELCD/117-202------------FTGMSSKVH.DMVKMSLDS.L...VNL.D..P..QLA.REV.I..SL....DDEVDSM........HH
Q2RNF7_RHORT/37-125------------IQQMGGLAI.AQTRDAIEV.I...LGR.HPD....VA.ARI.F..VR....EDEMNGL..........
A1VPD2_POLNA/21-109------------VMELGGLVE.SQLRLAIYA.L...SQF.S..A..ESA.NQV.I..ET....ELRVNGM........EL
Q8Y4F0_LISMO/121-206------------IPEMGEIVK.SMLQDVLKA.Y...LAE.D..E..GAA.REI.A..ER....DNEVDKL........HK
Q8TLE8_METAC/137-228------------FKRMSSLVF.LMFNDLMEI.Q...RTR.T..P..ENI.RDI.I..AR....DEDVDKI........FF
Q5WET9_BACSK/120-204------------LIELALDAK.GMIEKALHA.Y...ATK.N..V..LTA.QQL.A..KA....DDEIDER........FG
Q6AM12_DESPS/122-207------------YSTMSRIVI.EMLKMSIDA.L...VKR.D..S..AKA.RQV.F..FL....DDDVDAL........RD
Q2FUH2_METHJ/240-319------------IRKASEGAL.TTFEKSVES.F...FTH.D..L..KKA.NKM.I..EY....MHDLEES........FL
Q8RGL5_FUSNN/332-421------------VNSMVDIIE.DAFLKLEES.L...KEK.D..KIAKYN.DSI.I..EA....EDKLDLY........EK
A9KP20_CLOPH/121-206------------IPKMAQVAK.EMVHDAVDA.F...ISC.D..T..EAA.RVT.I..KK....DDIVDDL........FN
Q1QLM7_NITHX/342-429------------TLRMGDLVE.AMLRKVMDA.M...MAN.D..K..SLV.DQV.S..RM....DDGVDGL........DE
Q3ATH0_CHLCH/112-197------------FENMAMNAK.EMVIKAIDS.F...VEK.D..D..SLA.RKL.H..EM....DDAIDTT........HR
Q609Z7_METCA/24-112------------VLEMGTLVL.TQVKEAVRS.L...KTG.D..V..SLA.AEI.I..EE....DDQVDDL........EV
Q67RG3_SYMTH/124-209------------IPLLARRVQ.EMNREALDA.W...VQG.D..S..DRA.RRM.T..RR....DDEIDRL........YR
A5UKP1_METS3/126-211------------LEYMADYVQ.IMLTRGFGS.F...CNQ.D..I..SVA.REL.A..SD....DDKVDDL........FD
A8F5R4_THELT/16-104------------LMKMGWYTE.KMFLNAIEA.L...ENK.D..S..KLA.KQV.I..ED....DNVLDGM........EI
Q8EQ00_OCEIH/120-205------------LSHMHHQVK.KMLHTAVLA.F...EQE.D..I..SLA.GKL.A..EM....DDEVDHV........YK
Q5V6R8_HALMA/168-260------------LGRLSRTEA.VIRGDAISA.L...IEG.D..T..DLV.ETV.E..SR....QEQVEKL........FY
Q3IM37_NATPD/17-105------------VVSMSDLVL.DRYNRALTT.M...ETK.D..E..PMA.QSV.I..EG....DEDVNQL........YL
Q1AXT8_RUBXD/121-207------------LVEMARTAR.DIFHEGLEI.F...ETR.D..I..ERA.REL.Q..AS....DDRVDLL........YS
Q2RHH1_MOOTA/19-107------------LLHMGDYVV.GQLDQALAA.L...KTQ.D..V..KMA.RQV.I..MG....DDATDDL........DH
Q0W7U5_UNCMA/120-205------------VCEMYENVH.AMVRDSFIA.F...RDR.N..V..ELA.KSM.S..AR....DDVVDAQ........YD
Q8TSA7_METAC/17-105------------VSSLGEMAE.FVFSDSMDA.V...INL.D..I..ELA.KKT.L..AL....EPKMDRL........EE
A1SXC2_PSYIN/130-215------------LKHLGETVI.ANLHQAMKA.Y...AAL.D..I..ETA.LQV.I..EQ....DEQINIE........FD
Q8FMP1_COREF/18-106------------LIILCDLTK.DTMTKATDA.L...VNT.S.....LASAEAA.L..SN....AEQLEEV........RL
A2SSI2_METLZ/247-326------------LTGLSEFSL.NIFNKSIQA.I...YSG.S..I..PGA.NKI.I..TE....VEEMEAA........YH
Q5V0F9_HALMA/136-227------------ITRMRLVSL.TMLSDAVEA.L...IED.D..D..DLA.ADV.M..QR....DDDVDRL........WY
A6Q2I6_NITSB/16-104------------VSDAAEKVI.NAHKIALDS.F...KNK.D..I..NEF.KSV.S..EL....VKSLDNE........AR
A8ZSJ6_DESOH/16-104------------ILDLGAMTE.DRLNKAVTA.V...CES.R..R..DLA.EQI.I..AT....DYEIDDL........EV
Q1GAD2_LACDA/16-104------------MEEIGQLCK.ESIFESTDT.L...FTG.N..Y..HEA.EDT.I..NL....HHRIHKA........ER
A7HJE0_FERNB/119-204------------LPEMFSFAQ.KMLRKALRI.Y...VDQ.N..T..EGA.YGI.C..NQ....DEIMDKM........LE
Q92PS2_RHIME/340-427------------VLRVGDLIE.VMLMRASEA.F...SKN.D..V..NEL.GDI.E..NI....ERQVDLL........QQ
A6LSI4_CLOB8/122-207------------LWDMERKAR.YMIKASIDS.H...VND.D..E..EMA.YRI.C..KK....DDEIDTI........YR
A2BLI4_HYPBU/116-197------------IRVVLGKAE.EMLDMAYRA.L...VEE.D..G..GLA.EKV.S..EL....DASVDEA........YV
A0LDJ6_MAGSM/127-212------------VIQMAVRLA.EAIKDSVVA.Y...TNR.D..V..GKA.LRV.W..SG....DEEIDLL........NN
Q1AX68_RUBXD/13-97------------LAEAKDTSE.LMVDLAYAAIL...YDS.E.....DIS.EEV.F..RL....EERLNQL........VF
A5VLT3_LACRD/120-205------------IEQMMMIVR.KMLEQILDA.Y...VYT.D.....EQVAYEV.A..NE....DLKVDLL........YV
Q2RHH2_MOOTA/339-427------------LLRMAGIIREEMFPRVMRP.L...AE.....REVDLL.EKL.R..RL....DGTLDYL........YK
Y2053_DEIRA/72-160------------FLRMLSIIL.ELLAAVREA.D...ERA.E.FG..GLT.ARA.R..VL....EAETNAL........ER
Q6MP49_BDEBA/19-107------------ILLMGGHVE.KSLAQVTAA.L...LSR.D..V..DMF.SGV.H..DI....EKLINED........HI
Q2FTF7_METHJ/119-204------------LIIVGRKVL.SMIEDAFDA.F...EDR.D..V..NRI.RNM.R..ER....DSEIDRL........YC
Q6MP49_BDEBA/123-208------------IQKMSEIAG.RMVKGSLDS.F...VRG.D..V..EQA.KKI.L..LM....DDEIDAL........KN
O28477_ARCFU/135-226------------IRRMGNTCV.GMVSDFCTA.L...RKY.D.....RYLCSSI.I..FR....EREVDRL........YF
A0LDJ6_MAGSM/24-112------------ILRMLAQVG.QQLDSVIEA.L...RGM.R..S..EFS.DGV.V..VE....DAKLTTM........LT
Q6AAV0_PROAC/147-230------------FVEMSKIAD.SMIGKAEKT.L...ADR.D..A..EAA.ESL.A..SE....DSKMDDL........RR
A4FL22_SACEN/121-205------------VREMAGLDI.DMATRLAAL.V...SGE.G..A..EGGFDEL.R..HT....DDAVDAL........HA
A5V0U4_ROSS1/126-211------------LQELGALTE.HILTASIAA.F...LSE.D..A..TTA.RAI.A..TL....DDQVDAR........RR
Q5SM00_THET8/16-104------------SLRMLSLVR.EMTQEATEA.L...VQA.D..R..AKA.QGV.V..AK....DKEVDAL........EL
A6LEN2_PARD8/122-207------------VEEMLSELL.SMISLTKEA.F...EKE.S..S..EIA.SRI.F..LK....DNLIDEI........NH
A2SSH8_METLZ/116-201------------LHREGEATV.SILNEVYTA.F...ESG.D..V..SRL.QGC.A..DI....EGEIDTL........YA
Q3ZA57_DEHM1/17-105------------MLLLGSMVG.KAVDRSMQS.M...KER.D..L..ELA.KQV.I..EE....DKLINQK........RF
Q0ASG2_MARMM/127-212------------VERLGAIVI.KQLREVLDA.L...SSA.D..V..EPA.VRV.W..HS....DDEVDER........YN
A2SSH8_METLZ/16-104------------VTWYGRFAL.TMLKNSLLA.Y...ESA.D..L..MIA.ADI.I..RQ....KEYVNNQ........YE
Q30YR4_DESAG/121-206------------LTELAGVAG.NMFAHALAC.F...RDS.N..V..ETA.FEV.C..RM....DLKCNAL........EV
B2JUR6_BURP8/126-211------------LRSSGEMAA.SVLNRVLDA.F...ARM.D..A..VAA.AQI.V..RD....DKAIDEA........FR
Q8FMP1_COREF/123-206------------VRELGRLVT.NMSDKIREV.L...ITP.D..A..DIA.LAL.S..SD....DDAVDDL........HH
Q0W7U5_UNCMA/17-105------------FFQMGEDSL.RLMSRSLRS.L...VNK.D..L..ELA.KQV.M..EE....SDRMADR........EI
A6UUI6_META3/119-204------------LNVMVLYLK.DMLKDILKA.Y...QEK.N..E..ELA.REV.Y..KR....DKKIDKL........FE
Q2FTF7_METHJ/16-104------------ACDLGTYAI.TMLRDSIDA.F...ERG.D..T..QLA.QDV.C..NR....KIELKKR........FI
Q1IMC8_KORVE/119-204------------IPRMAETVA.TMVQRALES.F...IDG.K..A..ELA.EAV.L..QM....DNIVDRI........KD
Q251M5_DESHY/359-447------------VMHMGKVAG.QAVDNAMNY.F...FKR.Q..S..ANR.QYV.I..QM....ESATDRL........EN
A3DLY8_STAMF/20-104------------LMEMNVYSR.LMLDLAYYSVV...VKD.T.....SIA.YEV.Q..RI....EDKLDAD........WS
B4SH22_PELPB/118-203------------LESVGAKVA.EMLQYAIDA.F...AAK.D..T..VKA.SRV.F..AI....EEEIDSM........HR
Q186T5_PEPD6/447-532------------IYEIYNKTI.TNFKDALIV.L...DVK.D..F..ELA.NKV.L..EV....ENEVNYL........EK
B1YLB2_EXIS2/122-207------------LKEAFETLL.DMTETAIVA.Y...RDG.D..I..EKA.KAL.S..DL....DNIIDDT........TY
A1RZ38_THEPD/253-333------------ISTLSDKVS.EFFTASVHV.F...LDR.D..K..TTA.NRL.L..DV...DAEKLKAL........ER
Q3IM38_NATPD/147-240------------VDQIRQIAL.SMHENAVSS.V...LSS.E..TDEEMT.AHI.I..SR....DDDVDRL........FA
O27757_METTH/89-175------------LRDMAQHVC.KQLNKSFRS.L...EEY.D..E..DLA.NEA.L..KM....DYITNTM........HE
A3CVT1_METMJ/216-300------------IIEMKNLSE.LSVGLAYTSLL...FNN.M.....EVA.HEV.V..AL....DSTLDDM........RY
Q834B5_ENTFA/121-206------------ISDMSDYVK.KMVDNVLIA.Y...VKT.D..Q..KDA.RMI.A..QM....DDRTNEY........FD
A3CRL4_METMJ/338-425------------LRHAHEVTL.DLFRAAMTY.L...ATSKE..ADYQMV.ERL.K..SL....NNYLDAR..........
Q74KF7_LACJO/16-104------------FMGMGIDVS.EAIEEATQA.F...VEH.D..K..KLA.QSL.V..KD....DQKVSRA........AT
A8AA37_IGNH4/119-200------------FASLAPIVK.SMIEGSIDA.L...KNM.D..V..LKA.MKI.I..TK....DDEVDET........YH
Q6G4T5_BARHE/125-210------------FETITTLAL.NQLKEVLNA.Y...TSR.L..L..DHV.DAV.R..ER....DGKIDAL........YT
A9BHU2_PETMO/25-113------------VLRMGRIVQ.EMHYKFGDA.Y...LER.N..D..KLA.KEI.I..NQ....DDRLDFI........EA
Q2LUX4_SYNAS/355-442------------LEREAFLAN.RMMTESLAL.F...EHY.E..R..ARQ.ENI.L..YM....ELVVDHL........RR
Q4FLF7_PELUB/22-110------------LIKMGSLVE.AQLTDSMEA.I...IKV.D..K..EAA.ENI.I..KN....DEKINEL........RA
A0RXC3_CENSY/16-103------------LSEMGDMAV.QCVTLAIES.Y...LRG....V..NTS.PEV.H..SL....SDGIRRR........YY
A6LP09_THEM4/121-202------------IKEMFGVSL.KMLHDTFIA.F...SKK.D..L..KLL.KKI.W..DD....DKKLDDI........EI
Q2S080_SALRD/18-106------------IADMANRVD.EQFANAMNA.L...LQGDV.....DLAEEVV....AG....DDAVDAL........EL
A9BNX0_DELAS/469-555------------IRELLHHLL.DNLRLAMSV.F...LNG.N..V..REA.QKL.L..EE....KARFRDL........EL
Q5WET9_BACSK/17-105------------IQVLGTAVL.KQLDAAIDG.L...STK.N..R..AAV.QQI.I..DN....DADINKS........EL
Q2NHW3_METST/123-208------------MDQMAQEVE.NMLNRSIRS.Y...LTK.N..P..EEA.AEL.E..ED....DDIVDDL........FD
PHOU1_METTH/21-109------------MEEVSQKTL.KTHKLAVDL.L...MEY.D....EEKK.EKV.I..KN....SRAIDDM........VF
Q9CEW9_LACLA/121-206------------ISLLGEKVK.SIVDASLNA.Y...IQG.N..D..KRA.HEI.A..EQ....QYVIKSM........SH
A5D1M0_PELTS/120-205------------LSQMTEKVR.EMVASVINA.Y...TTA.D..I..ETA.RVI.V..KM....EDEIDGL........YR
Q2RHH2_MOOTA/445-531------------LQEMFTRVK.ENFTSAIQA.F...ASD.D..Q..ALA.ARV.I..RG....HPEILRL........EK
Q9YG50_AERPE/17-103------------LDRMYNIVV.KIVADTLRS.L.....E.E.....WSI.NEA.L..EDHLYLAENLSAV........VE
A9B5P2_HERA2/131-216------------ISELGQRTS.EILHAGLEA.L...RQN.D..R..SFA.DRV.T..EL....DDVIDHL........YR
Q47KT1_THEFY/132-215------------VLEMGHQAE.MLVIKAGEV.V...ANR.D..V..ETA.REL.D..KD....DDRMDRL........RR
E0THQ4_PARBH/20-108------------LATMGGAVE.EQVAQSIIA.F...ERR.D..L..LLA.EEI.R..HR....DVEIDDY........EQ
Q6D018_PECAS/339-425------------TLRIGDVLE.QML.RLYRE.V...LQG.D..H..MQR.REI.R..RL....DDDVDIL........YT
Q5Z0T5_NOCFA/22-110------------LTLMCRLAH.DSLERVVDA.L...AGA.D..L..TAA.YEV.F..AL....EEQLHKM........HG
PHOU1_THEMA/18-106------------VSKMLFLVS.ESLNDAIES.L...ETM.N..E..TLA.RKV.L..ES....DDMIDEL........NR
PHOU_AQUAE/117-202------------INFMSEIVK.EMVNDSVIS.F...IQQ.D..T..LLA.KKV.I..EK....DDTVDEL........YH
A6UVP6_META3/82-166------------YGKMANNVL.YNLNKTYKS.L...KIN.D..I..ETA.KGV.I..AQ....DYRLNRM........EE
A7H7E1_ANADF/124-209------------LSRLAEMSE.TQLKHALDA.F...VTG.D..V..AKA.EDV.M..RS....DEHLDAL........YL
A3CXV2_METMJ/119-204------------IPHMGEVVG.GMITDTLVA.F...ERE.D..L..TAI.DDI.V..ER....EVAVDAL........RY
B4S7F4_PROA2/163-246------------LKPMGDITA.EMIKKVVEA.F...VSG.N..T..KHA.QET.L..DM....MTEIDGI........YQ
A9B5P2_HERA2/20-108------------VFRVGTMVE.AALSEALQS.I...KLY.D..Q..AAV.RKV.V..QN....DQTINHE........VQ
Q5V0G4_HALMA/118-213------------VDTIGREAT.EMVERSIDA.Y...RRE.D..V..EEC.RAI.A..AD....DDALDAL........CQ
A7I9M4_METB6/16-104------------VSGMARYAF.SMLQDSQEA.F...INQ.D..A..ALA.ATV.L..DR....KDALREK........TV
A8MCD0_CALMQ/144-239------------IARMSNVVS.GMFKDALSL.....IKI.DPEERLSMA.RDI.M..DR....DYDVDRN........YM
Q8TX17_METKA/194-284------------VREAALEAR.SMVKTAYSI.F...LGR.V..KEEDLR.HEA.E..KV....YCAEDRV........HK
B8CZG2_HALOH/119-206------------IPELANTVS.DMLDTVLEA.F...VTR.N..A..DLA.EAV.C..RK....DEVADNI........YD
A8MBU9_CALMQ/146-238------------VLKIIRVIE.SMLDDIKVA.L...NTV.D..K..NIL.VDI.V..ER....DNEVDRF........YW
Q0RZA9_RHOSR/121-204------------LGRMGRLAG.ALAGLAEQV.L...RTR.D..P..ELA.AEL.D..RR....DDELDSP........HR
A4J4V6_DESRM/467-552------------VRTMAELTE.ETLNLALKS.F...ENN.D..R..SLA.RLV.I..KN....EVIIDNL........EK
Q4KBC7_PSEF5/340-427------------ALRMADMLS.GMLDRVLQL.F...RTA.N..Q..ANA.DQV.R..HI....DQSLDLL........SA
Q6ADH5_LEIXX/144-227------------FAEMGRLDV.AIAEKLAEL.L...RTQ.D..I..RLA.DEI.R..ND....DDDIDEL........HA
Q1WUX0_LACS1/120-205------------IREVSEQTQ.ENLVKIVSM.F...AKF.D..E..KGA.VEI.A..KK....NQEKREK........IN
B8CZG2_HALOH/16-104------------LSNMSEIAE.EMLQNAIKA.L...DEK.D..V..SLA.KDV.I..NR....DDVLDNY........QV
A8MGX2_ALKOO/16-104------------FIEMGKQSQ.QVIKLSVES.L...KEQ.N..I..EKA.NLA.I..KL....DDKVDEL........DF
A5UQ39_ROSS1/16-104------------LLRMGSRVE.HQLADAIKA.L...DRL.D..I..ELA.REI.V..AR....DREIDAA........RN
A4YI56_METS5/143-234------------INRAAVITQ.NMLKDTLDA.L...RNN.D..A..EMA.KEV.Q..ER....DDEVDRF........YF
Q05HF3_UNCMA/14-101------------TLKIAGLVG.QSIEDSVRS.L...ADR.D..I..DLA.GKV.I..DR....DAEIDRL........KL
A7HJE0_FERNB/16-104------------LTKEAWYVE.DLLRLTMEA.F...KER.N....LELA.KKV.K..NQ....YWDIYEE........YL
Q3IX36_RHOS4/343-430------------TLRVGDLVG.EMLERSRQA.L...LAN.D..E..FAA.QEV.S..RL....EPDIDRL........TE
O28086_ARCFU/211-297------------LIEVKNLSE.LSVDLAYSSLI...YGN.D.....EIA.LEV.V..YL....EEVIDNT........KF
A0B6T7_METTP/241-325------------LTRISSIIC.GLIDEAISA.L...LHR.N..T..EIA.NSI.I..EQ....TKEIRRE........AM
A5G3F8_GEOUR/366-453------------IKRMATVTG.SMYHEMVEQ.F...HSF.N..A..RSA.NRI.K..QR....EELLDVL........QR
A8ZSJ6_DESOH/119-205------------YAPMGKKVK.SMVQKSLNA.F...VQK.D..A..EAA.KAV.L..FA....DDEIDML........RG
Q6F1N0_MESFL/119-206------------IVNLFQLVI.DMLDSFSEL.F...SNF.D..N..NLV.VKV.M..EL....EAQINKE........FE
A5URZ8_ROSS1/121-206------------MERMARMAM.AMLQKALDA.F...AAR.D..S..ATA.EML.A..AD....DDEVDRL........YE
A5EXS4_DICNV/20-109------------VVDMANLCE.KQLH.AISA.F...LRQ.DPIS..ESL.RDI.V..NV....DALTNQY........HI
B2JUR6_BURP8/21-109------------LLAMGGMVE.RQITRCLTL.L...DDY.D..P..ALV.QEI.R..DS....ERELNAL........EI
Q31I87_THICR/133-218------------LVDISNRSS.VMLKMTLDS.F...ARV.S..T..DGV.GKV.I..RE....EEVIDDI........FK
A6GWK5_FLAPJ/140-225------------IASITKNIE.LITKKTNEC.F...DKQ.Q..E..KTI.GEI.F..LL....NKNIRVE........TQ
A6Q2I6_NITSB/121-210------------IIQLHETAI.EALEYSLRI.L...RIE.NLDDVEELY.RKT.L..VE....ESKTDEI........FT
Q3IUH9_NATPD/24-108------------LVEMKDTSE.LLIDLAYSAVL...HQN.D.....ELA.SEV.L..AL....EEKMDVL........QM
A9KP15_CLOPH/357-444------------TKQMAELAK.DTILSSIHL.L...TKY.D..D..KIS.ASI.M..DN....ENRVDKY........ED
B2JC47_BURP8/341-428------------VLRIGDIVR.TMLDNLSHL.I...HHN.D..P..EKA.RDT.I..RM....DDDVDHL........YA
Q03GY8_PEDPA/120-205------------IAEMTNVVR.TMLDVTMDA.Y...VKR.D..S..KLA.DEV.I..KA....NEQIDNS........YK
A4G2G4_HERAR/21-109------------VGAMGDFAG.VQFADAIQA.L...LAH.D..V..SLA.QRV.I..DQ....DRQVDAL........RR
A6LN86_THEM4/16-104------------VLKEGWLIE.SLLNQVLNA.L...KER.D....KEAV.LNA.L..KN....ENEINVM........DM
Q4FLF7_PELUB/125-210------------LKRLGELVQ.RQLKDVLDA.Y...LNQ.S..K..EAA.VKI.W..KS....DERVDDL........TH
PHOU_DEIRA/16-104------------ALNMLGTVE.RMLPVAAEV.L...LHE.R..A..DLL.GEV.R..SL....DREVDAQ........EA
O29778_ARCFU/134-226------------LKRMLQILS.GLMGEMERS.LPLESPN.V..K..EIL.ERI.Q..RY....EEDFDRL........YL
A8F5R4_THELT/118-203------------ILKLGKLTS.NMLKESIRL.L...ADL.Q..P..EGA.FVI.C..SK....DAEVDEL........YQ
Q11NF9_CYTH3/120-207------------FKEMTSIVL.EMLNTLCES.F...ETD.N..T..KLA.RTV.F..SK....DEILDEI........NS
Q5V3U8_HALMA/140-232------------LERLESTGS.TMRNEAVKS.L...AHG.N..P..DLA.QRA.L..NR....ERQANKI........FV
O28916_ARCFU/135-220------------LEKLFNITL.SMLKDLKDV.V.....A.N..LDRAVC.STI.L..TR....ENEVDKL........HF
A4J4A5_DESRM/448-534------------IQSLSERVV.HLLQLVNTA.F...ATN.N..D..GLA.EQA.K..LF....YEEIVDL........QF
A5UMQ1_METS3/7-91------------LIEMKNMSE.LMVDLAYSAVL...FNS.K.....DAA.EEV.L..KL....ENKVNSM........NY
A5WHR5_PSYWF/22-110------------FLKMGRMAA.EQVTLATHA.L...VDS.N..E..EMA.STV.I..EA....DHQINQM........EI
Y2861_DEIRA/125-208------------FAQALALLL.QMATTLRAA.S...SPM.N..A..ALA.HEV.R..AL....DDQVDAL........YD
A4J4V6_DESRM/359-449------------LSRMGRYSS.EFFSESVRF.F...FNP.K..D..KEV.NPM.YLEQK....EELINRL........DA
A0B6T8_METTP/129-214------------LSKMAGIAV.EMLSGAMEA.L...EKG.D..P..DMA.RNV.T..RH....DYVIDSL........YV
A4X1M0_SALTO/17-105------------LAVMSREAA.AAIRGAGTA.L...LDV.N..R..EAA.EQV.V..RN....DAVLDQL........RW
Q8F0J5_LEPIN/12-116------------LYSMAELCL.EQVLLLDDA.L...EKD.D..G..ELA.RKL.I..DR....DDLIDNL........EK
Q2S5E3_SALRD/191-276------------IREMSQAAR.RMLDEAKQA.F...LDQ.D..A..ELA.RSI.P..DL....DDEVDRL........HH
A5UKP1_METS3/22-110------------LRNYCNDTL.DLHRKSTSL.L...FNF.D..E..EIA.AGV.V..EK....AKELDVC........GY
Q971H7_SULTO/145-236------------LNRLINNLK.QMLHYLSLG.I...KEG.S..R..TFL.QET.I..EL....EREIDRL........YY
A6GWK5_FLAPJ/37-125------------IVKIGVLSE.NQIVEAMKS.L...LSD.P..N..ATT.KKL.K..KT....ENKIDKL........DV
Q30PB9_SULDN/121-210------------ILLLHKSSI.NALKYILEC.F...TNIQE..CNYEDNYRKV.L..VE....ESMNDDL........FS
Q8TWZ7_METKA/17-101------------LTEMKNLAQ.LSVDLAYSVLL...FGS.P.....ELA.EEV.R..RI....ERRVDEL........SM
Q9YA54_AERPE/147-239------------LSRMARIAA.EMIRDVARG.L...ENG.D..R..GLL.DLV.A..ER....DQLVDKL........YL
Q896W9_CLOTE/342-429------------IVRMAEKSK.EILEQAVES.L...HTG.D..E..ELI.KKA.M..EG....EDFVDLL........EE
Q1J0M9_DEIGD/118-204------------VLPLVDLLM.GMLERLAYA.F...AER.D..V..QAA.REVMR..RD....EEEVDAL........YE
Q186T5_PEPD6/342-429------------VVRMGHKAT.NSLEHSIAG.F...LNK.S..N..EDI.NKA.F..ES....EKVVNKL........QK
A0JSV0_ARTS2/16-104------------LVEISKLVS.EAIAKATTA.F...EGA.D..V..DLA.QDV.I..AA....DARIDFL........QN
PHOU2_METTH/20-108------------TVRYGNETS.ERVGRTVSS.Y...IKG.D..E..ETA.REL.I..ET....TAAVNEK........SY
A6TML5_ALKMQ/448-533------------LKNMSDIVV.KAYEDSLTS.M...KEL.N..G..SLA.MKV.I..EA....EGQIDHL........EK
Q180A4_PEPD6/120-205------------IPKMAKECK.SMMSQTREA.L...ILF.D..A..SIA.YDV.G..TK....DDIVDGL........YE
A4G2G4_HERAR/125-210------------IRRLADLTS.AQLRHALAA.Y...ATR.D..G..ARA.QTL.E..RD....DDQIDAL........HV
Q05HF3_UNCMA/116-201------------IMKMAEIAG.RMLKKCIDL.Y...SGK.T..S..GNL.RTV.Y..EN....DLGIDRL........YG
A3DLZ0_STAMF/142-234------------TRRLHLIVN.NMLLDALKA.F...YTK.D..T..GLA.EAV.L..QR....DDEADRF........HF
A9AVN3_HERA2/16-104------------IRDMGNRVS.LAVRDALWS.L...ERN.E..P..IFA.RQI.I..AN....DNVIDEL........RY
Q5V0G5_HALMA/139-228------------VRQLQFVAL.SMHRDAMAA.L...TTG.......TTS.DRW.G..DR....DEQADRL........HA
A6LGP6_PARD8/360-451------------ISLFAERTA.RMFNMVKEL.F...YEKNE.....ETFLKTY....SRIEKYENISDRM........EI
Q30PB9_SULDN/16-104------------LSLLLKDII.AADELSLEA.F...KSD.D..A..NKF.KEV.E..TL....LAKIGLI........GD
A1APX2_PELPD/349-436------------IGRMVAVTS.FMFADTREL.L...FDY.D..A..RRA.ETI.R..NH....EQVLDSL........NH
A0PXY5_CLONN/341-428------------ISRMGKIAE.NNLADSMAC.F...INN.D..E..NLI.PSV.V..EH....ENLINFL........HR
Q31I87_THICR/25-113------------ILEMGGMVE.RQLENALQS.L...GSS.D..I..DKA.QEV.I..SF....DKAINHA........EM
A3DN16_STAMF/122-203------------LREGFAWAT.EMVKLAIQS.F...IEN.N..T..DMA.RKV.L..DM....DNKLDNL........YI
Q73LA1_TREDE/351-442------------ILKMSNIVR.EMFSLLRSL.L...SKEEN..VSREFVIRQL.T..EK....EDYTDQM........QE
Q5UZI8_HALMA/218-302------------IVLMKDMGE.LAVDLAYGAVL...FDS.T.....EVA.EEV.V..EL....EAEVDAL........QS
A9BNX0_DELAS/363-450------------ALHQADMVE.SMLIGMQRV.L...ETD.D..L..KLS.QEL.R..EL....EGTVDDL........YS
A9KRG9_CLOPH/120-205------------IIRMADISQ.EMIKMSLDA.F...VNE.D..I..ALA.EKA.A..KR....DEEVDSL........YE
Q9YG50_AERPE/119-200------------VRKAAEIVA.SMVGDAYKA.Y...RSR.D..N..ELR.RKV.E..ET....DNMIDKI........YD
Q12XW7_METBU/17-105------------IQEMGDISQ.KMLVNSIQA.L...EYL.D..L..ELA.KNV.I..EM....DSIVDDL........EY
B8I417_CLOCE/120-205------------IPHMADMAK.KMVTKSIDS.Y...VKQ.D..I..NLA.KEV.C..DS....DDAIDNL........FS
Y2861_DEIRA/23-111------------FLSMQDTLA.GQLRALQAA.F...AQG.D..T..SVR.EEV.E..RL....DRDIDAA........NA
A9KNL1_CLOPH/461-546------------INKMATAVQ.KLLSYSIEM.F...ENK.N..R..EYL.EEI.L..KF....ENSIDDM........ER
O29464_ARCFU/138-228------------VRRMSQIIQ.SMIATIMEG.I...EKG.D..R..EAL.KDI.E..NL....EKDSDRL........YL
Q03YL4_LEUMM/120-205------------LGEMGEMVA.TMVSEVMDY.Y...VKN.D..A..LGA.EAI.A..DK....NSVLTQS........AA
A0L7V8_MAGSM/21-109------------VLQMAENVL.SQLSLAIES.V...ASL.D..A..EDA.LKV.I..EQ....DQQIDQL........EW
Q6F1N0_MESFL/18-106------------LEDMIKETK.IQFAETFEV.I...TKN.N..V..EGA.ALI.V..EH....DKIINDK........LN
A8AA77_IGNH4/19-103------------LRKMKDEVS.IALDMAFYSLV...YED.K.....DVA.QEV.E..KI....DVDVDND........FN
A3DN11_STAMF/143-235------------LEKMANTTR.SMLEDVERI.L...TRY.D..E..KIL.ISI.V..ER....DEVVDKL........FL
Q8YNR1_NOSS1/26-114------------VLRMGALVE.QSFRLSHQA.L...FSR.D..L..KAA.EEL.P..RL....DKKIDRF........YR
Q31LX7_SYNE7/130-214------------VGLMLERSR.SMLAMSLAA.I...ANI.D..A..ELG.RAI.K..DK....DDAVDAD........FD
Y1641_METJA/88-172------------LEKMEKTLL.NNLDLVYTA.L...KNS.D..K..KLA.EDI.I..IK....DYALNKM........EE
A2BIZ3_HYPBU/172-264------------VRRLMRTVE.LMLDDLITA.L...REL.N.....EATLLEI.D..ER....DDVVDKF........YM
A4X1M0_SALTO/122-204------------VTEMAEAAA.RIAEKASTV.L...TTR.D..P..LTA.MQI.G..LD....DDEVDTA........QS
Q8G3U8_BIFLO/16-104------------LDRMAQNVR.KAIKGAGEA.L...LNQ.D..V..EAA.QTV.I..DG....DIEIDAL........ES
A1A0C8_BIFAA/129-212------------FAEMQAFLD.NVADQVVSM.L...TDR.D..T..KTA.EQI.I..LN....DDKLDAL..........
Q2FUH2_METHJ/133-224------------LKRMFVIVK.SMHIDAIDA.F...IAH.D..S..DLI.TDV.I..ER....DNDVDRL........FW
A8F7W8_THELT/123-210------------LNEMIKIIL.TMFKEIVEA.V...QHK.D..L..DLA.IKV.W..KK....DDQVDFL........HN
Q1IMC8_KORVE/16-104------------LLRMGGLAE.QAIERAVEA.Y...RKR.D..A..KAC.QAV.F..DG....ERDINAA........ER
A3DJ80_CLOTH/353-440------------AREMAYASV.DAIKKAVAL.V...NNY.D..E..KEA.QKV.R..DA....EQQTDKY........ED
A8F7W8_THELT/19-107------------LAEFITGVE.NLFEKTLYA.I...QSG.D..E..HVI.KQI.E..NM....DDYFDSL........DL
A0R4B7_MYCS2/18-103------------..AMCELAG.TAMERATQS.L...LQA.D..L..VLA.EQV.I..SD....HEKMTTL........SA
A4VVC7_STRSY/33-119------------IKKMGREVR.QLVEETLEL.Y...LGDAD..M..ERA.YEV.A..AR....DEVVNEF........YS
A5I7G9_CLOBH/450-534------------IKHLFNYTL.DSLTRTIEG.F...ESN.D..V..ERS.QSV.M..YI....EEKIDNL........EE
A9WDH3_CHLAA/122-207------------IHEMAQLAL.QMLNTSLEA.F...LRQ.D..A..DLA.RSL.T..AH....DERVDEL........ED
B1HSR0_LYSSC/22-105------------....ANSSI.FALKTAFEA.L...VEQ.D..L..EKA.LKI.L..ED....DLIINRL........EE
B1WZW8_CYAA5/131-213------------..LMSNHAQ.MMLATSLVA.L...ADL.D.....AGAGKRV.K..KL....DDTVDDA........YD
B9JPC1_AGRRK/445-529------------LQQLFQLTI.DNLRIAQTI.L...ITR.D..I..KLA.TQL.M..ER....KIDVRRM........EK
F2KB65_PSEBN/131-214------------.RHIGDQVR.NMVRDALDA.F...ARF.D..A..DLA.LSV.A..QY....DKIIDRE........YK
J9ZE71_LEPFM/119-204------------IYSMAEIGR.DMLRKALDA.F...VMK.N..T..SEA.LAV.C..QE....DERVNVI........YR
PHOU_BORBU/126-210------------LREMADTAK.EMLSDIFDA.Y...FDG.D..F..TKI.LKI.V..KY....DNIIDKL........FS
PHOU_BORBU/18-106------------.WDMKECVL.KIIDDSLIA.L...ESK.D..K..NLA.KKI.I..NE...DEKIIDDY........QY
PHOU_STRR6/18-104------------..GLGQLVL.ETASKALLA.L...ASK.D..K..EMA.ELI.I..NK....DHAINQG........QS
Q04GB6_OENOB/124-209------------ISEMGLMAT.RTFDEILDA.Y...VSD.S..I..DDA.QKV.A..DH....SEEVSRL........SA
Q24PY3_DESHY/121-206------------LPRMADLVQ.QMVIKGIEA.Y...KAE.D..A..EAA.KAM.A..LM....DDEVDHL........YA
Q2FYQ1_STAA8/121-202------------LKTMGKLAM.LMLKDLDQA.F...KKK.D..T..VLI.REI.I..ER....DEDIDDL........YS
Q2FYQ1_STAA8/19-105------------LRRLGANVY.VSIENGIKS.L...SID.D..R..GFA.RQT.V..KN....DKHINQL........NY
Q2G1P4_STAA8/451-534------------.DKLFNHVA.ESFDKAIDM.L...DVY.D..K..TKK.DEI.V..ER....SRESFNI........EH
Q2YM24_BRUA2/456-537------------..HFHAMVL.ANAHMAFNV.I...VSR.D..G..RTA.RQL.V..QE....KDRLREM........EK
Q6LZG3_METMP/345-430------------.VEMGKFVR.ENLRLSKEA.L...VNK.N..V..QSI.KEV.H..EK....EKIIDTM........AH
Q72C09_DESVH/126-207------------....AESVL.AQVRFACAA.V...RDM.D..P..DAA.QRL.R..DM....DEEVDFG........LY
Q72C09_DESVH/21-107------------..IMLDGAE.KAVSNCVWA.Y...LRR.D..E..RLA.WDV.A..AH....DFAINDL........EV
Q7VWC2_BORPE/30-116------------.LQMGGIVE.AMIHEAVEA.I...PAG.D..M..SMV.EKV.R..ER....EKEVNRH........EV
Q81HK3_BACCR/348-434------------IIRMAEFSL.HGLKEANQF.L...NTQ.D..K..KHA.NMA.T..QL....EGAINNL........DK
Q81LW7_BACAN/120-205------------LDEMFAIAN.NMLQLALDA.Y...EQE.N..L..TFA.KQI.A..EM....NDSVDEI........YG
Q8DNL7_STRR6/120-203------------..ILHEVIG.LHMNRAISC.Y...REE.Q..S..GCL.DMVVI..QK....QNEIEEL........ST
Q8DX91_STRA5/121-206------------LNSMSNNVI.SMLTKSIDA.F...IYD.N..E..EQA.HQV.I..EQ....DRTVNQE........FD
Q8TR05_METAC/132-222------------IHRMFLIAG.SMQKDAIRA.L...KNV.D..H..DLA.LDV.S..QR....DDEVDRL........CL
Q8U4E2_PYRFU/11-95------------LIEMKNISS.LMIDLALSS.V...MYN.S..E..EIA.EEV.Y..LL....EEKVDEL........TL
Q8XMP7_CLOPE/18-103------------.KEMMELCE.VAIEKSVDS.I...VNK.D..L..ELA.REV.I..KM....DDDIDNL........RN
Q99YH9_STRP1/349-430------------.VHLASYAI.QAFEASYSY.I...MTA.D..G..KFG.EKV.K..RY....ERAVDTI........DE
Q99YH9_STRP1/453-538------------LTEMYQLTH.CLTLDAIRA.I...VDS.D..T..DLA.QTI.V..TR....HKEIEEK........ER
Q99ZG6_STRP1/17-104------------FYSMGMEVL.AQINKTVRA.F...VSH.D..R..ELA.KEV.I..EE....DDTINNF........ET
Q9KU03_VIBCH/128-210------------...LCRQAI.AMLHQVLDA.F...ARM.D..V..EAA.AEI.Y..KQ....DDRLDKE........YE
PHOU_XYLFA/24-110------------IIRMGEIAV.AQLEAALDV.V...ERR.D..D..KAA.DRI.V..MN....DEAIDAL........EQ
PHOU2_THEMA/18-104------------..KAGWFIE.KMFRNSISS.L...VER.N..E..SLA.REV.I..AD....EEVVDQM........EV
R5K2Z4_9CLOT/361-446------------.NQMAGYSA.EALYDSLEL.M...KDYSD.....EKW.QRV.E..AL....EDIVDKY........ED
R5KG61_9CLOT/467-549------------INTLLQATA.NIIDTTFTA.F...KND.D..L..TAV.SRI.E..PL....AQSITEV........KE
R5QA38_9FIRM/353-437------------..RMGYIVK.GTMDKTRRV.L...FTQ.D..E..ETM.NEI.R..EE....ESIADRL........CK
R5QB13_9FIRM/453-536------------LNEMKAQCI.AALDNLKEV.T...SEN....V..ERILSQA.V..II....EQKTDDM........RD
R5UEE2_9BACE/16-103------------IDEMWTLVY.NQLDRAGEA.V...LTL.D..K..ELA.QQV.M..VR....ERRVNAF........EL
R5ZG88_9ACTN/18-103------------..SIYEAVD.LALHDAVKA.Y...VTD.D..R..KLA.TKT.K..KR....TLSIDAR........CA
R6NBB4_9CLOT/18-105------------.KEMGAVVD.RRIGETMEA.L...KNL.D..K..DLA.AEV.V..GG....DREINQV........EH
R6P2I0_9CLOT/337-423------------VDRMGQLAK.ETLGMAMDA.L...ITQ.D..N..TKV.DQI.Y..EN....ENTINFL........NR
R6XDD0_9PORP/471-556------------.DQMLALTE.KALHRMIEI.L...KKS.......ELVRDDV.N...PSYNIENEINNY........RN
R7D861_9FIRM/17-100------------.ITMGSLCE.KAISLSNRA.I....RG.D.....KCI.QEI.F..DT....DKEIDTK........ER
R7D925_9FIRM/469-548------------.....AAVS.RIVDTAYQI.F...DKQ.D..L..NLT.EDV.E..PL....EEIVDEL........SK
R7FXE6_9FIRM/466-547------------...SLKTLE.KMFTDSIKA.L...QGD.K..S..VQT.EKL.I..KR....KDKIMDL........DL
X2GU61_9BACI/460-542------------..GMFSLAI.EAVRKSLEA.L...DTA.S..L..SLA.QEV.T..EL....ESLIDDM........ED

PF01865

Y1799_ARCFU/7-225NVTKSLMLPVDRHDLLEFLKVQDDILNNCEHVGHMVTFRKVSAPEDVWDEFLVLLSKLMEIVNNYEEMVERIMQLVETSF
PITX_RHIME/3-212AVRRSFITPFDRGDIKDLIQSMDDAIDMMHKTVKTIRLYE...QKSFDPGMQAMGAAVVEAAHLVAEAIPLLSRIGANAH
Y629_METJA/7-212NLEK.AFLPNMRRELSRSAELLDETLDSLKHAAMLYELLKEEFDEYLKNEIDLVLMITVDMFQHLDRVLDVIEK..GGDL
Y691_CHLTR/4-223HLASGVFLPVSRAALLEIISIQDSLADCAEDIAILLTVKELQFYPEFEELFFEFLQKTVQSFEAVAKTIREMDRLLESSF
Y1603_HAEIN/6-225KLPRGLFLPIDRTDLLELVTQQDKLANYAKDIAGRMIGRQFGIPEEMQEEFLHYVKRSLDAIHQAHRVIEEMDKLLETGF
Y1689_METTH/2-214EFYEGAFLPFDREDRIMLVESIDKVADVIESAAFTVSLGKVAFPAEFRDDFRAMMKVTGKTIRALHECVESLETDLGEAM
Y2149_ARCFU/6-209KIHSGAFIPALRSDFCNLAEELDEILDELEDIAMLYLLIDF.IPDELRDEFIRIADTNSKMAYLLLDAFNALE...EGGL

PF01895

Q03SN9_LACBA/120-205QV.........RADSYQQMRLDA---------------------------------------------------------
Q0C0L6_HYPNA/20-108EV.........EKQIVSLI.AR.---------------------------------------------------------
Q1AXT8_RUBXD/17-105EI.........ERDCMLLQ.AR.---------------------------------------------------------
Q2NHW3_METST/19-107EI.........YSMSVKIL.AM.---------------------------------------------------------
A1RZ38_THEPD/147-240YG.........LRQLHAAL.RG.---------------------------------------------------------
A3DN16_STAMF/16-108AF.........IESLVFIARFQP---------------------------------------------------------
Q3A6T9_PELCD/117-202ET.........YRL.VIDQ.IE.---------------------------------------------------------
Q2RNF7_RHORT/37-125EH...........QVNEQV....---------------------------------------------------------
A1VPD2_POLNA/21-109EI.........DRELSSII.AR.---------------------------------------------------------
Q8Y4F0_LISMO/121-206IV.........YQK.CIHF.MQ.---------------------------------------------------------
Q8TLE8_METAC/137-228LL.........SKL.FISR.LN.---------------------------------------------------------
Q5WET9_BACSK/120-204KL.........IKKLFRQE.TT.---------------------------------------------------------
Q6AM12_DESPS/122-207SA.........YKNIKAEF.YQ.---------------------------------------------------------
Q2FUH2_METHJ/240-319KI.........NTELLSLP....---------------------------------------------------------
Q8RGL5_FUSNN/332-421EI.........YDSNFSLL....---------------------------------------------------------
A9KP20_CLOPH/121-206EV.........KSTVIEAM.KN.---------------------------------------------------------
Q1QLM7_NITHX/342-429AI...........KLYVTK.LT.---------------------------------------------------------
Q3ATH0_CHLCH/112-197NI.........FNT.ATAM.MK.---------------------------------------------------------
Q609Z7_METCA/24-112EA.........DTEVVAQF.AR.---------------------------------------------------------
Q67RG3_SYMTH/124-209KV.........FDD.LLQA.MQ.---------------------------------------------------------
A5UKP1_METS3/126-211II.........LSHTTELL.TE.---------------------------------------------------------
A8F5R4_THELT/16-104EL.........REEAAVMMGIHT---------------------------------------------------------
Q8EQ00_OCEIH/120-205RV.........VSDLLYET.AT.---------------------------------------------------------
Q5V6R8_HALMA/168-260LF.........LRLVFTIY.R..---------------------------------------------------------
Q3IM37_NATPD/17-105DL.........ESDCIELF.AL.---------------------------------------------------------
Q1AXT8_RUBXD/121-207EA.........LNLIANPPADGN---------------------------------------------------------
Q2RHH1_MOOTA/19-107NI.........EMSALDLF.SL.---------------------------------------------------------
Q0W7U5_UNCMA/120-205RI.........RRELINVM.IN.---------------------------------------------------------
Q8TSA7_METAC/17-105GI.........EVSICDLL.AL.---------------------------------------------------------
A1SXC2_PSYIN/130-215NI.........SRLLITKM.ME.---------------------------------------------------------
Q8FMP1_COREF/18-106RC.........EVQAVELL.AL.---------------------------------------------------------
A2SSI2_METLZ/247-326GL.........ADSIRKMR....---------------------------------------------------------
Q5V0F9_HALMA/136-227MV.........SRV.FRTV.LR.---------------------------------------------------------
A6Q2I6_NITSB/16-104DI.........DNEVVKTI.AL.---------------------------------------------------------
A8ZSJ6_DESOH/16-104EI.........EEDCLKII.AL.---------------------------------------------------------
Q1GAD2_LACDA/16-104DI.........EETCLRLL.ME.---------------------------------------------------------
A7HJE0_FERNB/119-204KF.........QEDITTIIQNN.---------------------------------------------------------
Q92PS2_RHIME/340-427EV...........KIFLSR.LG.---------------------------------------------------------
A6LSI4_CLOB8/122-207SL.........FAS.FIKA.IK.---------------------------------------------------------
A2BLI4_HYPBU/116-197EA.........VRR.LGTV.AH.---------------------------------------------------------
A0LDJ6_MAGSM/127-212A.............AFSET.LQ.---------------------------------------------------------
Q1AX68_RUBXD/13-97DM.........RTLAVLAARSPS---------------------------------------------------------
A5VLT3_LACRD/120-205KL.........QKEIMKALVKGG---------------------------------------------------------
Q2RHH2_MOOTA/339-427AI.........ARYLANMN....---------------------------------------------------------
Y2053_DEIRA/72-160EI.........EDAC..LV.AF.---------------------------------------------------------
Q6MP49_BDEBA/19-107RV.........DNACMHVL.AK.---------------------------------------------------------
Q2FTF7_METHJ/119-204EV.........MRDLIKRMEQKK---------------------------------------------------------
Q6MP49_BDEBA/123-208KV.........FQD.AMAH.MK.---------------------------------------------------------
O28477_ARCFU/135-226LL.........LRQLKQATLHAD---------------------------------------------------------
A0LDJ6_MAGSM/24-112EV.........ERLALRFI.AL.---------------------------------------------------------
Q6AAV0_PROAC/147-230DQ.........FRL.LLGD.DW.---------------------------------------------------------
A4FL22_SACEN/121-205EL.........LDA.ATGA.EW.---------------------------------------------------------
A5V0U4_ROSS1/126-211AI.........LEA.VRQM.AL.---------------------------------------------------------
Q5SM00_THET8/16-104KV.........ENQAIAVI.AR.---------------------------------------------------------
A6LEN2_PARD8/122-207NS.........TAI.IAKY.IE.---------------------------------------------------------
A2SSH8_METLZ/116-201SL.........YKEIVTAM.EG.---------------------------------------------------------
Q3ZA57_DEHM1/17-105EI.........EEKSVELM.AT.---------------------------------------------------------
Q0ASG2_MARMM/127-212TL.........VRE.MLMS.MT.---------------------------------------------------------
A2SSH8_METLZ/16-104ML.........NERGLLLI.AL.---------------------------------------------------------
Q30YR4_DESAG/121-206DL.........LKALMDYM.SK.---------------------------------------------------------
B2JUR6_BURP8/126-211AF.........VRR.LVTQ.MN.---------------------------------------------------------
Q8FMP1_COREF/123-206HI.........MGL.LTIR.EW.---------------------------------------------------------
Q0W7U5_UNCMA/17-105EL.........ENKCIELL.AT.---------------------------------------------------------
A6UUI6_META3/119-204EL.........YGEMIRHI.IE.---------------------------------------------------------
Q2FTF7_METHJ/16-104AT.........EETMFRHL.AL.---------------------------------------------------------
Q1IMC8_KORVE/119-204EA.........FVV.LVDQ.MN.---------------------------------------------------------
Q251M5_DESHY/359-447QI.........TEY.VLKA.TS.---------------------------------------------------------
A3DLY8_STAMF/20-104LL.........VMQASLAVRSAR---------------------------------------------------------
B4SH22_PELPB/118-203MI.........VRT.VMAA.MK.---------------------------------------------------------
Q186T5_PEPD6/447-532TF.........RNS.HMIR.LN.---------------------------------------------------------
B1YLB2_EXIS2/122-207KA.........LRQ.YMRH.MS.---------------------------------------------------------
A1RZ38_THEPD/253-333KV.........FDELARRI....---------------------------------------------------------
Q3IM38_NATPD/147-240LV.........SRQ.FCRI.LT.---------------------------------------------------------
O27757_METTH/89-175KV.........RSSVDTAIAMNP---------------------------------------------------------
A3CVT1_METMJ/216-300DL.........DLWILEAARKIE---------------------------------------------------------
Q834B5_ENTFA/121-206SI.........YKH.AVEA.MK.---------------------------------------------------------
A3CRL4_METMJ/338-425...........IEQALRAI.SK.---------------------------------------------------------
Q74KF7_LACJO/16-104KV.........EKRTLKLM.AL.---------------------------------------------------------
A8AA37_IGNH4/119-200SM............LMDII.KN.---------------------------------------------------------
Q6G4T5_BARHE/125-210SL.........FRE.LLTY.MT.---------------------------------------------------------
A9BHU2_PETMO/25-113SL.........NYESVILLSSG.---------------------------------------------------------
Q2LUX4_SYNAS/355-442DV.........VRY.LWKL.S..---------------------------------------------------------
Q4FLF7_PELUB/22-110TI.........EEQIVTVL.VK.---------------------------------------------------------
A0RXC3_CENSY/16-103DV.........ADLTFDML.LK.---------------------------------------------------------
A6LP09_THEM4/121-202KI.........REK.SKKT.LK.---------------------------------------------------------
Q2S080_SALRD/18-106RI.........DEQCERILALHS---------------------------------------------------------
A9BNX0_DELAS/469-555AY.........SATHLARLSDNT---------------------------------------------------------
Q5WET9_BACSK/17-105DI.........NEKVFDII.AR.---------------------------------------------------------
Q2NHW3_METST/123-208EF.........LVTVTKAM.KE.---------------------------------------------------------
PHOU1_METTH/21-109NL.........ERKAISLI.AA.---------------------------------------------------------
Q9CEW9_LACLA/121-206EI.........QEKILDGM....---------------------------------------------------------
A5D1M0_PELTS/120-205QC.........FDR.LVEI.IK.---------------------------------------------------------
Q2RHH2_MOOTA/445-531NL.........RYSHFQRLQREN---------------------------------------------------------
Q9YG50_AERPE/17-103EQ.........ATFFI....AK.---------------------------------------------------------
A9B5P2_HERA2/131-216EM.........FEA.TVKV.ST.---------------------------------------------------------
Q47KT1_THEFY/132-215KL.........LER.ILSS.KW.---------------------------------------------------------
E0THQ4_PARBH/20-108SI.........ERQVVALL.EA.---------------------------------------------------------
Q6D018_PECAS/339-425AI...........KLYLAQ.IQ.---------------------------------------------------------
Q5Z0T5_NOCFA/22-110TC.........EARTVALL.AL.---------------------------------------------------------
PHOU1_THEMA/18-106EI.........EEKAYQII.AR.---------------------------------------------------------
PHOU_AQUAE/117-202QL.........ERELMTYV.LE.---------------------------------------------------------
A6UVP6_META3/82-166EI.........GVSIKMNS.LR.---------------------------------------------------------
A7H7E1_ANADF/124-209KI.........FNDLLAMM.ME.---------------------------------------------------------
A3CXV2_METMJ/119-204SV.........FRGCLACM.ME.---------------------------------------------------------
B4S7F4_PROA2/163-246KA.........VKKLKAEVNDN.---------------------------------------------------------
A9B5P2_HERA2/20-108RL.........HDQALLII.AT.---------------------------------------------------------
Q5V0G4_HALMA/118-213RA.........SETVARDLIERE---------------------------------------------------------
A7I9M4_METB6/16-104EL.........EEICYQLI.AL.---------------------------------------------------------
A8MCD0_CALMQ/144-239LI...........HRLINMAVNG---------------------------------------------------------
Q8TX17_METKA/194-284NI.........IRA.CEKA.VE.---------------------------------------------------------
B8CZG2_HALOH/119-206KI.........YGHSIKLI.NE.---------------------------------------------------------
A8MBU9_CALMQ/146-238LL.........NRI.LKKL.TT.---------------------------------------------------------
Q0RZA9_RHOSR/121-204RL.........LDL.IQKP.AW.---------------------------------------------------------
A4J4V6_DESRM/467-552EF.........RYG.HIMR.LN.---------------------------------------------------------
Q4KBC7_PSEF5/340-427AI...........RAYLAD.IG.---------------------------------------------------------
Q6ADH5_LEIXX/144-227SV.........FEKVLGET.WK.---------------------------------------------------------
Q1WUX0_LACS1/120-205EI.........RKLSINAI....---------------------------------------------------------
B8CZG2_HALOH/16-104TI.........EEEVSRLL.SL.---------------------------------------------------------
A8MGX2_ALKOO/16-104EI.........ENKCLLLI.AL.---------------------------------------------------------
A5UQ39_ROSS1/16-104AI.........DEHVFQLI.AT.---------------------------------------------------------
A4YI56_METS5/143-234YV.........ARQ.LTLS.IS.---------------------------------------------------------
Q05HF3_UNCMA/14-101DI.........DRECIDAL.AG.---------------------------------------------------------
A7HJE0_FERNB/16-104NI.........LNFSQTIV.GT.---------------------------------------------------------
Q3IX36_RHOS4/343-430AI...........KLYITR.LS.---------------------------------------------------------
O28086_ARCFU/211-297EI.........EKSVLKCSRHFN---------------------------------------------------------
A0B6T7_METTP/241-325RS.........FEPVISSS.STG---------------------------------------------------------
A5G3F8_GEOUR/366-453DI.........SSF.LITL.S..---------------------------------------------------------
A8ZSJ6_DESOH/119-205EI.........YDI.LKGT.GD.---------------------------------------------------------
Q6F1N0_MESFL/119-206EL.........YSYLVKALKKAE---------------------------------------------------------
A5URZ8_ROSS1/121-206CV.........ETM.LTHQ.MA.---------------------------------------------------------
A5EXS4_DICNV/20-109DI.........NKECVRLI.AK.---------------------------------------------------------
B2JUR6_BURP8/21-109EI.........DEEIHRVI.AR.---------------------------------------------------------
Q31I87_THICR/133-218KI.........EKELKESL.KT.---------------------------------------------------------
A6GWK5_FLAPJ/140-225QV.........IEN.IISE.MK.---------------------------------------------------------
A6Q2I6_NITSB/121-210LF.........EKELLENL.CK.---------------------------------------------------------
Q3IUH9_NATPD/24-108RA.........RMSLMLAVRNPK---------------------------------------------------------
A9KP15_CLOPH/357-444VL.........GTY.LVKL.S..---------------------------------------------------------
B2JC47_BURP8/341-428EV...........KAYLAR.VS.---------------------------------------------------------
Q03GY8_PEDPA/120-205KI.........RNE.VLSN.MK.---------------------------------------------------------
A4G2G4_HERAR/21-109DL.........STAAAKVI.AK.---------------------------------------------------------
A6LN86_THEM4/16-104KI.........KEKALIIL.ST.---------------------------------------------------------
Q4FLF7_PELUB/125-210IA.........MNE.VANF.LS.---------------------------------------------------------
PHOU_DEIRA/16-104QL.........EAECLRII.AL.---------------------------------------------------------
O29778_ARCFU/134-226LA.........VRIVNRGMKKIA---------------------------------------------------------
A8F5R4_THELT/118-203EI.........RSELLNSIRNK.---------------------------------------------------------
Q11NF9_CYTH3/120-207NA.........NNVLA.....E.---------------------------------------------------------
Q5V3U8_HALMA/140-232LL.........LRLIFTAYQNPN---------------------------------------------------------
O28916_ARCFU/135-220LV..............LRL.LN.---------------------------------------------------------
A4J4A5_DESRM/448-534RL.........QMSHLIRM.KE.---------------------------------------------------------
A5UMQ1_METS3/7-91EI.........KKESLVAARSYE---------------------------------------------------------
A5WHR5_PSYWF/22-110KV.........DEQVILLV.AK.---------------------------------------------------------
Y2861_DEIRA/125-208............RAVEQVL.AG.---------------------------------------------------------
A4J4V6_DESRM/359-449TI.........TDY.LVKL.SA.---------------------------------------------------------
A0B6T8_METTP/129-214KV.........RDVLMRMT.AE.---------------------------------------------------------
A4X1M0_SALTO/17-105DI.........EAAVPELL.AR.---------------------------------------------------------
Q8F0J5_LEPIN/12-116QNDN.....LSQNAILEAV.AN.---------------------------------------------------------
Q2S5E3_SALRD/191-276EN.........FRG.LVDY.IQ.---------------------------------------------------------
A5UKP1_METS3/22-110EI.........ERSCIRFI.AM.---------------------------------------------------------
Q971H7_SULTO/145-236LA.........LRQLILSQ.S..---------------------------------------------------------
A6GWK5_FLAPJ/37-125KI.........DEICQNIF.AL.---------------------------------------------------------
Q30PB9_SULDN/121-210VL.........EKEILNKIIDEK---------------------------------------------------------
Q8TWZ7_METKA/17-101VL.........KAKLALAIRDLE---------------------------------------------------------
Q9YA54_AERPE/147-239YM.........ARQ.MTMA.SS.---------------------------------------------------------
Q896W9_CLOTE/342-429EI.........TKY.LVKL.S..---------------------------------------------------------
Q1J0M9_DEIGD/118-204QM.........LRASLTRL.HE.---------------------------------------------------------
Q186T5_PEPD6/342-429DI.........LNY.LLKL.S..---------------------------------------------------------
A0JSV0_ARTS2/16-104SL.........DERAIDIL.AL.---------------------------------------------------------
PHOU2_METTH/20-108RI.........EDECLKIL.GL.---------------------------------------------------------
A6TML5_ALKMQ/448-533TL.........RAN.HIGR.LN.---------------------------------------------------------
Q180A4_PEPD6/120-205QV.........QID.CLKI.MH.---------------------------------------------------------
A4G2G4_HERAR/125-210EI.........FDD.ITAL.MK.---------------------------------------------------------
Q05HF3_UNCMA/116-201SV.........FYN.SLGE.IV.---------------------------------------------------------
A3DLZ0_STAMF/142-234MIVRQLALALLDIRIMNEL.GI.---------------------------------------------------------
A9AVN3_HERA2/16-104QI.........ETNALSVI.TR.---------------------------------------------------------
Q5V0G5_HALMA/139-228MI.........DRYFERGLARLD---------------------------------------------------------
A6LGP6_PARD8/360-451EI.........ANYLTEVSEGRL---------------------------------------------------------
Q30PB9_SULDN/16-104EI.........DNEVIKTF.AL.---------------------------------------------------------
A1APX2_PELPD/349-436EI.........TAF.LAKL.A..---------------------------------------------------------
A0PXY5_CLONN/341-428EI.........TDY.MVSL.S..---------------------------------------------------------
Q31I87_THICR/25-113EI.........DRLCAKVL.AR.---------------------------------------------------------
A3DN16_STAMF/122-203NY.........LKK..LKE.ME.---------------------------------------------------------
Q73LA1_TREDE/351-442EL.........SVYLIKTSQLSL---------------------------------------------------------
Q5UZI8_HALMA/218-302RF.........EAWTLRAAADID---------------------------------------------------------
A9BNX0_DELAS/363-450AI...........KYYMTK.IS.---------------------------------------------------------
A9KRG9_CLOPH/120-205TV.........IND.ILNN.IT.---------------------------------------------------------
Q9YG50_AERPE/119-200AM.........LER.IGKV.ES.---------------------------------------------------------
Q12XW7_METBU/17-105DV.........EKATVHLL.AL.---------------------------------------------------------
B8I417_CLOCE/120-205KI.........VLE.LINI.MK.---------------------------------------------------------
Y2861_DEIRA/23-111RI.........EGEALHLL.AR.---------------------------------------------------------
A9KNL1_CLOPH/461-546RF.........QKN.HVVR.LT.---------------------------------------------------------
O29464_ARCFU/138-228LA.........VRQEHRLVREFS---------------------------------------------------------
Q03YL4_LEUMM/120-205KV.........RTDSVNGM....---------------------------------------------------------
A0L7V8_MAGSM/21-109EV.........ENQVIRIL.AL.---------------------------------------------------------
Q6F1N0_MESFL/18-106EF.........TSTALWKI.AK.---------------------------------------------------------
A8AA77_IGNH4/19-103LL.........ALQLMVAARDPE---------------------------------------------------------
A3DN11_STAMF/143-235LI.........TRQ.LNQL.LL.---------------------------------------------------------
Q8YNR1_NOSS1/26-114QI.........ESDCTSIM.TL.---------------------------------------------------------
Q31LX7_SYNE7/130-214AL.........YDR.LVHD.SQ.---------------------------------------------------------
Y1641_METJA/88-172EV.........RILLSMNA.LK.---------------------------------------------------------
A2BIZ3_HYPBU/172-264FI.........SRQLVSVLAGHR---------------------------------------------------------
A4X1M0_SALTO/122-204RL.........LSL.LLAS..W.---------------------------------------------------------
Q8G3U8_BIFLO/16-104SV.........IDQCVKLL.AK.---------------------------------------------------------
A1A0C8_BIFAA/129-212...........HKKTFELAQSED---------------------------------------------------------
Q2FUH2_METHJ/133-224LI.........ARQ.TNMI.LH.---------------------------------------------------------
A8F7W8_THELT/123-210RG.........HEN.LIDF.AC.---------------------------------------------------------
Q1IMC8_KORVE/16-104EI.........DELALDLL.AM.---------------------------------------------------------
A3DJ80_CLOTH/353-440AL.........GTYLVRLS....---------------------------------------------------------
A8F7W8_THELT/19-107KI.........QTTAFDII.GK.---------------------------------------------------------
A0R4B7_MYCS2/18-103QA.........EESAFVLL.AL.---------------------------------------------------------
A4VVC7_STRSY/33-119TI.........QELTTEEIKKN.---------------------------------------------------------
A5I7G9_CLOBH/450-534QL.........RETNIKRL.NK.---------------------------------------------------------
A9WDH3_CHLAA/122-207TL.........RELIIAEA....---------------------------------------------------------
B1HSR0_LYSSC/22-105EI.........NDHVILMI.AK.---------------------------------------------------------
B1WZW8_CYAA5/131-213HL.........YHR...LA.YQ.---------------------------------------------------------
B9JPC1_AGRRK/445-529RS.........SERHLERLRDG.---------------------------------------------------------
F2KB65_PSEBN/131-214TA.........LRELATYM.ME.---------------------------------------------------------
J9ZE71_LEPFM/119-204DL.........VRSMVQEV.SR.---------------------------------------------------------
PHOU_BORBU/126-210KQ.........KSIVIDAMKKN.---------------------------------------------------------
PHOU_BORBU/18-106DI.........EDLCGRII.AT.---------------------------------------------------------
PHOU_STRR6/18-104AI.........ELTCARLL.AL.---------------------------------------------------------
Q04GB6_OENOB/124-209TI.........RKDILTSM....---------------------------------------------------------
Q24PY3_DESHY/121-206QV.........FRDLLVFM.ME.---------------------------------------------------------
Q2FYQ1_STAA8/121-202HI.........INATYLI..DN.---------------------------------------------------------
Q2FYQ1_STAA8/19-105DI.........NERVIMLI.TK.---------------------------------------------------------
Q2G1P4_STAA8/451-534KL.........RKGHIKRL.NR.---------------------------------------------------------
Q2YM24_BRUA2/456-537QT.........SMRHFSRL.R..---------------------------------------------------------
Q6LZG3_METMP/345-430EI.........TNHLIELS.NQ.---------------------------------------------------------
Q72C09_DESVH/126-207EL.........STAVVAFM..K.---------------------------------------------------------
Q72C09_DESVH/21-107EI.........DELSLQLL.AR.---------------------------------------------------------
Q7VWC2_BORPE/30-116EI.........DERISLIL.AR.---------------------------------------------------------
Q81HK3_BACCR/348-434KI.........TEYLVLLS.EK.---------------------------------------------------------
Q81LW7_BACAN/120-205KA.........IREFISSVPE..---------------------------------------------------------
Q8DNL7_STRR6/120-203NI.........EKKIMNYI.FE.---------------------------------------------------------
Q8DX91_STRA5/121-206TI.........KKQLVL.Y.FS.---------------------------------------------------------
Q8TR05_METAC/132-222LI.........SKQFRSVL.CG.---------------------------------------------------------
Q8U4E2_PYRFU/11-95KV.........KKLALKAA.KQ.---------------------------------------------------------
Q8XMP7_CLOPE/18-103KI.........IEKSIELT.AL.---------------------------------------------------------
Q99YH9_STRP1/349-430EL.........TTYLVDIS.NE.---------------------------------------------------------
Q99YH9_STRP1/453-538RL.........RKTHIKRL.NC.---------------------------------------------------------
Q99ZG6_STRP1/17-104KL.........EKKSLEII.AL.---------------------------------------------------------
Q9KU03_VIBCH/128-210AV.........VRQLMTYM.ME.---------------------------------------------------------
PHOU_XYLFA/24-110SI.........SHDVMRL..AL.---------------------------------------------------------
PHOU2_THEMA/18-104EI.........QEKAMEVL.GL.---------------------------------------------------------
R5K2Z4_9CLOT/361-446EL.........GTYLAKVS.GK.---------------------------------------------------------
R5KG61_9CLOT/467-549II.........KDHHVIRL.QT.---------------------------------------------------------
R5QA38_9FIRM/353-437GI.........TDYLIRIS.SL.---------------------------------------------------------
R5QB13_9FIRM/453-536KY.........FKKQMQRL.KK.---------------------------------------------------------
R5UEE2_9BACE/16-103KI.........DSDVEDII.AL.---------------------------------------------------------
R5ZG88_9ACTN/18-103NL.........EAVCYNLI.AT.---------------------------------------------------------
R6NBB4_9CLOT/18-105EI.........ESVCMNLL.AL.---------------------------------------------------------
R6P2I0_9CLOT/337-423GI.........AEYLVKIN.GL.---------------------------------------------------------
R6XDD0_9PORP/471-556QL.........KIHNVEDI....---------------------------------------------------------
R7D861_9FIRM/17-100EI.........ENLCMRIL.LH.---------------------------------------------------------
R7D925_9FIRM/469-548EL.........KRRHINRL.RS.---------------------------------------------------------
R7FXE6_9FIRM/466-547KM.........RKAHVQRV.NK.---------------------------------------------------------
X2GU61_9BACI/460-542KL.........RQKHIARL.NT.---------------------------------------------------------

PF01865

Y1799_ARCFU/7-225SKKEVNRALEYVPIIEQLEHECDLIQIGLHTKLFN..LEN.SNPLDIQLMVTWVVHLGYVANAAARASDRFRIMILG
PITX_RHIME/3-212RLS......AIAEEVTHVEDRSDQLHEQGLKDLFQ..RHGASNPMAYIIGSEIYGELEKVVDRFEDVANEISGIVIE
Y629_METJA/7-212DP........IIKEIKDKEKFIDDVYQNRIYKYLIN..LEVESFWEGKILCDFIDNIVNISDYIEDVADELHIIYLH
Y691_CHLTR/4-223GGNRADKTRVLVSEVSNLEHECDLLQRELMKVFFS..DDFAIGTKGFVLWMQIIKGISGISNNSEKLAYRVSMTLEE
Y1603_HAEIN/6-225KGRELKLVNDMIQELDSIEDDTDQMQIKLRKMLYT..IESRYNPIDVMFLYKIIEWVGVLADQAQRVGSRIELMLAR
Y1689_METTH/2-214R.........KVHEIERFEDEADIIERKIITGLYSAYRQDRIGVVKFLDMKEITRKVANISDRAEDASDRALIIIAK
Y2149_ARCFU/6-209S........DILLKIKILEEQIDSMKGRIYEKLKN...IDFSGYAEWYYFIKFVEKLLNVSDLIEDAGDTIQVLSVS

PF01895

Q03SN9_LACBA/120-205----------AFE..TGAS...................I........YLN..VAQDLSRIGDYVTNVCEWI------
Q0C0L6_HYPNA/20-108----------.RQ..PMGH............DLRM...I..LS....ALK..TSNELERIGDLSKNIAKRA------
Q1AXT8_RUBXD/17-105----------.QA..PVAK............DLRL...I..YT....VMS..LTNHLVRSGTLCEHICHAV------
Q2NHW3_METST/19-107----------.EQ..PVAT............DLRF...V..AN....TIK..IANHLKRIGKLSFNMAEIA------
A1RZ38_THEPD/147-240----------.YV..GLEEIG........LRKVEE...V........LPHGMVLKNIERIADHAASIAQAL------
A3DN16_STAMF/16-108----------LGK..ELRL.............VEA............YIN..VYYDIYRISRYCGEISRID------
Q3A6T9_PELCD/117-202----------.LH..PE..............RIQS...L..IC....FLV..ISRYLERIADQTTNIAEDT------
Q2RNF7_RHORT/37-125----------.VR..LLALRQP......VADDLRT...V..IT....GLK..VSGMLERVGDYAANAAKRG------
A1VPD2_POLNA/21-109----------.RQ..PTAR............DLRL...L..IA....ISK..TTANLERAGDEAAKIARMV------
Q8Y4F0_LISMO/121-206----------.EE..PE..............HIED...V..SQ....LLL..VSQYIERIGDYVTNVCEWI------
Q8TLE8_METAC/137-228----------.LR..KTSKKD........RLRLIE...A..FY....YRL..AAGELERIGNLIVKIVHDL------
Q5WET9_BACSK/120-204----------.DQ..D................VEA...I..TQ....LAF..IARYIERIADYATNLSEWI------
Q6AM12_DESPS/122-207----------.GH..DC...............SSA...L..ID....VFL..VAGYLERIADRATNIAEEV------
Q2FUH2_METHJ/240-319----------......................VNI...A..VP....LRN..ITDSIRRSGEYSADIAENV------
Q8RGL5_FUSNN/332-421----------.SK..SLSKELI......EDTRMNL...L.............ACDEYETIGDYQNRIANRL------
A9KP20_CLOPH/121-206----------.SG..E...............NADS...Y..ID....ILM..IAKYMERIGDHAVNICEWT------
Q1QLM7_NITHX/342-429----------.RG..SLDER...........EGHR...S..ME....IIA..FAINLEHIGDIIDKNLSEL------
Q3ATH0_CHLCH/112-197----------.NP..DA..............DIDQ...L..IA....SLS..ISRYIERMADHAVSIANEV------
Q609Z7_METCA/24-112----------.RC..PKGS............DLRL...V..MA....LSK..AITDLERVGDEAVKIASCV------
Q67RG3_SYMTH/124-209----------.SD..PK..............AVRP...A..VY....LLL..VAHYLERIGDHATNLGEWT------
A5UKP1_METS3/126-211----------.KI..Q...............NALE...I..VN....IIF..IARYLERIADRVVNIGERV------
A8F5R4_THELT/16-104----------LIG..SR...............LRF...V..VG....SIQ..LANIFERIGDNARRISQIT------
Q8EQ00_OCEIH/120-205----------.RP..D...............QIEY...V..MQ....MSF..CARYLERFADHITNIGESI------
Q5V6R8_HALMA/168-260----------.NP..RLNQAVG......LETGFPL...IGYRS.........VAQDVVLMADTAVEIASLA------
Q3IM37_NATPD/17-105----------.QQ..PVAG............DLRF...I..AS....TFK..IITDLERIGDFATNLAGYA------
Q1AXT8_RUBXD/121-207----------TGS..PEWR............................MRAALIVHYLERIADHGVDIGALT------
Q2RHH1_MOOTA/19-107----------.QQ..PSGE............DLRT...L..AT....VLR..VSRELERISDYAVNIAEAA------
Q0W7U5_UNCMA/120-205----------.DP..S...............TIDI...A..SH....LSF..VARYLERSADHACVIASWT------
Q8TSA7_METAC/17-105----------.QQ..PMAS............DLRL...V..VS....ALK..IAADLRRILGLSINIAKIP------
A1SXC2_PSYIN/130-215----------.DP..RE...............IKN...C..LR....ITW..CARAFERIGDHGKNICEYV------
Q8FMP1_COREF/18-106----------.ET..PVAR............DLRQ...V..VS....SIY..IVEDFSRMGALGMHVASAA------
A2SSI2_METLZ/247-326----------......................VPE...A..VA....VTQ..ITQSLHRITEYSSDIAEIL------
Q5V0F9_HALMA/136-227----------.NP..TAANEI........GFPRET...V..FD....FQS..SARQLERIADHATKIASLS------
A6Q2I6_NITSB/16-104----------.FG..PEAS............QLRE...L..IA....YIK..LTNEIVRVGDYAKSYAKNM------
A8ZSJ6_DESOH/16-104----------.HQ..PVAI............DLRF...L..VV....TIK..INNDLERIADEAVNIAQRV------
Q1GAD2_LACDA/16-104----------.QQ..PVAT............DLRI...I..SA....SLK..AVYDLERIGEIGADIADLV------
A7HJE0_FERNB/119-204----------......................PRL......IKRGLILLD..ISKILEEISDFAVQIIEIT------
Q92PS2_RHIME/340-427----------.RD..GLNEE...........DGRR...S..IV....IID..YAINLEHMGDIIEKGLCEQ------
A6LSI4_CLOB8/122-207----------.KD..ES..............LLQE...G..TQ....LLF..VIKYLERIGDHVTNICEWT------
A2BLI4_HYPBU/116-197----------.LS..RCE.............VAE..............ML..LLRHVERIADHAVYIAAEA------
A0LDJ6_MAGSM/127-212----------.HM..STHSQ...........EVIG...A..SH....LLF..MARDMERLGDHLTDVVEDI------
Q1AX68_RUBXD/13-97----------DAE..QMAG............................ILQ..VVQDIEKIGNAAYDIAKIV------
A5VLT3_LACRD/120-205----------EDV..KAYE............S...............YLA..VLRNLERAGDHIVNLAEWI------
Q2RHH2_MOOTA/339-427----------.HD..NLSE.............EQM...VAQTR....LLY..IANDLEHIGDVTVEMARQW------
Y2053_DEIRA/72-160----------.AA..GLSER...........ELAF...Y..LM....VFR..SLANLERVGDYAFSVARDL------
Q6MP49_BDEBA/19-107----------.QG..PVAK............DLRL...I..IS....VLK..INNDLERMGDQTVNISYSG------
Q2FTF7_METHJ/119-204----------DDV..PILA............R...............YVI..IDRYLERCGDQACNIAEMT------
Q6MP49_BDEBA/123-208----------.AH..SD..............DVEA...G..MD....LIL..IARNLERLGDHATNIAEDV------
O28477_ARCFU/135-226----------VAA..QLDIPIE......TIQEYRT.................VVRTLERVADHAANMAESL------
A0LDJ6_MAGSM/24-112----------.RQ..PVAV............DLRA...T..VA....AMR..MAHHLERMGDYTKDVARRI------
Q6AAV0_PROAC/147-230----------.TY..................GVES...A..VD....TAL..LGRYYERIADHAVAVGSRV------
A4FL22_SACEN/121-205----------.TH..................GVAA...A..IN....LAL..LARFYERFADQAVSVARRL------
A5V0U4_ROSS1/126-211----------.ND..AA..............LFDA...A..LA....SLE..ITRALERVADRATNIAERT------
Q5SM00_THET8/16-104----------.HQ..PVAS............DLRL...I..FT....VIK..ALTDLERAGDYAMHVAEDA------
A6LEN2_PARD8/122-207----------.EH..KG..............SALA...G..LY....MAG..VIRKMERFGDHCTNIAEEL------
A2SSH8_METLZ/116-201----------.GS..M...............TIPF...G..SA....CHL..VNRYLERCGDHACRMAEKV------
Q3ZA57_DEHM1/17-105----------.QQ..PMAR............DLRI...I..VA....VLN..IIVDLERIGDHAEGNAKIA------
Q0ASG2_MARMM/127-212----------.ED..SG..............LVGP...G..VH....ILF..VAKNLERIGDHATNIAEAV------
A2SSH8_METLZ/16-104----------.NQ..PMAK............DLRM...I..SS....CMD..IVTSSERIGRYAKDITELV------
Q30YR4_DESAG/121-206----------.ES..PAVE............R......A..VH....TIL..VSRALERVGDLSTNIAEAV------
B2JUR6_BURP8/126-211----------.ET..PQ..............TVSI...A..LE....YLF..IAKAMERIGDHAKNIAEFV------
Q8FMP1_COREF/123-206----------.PY..................STRE...A..VD....MAL..LSRFYERYADHTVNVAARV------
Q0W7U5_UNCMA/17-105----------.QQ..PMAS............DLRF...I..ST....VLK..ILTECRRFSRLAWDIGLIT------
A6UUI6_META3/119-204----------.NP..S...............HTSK...V..TE....IIF..VGKYLERNGNLIASIGDRI------
Q2FTF7_METHJ/16-104----------.YQ..PVAR............DMRE...I..VA....SLR..IIYNFERIGRMGYDIGDTI------
Q1IMC8_KORVE/119-204----------.KY..PE..............TTRY...S..LD....VLL..IARNLERIADHATNIAEDV------
Q251M5_DESHY/359-447----------.GT..NLTKE...........QSDQ...R..YR....VLQ..VIGDMERVGDHSVNLIELT------
A3DLY8_STAMF/20-104----------DAE..EMVS............................VYR..MANALDKLSDSAADIAMLV------
B4SH22_PELPB/118-203----------.IL..PG..............EIEQ...L..IA....VLS..VSRYLERIADHATKTAREA------
Q186T5_PEPD6/447-532----------.NG..SC..............TIDA...G..VL....YLD..LLTNLERISDHSTNIVKQV------
B1YLB2_EXIS2/122-207----------.LQ..PV..............VVDE...I..MQ....FTN..ICRYIERMGDHLTNVGEHL------
A1RZ38_THEPD/253-333----------......................PEE...I..LA....VRL..MVGSYRRIFDYSTDILEAT------
Q3IM38_NATPD/147-240----------.DI..REVET..........LRAGR...R..TV....FTQFRVARQLERIADHAERIADVG------
O27757_METTH/89-175----------YSE..FSKT......................MA....FTE..IAYDLERIGDHSAIIANFA------
A3CVT1_METMJ/216-300----------DVR..YLRG............................LLY..MSSFAQAISDSAHSIVDVL------
Q834B5_ENTFA/121-206----------.AN..PE..............TVIS...G..TD....YLH..VAQYLERIGDYVTNICEWI------
A3CRL4_METMJ/338-425----------.RQ..LSDG............EATE...V..VF....LVR..MSNEIERLGDLGADLGEFF------
Q74KF7_LACJO/16-104----------.QQ..PVAS............DFRN...V..IS....ILK..ATNDLERIGENANSIAWET------
A8AA37_IGNH4/119-200----------.YE..................NVPC...A..VV....EAL..SIKFLERAADHSVQVASQV------
Q6G4T5_BARHE/125-210----------.ED..MR..............NITV...C..TH....LLF..CIKNIERIGDHVTNIAETL------
A9BHU2_PETMO/25-113----------N.Y..TGIY.............LKA...C..FM....SSK..LVQIFENMGDICEKNAKLI------
Q2LUX4_SYNAS/355-442----------.RN..SLTAQ...........PSRT...L..FN....YTA..MVDDIERIADHAVNIIELA------
Q4FLF7_PELUB/22-110----------.RA..PMAI............DLRL...T..IS....TLK..ISSDLERIGDLAKSVAKKI------
A0RXC3_CENSY/16-103----------.YQ..PVAD............DFRL...V..RS....SIE..ISYAYSRFGRYAYDIAQVR------
A6LP09_THEM4/121-202----------.D....................IDE...L..IL....NIL..IARDLERIGDHLNNLCEEI------
Q2S080_SALRD/18-106----------PVA..VDLRM...........L...............IMAVKINTDFERIGDHCRNLSRNA------
A9BNX0_DELAS/469-555----------VSS..IETS............................SLHIDLISDLKRINSLLCSVAYPI------
Q5WET9_BACSK/17-105----------.QQ..PVAT............DLRR...L..IV....VMK..MAGDLERVADFAVDIAKVS------
Q2NHW3_METST/123-208----------.DT..S...............TINT...L..VP....FLL..IARYLERIADRSESIGGRV------
PHOU1_METTH/21-109----------.EQ..PVAG............DLRF...I..EA....CIK..VGSHLKRIGYLAANIAEAA------
Q9CEW9_LACLA/121-206----------.KE..NSET.............VTT...G..KE....YLL..TLVYLERITGYAVNLCEWI------
A5D1M0_PELTS/120-205----------.KE..PG..............KAEM...A..IQ....LLF..AGHCLERIADHATNIGESI------
Q2RHH2_MOOTA/445-531----------RLS..LETT............................SVHMELINHLLRLNIHNVSIAQAV------
Q9YG50_AERPE/17-103----------.YQ..PLGP............ELLE...A..KS....LIR..TSYDLYRIARYCREINRVI------
A9B5P2_HERA2/131-216----------.TS..PD..............MAAA...T..IH....LLT..LAHNLERLGDRVTNLAEQI------
Q47KT1_THEFY/132-215----------.EY..................GVEA...T..MD....VTL..AGRFYERFGDHAVHVADNL------
E0THQ4_PARBH/20-108----------.RR..PSGS............PLRR...A..MT....AIK..IAAEMERIGDLAKNVAKRT------
Q6D018_PECAS/339-425----------.KD..GLDER...........DSRR...W..AE....VIE..VALNLEQAGDIIERMADDI------
Q5Z0T5_NOCFA/22-110----------.QA..PVAR............DLRH...V..VT....AMQ..IADQLSGIGTLTSAVADQV------
PHOU1_THEMA/18-106----------.YN..PILK............QLRY...I..IT....ILK..FSNDLERIGDLSCNIAEKC------
PHOU_AQUAE/117-202----------.DP..R...............NIKR...A..MH....LSF..VARHYERIADHAENVAEAA------
A6UVP6_META3/82-166----------.YL..PME................Q...S..MR....LSV..IAANIERCGDYISNIAEEI------
A7H7E1_ANADF/124-209----------.DS..R...............NIRR...A..TS....LMF..AAKHLERFGDHATNLAEMV------
A3CXV2_METMJ/119-204----------.DP..K...............NITQ...C..TN....YVM..IARYLERCGDHACKIAEKV------
B4S7F4_PROA2/163-246----------........N.............ITN...F..TG....ILS..VVEHVKMSADISCDIARML------
A9B5P2_HERA2/20-108----------.QQ..PLAR............DLRL...V..SV....VLS..LLPELERMGDYAATICKLQ------
Q5V0G4_HALMA/118-213----------ADG..DDGW............AVEQ...L..LDDVSRLLL..TVRDLERVGDHAVNIAART------
A7I9M4_METB6/16-104----------.NQ..PVAK............DMRT...I..VC....SLK..MIAASERIGRYGKSTAKIV------
A8MCD0_CALMQ/144-239----------LIS..VRSVEID......DRPELLS............CLL..VSKSLERSGDHSWRIAQWM------
Q8TX17_METKA/194-284----------.ET..KEFPE...........KADR...L..FG....LSR..ITKDIERIADKAVDVVDFT------
B8CZG2_HALOH/119-206----------.SE..GTR.............NINQ...V..IQ....FLN..IAKSLERIGDHATNIGEET------
A8MBU9_CALMQ/146-238----------.SS..YYASMSG.......IKDPRT...I..LD....YAL..INKSLERLSDHIVQIANEL------
Q0RZA9_RHOSR/121-204----------.SD..................SVTA...A..VD....ATL..LGRFYERFGDHTAVVGRRV------
A4J4V6_DESRM/467-552----------.EG..FC..............AGAE...G..SV....FLD..LLSNMERIGDHSVNLAEYV------
Q4KBC7_PSEF5/340-427----------.KE..GISDQ...........DADR...S..QE....ILL..LVINLEHAGDILATSLAHL------
Q6ADH5_LEIXX/144-227----------......................GQA...VDTVD....ATL..ASRYHERFADHAVSIAKKV------
Q1WUX0_LACS1/120-205----------.KE..DANF.............AEE...G..ID....YLS..IIAHIKRINDYITNLAEWI------
B8CZG2_HALOH/16-104----------.DK..PLTS............DVYN...N..VA....LVK..IAGDLERVGDLATDIADTV------
A8MGX2_ALKOO/16-104----------.QQ..PIAK............DLRS...V..GT....LLK..IITDMERIGDYGVNIAKVT------
A5UQ39_ROSS1/16-104----------.QQ..PVAT............DLRS...L..LA....AIA..IAGELERAADYAKGIAKKV------
A4YI56_METS5/143-234----------.SF..EILEEE........GYNATQ...I..VD....IYS..AVKSIERIADHASRISGLT------
Q05HF3_UNCMA/14-101----------.KL..E.GR............DLRV...V..LG....TYR..MIVDLEHIGDYSVSVSRVT------
A7HJE0_FERNB/16-104----------.SN..PSGY............ELRF...I..FG....SVL..VAKVLLDISSRLKDIAEDI------
Q3IX36_RHOS4/343-430----------.RA..ELDED...........DVRR...A..NE....ITS..FAINLEHMGDIIETGLADA------
O28086_ARCFU/211-297----------DEQLMPLMA............................IVE..IAYCSELIADAARDIAQVL------
A0B6T7_METTP/241-325----------VNQ..EEIL.............MRM...V.............ISSSIARFLDHIKNIGEFT------
A5G3F8_GEOUR/366-453----------.RQ..PLPST...........NAVE...I..PT....MIQ..IINELEHIGDQSEAIMEYM------
A8ZSJ6_DESOH/119-205----------.TG..NIM.............DTEY...L..LN....MFL..ISRHLERIADHATNIAEEV------
Q6F1N0_MESFL/119-206----------NNE..ELLE.............ISE............AMK..QAKNLERAGDHLLTVQEIV------
A5URZ8_ROSS1/121-206----------.QN..PL..............TVAW...N..AG....LLF..AAHYLERVADRATNIGERV------
A5EXS4_DICNV/20-109----------.RS..PVAS............DLRF...I..TA....CDR..IATDLERIGDENCKIAYLL------
B2JUR6_BURP8/21-109----------.RQ..PAAR............DLRL...L..MA....MSK..CVTNLERMGDEARKVSKRL------
Q31I87_THICR/133-218----------.SP..DKIE..............CL...MEMII.........ALRAAERVSDHARNIVESI------
A6GWK5_FLAPJ/140-225----------.TN..SK..............AVGS...G..TN....LIL..ALKHLERIGEHCTNIAESI------
A6Q2I6_NITSB/121-210----------.DT..TK...............LTD...F..LN....VLS..SCRKLERTADRAVEIAKLL------
Q3IUH9_NATPD/24-108----------EAE..ALAP............................VLG..IVAGADHVSDAAADIAKIV------
A9KP15_CLOPH/357-444----------.SK..ELSLS...........NSNS...V..SM....FLH..SIGDLERISDHAVNILDLA------
B2JC47_BURP8/341-428----------.RE..QLDDA...........DSRR...W..TD....IIA..LTINLEHAGDIIERIVTDI------
Q03GY8_PEDPA/120-205----------.TN..PK..............LVTG...G..AG....YLM..VANYIERIGDHVTNVVEWI------
A4G2G4_HERAR/21-109----------.RQ..PVAI............DLDE...V..LA....ELR..IVEDLERIGDLAKNIARRA------
A6LN86_THEM4/16-104----------.LM..PMSK............DLRM...V..TG....SFV..ISSYFQDISEKTLDIARKI------
Q4FLF7_PELUB/125-210----------.KD..KK..............NLDL...A..TH....LLF..VTKNIERAGDHITNIAEAL------
PHOU_DEIRA/16-104----------.HQ..PVAR............DLRL...V..AL....ILK..SLSDIERMGDYVVHVAEDG------
O29778_ARCFU/134-226----------V.S..NWDE.............LRF...L..LG....SRI..IAKFYEEIADTLLIFSRYI------
A8F5R4_THELT/118-203----------P......DQ.............IEK...N..ML....LAE..IAQRIEEIADLSTNVVETV------
Q11NF9_CYTH3/120-207----------.YI..SGNQDR.........EKVLQ...A..VY....LLS..MIRKTERVGDYITNISEEI------
Q5V3U8_HALMA/140-232----------L.A..RAIG.............LNDGFPL..IG....YRS..IAKNLELTADNAEDIAEIA------
O28916_ARCFU/135-220----------.HA..GEGGI..........MHAVD...A..MN....YRS..VVRNLERVSDHISQMSEAT------
A4J4A5_DESRM/448-534----------.G...SRET.............ERT...S........FSHMELINCYIRMSEHLKNIAMLM------
A5UMQ1_METS3/7-91----------DAE..KLTA............................LLE..VAEAAESIANAAKDLADLV------
A5WHR5_PSYWF/22-110----------.RQ..PAAS............DLRL...I..MA....LSK..GVVDLERIGDEASKIARMA------
Y2861_DEIRA/125-208----------.RP..................DAAL...ADTLE....ASH..AWRAAERLGDHLVNVAQRT------
A4J4V6_DESRM/359-449----------.NK..TMTEE...........QSKY...A..ST....LLQ..AVNDLERIGDHAENIVEST------
A0B6T8_METTP/129-214----------.DM..N...............LMDQ...T..IP....LLM..VNRHIERIGDHICNICESI------
A4X1M0_SALTO/17-105----------.QQ..PVAS............DLRL...V..LC....AIR..IAADLERMGDLAVHIAKVV------
Q8F0J5_LEPIN/12-116----------.RN..SMGMDQVDGEVVLKRDPLRF...A..LS....AIR..ITRNLERMGDQIVNCAKCF------
Q2S5E3_SALRD/191-276----------.KN..PE..............HAEV...A..AH....LIT..ASKAIERISDHSTNIAKGV------
A5UKP1_METS3/22-110----------.EQ..PLAT............DLMY...I..ES....SIR..VISHVKRIAYLCRNIAESA------
Q971H7_SULTO/145-236----------.NR..SLAYMIG......VKRI.QL...IGNRI.........LIKAIEEAADEISEAANDL------
A6GWK5_FLAPJ/37-125----------.QQ..PVAS............DLRF...I..IS....AMQ..ISSEIERIGDLAISVIKNS------
Q30PB9_SULDN/121-210----------ELS..IEYV............K...............VLG..SLRKLERSCDRSVNIANLM------
Q8TWZ7_METKA/17-101----------DVR..HLLP............................IME..LTQSMEVITDAANDIAETV------
Q9YA54_AERPE/147-239----------.GR..LPLKDLG.......VYSPAE...I..VH....LFL..AVKSIERVADHATILSVRV------
Q896W9_CLOTE/342-429----------.NT..QISTK...........EIDV...V..TS....MFR..VVKDIERIGDHGKNIADLS------
Q1J0M9_DEIGD/118-204----------.RP..H...............DTEV...A..LM....AQR..MARSLERLGDHLVNVAERL------
Q186T5_PEPD6/342-429----------.KE..PLRDD...........ERFR...T..DL....LFN..TVNDIERVSDHAENIAELA------
A0JSV0_ARTS2/16-104----------.QG..PVAS............DLRM...I..VG....SLR..MSASLERMGDLARHIAQLA------
PHOU2_METTH/20-108----------.HQ..PVAK............DLRL...A..SS....IMR..SAIELERINILLAYIARYA------
A6TML5_ALKMQ/448-533----------.AR..QC..............IPGS...G..VV....FLD..IISNLERIGDHSSNIAMAV------
Q180A4_PEPD6/120-205----------.EN..SN..............TIDQ...G..VK....LLL..IGRYLERIGDHITNVCEKI------
A4G2G4_HERAR/125-210----------.GS..QQ..............QVVG...L..VH....LLF..CAKNIERIADHATHLAENA------
Q05HF3_UNCMA/116-201----------.HE..PE..............RSTN...I..IY....LIM..AARALERIGDHITEIAERV------
A3DLZ0_STAMF/142-234----------.SN..PVEAI...........NYRI...L..............ARNLERIADHAVNIAKRT------
A9AVN3_HERA2/16-104----------.QQ..PMAR............DLRV...V..SM....FLE..LASELERIGDYAEGIAELV------
Q5V0G5_HALMA/139-228----------EID..ALGLTRP......ELFT...............LWG..TANELERVADHAERIGTIA------
A6LGP6_PARD8/360-451----------SSE..SKEE.............IRI............MLR..AVSEIESIADSCNNLARSI------
Q30PB9_SULDN/16-104----------.FG..PEAN............ELRF...L..IT....FLK..MTNELISIGGGVKKYARRM------
A1APX2_PELPD/349-436----------.RS..STNTA...........VSFQ...I..PG....LLQ..MVTDLEKIGDCCEKILDCI------
A0PXY5_CLONN/341-428----------.ST..NLSEA...........QSEL...I..TS....LFH..VVSDIERIGDHADNIVEIA------
Q31I87_THICR/25-113----------.QQ..PTAS............DLRL...I..LA....AIR..IAIDLERMGDEVVKLAKLV------
A3DN16_STAMF/122-203----------.KV..PKY.............FATK...T..I..........LARHIERIGDHATYIAEKV------
Q73LA1_TREDE/351-442----------SEK..NRKN.............VRL............MLG..IVDDIENMTDQIFELGLFI------
Q5UZI8_HALMA/218-302----------DPV..SLRG............................LVH..LARSTEVISDAALEMSEGV------
A9BNX0_DELAS/363-450----------.RA..ELDER...........EGQR...W..TE....IIS..FTINMEQIGDIIERVLLDI------
A9KRG9_CLOPH/120-205----------.EI..KG..............LLKQ...G..TK....LLF..LGRYLERIADHSTNICERT------
Q9YG50_AERPE/119-200----------.LS..QTE.............AVD..............LL..IVRHLERIADHAVYIARQA------
Q12XW7_METBU/17-105----------.QQ..PMAK............DLRL...I..TA....SYK..IAIDLERMSDFAVNIAELV------
B8I417_CLOCE/120-205----------.NN..PS..............TVEQ...A..TD....YMF..VVKYLERIGDHATNIAEWV------
Y2861_DEIRA/23-111----------.QS..PVAH............DLKL...T..LL....ILQ..STPDLERAGDYAKHVARRL------
A9KNL1_CLOPH/461-546----------.KN..AC..............SAET...G..MI....FSD..LLSNLERVADHGTNIAFSI------
O29464_ARCFU/138-228----------SPS..KWNE.............LRL...I..LG....IRT..VAKLIEEIADSLYNFSTYA------
Q03YL4_LEUMM/120-205----------.KE..DAEL.............VDS...A..AD....YLV..IAGYLKRIGDYTTDIAEWI------
A0L7V8_MAGSM/21-109----------.RE..PKAD............DLRR...V..VS....IMK..TATDLERMGDLSANISKRA------
Q6F1N0_MESFL/18-106----------.QQ..LVAR............DLRL...A..VG....GIL..LAREIEIIADYSKKLCIFF------
A8AA77_IGNH4/19-103----------DAE..KLLP............................ALR..LGMSMDLATEAASDMATTV------
A3DN11_STAMF/143-235----------.GE..LSPSNLG.......LVALPE...A..LY....MII..SVKSIERIADHAVLISEII------
Q8YNR1_NOSS1/26-114----------.QA..PTAQ............DLRC...L..SA....FMQ..LVRDLERIGDYAKDLAQIA------
Q31LX7_SYNE7/130-214----------.AQ..F...............NLEA...T..VL....LVL..VIRHIERMADHATNVGQRI------
Y1641_METJA/88-172----------.YL..PGA................Y...A..NA....LAT..IASNLERLGDYIANIAEEV------
A2BIZ3_HYPBU/172-264----------QPG..EIG....................LGSAAEAGLILM..ASKHVERAGDHVSRMARSA------
A4X1M0_SALTO/122-204----------.QY..................GVES...A..ID....LAL..VGRYYERYADHAVNVARQV------
Q8G3U8_BIFLO/16-104----------.QN..PVAT............DLRV...V..VS....TMR..LASTFERMGDLARHVAEAA------
A1A0C8_BIFAA/129-212----------WKG..TNQQ...................L..ID....VVL..IGRFMERLGDHAVSAARRV------
Q2FUH2_METHJ/133-224----------.NV..HLSRKM........NMNISE...M..LP....HFQ..VARIIERVGDHSVRIALNA------
A8F7W8_THELT/123-210----------.KE..TSPR............MMRL...Y..LE....EAF..LIRHLERIADHLTNISEKL------
Q1IMC8_KORVE/16-104----------.QQ..PMAV............DLRF...I..LA....VVK..INADLERVGDQAVNIAQRV------
A3DJ80_CLOTH/353-440----------.SQ..NLSAR...........DTTE...A..AK....LLF..LIGEFERIADYALNIVDSA------
A8F7W8_THELT/19-107----------.YQ..PLAD............DLRF...V..VA....MIG..LSVDLERIADECVNIAQLS------
A0R4B7_MYCS2/18-103----------.QA..PVAG............DLRT...V..VS....AIQ..IIADVDRMGALALHVAKI.------
A4VVC7_STRSY/33-119----------.PE..SL................VA...G..RD....YYQ..VLTYLERVGDYAKNICEWV------
A5I7G9_CLOBH/450-534----------.GT..CNAN.............A.....S..AI....FLD..IINNFERVGDHCTNIAQT.------
A9WDH3_CHLAA/122-207----------.RQ..DPDR.............FEA...A..LD....LLD..MVHALERTADRATNIGERV------
B1HSR0_LYSSC/22-105----------.QQ..PVAT............DLRR...L..MV....LVK..AAADMERVGDYAVNIAKE.------
B1WZW8_CYAA5/131-213----------.RD..ILGF.............IEP...F..LL....LAL..IIRHLERMADHATNIAQRV------
B9JPC1_AGRRK/445-529----------RAD..S................LQT...S..SL....HLD..ILRDLKRINAHITSVAH..------
F2KB65_PSEBN/131-214----------.DP..R..S.............ISR...V..LS....IIW..VLRSLERIGDHARNISEL.------
J9ZE71_LEPFM/119-204----------.DP..G..K.............TSP...V..IR....LLF..VGRSLERFADHATNVAEII------
PHOU_BORBU/126-210----------.PE..N................LDY...L..LN....ILF..LNSFLERVGDHVATIGEL.------
PHOU_BORBU/18-106----------.EH..PVAT............ELRE...I..LA....IIK..IISSLERIADHATKIVKVV------
PHOU_STRR6/18-104----------QQP..QVSD.............LRF...V..IS....IMS..SCSDLERMGDHMAGIAKAV------
Q04GB6_OENOB/124-209----------.KG..DVDT.............IDA...G..AD....YLV..VVGYLKRTADHATDIAEWL------
Q24PY3_DESHY/121-206----------.AP..K..T.............INQ...A..TY....LIF..VGRFLERMGDYCTNIAEEV------
Q2FYQ1_STAA8/121-202----------.DP..FVA.......................AQ....AHL..AARHLERIGDHIINIAESV------
Q2FYQ1_STAA8/19-105----------.QQ..PIAS............DLRM...M..IS....SLK..IASDLERIGDNASSIAN..------
Q2G1P4_STAA8/451-534----------.GE..CTTKG..........GLL..............YID..MIGVLERIGYHSRNVSEA.------
Q2YM24_BRUA2/456-537----------.EG..STRS.............IET...S..SI....HLD..TIRDLKQINSLLASMA...------
Q6LZG3_METMP/345-430----------.EI..SDSQ............KL.K...I..TS....LIS..NVTSLERIGDLAEDIVEH.------
Q72C09_DESVH/126-207----------.EN..PEAM..............ER...A..LS....FLI..MARRLERIADLATNIGESV------
Q72C09_DESVH/21-107----------.EA..PLAQ............DLRT...I..IA....TMR..ISNDVERIADEAANVAERA------
Q7VWC2_BORPE/30-116----------.HQ..PTAI............DLRT...L..LA....VSK..MLTDMERSGDEAEKIATA.------
Q81HK3_BACCR/348-434----------PLS.....PT...........DSEK...H..SV....LAG..VVGDIERVGDHVENLVEL.------
Q81LW7_BACAN/120-205----------..Q..PEA..............ITQ...I..TQ....LSF..VARYIERVADHITNIAENV------
Q8DNL7_STRR6/120-203----------DDG.....N.............VSE...V..IG....ALD..IIHHLDKIAHTTQSIYKW.------
Q8DX91_STRA5/121-206----------.VQ..DVDG..............EY...P..ID....VLM..IAKYLERIGDHTVNIAKWV------
Q8TR05_METAC/132-222----------GRM..PDSSE..........TSIEE...Y..HD....FRM..AASPIERIADHSQRIANV.------
Q8U4E2_PYRFU/11-95----------LED..PESM......................LS....VIE..MANINEQISDSAYEIADIV------
Q8XMP7_CLOPE/18-103----------.KQ..PMAK............DLRN...V..YA....LST..IAMELERVGDYSVNIAM..------
Q99YH9_STRP1/349-430----------ALS..PSE..............NEV...L..AG....ILD..SSRDLERIGDHSES.....------
Q99YH9_STRP1/453-538----------.GE..CT...............AQA...G..IN....FID..IISHYTRITDHALNLAEKV------
Q99ZG6_STRP1/17-104----------.QQ..PVSN............DLRM...V..IT....VLK..ASSDIERMGDHAASIAKA.------
Q9KU03_VIBCH/128-210----------.DP..K..N.............IPH...I..LQ....VIW..SARAIERVGDRCQNICEYI------
PHOU_XYLFA/24-110----------.RG..PMAR............DLRE...I..LA....GLR..IPADIERIGDYAANVAKR.------
PHOU2_THEMA/18-104----------.FS..PIGK............PLLT...V..TA....GIR..VAELIENIADKCHDIAKNV------
R5K2Z4_9CLOT/361-446----------.....ELAEE...........DSKR...V..SN....GLH..CIGDLERISDHALAIAEI.------
R5KG61_9CLOT/467-549----------..G..DC.D.............IDG...G..FA....LVD..ILTSLDRIGSHCSNIG...------
R5QA38_9FIRM/353-437----------.AI..NEKE.............HQH...V..AS....LLQ..IVSDIERISDYCENISEY.------
R5QB13_9FIRM/453-536----------.GK..CK...............PQS...G..IV....FSE..ILTDFERMGDHALNIAQ..------
R5UEE2_9BACE/16-103----------.YN..PVAI............DLRF...V..LA....MLK..INTNLERLGDFAEGIARF.------
R5ZG88_9ACTN/18-103----------.QS..PVAS............DFRL...L..QT....IIY..VDFNLQRMTDKVRQICRA.------
R6NBB4_9CLOT/18-105----------.QQ..PIAT............DLRV...I..AS....CLK..IITDVERVADQCADICDII------
R6P2I0_9CLOT/337-423----------.....DLED............YDRQ...A..LG...SMYH..VISDMERIGDHSENLCEL.------
R6XDD0_9PORP/471-556----------.NN..KKYQ.............YQD...G..VY....YMD..IIGEAEKLGDYVLNVVQA.------
R7D861_9FIRM/17-100----------.QQ..PVAR............DLRE...V..SA....ALK..MISDMERIGDQASDIAD..------
R7D925_9FIRM/469-548----------.GE..CT...............IEM...G..FI....LTD..LLTSLERIADHCSNISVC.------
R7FXE6_9FIRM/466-547----------.GK..CKAS.............L.....T..TP....FTN..ILHLIDRMGNSCVNLADV.------
X2GU61_9BACI/460-542----------.NE..CSGA...............A...G..IV....YTD..IVSNLERIGDHAVNIADS.------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window