Sequence alignment for CL0297

PF01865

Y1799_ARCFU/7-225VGEVFGYSPFRSLAQHARMCG-RAVGLLQQQ-FEALRRG-NYEEVEELR-EEI-D--EL----EHHADQI--------KE
PITX_RHIME/3-212GLFRKLLPREDRFFDLFADHS-RTVMGAAEA-LNALLAG-G.PDIESHC-DRI-V--AL----ENEADEI--------TR
Y1389_PYRHO/1-210MIGGKEKEVFAKIREHLNAVE-STLMAFRKL-FEVYIRG-DVERAEELL-KDV-E--RE----ESRADEL--------RR
Y629_METJA/7-212SIFLFERDNEKSVIDNLRLLI-QMSLKSIEL-LKDYMN.-..SKDEKIL-KEI-I--KI----EEEGDET--------TK
Y691_CHLTR/4-223LASLFGQSPFAPLQAHLELVS-STINVLFPL-FSALKEG-DYERVGVLA-QLV-S--SK----ERQADGM--------KN
Y637_PYRHO/7-226WKKLFAKSPFKPLIRHAEVVV-QTVETLEKA-LDSWARG-DYENMKEYA-KKV-D--DL----EDIADKI--------KS
Y1603_HAEIN/6-225ILGLFAHSPLKPLQKHSEKVT-ECSDLLIPF-FQTTFSK-NWEQAEEKR-LEI-S--QC----EREADSL--------KR
Y1689_METTH/2-214KFFLKESKVEKHGRQHLEKVM-ECYLKFEEL-MEAFYRG-DCRLVSELT-KEI-A--IK----EHEADEI--------RR
Y2149_ARCFU/6-209KKIVFGGEREREVVELIGKQV-ELIIDTCEL-MKSIIE.-..RSDEAVV-GDV-C--EA----EKLGDAI--------RR

PF01895

Q9WWA8_AGRRK/446-532------------LQQLFQLTI.DNLRIAQTI.L...ITR.D..I..KLA.TQL.M..ER....KIDVRRM........EK
Q03SN9_LACBA/120-205------------IGQMGHLTT.QMVKDVLSA.Y...VNK.D..E..HEA.REL.A..AV....DRQLDDL........NH
Q3K4F6_PSEPF/130-215------------VRHIGDQVR.NMVRDALDA.F...ARF.D..A..DLA.LSV.A..QY....DKIIDRE........YK
A3IBE4_9BACI/458-543------------LIGMFSLAI.EAVRKSIEA.L...DTA.S..L..SLA.QEV.T..EL....ESLIDDM........ED
Q0C0L6_HYPNA/20-108------------IMRMGGIVE.TMIADSCRA.L...SIN.D..P..VLA.REV.I..AR....DPQVDVI........EA
A9A7B7_METM6/344-431------------VVEMGKFVR.ENLRLAKDA.F...VNK.N..V..QII.KEV.H..EK....EGIIDTM........AH
Q1AXT8_RUBXD/17-105------------VLDLGREVL.GSLDDMVEA.L...ETG.D..I..GAANREIGV........DARYKAR........GT
Q9HS09_HALSA/241-324------------LETLQADAT.DIIETAMDA.L...FAD.TADEATALA.TQA.R..AQ....VRDIDDQ........AR
Q2NHW3_METST/19-107------------TEKLSTLTI.DNYKESIEL.F...HNY.N....DEQY.KII.E..EN....TNRIVKE........SK
Q14PE5_SPICI/124-211------------LKKLVAKVI.EMLTEVSNI.F...EEE.R..I..ESA.YNI.L..KY....DTELDKI........YK
Q3DDJ5_STRAG/121-206------------LNSMSNNVI.SMLTKSIDA.F...IYD.N..E..EQA.HQV.I..EQ....DRTVNQE........FD
A1RZ38_THEPD/147-240------------ITKMRDAVT.GMLEDVKAA.L...GGG.D..V..EKIASEI.V..SR....DDIVDKL........YL
C0AA68_9BACT/341-428------------TLRMADRVR.AQLTSFWQA.C...RNG.D..V..ELA.KRI.Q..RE....DDKVDWY........NR
A3DN16_STAMF/16-108------------LNDMKDIIY.KILDYTGKL.F...SEP.N.....EYIRRDI..........RKSIEELINTIEIIRHD
A4TA42_MYCGI/121-204------------FADMAQVAT.ELGELVRRT.V...DSG.D..P..GLA.QQV.C..DG....DERMNDL........HR
Q7WH04_BORBR/20-108------------FLQMGGIVE.AMIHEAVEA.I...PAG.D..M..SMV.EKV.R..ER....EKEVNRH........EV
Q3A6T9_PELCD/117-202------------FTGMSSKVH.DMVKMSLDS.L...VNL.D..P..QLA.REV.I..SL....DDEVDSM........HH
Q2RNF7_RHORT/37-125------------IQQMGGLAI.AQTRDAIEV.I...LGR.HPD....VA.ARI.F..VR....EDEMNGL..........
A1VPD2_POLNA/21-109------------VMELGGLVE.SQLRLAIYA.L...SQF.S..A..ESA.NQV.I..ET....ELRVNGM........EL
A6UJ27_SINMW/347-434------------VLFMGEMVE.RMLCPVMEL.L...EHP.N..R..RKL.EEI.R..RL....DEHVNRA........HR
Q609Z7_METCA/131-216------------VLVLADLVV.KRFESALRI.V.......D.....SWEAEQA....QQFIASQREVSER........FQ
Q8Y4F0_LISMO/121-206------------IPEMGEIVK.SMLQDVLKA.Y...LAE.D..E..GAA.REI.A..ER....DNEVDKL........HK
A3SW68_9RHOB/125-210------------IRRMCKTVE.SMLKDALDS.Y...VQR.D..A..ELA.MDV.I..AR....DEDVDQM........YN
A7VHC0_9CLOT/465-550------------LNLYSNAVY.EIMSMTCKA.L...NED.D..M..KIA.KRI.E..PL....EEVINGL........NA
A7NGW7_ROSCS/12-100------------LDAMGRRVK.DALHESLQA.L...RRS.D..A..IGA.QRV.V..HD....DPDINAL........QQ
A9A7B7_METM6/449-534------------INVMFDKVM.TALETALEA.F...ENE.D..E..VLI.ERV.T..FL....EDEVDNL........EK
Q0W1F8_UNCMA/244-323------------IEDANRQSM.KLVENAIDA.M...FKR.N..I..NQA.NST.F..IL....RQEATQK........LR
Q8TLE8_METAC/137-228------------FKRMSSLVF.LMFNDLMEI.Q...RTR.T..P..ENI.RDI.I..AR....DEDVDKI........FF
Q9V263_PYRAB/138-231------------LKRMSAIVT.SMFSDLELI.I...QGQ.N..G..EVL.RDI.K..DL....ENELDRF........YF
Q7WTY2_MYCSM/16-104------------LGAMCELAG.TAMERATQS.L...LQA.D..L..VLA.EQV.I..SD....HEKMTTL........SA
Q1Q2E1_9BACT/157-242------------IPRMGEIGI.AMLEKSLKA.F...MER.D..V..EAA.RSV.C..DE....DDKVDAL........HD
A0NT92_9RHOB/344-431------------LLRMGELVE.VMARPVLMM.L...EKG.S..E..QEI.RRL.Q..QL....DTQVNAI........HS
Q5WET9_BACSK/120-204------------LIELALDAK.GMIEKALHA.Y...ATK.N..V..LTA.QQL.A..KA....DDEIDER........FG
Q6AM12_DESPS/122-207------------YSTMSRIVI.EMLKMSIDA.L...VKR.D..S..AKA.RQV.F..FL....DDDVDAL........RD
Q2FUH2_METHJ/240-319------------IRKASEGAL.TTFEKSVES.F...FTH.D..L..KKA.NKM.I..EY....MHDLEES........FL
Q8RGL5_FUSNN/332-421------------VNSMVDIIE.DAFLKLEES.L...KEK.D..KIAKYN.DSI.I..EA....EDKLDLY........EK
A6DFF6_9BACT/119-204------------LQEMFPKVL.NMMNLTIDC.....AYKDDIETVIQVC........EL....DNSIDAL........NK
A5LR94_STRPN/16-104------------FLGLGQLVL.ETASKTLLA.L...ASK.D..K..EMA.ELI.I..NK....DHAINQG........QS
A0RIP2_BACAH/120-205------------LDEMFAIAN.NMLQLALDA.Y...EQE.N..L..TFA.KQI.A..EM....DDSVDEI........YG
A9KP20_CLOPH/121-206------------IPKMAQVAK.EMVHDAVDA.F...ISC.D..T..EAA.RVT.I..KK....DDIVDDL........FN
Q3R0V0_XYLFA/24-111------------IIRMGEIAV.AQLEAALDV.V...ERR.D..D..KAA.DRI.V..MN....DEAIDAL........EQ
D1N4D7_9BACT/120-205------------FAPQMEIAR.QMLKAALDA.L...VAR.N..C..LEA.NET.I..RM....DDRIDEL........NR
Q1QLM7_NITHX/342-429------------TLRMGDLVE.AMLRKVMDA.M...MAN.D..K..SLV.DQV.S..RM....DDGVDGL........DE
A6GK60_9DELT/17-105------------FKFLILEVT.KLLEDTQRV.L...VDP.R..P..EVI.AKI.A..AR....DDYVDNL........KS
Q3ATH0_CHLCH/112-197------------FENMAMNAK.EMVIKAIDS.F...VEK.D..D..SLA.RKL.H..EM....DDAIDTT........HR
Q609Z7_METCA/24-112------------VLEMGTLVL.TQVKEAVRS.L...KTG.D..V..SLA.AEI.I..EE....DDQVDDL........EV
Q67RG3_SYMTH/124-209------------IPLLARRVQ.EMNREALDA.W...VQG.D..S..DRA.RRM.T..RR....DDEIDRL........YR
A5UKP1_METS3/126-211------------LEYMADYVQ.IMLTRGFGS.F...CNQ.D..I..SVA.REL.A..SD....DDKVDDL........FD
A8F5R4_THELT/16-104------------LMKMGWYTE.KMFLNAIEA.L...ENK.D..S..KLA.KQV.I..ED....DNVLDGM........EI
Q8EQ00_OCEIH/120-205------------LSHMHHQVK.KMLHTAVLA.F...EQE.D..I..SLA.GKL.A..EM....DDEVDHV........YK
Q5V6R8_HALMA/168-260------------LGRLSRTEA.VIRGDAISA.L...IEG.D..T..DLV.ETV.E..SR....QEQVEKL........FY
Q3IM37_NATPD/17-105------------VVSMSDLVL.DRYNRALTT.M...ETK.D..E..PMA.QSV.I..EG....DEDVNQL........YL
A7FZ36_CLOB1/450-535------------IKHLFNYTL.DSLTRTIEG.F...ESN.D..V..ERS.QSV.M..YI....EEKIDNL........EE
B3EDV7_CHLL2/52-141------------LTKLSSNVE.NNLMLSIRA.S...TKK.N..V..ELA.ASA.F..KF....DEEYIQK........GK
Q1AXT8_RUBXD/121-207------------LVEMARTAR.DIFHEGLEI.F...ETR.D..I..ERA.REL.Q..AS....DDRVDLL........YS
A1RZ34_THEPD/143-235------------LSRMEILVK.NDVRDLEDY.....YEEKD.....SSYLRSV......V.ERDVELDKF........YF
Q2RHH1_MOOTA/19-107------------LLHMGDYVV.GQLDQALAA.L...KTQ.D..V..KMA.RQV.I..MG....DDATDDL........DH
Q0W7U5_UNCMA/120-205------------VCEMYENVH.AMVRDSFIA.F...RDR.N..V..ELA.KSM.S..AR....DDVVDAQ........YD
Q8TSA7_METAC/17-105------------VSSLGEMAE.FVFSDSMDA.V...INL.D..I..ELA.KKT.L..AL....EPKMDRL........EE
A1SXC2_PSYIN/130-215------------LKHLGETVI.ANLHQAMKA.Y...AAL.D..I..ETA.LQV.I..EQ....DEQINIE........FD
Q48XB8_STRP1/459-544------------LTEMYQLTH.CLTLDAIRA.I...VDS.D..T..DLA.QTI.V..TR....HKEIEEK........ER
PHOU_ARCFU/109-184------------VFKAEKYLK.KMFDAVKEG.Y.................TKTEGLKERMTELDNAVDEI........YV
A3IBD5_9BACI/121-206------------LQTMCNKTV.EMLESIMKA.F...TEE.D..T..VRA.KEI.A..EL....DDYVDDL........YG
Q8FMP1_COREF/18-106------------LIILCDLTK.DTMTKATDA.L...VNT.S.....LASAEAA.L..SN....AEQLEEV........RL
A3IBE4_9BACI/353-440------------VLRMGEHAL.RGLEETFLY.M...KSG.E..A..EHI.PTV.L..QL....EAGLNHL........DN
Q18H39_HALWD/153-237------------LNRLNTVTT.TQYHAAHDAFL...DNKPD................QPAGTLESLANER........YS
Q0TMT3_CLOP1/448-533------------IDYIYDQTI.RALDITIDA.Y...ANE.N..V..EEA.GTI.Y..EI....ERKIDAS........QK
A2SSI2_METLZ/247-326------------LTGLSEFSL.NIFNKSIQA.I...YSG.S..I..PGA.NKI.I..TE....VEEMEAA........YH
Q5V0F9_HALMA/136-227------------ITRMRLVSL.TMLSDAVEA.L...IED.D..D..DLA.ADV.M..QR....DDDVDRL........WY
Q1K0S3_DESAC/368-455------------TNRMAELCL.ECLDDTLRF.M...RTR.D..S..RML.EGL.R..KK....EDLIDLL........QK
A4W1M8_STRS2/121-207------------IKKMGREVR.QLVEETLELYL...GDA.D..M..ERA.YEV.A..AR....DEVVNEF........YS
A6Q2I6_NITSB/16-104------------VSDAAEKVI.NAHKIALDS.F...KNK.D..I..NEF.KSV.S..EL....VKSLDNE........AR
A8ZSJ6_DESOH/16-104------------ILDLGAMTE.DRLNKAVTA.V...CES.R..R..DLA.EQI.I..AT....DYEIDDL........EV
Q2NHV4_METST/190-278------------LEEMYEMSE.TMFKKAVRS.F...FKR.D.........VNI..........KEKMDRY........ER
Q1GAD2_LACDA/16-104------------MEEIGQLCK.ESIFESTDT.L...FTG.N..Y..HEA.EDT.I..NL....HHRIHKA........ER
A7HJE0_FERNB/119-204------------LPEMFSFAQ.KMLRKALRI.Y...VDQ.N..T..EGA.YGI.C..NQ....DEIMDKM........LE
A1RSV4_PYRIL/142-234------------AGKMLRLVG.NMLSDLITG.L...EKD.D..V..AML.RDI.I..ER....DDEVDRL........YW
Q92PS2_RHIME/340-427------------VLRVGDLIE.VMLMRASEA.F...SKN.D..V..NEL.GDI.E..NI....ERQVDLL........QQ
Q39UL6_GEOMG/454-539------------IRNLARKAE.EMVALAVET.I.......E.....TPAADAI....EKGRGLRDEVVQM........RE
A6LSI4_CLOB8/122-207------------LWDMERKAR.YMIKASIDS.H...VND.D..E..EMA.YRI.C..KK....DDEIDTI........YR
B0K446_THEPX/17-105------------VLKMGSLVE.EMIANAIAS.L...VNH.D..T..ELA.QKV.I..DG....DDRIDKM........EV
A2BLI4_HYPBU/116-197------------IRVVLGKAE.EMLDMAYRA.L...VEE.D..G..GLA.EKV.S..EL....DASVDEA........YV
A0LDJ6_MAGSM/127-212------------VIQMAVRLA.EAIKDSVVA.Y...TNR.D..V..GKA.LRV.W..SG....DEEIDLL........NN
Q0A7V3_ALHEH/22-110------------LTRMLEHGA.WMFARANEV.L....YSET..PADEVR.QPL.Y..DR....DQSINEL........ER
A2PVH6_VIBCL/125-210------------LEPLCRQAI.AMLHQVLDA.F...ARM.D..V..EAA.AEI.Y..KQ....DDRLDKE........YE
Q1AX68_RUBXD/13-97------------LAEAKDTSE.LMVDLAYAAIL...YDS.E.....DIS.EEV.F..RL....EERLNQL........VF
B8G920_CHLAD/123-203------------LVELGKIAR.INLDRTLLA.F...GDG.S..S..EAI.KGI.I..EQ....EDEIDHK........YK
Q0W3W9_UNCMA/337-424------------LKHSTDLII.TLFDESMRT.L...ETPKS.........GDI....QKIEKLESLSDYL........DE
A5VLT3_LACRD/120-205------------IEQMMMIVR.KMLEQILDA.Y...VYT.D.....EQVAYEV.A..NE....DLKVDLL........YV
Q2RHH2_MOOTA/339-427------------LLRMAGIIREEMFPRVMRP.L...AE.....REVDLL.EKL.R..RL....DGTLDYL........YK
Y2053_DEIRA/72-160------------FLRMLSIIL.ELLAAVREA.D...ERA.E.FG..GLT.ARA.R..VL....EAETNAL........ER
Q6MP49_BDEBA/19-107------------ILLMGGHVE.KSLAQVTAA.L...LSR.D..V..DMF.SGV.H..DI....EKLINED........HI
Q2FTF7_METHJ/119-204------------LIIVGRKVL.SMIEDAFDA.F...EDR.D..V..NRI.RNM.R..ER....DSEIDRL........YC
Q6MP49_BDEBA/123-208------------IQKMSEIAG.RMVKGSLDS.F...VRG.D..V..EQA.KKI.L..LM....DDEIDAL........KN
Q9YAE0_AERPE/200-281------------VARAKVLAR.AGFDASLYS.L...LAG.D.....AGLARTV......L.DMEEMLD..........ND
A6P1M5_9FIRM/363-450------------VVHMGTLAR.DNYRISVSL.L...SQY.D..A..KKV.ELL.R..EN....EDTLDKL........EG
A5INX6_STAA9/348-434------------LQNVGQIVL.SMFEDIREI.....TKDDK.........KLI....KKLEQKHQAVETI........ND
Q7A1Z9_STAAW/452-537------------MDKLFNHVA.ESFDKAIDM.L...DVY.D..K..TKK.DEI.V..ER....SRESFNI........EH
O28477_ARCFU/135-226------------IRRMGNTCV.GMVSDFCTA.L...RKY.D.....RYLCSSI.I..FR....EREVDRL........YF
A0LDJ6_MAGSM/24-112------------ILRMLAQVG.QQLDSVIEA.L...RGM.R..S..EFS.DGV.V..VE....DAKLTTM........LT
Q6AAV0_PROAC/147-230------------FVEMSKIAD.SMIGKAEKT.L...ADR.D..A..EAA.ESL.A..SE....DSKMDDL........RR
Q0TTG5_CLOP1/17-105------------TKEMMELCE.LAIEKSVDS.I...VNK.D..L..ELA.REV.I..KM....DDDIDNL........RN
A4FL22_SACEN/121-205------------VREMAGLDI.DMATRLAAL.V...SGE.G..A..EGGFDEL.R..HT....DDAVDAL........HA
A5V0U4_ROSS1/126-211------------LQELGALTE.HILTASIAA.F...LSE.D..A..TTA.RAI.A..TL....DDQVDAR........RR
Q5SM00_THET8/16-104------------SLRMLSLVR.EMTQEATEA.L...VQA.D..R..AKA.QGV.V..AK....DKEVDAL........EL
A6LEN2_PARD8/122-207------------VEEMLSELL.SMISLTKEA.F...EKE.S..S..EIA.SRI.F..LK....DNLIDEI........NH
A8MCD0_CALMQ/253-330------------ILALGDEVS.DLHKSAVSS.F...LSR.D..V..DKA.QAV.L..DM....RNNIAQR........RV
A2SSH8_METLZ/116-201------------LHREGEATV.SILNEVYTA.F...ESG.D..V..SRL.QGC.A..DI....EGEIDTL........YA
Q3ZA57_DEHE1/17-105------------MLLLGSMVG.KAVDRSMQS.M...KER.D..L..ELA.KQV.I..EE....DKLINQK........RF
A6FRR4_9RHOB/21-109------------IMKMGGLVE.QAILDAATS.L...ETR.D..E..ELA.EQV.R..QG....DRAIDAL........EE
A0RXC3_CENSY/117-197------------LYDISNKVK.GMIKDAILS.F...AQL.D..V..SKA.VSI.Q..ED....EAFIDRV........YR
O28916_ARCFU/230-309------------LSEMIETLE.NIFRRAMVC.F...FKN.D..R..KIA.EEV.L..EDVEDFTNRILKY........YE
A6CFS1_9PLAN/358-447------------VIKMGVLCN.EMAQILYRI.L...SQE.......KPDPDDV....EKLFQHEEELDRM........QD
Y1732_METTH/119-196------------IEFMSQTVQ.DMINDALGA.L...MNR.D..I..QLL.KRS.T..RN....YIQLQDL........YN
Q2Y4E8_9ARCH/231-312------------IFEMGGLVR.DVFKDAVKS.L...AEN.D..V..KHA.NRV.I..AN....AKKAADT........GA
Q0ASG2_MARMM/127-212------------VERLGAIVI.KQLREVLDA.L...SSA.D..V..EPA.VRV.W..HS....DDEVDER........YN
A2SSH8_METLZ/16-104------------VTWYGRFAL.TMLKNSLLA.Y...ESA.D..L..MIA.ADI.I..RQ....KEYVNNQ........YE
A3IMM3_9CHRO/129-213------------IAVMSNHAQ.MMLATSLVA.L...ADL.D..A..GAG.KRV.K..KL....DDTVDDA........YD
Q8F0J5_LEPIN/132-214------------LNRLLSRVI.TIVGMAVES.L...VEEKN.............RFYGSVHTVEEEINNL..........
Q30YR4_DESDG/121-206------------LTELAGVAG.NMFAHALAC.F...RDS.N..V..ETA.FEV.C..RM....DLKCNAL........EV
A2REA1_STRPG/17-105------------FYSMGTEVL.AQINKTVRA.F...VSH.D..R..ELA.KEV.I..EE....DDTINNF........ET
B2JUR6_BURP8/126-211------------LRSSGEMAA.SVLNRVLDA.F...ARM.D..A..VAA.AQI.V..RD....DKAIDEA........FR
Q1K267_DESAC/120-205------------FPLMAKRVL.AMLDKSLTS.L...VNL.D..A..ATA.QQV.I..AD....DDQIDEL........HR
A3ZZ51_9PLAN/120-205------------LQRSKEASV.EMLRQSLDA.L...LDR.D..A..SKA.RAI.I..AA....DDKVDEL........HR
Q8FMP1_COREF/123-206------------VRELGRLVT.NMSDKIREV.L...ITP.D..A..DIA.LAL.S..SD....DDAVDDL........HH
Q0W7U5_UNCMA/17-105------------FFQMGEDSL.RLMSRSLRS.L...VNK.D..L..ELA.KQV.M..EE....SDRMADR........EI
Q9UZU5_PYRAB/16-100------------LAEMGKEAL.IALDYAKES.L...TGK.E.....NNA.EEI..........SAKLKIL........RS
A6UUI6_META3/119-204------------LNVMVLYLK.DMLKDILKA.Y...QEK.N..E..ELA.REV.Y..KR....DKKIDKL........FE
Q2FTF7_METHJ/16-104------------ACDLGTYAI.TMLRDSIDA.F...ERG.D..T..QLA.QDV.C..NR....KIELKKR........FI
Q1NKG6_9DELT/478-564------------LQEMLSTVHESLVFMAQNL...............KDSTDKVDL..KKALELENGINNL........RD
A3DN11_STAMF/248-325------------IVELFSKTK.ELYINAIKG.L...KSLNK.....KYA.NNV.V..TL....FKELEKL........EE
A3CVF4_METMJ/140-231------------IKRMHLLAR.GMQQDAMAA.I...RGQ.D.....TALAGDV......V.VRDTEVDRL........HW
Q7A5Q4_STAAN/19-107------------LRRLGANVY.VSIENGIKS.L...SID.D..R..GFA.RQT.V..KN....DKHINQL........NY
Q18H40_HALWD/245-326------------LSSLGDATR.SIITDAADAVL...TDGDI.....TTANTAI....TKHEDLSTRLTDL........DR
Q1IMC8_KORVE/119-204------------IPRMAETVA.TMVQRALES.F...IDG.K..A..ELA.EAV.L..QM....DNIVDRI........KD
Q5HG35_STAAC/121-202------------LKTMGKLAM.LMLKDLDQA.F...KKK.D..T..VLI.REI.I..ER....DEDIDDL........YS
Q251M5_DESHY/359-447------------VMHMGKVAG.QAVDNAMNY.F...FKR.Q..S..ANR.QYV.I..QM....ESATDRL........EN
A3ER26_9BACT/16-104------------VTAMGHMVE.EQLDGAMKA.L...TDR.D..V..EKA.KGI.I..AR....DHQVNAM........EV
A4A3L4_9GAMM/129-214------------FRLISGHVG.NMLRQALDS.F...ARL.D..V..ARA.IEV.V..LD....ADAVNAE........HD
A3DLY8_STAMF/20-104------------LMEMNVYSR.LMLDLAYYSVV...VKD.T.....SIA.YEV.Q..RI....EDKLDAD........WS
B4SH22_PELPB/118-203------------LESVGAKVA.EMLQYAIDA.F...AAK.D..T..VKA.SRV.F..AI....EEEIDSM........HR
Q186T5_CLOD6/447-532------------IYEIYNKTI.TNFKDALIV.L...DVK.D..F..ELA.NKV.L..EV....ENEVNYL........EK
B1YLB2_EXIS2/122-207------------LKEAFETLL.DMTETAIVA.Y...RDG.D..I..EKA.KAL.S..DL....DNIIDDT........TY
A1RZ38_THEPD/253-333------------ISTLSDKVS.EFFTASVHV.F...LDR.D..K..TTA.NRL.L..DV...DAEKLKAL........ER
Q3IM38_NATPD/147-240------------VDQIRQIAL.SMHENAVSS.V...LSS.E..TDEEMT.AHI.I..SR....DDDVDRL........FA
O27757_METTH/89-175------------LRDMAQHVC.KQLNKSFRS.L...EEY.D..E..DLA.NEA.L..KM....DYITNTM........HE
Q53W26_THET8/300-379------------LARIGDAAR.HMLEGVLKA.L...VQETG..HEAELL.P.......L....EEKVDRL........SR
A3CVT1_METMJ/216-300------------IIEMKNLSE.LSVGLAYTSLL...FNN.M.....EVA.HEV.V..AL....DSTLDDM........RY
Q834B5_ENTFA/121-206------------ISDMSDYVK.KMVDNVLIA.Y...VKT.D..Q..KDA.RMI.A..QM....DDRTNEY........FD
A4IQY4_GEOTN/16-104------------LIEMGRLTE.VALQQAIES.F...QTQ.N..K..KLA.MAV.I..DG....DGSIDKL........EE
A0NJJ5_OENOE/131-216------------ISEMGLMAT.RTFDEILDAYV.............SDSIDDA....QKVADHSEEVSRL........SA
A3CRL4_METMJ/338-425------------LRHAHEVTL.DLFRAAMTY.L...ATSKE..ADYQMV.ERL.K..SL....NNYLDAR..........
Q9YA54_AERPE/253-331------------LSSLVMEAA.EGFSKSVEA.L...IKA.D..A..GLA.ASI.A..PV...LSEYRSRL........ES
Q0YRH7_9CHLB/17-105------------LIQLSDKVL.ENFFNALHA.V...KHQ.D..E..QSA.RQI.R..QI....DNEIDLA........EV
Q74KF7_LACJO/16-104------------FMGMGIDVS.EAIEEATQA.F...VEH.D..K..KLA.QSL.V..KD....DQKVSRA........AT
A8AA37_IGNH4/119-200------------FASLAPIVK.SMIEGSIDA.L...KNM.D..V..LKA.MKI.I..TK....DDEVDET........YH
Q6G4T5_BARHE/125-210------------FETITTLAL.NQLKEVLNA.Y...TSR.L..L..DHV.DAV.R..ER....DGKIDAL........YT
A9BHU2_PETMO/25-113------------VLRMGRIVQ.EMHYKFGDA.Y...LER.N..D..KLA.KEI.I..NQ....DDRLDFI........EA
Q2LUX4_SYNAS/355-442------------LEREAFLAN.RMMTESLAL.F...EHY.E..R..ARQ.ENI.L..YM....ELVVDHL........RR
Q4FLF7_PELUB/22-110------------LIKMGSLVE.AQLTDSMEA.I...IKV.D..K..EAA.ENI.I..KN....DEKINEL........RA
A0RXC3_CENSY/16-103------------LSEMGDMAV.QCVTLAIES.Y...LRG....V..NTS.PEV.H..SL....SDGIRRR........YY
A5ILH4_THEP1/119-204------------IPAMANQTS.EMLKFALRM.F...ADV.N..V..EKS.FEV.C..RM....DSKVDDL........YE
A6LP09_THEM4/121-202------------IKEMFGVSL.KMLHDTFIA.F...SKK.D..L..KLL.KKI.W..DD....DKKLDDI........EI
Q2S080_SALRD/18-106------------IADMANRVD.EQFANAMNA.L...LQGDV.....DLAEEVV....AG....DDAVDAL........EL
A9BNX0_DELAS/469-555------------IRELLHHLL.DNLRLAMSV.F...LNG.N..V..REA.QKL.L..EE....KARFRDL........EL
Q9YAE0_AERPE/15-99------------LSEARRLTS.IMIDLSIYS.....VAFGD.....RLAALET......L.MLEDDVDEI.......IRE
Q5WET9_BACSK/17-105------------IQVLGTAVL.KQLDAAIDG.L...STK.N..R..AAV.QQI.I..DN....DADINKS........EL
A5ZNC6_9FIRM/16-102------------IITMGSLCE.KAISLSNRA.I.....R.G..D..KCI.QEI.F..DT....DKEIDTK........ER
A0LAE5_MAGSM/412-500------------IRGLGMRCG.LILNDALPIVL.............HGNAEAL....AAYKNRDEEIDSL........YE
A6CFS1_9PLAN/465-550------------LLDLLTMVE.KQLNHVTTA.Y...QQS.H..T..DVV.SAT.I..RS....GTEIKHK........VK
A6DAS5_9PROT/94-175------------IDALYQNAL.SAITTLKLA.....TKSDN..L..EDAYSTI.I..SY....EKIADEI........YK
B8G180_DESHD/18-106------------VFELGKKVN.SRVDAAIKS.L...AKQ.D..L..ELA.DNV.I..TG....DLEINEL........QA
A4IQY4_GEOTN/119-204------------FVLMHRLAT.DMVSTVIAA.Y...DQE.D..V..SLA.AQI.A..DM....DHQVDEQ........YG
Q8TX17_METKA/93-179------------FKRMTDLTL.EQIETALIA.V.............EENPEQA....PKVIEMDEEVNRL........DE
Q2NHW3_METST/123-208------------MDQMAQEVE.NMLNRSIRS.Y...LTK.N..P..EEA.AEL.E..ED....DDIVDDL........FD
A5G3F8_GEOUR/471-558------------IKAFAAQVA.EMVTLAVNS.L...CEESTTTADSASAKEKM...........NAINLA........HE
A4FX70_METM5/17-105------------IYEMSEMCA.IALENSITA.F...INN.D..I..ELA.KVI.K..AG....DDAIDLK........EM
PHOU_METTH/21-109------------MEEVSQKTL.KTHKLAVDL.L...MEY.D....EEKK.EKV.I..KN....SRAIDDM........VF
Q662X1_BORGA/126-211------------LREMADTAK.EMLSDIFDAYF.............DGDFTKI....LKIVKYDNIIDKL........FS
A1VDV5_DESVV/122-207------------FTPFAESVL.AQVRFACAA.V...RDM.D..P..DAA.QRL.R..DM....DEEVDFG........LY
Q0PIQ4_DESVU/19-107------------LLIMLDGAE.KAVSNCVWA.Y...LRR.DER....LA.WDV.A..AH....DFAINDL..........
Q8PZB8_METMA/122-207------------TKKMADITA.YMLENSIKA.F...KNH.D..P..RLA.RET.A..AR....DDEVDKL........FY
Q9CEW9_LACLA/121-206------------ISLLGEKVK.SIVDASLNA.Y...IQG.N..D..KRA.HEI.A..EQ....QYVIKSM........SH
B9LHB3_CHLSY/122-207------------IHEMAQLAL.QMLNTSLEA.F...LRQ.D..A..DLA.RSL.T..AH....DERVDEL........ED
A5D1M0_PELTS/120-205------------LSQMTEKVR.EMVASVINA.Y...TTA.D..I..ETA.RVI.V..KM....EDEIDGL........YR
Q2RHH2_MOOTA/445-531------------LQEMFTRVK.ENFTSAIQA.F...ASD.D..Q..ALA.ARV.I..RG....HPEILRL........EK
Q9YG50_AERPE/17-103------------LDRMYNIVV.KIVADTLRS.L.....E.E.....WSI.NEA.L..EDHLYLAENLSAV........VE
A9B5P2_HERA2/131-216------------ISELGQRTS.EILHAGLEA.L...RQN.D..R..SFA.DRV.T..EL....DDVIDHL........YR
A4YI56_METS5/245-324------------ILEFGNKVL.EVYKESTRA.F...LNGKR.....EIA.NKI.I..DQ....DYELAIE........HK
Q47KT1_THEFY/132-215------------VLEMGHQAE.MLVIKAGEV.V...ANR.D..V..ETA.REL.D..KD....DDRMDRL........RR
E0THQ4_PARBH/20-108------------LATMGGAVE.EQVAQSIIA.F...ERR.D..L..LLA.EEI.R..HR....DVEIDDY........EQ
Q6D018_ERWCT/339-425------------TLRIGDVLE.QML.RLYRE.V...LQG.D..H..MQR.REI.R..RL....DDDVDIL........YT
Q5Z0T5_NOCFA/22-110------------LTLMCRLAH.DSLERVVDA.L...AGA.D..L..TAA.YEV.F..AL....EEQLHKM........HG
A4E7E4_9ACTN/16-104------------MLSIYEAVD.LALHDAVKA.Y...VTDDR.....KLATKTK....KRTLSIDARCANL........EA
PHOU1_THEMA/18-106------------VSKMLFLVS.ESLNDAIES.L...ETM.N..E..TLA.RKV.L..ES....DDMIDEL........NR
PHOU_AQUAE/117-202------------INFMSEIVK.EMVNDSVIS.F...IQQ.D..T..LLA.KKV.I..EK....DDTVDEL........YH
A6UVP6_META3/82-166------------YGKMANNVL.YNLNKTYKS.L...KIN.D..I..ETA.KGV.I..AQ....DYRLNRM........EE
A5Z3H1_9FIRM/450-535------------LIKMYNKVI.KIFDESVKT.F...VNN.D..K..SNM.DKI.N..EL....EDIIDQM........QI
A7H7E1_ANADF/124-209------------LSRLAEMSE.TQLKHALDA.F...VTG.D..V..AKA.EDV.M..RS....DEHLDAL........YL
A5Z3H1_9FIRM/345-432------------IERMALMVR.ENLEFSTRA.L...IEN.D..R..SAS.DDV.Y..KR....EKYIDFL........SH
A3CXV2_METMJ/119-204------------IPHMGEVVG.GMITDTLVA.F...ERE.D..L..TAI.DDI.V..ER....EVAVDAL........RY
Q1K0S3_DESAC/473-558------------FDDLAGHTR.EFLAFVKAA.M...ERK.D..V..TIG.EKA.Q..FM....ENRIDDL........EE
B4S7F4_PROA2/163-246------------LKPMGDITA.EMIKKVVEA.F...VSG.N..T..KHA.QET.L..DM....MTEIDGI........YQ
A9B5P2_HERA2/20-108------------VFRVGTMVE.AALSEALQS.I...KLY.D..Q..AAV.RKV.V..QN....DQTINHE........VQ
Q5V0G4_HALMA/118-213------------VDTIGREAT.EMVERSIDA.Y...RRE.D..V..EEC.RAI.A..AD....DDALDAL........CQ
A7I9M4_METB6/16-104------------VSGMARYAF.SMLQDSQEA.F...INQ.D..A..ALA.ATV.L..DR....KDALREK........TV
A8MCD0_CALMQ/144-239------------IARMSNVVS.GMFKDALSL.....IKI.DPEERLSMA.RDI.M..DR....DYDVDRN........YM
Q8TX17_METKA/194-284------------VREAALEAR.SMVKTAYSI.F...LGR.V..KEEDLR.HEA.E..KV....YCAEDRV........HK
B8CZG2_HALOH/119-206------------IPELANTVS.DMLDTVLEA.F...VTR.N..A..DLA.EAV.C..RK....DEVADNI........YD
A8MBU9_CALMQ/146-238------------VLKIIRVIE.SMLDDIKVA.L...NTV.D..K..NIL.VDI.V..ER....DNEVDRF........YW
A7VHC0_9CLOT/360-447------------MNQMAGYSA.EALYDSLEL.M...KDY.S..D..EKW.QRV.E..AL....EDIVDKY........ED
Q0RZA9_RHOSR/121-204------------LGRMGRLAG.ALAGLAEQV.L...RTR.D..P..ELA.AEL.D..RR....DDELDSP........HR
Q3A1F9_PELCD/468-553------------LEEMSKRVL.AFLDLIIEQ.L...QAP.D.....DTFMQTASR..HETGINLQFNKMR........ME
A3ZZ51_9PLAN/16-104------------LLTLGSMVE.DHVMLAIRA.A...EEQ.N..R..DLA.QEA.V..DR....DDDVDAM........QM
A4J4V6_DESRM/467-552------------VRTMAELTE.ETLNLALKS.F...ENN.D..R..SLA.RLV.I..KN....EVIIDNL........EK
Q4KBC7_PSEF5/340-427------------ALRMADMLS.GMLDRVLQL.F...RTA.N..Q..ANA.DQV.R..HI....DQSLDLL........SA
Q6ADH5_LEIXX/144-227------------FAEMGRLDV.AIAEKLAEL.L...RTQ.D..I..RLA.DEI.R..ND....DDDIDEL........HA
Q1WUX0_LACS1/120-205------------IREVSEQTQ.ENLVKIVSM.F...AKF.D..E..KGA.VEI.A..KK....NQEKREK........IN
Q0F0C9_9PROT/122-207------------LHNLADKAI.LQLQQALDC.F...AHG.D..A..DLA.MAI.I..ES....DKKVNTL........FK
Q2YM24_BRUA2/348-436------------VVGVCDTIE.VMLRRIIEL.....YEKPD.....QARINEL......E.ALDDRVDKK........HV
Q6XYS9_SPIKU/16-104------------IIDMIAMTK.NQYDDMVKC.L...ETN.D..V..ELA.QSV.I..SA....DETINKM........QE
A5KMQ5_9FIRM/453-538------------LNEMKAQCI.AALDNLKEV.T...SEN.V..E..RIL.SQA.V..II....EQKTDDM........RD
B8CZG2_HALOH/16-104------------LSNMSEIAE.EMLQNAIKA.L...DEK.D..V..SLA.KDV.I..NR....DDVLDNY........QV
A6GE05_9DELT/129-214------------IERMAETVR.SMIADALDA.F...VEG.D..T..ELA.RKV.I..AR....DDEVDEL........HD
A8MGX2_ALKOO/16-104------------FIEMGKQSQ.QVIKLSVES.L...KEQ.N..I..EKA.NLA.I..KL....DDKVDEL........DF
A5UQ39_ROSS1/16-104------------LLRMGSRVE.HQLADAIKA.L...DRL.D..I..ELA.REI.V..AR....DREIDAA........RN
A4YI56_METS5/143-234------------INRAAVITQ.NMLKDTLDA.L...RNN.D..A..EMA.KEV.Q..ER....DDEVDRF........YF
Q05HF3_UNCMA/14-101------------TLKIAGLVG.QSIEDSVRS.L...ADR.D..I..DLA.GKV.I..DR....DAEIDRL........KL
A7HJE0_FERNB/16-104------------LTKEAWYVE.DLLRLTMEA.F...KER.N....LELA.KKV.K..NQ....YWDIYEE........YL
Q3IX36_RHOS4/343-430------------TLRVGDLVG.EMLERSRQA.L...LAN.D..E..FAA.QEV.S..RL....EPDIDRL........TE
O28086_ARCFU/211-297------------LIEVKNLSE.LSVDLAYSSLI...YGN.D.....EIA.LEV.V..YL....EEVIDNT........KF
A0B6T7_METTP/241-325------------LTRISSIIC.GLIDEAISA.L...LHR.N..T..EIA.NSI.I..EQ....TKEIRRE........AM
A3ZXF3_9PLAN/119-204------------MERMVNITR.QMVAGALDA.F...VGL.D..S..QAA.MNV.R..LL....DDDVDLL........NR
A5G3F8_GEOUR/366-453------------IKRMATVTG.SMYHEMVEQ.F...HSF.N..A..RSA.NRI.K..QR....EELLDVL........QR
A7LS25_BACOV/16-104------------IDEMWTLVY.NQLDRAGEA.V...LTL.D..K..ELA.QQV.M..VR....ERRVNAF........EL
Q8U240_PYRFU/93-170------------LKEGFELTI.EAVKTAIKA.F...ENL.D..E..VLA.GKL.L..EI....DNRVDEL........YI
A1UU23_BARBK/21-109------------IVEMGDYAE.RMIECSLAS.I...VSD.D..L..HLA.AKV.I..SD....DLFLDEA........ER
Q2SS07_MYCCT/120-207------------ISELYQLVV.EMLDIFSDV.F...GNL.E..I..DKE.QQV.L..SL....EEKINEK........FR
A0RA51_BACAH/351-438------------IIRMAEFSL.HGLKEANQF.L...NTQ.D..K..KHA.DMA.T..QL....EGAINNL........DK
A8ZSJ6_DESOH/119-205------------YAPMGKKVK.SMVQKSLNA.F...VQK.D..A..EAA.KAV.L..FA....DDEIDML........RG
Q6F1N0_MESFL/119-206------------IVNLFQLVI.DMLDSFSEL.F...SNF.D..N..NLV.VKV.M..EL....EAQINKE........FE
Q2LUX4_SYNAS/460-545------------FDHIRQLVA.ANVDDALAL.I...SQW.DEE....RI.RNI.T..CR....EAQI.............
A5URZ8_ROSS1/121-206------------MERMARMAM.AMLQKALDA.F...AAR.D..S..ATA.EML.A..AD....DDEVDRL........YE
Q2Y4E6_9ARCH/245-318------------VMGLGKVSQ.GLVSHSVES.L...RHS.D..T..DLA.NKV.L..KE....KKDLGRK........VS
Y409_MYCGE/126-215------------LVTLHQSAL.NNLKKTFES.LQDKEKP.L..T..LQF.ENA.T..KT....IIEFEHQ........YR
A0RXQ8_CENSY/138-229------------LRRMSSMVL.GMYNDTISG.L...AGGDR.........SDL....GAMPSRDDEVDRQ........YF
Q3A1F9_PELCD/363-450------------ILKMAKKAR.QTLNNVIPAIK...HRDPDMMTGWKAQ..............EKWLDQA........RK
A5EXS4_DICNV/20-109------------VVDMANLCE.KQLH.AISA.F...LRQ.DPIS..ESL.RDI.V..NV....DALTNQY........HI
B2JUR6_BURP8/21-109------------LLAMGGMVE.RQITRCLTL.L...DDY.D..P..ALV.QEI.R..DS....ERELNAL........EI
Q31I87_THICR/133-218------------LVDISNRSS.VMLKMTLDS.F...ARV.S..T..DGV.GKV.I..RE....EEVIDDI........FK
A6GWK5_FLAPJ/140-225------------IASITKNIE.LITKKTNEC.F...DKQ.Q..E..KTI.GEI.F..LL....NKNIRVE........TQ
B8G180_DESHD/121-206------------LPRMADLVQ.QMVIKGIEA.Y...KTE.D..G..SAA.KAM.A..LM....DDEVDHL........YA
Y409_MYCGE/20-112------------FFEYFKHVI.NAHETLNQL.L...CEDNL.....EKRKELI....KTIYEMEDQSNRS........EF
A6Q2I6_NITSB/121-210------------IIQLHETAI.EALEYSLRI.L...RIE.NLDDVEELY.RKT.L..VE....ESKTDEI........FT
Q3IUH9_NATPD/24-108------------LVEMKDTSE.LLIDLAYSAVL...HQN.D.....ELA.SEV.L..AL....EEKMDVL........QM
Q8PZB9_METMA/245-322------------IFKMAELSR.KVFERSIHS.M...QEE.D..L..RAI.NKI.V..MD....AKNISQL........GI
A9KP15_CLOPH/357-444------------TKQMAELAK.DTILSSIHL.L...TKY.D..D..KIS.ASI.M..DN....ENRVDKY........ED
Q1IMC3_KORVE/122-205------------LTLMASRLE.KMLSEVREA.F...EMR.N..L..DKA.LAV.L..RS....DAEIDRL.........R
B2JC47_BURP8/341-428------------VLRIGDIVR.TMLDNLSHL.I...HHN.D..P..EKA.RDT.I..RM....DDDVDHL........YA
Q03GY8_PEDPA/120-205------------IAEMTNVVR.TMLDVTMDA.Y...VKR.D..S..KLA.DEV.I..KA....NEQIDNS........YK
A6VG44_METM7/121-206------------LTIMGEILE.KMLKNSILS.F...RNR.D..L..SLA.KET.Y..LE....DNKIDEL........YK
A4G2G4_HERAR/21-109------------VGAMGDFAG.VQFADAIQA.L...LAH.D..V..SLA.QRV.I..DQ....DRQVDAL........RR
A6LN86_THEM4/16-104------------VLKEGWLIE.SLLNQVLNA.L...KER.D....KEAV.LNA.L..KN....ENEINVM........DM
A5ZVN9_9FIRM/463-548------------LNIVMEAVR.EEINVTCNA.F...MKD.D..K..EAA.QRV.A..PLGAVITNLCDEL........KM
Q879I2_STRPQ/323-410------------LVHLASYAI.QAFEASYSY.I...MTA.D..G..KFG.EKV.K..RY....ERAVDTI........DE
Q4FLF7_PELUB/125-210------------LKRLGELVQ.RQLKDVLDA.Y...LNQ.S..K..EAA.VKI.W..KS....DERVDDL........TH
A5KLQ2_9FIRM/351-438------------VCRMGYIVK.GTMDKTRRV.L...FTQ.D..E..ETM.NEI.R..EE....ESIADRL........CK
Y1641_METJA/186-266------------VNMIFTLLK.EMLTEAIDV.V...KSKKK.....ETKIHEL..........EEKLHKN........LE
A6BD84_9FIRM/463-548------------LQKSLKTLE.KMFTDSIKA.L...QGD.K.....SVQTEKLIKRKDKIMDLDLKMRKA..........
A5ILH4_THEP1/16-104------------VLKAGWFIE.KMFRNSISS.L...VER.N..E..SLA.REV.I..AD....EEVVDQM........EV
A9A622_NITMS/148-240------------FKRMIHLAK.SMSSDALLA.V...KENNE.....DLA.QEV.I..NT....DDEVDRF........GF
PHOU_DEIRA/16-104------------ALNMLGTVE.RMLPVAAEV.L...LHE.R..A..DLL.GEV.R..SL....DREVDAQ........EA
O29778_ARCFU/134-226------------LKRMLQILS.GLMGEMERS.LPLESPN.V..K..EIL.ERI.Q..RY....EEDFDRL........YL
C0A5V8_9BACT/119-205------------IPRMAALAT.TMLRDSLDC.F...LNTGD..P..ERP.IEI.I..KR....DEEVDRL........NK
A8F5R4_THELT/118-203------------ILKLGKLTS.NMLKESIRL.L...ADL.Q..P..EGA.FVI.C..SK....DAEVDEL........YQ
Q11NF9_CYTH3/120-207------------FKEMTSIVL.EMLNTLCES.F...ETD.N..T..KLA.RTV.F..SK....DEILDEI........NS
Q5V3U8_HALMA/140-232------------LERLESTGS.TMRNEAVKS.L...AHG.N..P..DLA.QRA.L..NR....ERQANKI........FV
O28916_ARCFU/135-220------------LEKLFNITL.SMLKDLKDV.V.....A.N..LDRAVC.STI.L..TR....ENEVDKL........HF
A4WI32_PYRAR/111-191------------VAEVGEVVK.QMVARAVDM.F...LRR.D.....ASGIREV..........EKMDDEI..........
A4J4A5_DESRM/448-534------------IQSLSERVV.HLLQLVNTA.F...ATN.N..D..GLA.EQA.K..LF....YEEIVDL........QF
A5UMQ1_METS3/7-91------------LIEMKNMSE.LMVDLAYSAVL...FNS.K.....DAA.EEV.L..KL....ENKVNSM........NY
A5WHR5_PSYWF/22-110------------FLKMGRMAA.EQVTLATHA.L...VDS.N..E..EMA.STV.I..EA....DHQINQM........EI
Y2861_DEIRA/125-208------------FAQALALLL.QMATTLRAA.S...SPM.N..A..ALA.HEV.R..AL....DDQVDAL........YD
A8AA77_IGNH4/213-294------------IALLKNMTE.IAFDLAVYSML...YQD.......PRAAEEV......L.EIESFMDEE........SA
A3DLZ0_STAMF/247-329------------TYDIGLRIN.SLFNKAMDG.LYRLSRQQS.........EEVIF..EA....QEIIKTI........DN
A1S0L5_THEPD/137-223------------IYRMDSTTR.EMLLKATDL.L...LGGGD.....ASAVSAL..........DDRVDRL........YF
A4J4V6_DESRM/359-449------------LSRMGRYSS.EFFSESVRF.F...FNP.K..D..KEV.NPM.YLEQK....EELINRL........DA
A0B6T8_METTP/129-214------------LSKMAGIAV.EMLSGAMEA.L...EKG.D..P..DMA.RNV.T..RH....DYVIDSL........YV
Q0BUY2_GRABC/490-575------------IQTLIERCT.SNLRNAAAL.F...MTE.D.....VRLARRLAAEKEVFRDAENSATEQ........YF
A4X1M0_SALTO/17-105------------LAVMSREAA.AAIRGAGTA.L...LDV.N..R..EAA.EQV.V..RN....DAVLDQL........RW
Q8F0J5_LEPIN/12-116------------LYSMAELCL.EQVLLLDDA.L...EKD.D..G..ELA.RKL.I..DR....DDLIDNL........EK
Q2S5E3_SALRD/191-276------------IREMSQAAR.RMLDEAKQA.F...LDQ.D..A..ELA.RSI.P..DL....DDEVDRL........HH
A5UKP1_METS3/22-110------------LRNYCNDTL.DLHRKSTSL.L...FNF.D..E..EIA.AGV.V..EK....AKELDVC........GY
Q971H7_SULTO/145-236------------LNRLINNLK.QMLHYLSLG.I...KEG.S..R..TFL.QET.I..EL....EREIDRL........YY
Q8FZK0_BRUSU/454-540------------LSHFHAMVL.ANAHMAFNV.I...VSR.D..G..RTA.RQL.V..QE....KDRLREM........EK
A6GWK5_FLAPJ/37-125------------IVKIGVLSE.NQIVEAMKS.L...LSD.P..N..ATT.KKL.K..KT....ENKIDKL........DV
Q30PB9_SULDN/121-210------------ILLLHKSSI.NALKYILEC.F...TNIQE..CNYEDNYRKV.L..VE....ESMNDDL........FS
Q8TWZ7_METKA/17-101------------LTEMKNLAQ.LSVDLAYSVLL...FGS.P.....ELA.EEV.R..RI....ERRVDEL........SM
Q9YA54_AERPE/147-239------------LSRMARIAA.EMIRDVARG.L...ENG.D..R..GLL.DLV.A..ER....DQLVDKL........YL
Q6WB50_ALCFA/125-210------------LATLFRLVR.GFFSDAMSG.Y...RSA.D..S..QRLLAMV....DA....DNAVDEA........YH
A4ANM1_MARSH/120-205------------FDKMMETIK.LMLNHITIA.F...EDK.D.....VKIARKV.F..KK....DKVLDKINIKSFQILEM
Q896W9_CLOTE/342-429------------IVRMAEKSK.EILEQAVES.L...HTG.D..E..ELI.KKA.M..EG....EDFVDLL........EE
Q1J0M9_DEIGD/118-204------------VLPLVDLLM.GMLERLAYA.F...AER.D..V..QAA.REVMR..RD....EEEVDAL........YE
A5LNQ6_STRPN/118-204------------IKILHEVIG.LHMNRAISC.....YREEQ.....SGCLDMVVI..QK....QNEIEEL........SI
A3CVF4_METMJ/247-326------------MDESSALAL.QIFSWSMEA.F...HTG.D..V..EKA.NTT.L..QR....VRDLEEM........AR
A7IB03_METB6/247-326------------LKKASILSM.QIFDKSIIS.F...FNA.D..I..REA.HKT.I..ES....VSALEHV........CG
A8DJW4_9BACT/17-106------------VLLLGGQSE.DSLSRALGA.L...IRR.S..S..TLA.EQV.I..QG....DDAIDSV........ES
A6UVP6_META3/180-262------------VELLFNIIT.EMFELAMDR.V...RNNTS.....NYKIYEL..........EGELHKT..........
A3JY90_9RHOB/333-420------------VLAVGDVIE.RMLLQILAS.F...RTM.D..A..APL.ETV.P..EL....EDRIDRT........QQ
Q186T5_CLOD6/342-429------------VVRMGHKAT.NSLEHSIAG.F...LNK.S..N..EDI.NKA.F..ES....EKVVNKL........QK
A3WCP8_9SPHN/123-208------------LPAMGELAG.EMVHDVLTA.Y...AAR.D..P..GLA.REV.I..ST....DAKVDAF........YN
A0JSV0_ARTS2/16-104------------LVEISKLVS.EAIAKATTA.F...EGA.D..V..DLA.QDV.I..AA....DARIDFL........QN
Y1732_METTH/20-108------------TVRYGNETS.ERVGRTVSS.Y...IKG.D..E..ETA.REL.I..ET....TAAVNEK........SY
A6TML5_ALKMQ/448-533------------LKNMSDIVV.KAYEDSLTS.M...KEL.N..G..SLA.MKV.I..EA....EGQIDHL........EK
A9A9E5_METM6/23-112------------IVGIGEITA.NGINNAIYA.H...VTS.D..K..EKA.KTV.I..ES....LLSAEDV........SD
Q0SPC2_BORAP/17-106------------LWDMKECVL.KIIDDSLIA.L...ESK.D.....KSLAKKI......INEDEKIIDDY........QY
A6NWS5_9FIRM/352-439------------LQRMLGKAR.SNIDLAFQA.V...LEV.K..P..ELL.DKA.E..EA....ETYIDYL........NK
Q180A4_CLOD6/120-205------------IPKMAKECK.SMMSQTREA.L...ILF.D..A..SIA.YDV.G..TK....DDIVDGL........YE
A4G2G4_HERAR/125-210------------IRRLADLTS.AQLRHALAA.Y...ATR.D..G..ARA.QTL.E..RD....DDQIDAL........HV
Q05HF3_UNCMA/116-201------------IMKMAEIAG.RMLKKCIDL.Y...SGK.T..S..GNL.RTV.Y..EN....DLGIDRL........YG
A3DLZ0_STAMF/142-234------------TRRLHLIVN.NMLLDALKA.F...YTK.D..T..GLA.EAV.L..QR....DDEADRF........HF
A9AVN3_HERA2/16-104------------IRDMGNRVS.LAVRDALWS.L...ERN.E..P..IFA.RQI.I..AN....DNVIDEL........RY
Q5V0G5_HALMA/139-228------------VRQLQFVAL.SMHRDAMAA.L...TTG.......TTS.DRW.G..DR....DEQADRL........HA
A6LGP6_PARD8/360-451------------ISLFAERTA.RMFNMVKEL.F...YEKNE.....ETFLKTY....SRIEKYENISDRM........EI
Q30PB9_SULDN/16-104------------LSLLLKDII.AADELSLEA.F...KSD.D..A..NKF.KEV.E..TL....LAKIGLI........GD
A1APX2_PELPD/349-436------------IGRMVAVTS.FMFADTREL.L...FDY.D..A..RRA.ETI.R..NH....EQVLDSL........NH
O57974_PYRHO/11-95------------LIEMRNLSS.LMIDLALSSVM...YNS.E.....EIA.EEV.Y..LL....EEKMDEL........TL
A0PXY5_CLONN/341-428------------ISRMGKIAE.NNLADSMAC.F...INN.D..E..NLI.PSV.V..EH....ENLINFL........HR
Q31I87_THICR/25-113------------ILEMGGMVE.RQLENALQS.L...GSS.D..I..DKA.QEV.I..SF....DKAINHA........EM
A3DN16_STAMF/122-203------------LREGFAWAT.EMVKLAIQS.F...IEN.N..T..DMA.RKV.L..DM....DNKLDNL........YI
Q73LA1_TREDE/351-442------------ILKMSNIVR.EMFSLLRSL.L...SKEEN..VSREFVIRQL.T..EK....EDYTDQM........QE
A3ER26_9BACT/119-204------------IYSMAEIGR.DMLRKALDA.F...VMK.N..T..SEA.LAV.C..QE....DERVNVI........YR
A1RUP2_PYRIL/16-99------------LREGAKLAV.EALSTALSG.G...VSA.E......KI.REV.A..SR....LHNIHDE........VS
Q5UZI8_HALMA/218-302------------IVLMKDMGE.LAVDLAYGAVL...FDS.T.....EVA.EEV.V..EL....EAEVDAL........QS
A9BNX0_DELAS/363-450------------ALHQADMVE.SMLIGMQRV.L...ETD.D..L..KLS.QEL.R..EL....EGTVDDL........YS
A9KRG9_CLOPH/120-205------------IIRMADISQ.EMIKMSLDA.F...VNE.D..I..ALA.EKA.A..KR....DEEVDSL........YE
Q4J8G9_SULAC/246-327------------VYNHGMSVI.ELYKTSFSA.F...SNRDR.....KRA.HDV.I..NK....GFETLDT........NS
Q9YG50_AERPE/119-200------------VRKAAEIVA.SMVGDAYKA.Y...RSR.D..N..ELR.RKV.E..ET....DNMIDKI........YD
Q12XW7_METBU/17-105------------IQEMGDISQ.KMLVNSIQA.L...EYL.D..L..ELA.KNV.I..EM....DSIVDDL........EY
A6GE05_9DELT/24-112------------LLAMGGRVE.QMIGQGTRA.L...LHR.D..A..VGG.AEV.R..KA....DKAVNDA........EK
B8I417_CLOCE/120-205------------IPHMADMAK.KMVTKSIDS.Y...VKQ.D..I..NLA.KEV.C..DS....DDAIDNL........FS
A7VDA3_9CLOT/469-554------------INTLLQATA.NIIDTTFTA.F...KND.D.....LTAVSRIEPLAQSITEVKEIIKDH..........
A6DFF6_9BACT/16-104------------LLELGGDVN.SSLNMTYKA.L...LDM.D..K..ALA.NKV.I..KA....DQKINDA........EI
A5ZXG9_9FIRM/464-549------------LQVLIAAVS.RIVDTAYQI.F...DKQ.D..L..NLT.EDV.E..PL....EEIVDEL........SK
Y2861_DEIRA/23-111------------FLSMQDTLA.GQLRALQAA.F...AQG.D..T..SVR.EEV.E..RL....DRDIDAA........NA
A7VSN0_9CLOT/344-431------------VDRMGQLAK.ETLGMAMDA.L...ITQ.D..N..TKV.DQI.Y..EN....ENTINFL........NR
A7VSN0_9CLOT/449-536------------ATEMRNRVE.AMLEEALQM.F...ASR.E..TQPQMA.ADI.N..RR....EEIIDDA........TQ
A9KNL1_CLOPH/461-546------------INKMATAVQ.KLLSYSIEM.F...ENK.N..R..EYL.EEI.L..KF....ENSIDDM........ER
A3KAI2_9RHOB/452-538------------LEKLHDVVC.SNAQLAMGV.L...TTGNP.....DDARQLVAQ........KDEMRGL........EQ
A3DLY8_STAMF/215-297------------IAYMKNITD.VMIDLAFHA.I...VNN.D.....KLAAIEV.L..NL....EEIVDDT........IH
Q8PZB9_METMA/140-232------------IKNMYGLVI.SMLVDSMAA.L...RDH.N..V..EIA.KDV.I..QR....DDGVDRF........YL
Q1NQ35_9DELT/126-211------------FQAMFEKTL.GMLRMTIEA.F...HNE.D..T..DLA.HKV.C..LI....DDEVDGD........KR
A7AA41_9PORP/470-557------------VDQMLALTE.KALHRMIEI.L...KKS.......ELVRDDV....NPSYNIENEINNY........RN
Q8PUH1_METMA/112-203------------IHRMFLITG.SMQKDAIRA.L...KTG.D..H..DLA.LDV.S..QR....DDEVDRL........CL
O29464_ARCFU/138-228------------VRRMSQIIQ.SMIATIMEG.I...EKG.D..R..EAL.KDI.E..NL....EKDSDRL........YL
Q03YL4_LEUMM/120-205------------LGEMGEMVA.TMVSEVMDY.Y...VKN.D..A..LGA.EAI.A..DK....NSVLTQS........AA
A0L7V8_MAGSM/21-109------------VLQMAENVL.SQLSLAIES.V...ASL.D..A..EDA.LKV.I..EQ....DQQIDQL........EW
Q97CB8_THEVO/140-221------------IRRMSLNVG.TMIEDTIKA.I...EDY.D..E..ELF.QNV.I..ER....DDEVDRY........QW
A5ZVN9_9FIRM/358-445------------MNGMSKKLR.KNVNRAMNL.L...NDY.Q..Q..DKY.DKV.Q..RK....EDLIDKY........ES
Q6F1N0_MESFL/18-106------------LEDMIKETK.IQFAETFEV.I...TKN.N..V..EGA.ALI.V..EH....DKIINDK........LN
A4FWX8_METM5/180-263------------VFEIQDIIS.KMFNHAMNM.V...KHKTN.....DTEIYEL..........EGNLHKK..........
A8AA77_IGNH4/19-103------------LRKMKDEVS.IALDMAFYSLV...YED.K.....DVA.QEV.E..KI....DVDVDND........FN
A3KAI2_9RHOB/346-434------------LMRMGETVQ.AMLVQVKPL.....YRAWD.....AEAEARI......L.RLEEAVDRM........HF
A3DN11_STAMF/143-235------------LEKMANTTR.SMLEDVERI.L...TRY.D..E..KIL.ISI.V..ER....DEVVDKL........FL
Q0BUY2_GRABC/384-472------------ALRLVDVLE.TMLHGLKEA.F...ARGGR.........KGI....ADTRRLDSVLDRL........NA
A7VZ22_9CLOT/17-105------------MKEMGAVVD.RRIGETMEA.L...KNL.D..K..DLA.AEV.V..GG....DREINQV........EH
Q8YNR1_NOSS1/26-114------------VLRMGALVE.QSFRLSHQA.L...FSR.D..L..KAA.EEL.P..RL....DKKIDRF........YR
A5GUB9_SYNR3/26-114------------LLRLGSMVE.ESAVLARAV.....LSGPD.....MEAAPQI......R.RGDDRIDKL........YR
A3IBD5_9BACI/18-106------------FMALANSSI.FALKTSFEA.L...VEQ.N..L..EKA.LKI.L..ED....DLIINRL........EE
Q31LX7_SYNE7/130-214------------VGLMLERSR.SMLAMSLAA.I...ANI.D..A..ELG.RAI.K..DK....DDAVDAD........FD
Y1641_METJA/88-172------------LEKMEKTLL.NNLDLVYTA.L...KNS.D..K..KLA.EDI.I..IK....DYALNKM........EE
Q8TR05_METAC/238-318------------IENLSNTYM.ELVQQAVDA.L...YNA.D..T..SLA.NQA.I..DS....IDGMRLR........VK
A1WT64_HALHL/126-210------------LEEIEGELG.GIFRTLAFA.....CRDPD.....QQEAARARR..DQAREIQRRCDQL........IE
Q975R4_SULTO/114-201------------LISMIEKLI.AATSNALES.FRLLSLNTK..KSAEKA.RNI.I..KI....EEEVDDL........YR
A2BIZ3_HYPBU/172-264------------VRRLMRTVE.LMLDDLITA.L...REL.N.....EATLLEI.D..ER....DDVVDKF........YM
PHOU_STRR6/119-204------------LHQMGKLSL.SMLADLLVA.FPLHQAS...........KAI.SIAQK....DEQIDQY........YY
A4X1M0_SALTO/122-204------------VTEMAEAAA.RIAEKASTV.L...TTR.D..P..LTA.MQI.G..LD....DDEVDTA........QS
A0P428_9RHOB/114-199------------YPAMVSRVR.EGVARIEDA.F...LSR.D..S..EKA.IEI.G..QL....QNRIEAD........YR
A5KMQ5_9FIRM/348-435------------VNRMRDMVA.KNISDSFDS.L...VQY.D..E..KLR.KKV.S..ER....EEYIDFL........NK
A6BD84_9FIRM/357-445------------ILRVSEMVK.VVVADTITI.V...KTE.D........MNELEPLQEKGLQIKKLTDQI........TE
Q8G3U8_BIFLO/16-104------------LDRMAQNVR.KAIKGAGEA.L...LNQ.D..V..EAA.QTV.I..DG....DIEIDAL........ES
A1A0C8_BIFAA/129-212------------FAEMQAFLD.NVADQVVSM.L...TDR.D..T..KTA.EQI.I..LN....DDKLDAL..........
Q2FUH2_METHJ/133-224------------LKRMFVIVK.SMHIDAIDA.F...IAH.D..S..DLI.TDV.I..ER....DNDVDRL........FW
A8F7W8_THELT/123-210------------LNEMIKIIL.TMFKEIVEA.V...QHK.D..L..DLA.IKV.W..KK....DDQVDFL........HN
Q1IMC8_KORVE/16-104------------LLRMGGLAE.QAIERAVEA.Y...RKR.D..A..KAC.QAV.F..DG....ERDINAA........ER
A3DJ80_CLOTH/353-440------------AREMAYASV.DAIKKAVAL.V...NNY.D..E..KEA.QKV.R..DA....EQQTDKY........ED
A8F7W8_THELT/19-107------------LAEFITGVE.NLFEKTLYA.I...QSG.D..E..HVI.KQI.E..NM....DDYFDSL........DL
A5UKP6_METS3/187-276------------LKKMHKTAQ.KMIRSAMLAFL...EGK...........TNL..........KDDIMDF........EE

PF01865

Y1799_ARCFU/7-225EI---------RGNVTKSLMLPVDRHDLLEFLKVQDDILNNCEHVGHMVTFRK..VSAPEDVWDEFLVLLSKLMEIVNNY
PITX_RHIME/3-212EV---------LLAVRRSFITPFDRGDIKDLIQSMDDAIDMMHKTVKTIRLYE.....QKSFDPGMQAMGAAVVEAAHLV
Y1389_PYRHO/1-210NI---------ELMLYGGAFLPASRGDYVRLSELIDNVADAAESAAHSLMFAK..PIVPKGLEDEIIRLVDESLKTFEYL
Y629_METJA/7-212NI---------RINLEK.AFLPNMRRELSRSAELLDETLDSLKHAAMLYELLK..EEFDEYLKNEIDLVLMITVDMFQHL
Y691_CHLTR/4-223DV---------RRHLASGVFLPVSRAALLEIISIQDSLADCAEDIAILLTVKE..LQFYPEFEELFFEFLQKTVQSFEAV
Y637_PYRHO/7-226EL---------RDSITSKLLMPVQRTDILEYLHMQDKIADAAEDTAKWLLIKRNLDSIPNDIKDIILKMGKESIKAAKLV
Y1603_HAEIN/6-225EI---------RLKLPRGLFLPIDRTDLLELVTQQDKLANYAKDIAGRMIGRQ..FGIPEEMQEEFLHYVKRSLDAIHQA
Y1689_METTH/2-214KM---------ELEFYEGAFLPFDREDRIMLVESIDKVADVIESAAFTVSLGK..VAFPAEFRDDFRAMMKVTGKTIRAL
Y2149_ARCFU/6-209DI---------VLKIHSGAFIPALRSDFCNLAEELDEILDELEDIAMLYLLID..F.IPDELRDEFIRIADTNSKMAYLL

PF01895

Q9WWA8_AGRRK/446-532RS.........SE.....RHLERL.....RD..GRAD......S.........---------------------------
Q03SN9_LACBA/120-205QV.........RA.....DSYQQMRLDAAFE..TGAS................---------------------------
Q3K4F6_PSEPF/130-215TA.........LR.....E.LATY.MM..ED..PR........S.........---------------------------
A3IBE4_9BACI/458-543KL.........RQ.....K.HIAR.LN..TN..EC........S.........---------------------------
Q0C0L6_HYPNA/20-108EV.........EK.....QIVSLI.AR..RQ..PMGH......D.........---------------------------
A9A7B7_METM6/344-431EI.........TN.....HLIELS.NQ..EI..S.........D.........---------------------------
Q1AXT8_RUBXD/17-105EI.........ER.....DCMLLQ.AR..QA..PVAK......D.........---------------------------
Q9HS09_HALSA/241-324DV.........DD.....RLHGLT.............................---------------------------
Q2NHW3_METST/19-107EI.........YS.....MSVKIL.AM..EQ..PVAT......D.........---------------------------
Q14PE5_SPICI/124-211VE.........ND.....ALIEKI.RE..AK..SKEE................---------------------------
Q3DDJ5_STRAG/121-206TI.........KK.....QLVLYF.SV..QD..V.........D.........---------------------------
A1RZ38_THEPD/147-240YG.........LR.....QLHAAL.RG..YV..GLEEIG..LRK.........---------------------------
C0AA68_9BACT/341-428EL.........ID......YLSH..IG..GE..KNAR......D.........---------------------------
A3DN16_STAMF/16-108AF.........IE.....SLVFIARFQPLGK..ELRL................---------------------------
A4TA42_MYCGI/121-204EL.........FA.....Q.LIGP.HW..QH............G.........---------------------------
Q7WH04_BORBR/20-108EI.........DE.....RISLIL.AR..HQ..PTAI......D.........---------------------------
Q3A6T9_PELCD/117-202ET.........YR.....L.VIDQ.IE..LH..PE........R.........---------------------------
Q2RNF7_RHORT/37-125EH................QVNEQV.....VR..LLALRQPVADD.........---------------------------
A1VPD2_POLNA/21-109EI.........DR.....ELSSII.AR..RQ..PTAR......D.........---------------------------
A6UJ27_SINMW/347-434GI................KLYLAA.IN..RG..VLDE.....PQ.........---------------------------
Q609Z7_METCA/131-216QT.........LG.....GLMDNGGSDAGGA..NRAV.....N..........---------------------------
Q8Y4F0_LISMO/121-206IV.........YQ.....K.CIHF.MQ..EE..PE........H.........---------------------------
A3SW68_9RHOB/125-210AL.........FR.....EFLTFM.ME..DP..R.........N.........---------------------------
A7VHC0_9CLOT/465-550TI.........KK.....Q.HIKR.LQ..KG..KC........T.........---------------------------
A7NGW7_ROSCS/12-100AV.........ED.....RIARFI.TQ..RQ..PLLR......D.........---------------------------
A9A7B7_METM6/449-534TF.........RK.....QHIKRL.NS..KE..CA..................---------------------------
Q0W1F8_UNCMA/244-323KL.........DE.....EVLKLS.............................---------------------------
Q8TLE8_METAC/137-228LL.........SK.....L.FISR.LN..LR..KTSKKD..RLR.........---------------------------
Q9V263_PYRAB/138-231LI.........MR.....A.VNRL.LS..KR..GVTEESGLFKK.........---------------------------
Q7WTY2_MYCSM/16-104QA.........EE.....SAFVLL.AL..QA..PVAG......D.........---------------------------
Q1Q2E1_9BACT/157-242QI.........YH.....E.LLLL.MM..GN..PK........I.........---------------------------
A0NT92_9RHOB/344-431SV................KLYIAE.VN..RG..ELTG.....EQ.........---------------------------
Q5WET9_BACSK/120-204KL.........IK.....KLFRQE.TT..DQ..D...................---------------------------
Q6AM12_DESPS/122-207SA.........YK.....NIKAEF.YQ..GH..DC..................---------------------------
Q2FUH2_METHJ/240-319KI.........NT.....ELLSLP.............................---------------------------
Q8RGL5_FUSNN/332-421EI.........YD.....SNFSLL.....SK..SLSKELIEDTR.........---------------------------
A6DFF6_9BACT/119-204SL.........LS.....ELKEKIQESPEMT..DQLL.....Y..........---------------------------
A5LR94_STRPN/16-104AI.........EL.....TCARLL.AL..QQ..PQVS......D.........---------------------------
A0RIP2_BACAH/120-205KA.........IR.....E.FISS.VP..EQ..PE........A.........---------------------------
A9KP20_CLOPH/121-206EV.........KS.....TVIEAM.KN..SG..E.........N.........---------------------------
Q3R0V0_XYLFA/24-111SI.........SH.....EVMRL..AL..RG..PMAR......D.........---------------------------
D1N4D7_9BACT/120-205EV.........IE......RSEEL.IK..QH..PELA......E.........---------------------------
Q1QLM7_NITHX/342-429AI................KLYVTK.LT..RG..SLDE.....RE.........---------------------------
A6GK60_9DELT/17-105MI.........EN.....KCFRLL.TN..EE..L.........D.........---------------------------
Q3ATH0_CHLCH/112-197NI.........FN.....T.ATAM.MK..NP..DA........D.........---------------------------
Q609Z7_METCA/24-112EA.........DT.....EVVAQF.AR..RC..PKGS......D.........---------------------------
Q67RG3_SYMTH/124-209KV.........FD.....D.LLQA.MQ..SD..PK........A.........---------------------------
A5UKP1_METS3/126-211II.........LS.....HTTELL.TE..KI..Q.........N.........---------------------------
A8F5R4_THELT/16-104EL.........RE.....EAAVMMGIHTLIG..SR..................---------------------------
Q8EQ00_OCEIH/120-205RV.........VS.....DLLYET.AT..RP..D.........Q.........---------------------------
Q5V6R8_HALMA/168-260LF.........LR.....LVFTIY.R...NP..RLNQAVGLETG.........---------------------------
Q3IM37_NATPD/17-105DL.........ES.....DCIELF.AL..QQ..PVAG......D.........---------------------------
A7FZ36_CLOB1/450-535QL.........RE.....T.NIKR.LN..KG..TC........N.........---------------------------
B3EDV7_CHLL2/52-141FE.........VE.....YL..TLAYSSFQN..LSEEHLAVVRN.........---------------------------
Q1AXT8_RUBXD/121-207EA.........LN.....LIANPPADGNTGS..PEWR................---------------------------
A1RZ34_THEPD/143-235LL.........SR.....QVALSLKSSSYAE..KIGVKSRPLLL.........---------------------------
Q2RHH1_MOOTA/19-107NI.........EM.....SALDLF.SL..QQ..PSGE......D.........---------------------------
Q0W7U5_UNCMA/120-205RI.........RR.....ELINVM.IN..DP..S.........T.........---------------------------
Q8TSA7_METAC/17-105GI.........EV.....SICDLL.AL..QQ..PMAS......D.........---------------------------
A1SXC2_PSYIN/130-215NI.........SR.....LLITKM.ME..DP..RE..................---------------------------
Q48XB8_STRP1/459-544RL.........RK.....THIKRL.NC..GE..CT..................---------------------------
PHOU_ARCFU/109-184EA.........IE.....QLEESCDVN..........................---------------------------
A3IBD5_9BACI/121-206AT.........VT.....LLLRAG.VE..DP..A.........H.........---------------------------
Q8FMP1_COREF/18-106RC.........EV.....QAVELL.AL..ET..PVAR......D.........---------------------------
A3IBE4_9BACI/353-440EI.........TD.....Y.LVMV.S...KQ..PLSR.....AD.........---------------------------
Q18H39_HALWD/153-237AV.........LSELKSYTLTTNWPGNRIAA..DLST................---------------------------
Q0TMT3_CLOP1/448-533EF.........RE.....N.HIKR.LS..QG..SC........N.........---------------------------
A2SSI2_METLZ/247-326GL.........AD.....SIRKMR.............................---------------------------
Q5V0F9_HALMA/136-227MV.........SR.....V.FRTV.LR..NP..TAANEI..GFP.........---------------------------
Q1K0S3_DESAC/368-455EI.........ID.....F.LVAV.S...QR..PISQ.....EL.........---------------------------
A4W1M8_STRS2/121-207TI.........QE.....LTTEEI.KKNPES..LVAG.....RD.........---------------------------
A6Q2I6_NITSB/16-104DI.........DN.....EVVKTI.AL..FG..PEAS......Q.........---------------------------
A8ZSJ6_DESOH/16-104EI.........EE.....DCLKII.AL..HQ..PVAI......D.........---------------------------
Q2NHV4_METST/190-278EL................TNLQKLATKKISS..QMAKDNIDKKN.........---------------------------
Q1GAD2_LACDA/16-104DI.........EE.....TCLRLL.ME..QQ..PVAT......D.........---------------------------
A7HJE0_FERNB/119-204KF.........QE.....DITTIIQNN..........................---------------------------
A1RSV4_PYRIL/142-234LM.........ER.....Q.LKRA.AM..SR..YIMLEL.KIDD.........---------------------------
Q92PS2_RHIME/340-427EV................KIFLSR.LG..RD..GLNE.....ED.........---------------------------
Q39UL6_GEOMG/454-539AM.........LN.....GHIKRLSTGKCTV..RAG.................---------------------------
A6LSI4_CLOB8/122-207SL.........FA.....S.FIKA.IK..KD..ES........L.........---------------------------
B0K446_THEPX/17-105KI.........DN.....KCAKII.VT..QQ..PIAR......D.........---------------------------
A2BLI4_HYPBU/116-197EA.........VR.....R.LGTV.AH..LS..RCE.......V.........---------------------------
A0LDJ6_MAGSM/127-212A..................AFSET.LQ..HM..STHS.....QE.........---------------------------
Q0A7V3_ALHEH/22-110SI.........RR.....KVLRH.............LTVNPGHD.........---------------------------
A2PVH6_VIBCL/125-210AV.........VR.....QLMTYM.ME..DP..K.........N.........---------------------------
Q1AX68_RUBXD/13-97DM.........RT.....LAVLAARSPSDAE..QMAG................---------------------------
B8G920_CHLAD/123-203RL.........KQ.....ALVAQL.TP..PE......................---------------------------
Q0W3W9_UNCMA/337-424RI.........ER.....AILEISQRDMGAK..EAGQ.....T..........---------------------------
A5VLT3_LACRD/120-205KL.........QK.....EIMKALVKGGEDV..KAYE.....S..........---------------------------
Q2RHH2_MOOTA/339-427AI.........AR.....YLANMN.....HD..NLSE................---------------------------
Y2053_DEIRA/72-160EI.........ED.....AC..LV.AF..AA..GLSE.....RE.........---------------------------
Q6MP49_BDEBA/19-107RV.........DN.....ACMHVL.AK..QG..PVAK......D.........---------------------------
Q2FTF7_METHJ/119-204EV.........MR.....DLIKRMEQKKDDV..PILA.....R..........---------------------------
Q6MP49_BDEBA/123-208KV.........FQ.....D.AMAH.MK..AH..SD........D.........---------------------------
Q9YAE0_AERPE/200-281IL................SLMEDIVAQGLTG..PETL.....T..........---------------------------
A6P1M5_9FIRM/363-450AL..........D.....NYLVRL.SD..HS..LSA......QE.........---------------------------
A5INX6_STAA9/348-434SI.........RN.....YLVRISTKAITKA..DVER.....L..........---------------------------
Q7A1Z9_STAAW/452-537KL.........RK.....GHIKRL.NR..GE..CT..................---------------------------
O28477_ARCFU/135-226LL.........LR.....QLKQATLHADVAA..QLDIPIETIQE.........---------------------------
A0LDJ6_MAGSM/24-112EV.........ER.....LALRFI.AL..RQ..PVAV......D.........---------------------------
Q6AAV0_PROAC/147-230DQ.........FR.....L.LLGD.DW..TY............G.........---------------------------
Q0TTG5_CLOP1/17-105KI.........IE.....KSIELT.AL..KQ..PMAK......D.........---------------------------
A4FL22_SACEN/121-205EL.........LD.....A.ATGA.EW..TH............G.........---------------------------
A5V0U4_ROSS1/126-211AI.........LE.....A.VRQM.AL..ND..AA........L.........---------------------------
Q5SM00_THET8/16-104KV.........EN.....QAIAVI.AR..HQ..PVAS......D.........---------------------------
A6LEN2_PARD8/122-207NS.........TA.....I.IAKY.IE..EH..KG........S.........---------------------------
A8MCD0_CALMQ/253-330EV.........SN........................................---------------------------
A2SSH8_METLZ/116-201SL.........YK.....EIVTAM.EG..GS..M.........T.........---------------------------
Q3ZA57_DEHE1/17-105EI.........EE.....KSVELM.AT..QQ..PMAR......D.........---------------------------
A6FRR4_9RHOB/21-109QI.........NE.....EAARTI.AL..RA..PTAI......D.........---------------------------
A0RXC3_CENSY/117-197ER.........LP.....AIINSQDTK..........................---------------------------
O28916_ARCFU/230-309KI.........AE........................................---------------------------
A6CFS1_9PLAN/358-447EV.........TSYITHLLAMDLTQDVISKG..RCQL.....R..........---------------------------
Y1732_METTH/119-196QL........................................QE.........---------------------------
Q2Y4E8_9ARCH/231-312SL.........AK.....KNRKNADPC..........................---------------------------
Q0ASG2_MARMM/127-212TL.........VR.....E.MLMS.MT..ED..SG........L.........---------------------------
A2SSH8_METLZ/16-104ML.........NE.....RGLLLI.AL..NQ..PMAK......D.........---------------------------
A3IMM3_9CHRO/129-213HL.........YH.....H.LAYQ.RD..VL..G.........V.........---------------------------
Q8F0J5_LEPIN/132-214...........CQSAFLKFVMDSRLDKNQFA..DVYR................---------------------------
Q30YR4_DESDG/121-206DL.........LK.....ALMDYM.SK..ES..PAVE.....R..........---------------------------
A2REA1_STRPG/17-105KL.........EK.....KSLEII.AL..QQ..PVSN......D.........---------------------------
B2JUR6_BURP8/126-211AF.........VR.....R.LVTQ.MN..ET..PQ........T.........---------------------------
Q1K267_DESAC/120-205QT.........YG.....LVKQEL.............................---------------------------
A3ZZ51_9PLAN/120-205SM.........YD.....W.FKNG.AR..QR..PD........D.........---------------------------
Q8FMP1_COREF/123-206HI.........MG.....L.LTIR.EW..PY............S.........---------------------------
Q0W7U5_UNCMA/17-105EL.........EN.....KCIELL.AT..QQ..PMAS......D.........---------------------------
Q9UZU5_PYRAB/16-100EV.........FE.....IATELL.VR..YS..PVAS......D.........---------------------------
A6UUI6_META3/119-204EL.........YG.....EMIRHI.IE..NP..S.........H.........---------------------------
Q2FTF7_METHJ/16-104AT.........EE.....TMFRHL.AL..YQ..PVAR......D.........---------------------------
Q1NKG6_9DELT/478-564CL.........RN.....RHYGRLEQGVYPP..RIGV.....M..........---------------------------
A3DN11_STAMF/248-325KT.........RH.....NLINPLGFPEANL......................---------------------------
A3CVF4_METMJ/140-231LV................ARQDNLIANDATL..ARRM................---------------------------
Q7A5Q4_STAAN/19-107DI.........NE.....RVIMLI.TK..QQ..PIAS......D.........---------------------------
Q18H40_HALWD/245-326EL................YDHDVPSEA..........................---------------------------
Q1IMC8_KORVE/119-204EA.........FV.....V.LVDQ.MN..KY..PE........T.........---------------------------
Q5HG35_STAAC/121-202HI.........IN.....A.TYLI.DN..DP..FVAAQA.HLA..........---------------------------
Q251M5_DESHY/359-447QI.........TE.....Y.VLKA.TS..GT..NLTK.....EQ.........---------------------------
A3ER26_9BACT/16-104GI.........DE.....DCIRMI.AL..HQ..PEAR......D.........---------------------------
A4A3L4_9GAMM/129-214AA.........MD.....SLLRLM.KN..DA..G.........S.........---------------------------
A3DLY8_STAMF/20-104LL.........VM.....QASLAVRSARDAE..EMVS................---------------------------
B4SH22_PELPB/118-203MI.........VR.....T.VMAA.MK..IL..PG........E.........---------------------------
Q186T5_CLOD6/447-532TF.........RN.....S.HMIR.LN..NG..SC........T.........---------------------------
B1YLB2_EXIS2/122-207KA.........LR.....Q.YMRH.MS..LQ..PV........V.........---------------------------
A1RZ38_THEPD/253-333KV.........FD.....ELARRI.............................---------------------------
Q3IM38_NATPD/147-240LV.........SR.....Q.FCRI.LT..DI..REVET....LR.........---------------------------
O27757_METTH/89-175KV.........RS.....SVDTAIAMNPYSE..FSKT................---------------------------
Q53W26_THET8/300-379EV.........LV.....YVAKLP.....QD......................---------------------------
A3CVT1_METMJ/216-300DL.........DL.....WILEAARKIEDVR..YLRG................---------------------------
Q834B5_ENTFA/121-206SI.........YK.....H.AVEA.MK..AN..PE........T.........---------------------------
A4IQY4_GEOTN/16-104EV.........ND.....FALWLI.AK..QQ..PVAT......D.........---------------------------
A0NJJ5_OENOE/131-216TI.........RK.....DILTSMKGDVDTI..DAGA.....D..........---------------------------
A3CRL4_METMJ/338-425...........IE.....QALRAI.SK..RQ..LSDG......E.........---------------------------
Q9YA54_AERPE/253-331MT.........AQ.....EFLRGG.............................---------------------------
Q0YRH7_9CHLB/17-105DL.........EE.....RCLAFL.AL..QQ..PVAR......D.........---------------------------
Q74KF7_LACJO/16-104KV.........EK.....RTLKLM.AL..QQ..PVAS......D.........---------------------------
A8AA37_IGNH4/119-200SM.................LMDII.KN..YE............N.........---------------------------
Q6G4T5_BARHE/125-210SL.........FR.....E.LLTY.MT..ED..MR........N.........---------------------------
A9BHU2_PETMO/25-113SL.........NY.....ESVILLSSG.N.Y..TGIY................---------------------------
Q2LUX4_SYNAS/355-442DV.........VR.....Y.LWKL.S...RN..SLTA.....QP.........---------------------------
Q4FLF7_PELUB/22-110TI.........EE.....QIVTVL.VK..RA..PMAI......D.........---------------------------
A0RXC3_CENSY/16-103DV.........AD.....LTFDML.LK..YQ..PVAD......D.........---------------------------
A5ILH4_THEP1/119-204KV.........RE.....ELLLYM.............................---------------------------
A6LP09_THEM4/121-202KI.........RE.....K.SKKT.LK..D.......................---------------------------
Q2S080_SALRD/18-106RI.........DE.....QCERILALHSPVA..VDLRM....L..........---------------------------
A9BNX0_DELAS/469-555AY.........SA.....THLARLSDNTVSS..IETS................---------------------------
Q9YAE0_AERPE/15-99AV................GLLSLAVRGPGHT..GLAK.....G..........---------------------------
Q5WET9_BACSK/17-105DI.........NE.....KVFDII.AR..QQ..PVAT......D.........---------------------------
A5ZNC6_9FIRM/16-102EI.........EN.....LCMRIL.LH..QQ..PVAR......D.........---------------------------
A0LAE5_MAGSM/412-500QF.........INY..LGKISQGHLTEAHTR..EMIT................---------------------------
A6CFS1_9PLAN/465-550TL.........QR.....EHLDYL.SA..EK...........VD.........---------------------------
A6DAS5_9PROT/94-175ELVIEIKQIDDID.....LILKTLN............................---------------------------
B8G180_DESHD/18-106DI.........EE.....TCMLLI.AQ..QQ..PFAK......D.........---------------------------
A4IQY4_GEOTN/119-204EL.........MK.....SLLEME.KT..DK..E.........A.........---------------------------
Q8TX17_METKA/93-179EI.........RLYVRTLPVLHPCEEAGKVA..TL..................---------------------------
Q2NHW3_METST/123-208EF.........LV.....TVTKAM.KE..DT..S.........T.........---------------------------
A5G3F8_GEOUR/471-558TL.........QQ.....NHIKRLHSGKCTI..VAG.................---------------------------
A4FX70_METM5/17-105EI.........EE.....KCISFM.AT..QQ..PVAS......D.........---------------------------
PHOU_METTH/21-109NL.........ER.....KAISLI.AA..EQ..PVAG......D.........---------------------------
Q662X1_BORGA/126-211KQ.........KS.....IVIDAMKKNPENL..DYLL.....N..........---------------------------
A1VDV5_DESVV/122-207EL.........ST.....AVVAFM.....KE..NPEA................---------------------------
Q0PIQ4_DESVU/19-107EV................EIDELS.....LQ..LLAREAPLAQD.........---------------------------
Q8PZB8_METMA/122-207AV.........WV.....E.LIEM.MA..KD..TS........I.........---------------------------
Q9CEW9_LACLA/121-206EI.........QE.....KILDGM.....KE..NSET................---------------------------
B9LHB3_CHLSY/122-207TL.........RE.....LIIAEA.RQ..DP..D.........R.........---------------------------
A5D1M0_PELTS/120-205QC.........FD.....R.LVEI.IK..KE..PG........K.........---------------------------
Q2RHH2_MOOTA/445-531NL.........RY.....SHFQRLQRENRLS..LETT................---------------------------
Q9YG50_AERPE/17-103EQ.........AT.....FFI....AK..YQ..PLGP......E.........---------------------------
A9B5P2_HERA2/131-216EM.........FE.....A.TVKV.ST..TS..PD........M.........---------------------------
A4YI56_METS5/245-324KV.........TE.....TIFRSSEAMKPS.......................---------------------------
Q47KT1_THEFY/132-215KL.........LE.....R.ILSS.KW..EY............G.........---------------------------
E0THQ4_PARBH/20-108SI.........ER.....QVVALL.EA..RR..PSGS......P.........---------------------------
Q6D018_ERWCT/339-425AI................KLYLAQ.IQ..KD..GLDE.....RD.........---------------------------
Q5Z0T5_NOCFA/22-110TC.........EA.....RTVALL.AL..QA..PVAR......D.........---------------------------
A4E7E4_9ACTN/16-104VC.........YN.....LIATQSPVASDFR..LLQT................---------------------------
PHOU1_THEMA/18-106EI.........EE.....KAYQII.AR..YN..PILK......Q.........---------------------------
PHOU_AQUAE/117-202QL.........ER.....ELMTYV.LE..DP..R.........N.........---------------------------
A6UVP6_META3/82-166EI.........GV.....SIKMNS.LR..YL..PME.................---------------------------
A5Z3H1_9FIRM/450-535DY.........QE.....G.HVER.MA..AG..DC........S.........---------------------------
A7H7E1_ANADF/124-209KI.........FN.....DLLAMM.ME..DS..R.........N.........---------------------------
A5Z3H1_9FIRM/345-432RI.........TE.....Y.MVKA.N...QY..GMPI.....KD.........---------------------------
A3CXV2_METMJ/119-204SV.........FR.....GCLACM.ME..DP..K.........N.........---------------------------
Q1K0S3_DESAC/473-558RL.........RL.....N.HIAR.LN..TG..EC........S.........---------------------------
B4S7F4_PROA2/163-246KA.........VK.....KLKAEVNDN.........N................---------------------------
A9B5P2_HERA2/20-108RL.........HD.....QALLII.AT..QQ..PLAR......D.........---------------------------
Q5V0G4_HALMA/118-213RA.........SE.....TVARDLIEREADG..DDGW.....A..........---------------------------
A7I9M4_METB6/16-104EL.........EE.....ICYQLI.AL..NQ..PVAK......D.........---------------------------
A8MCD0_CALMQ/144-239LI................HRLINMAVNGLIS..VRSVEIDDRPE.........---------------------------
Q8TX17_METKA/194-284NI.........IR.....A.CEKA.VE..ET..KEFP.....EK.........---------------------------
B8CZG2_HALOH/119-206KI.........YG.....HSIKLI.NE..SE..GTR.......N.........---------------------------
A8MBU9_CALMQ/146-238LL.........NR.....I.LKKL.TT..SS..YYASMS.GIKD.........---------------------------
A7VHC0_9CLOT/360-447EL.........GT.....Y.LAKV.S...GK..ELAE.....ED.........---------------------------
Q0RZA9_RHOSR/121-204RL.........LD.....L.IQKP.AW..SD............S.........---------------------------
Q3A1F9_PELCD/468-553KI................QRLQERNCSIE........................---------------------------
A3ZZ51_9PLAN/16-104EI.........AE.....ESLHLV.AL..FQ..PVAS......D.........---------------------------
A4J4V6_DESRM/467-552EF.........RY.....G.HIMR.LN..EG..FC........A.........---------------------------
Q4KBC7_PSEF5/340-427AI................RAYLAD.IG..KE..GISD.....QD.........---------------------------
Q6ADH5_LEIXX/144-227SV.........FE.....KVLGET.WK..........................---------------------------
Q1WUX0_LACS1/120-205EI.........RK.....LSINAI.....KE..DANF................---------------------------
Q0F0C9_9PROT/122-207SL.........QR.....ENLTYM.ME..DH..R.........Q.........---------------------------
Q2YM24_BRUA2/348-436AI................KLYLTRLATQNLT..DFESLR.MQE..........---------------------------
Q6XYS9_SPIKU/16-104AF.........IE.....VSLWKI.AK..QQ..MVAK......D.........---------------------------
A5KMQ5_9FIRM/453-538KY.........FK.....K.QMQR.LK..KG..KC........K.........---------------------------
B8CZG2_HALOH/16-104TI.........EE.....EVSRLL.SL..DK..PLTS......D.........---------------------------
A6GE05_9DELT/129-214QV.........FE.....E.VLLG.MM..GK..SM........G.........---------------------------
A8MGX2_ALKOO/16-104EI.........EN.....KCLLLI.AL..QQ..PIAK......D.........---------------------------
A5UQ39_ROSS1/16-104AI.........DE.....HVFQLI.AT..QQ..PVAT......D.........---------------------------
A4YI56_METS5/143-234YV.........AR.....Q.LTLS.IS..SF..EILEEE..GYN.........---------------------------
Q05HF3_UNCMA/14-101DI.........DR.....ECIDAL.AG..KL..E.GR......D.........---------------------------
A7HJE0_FERNB/16-104NI.........LN.....FSQTIV.GT..SN..PSGY......E.........---------------------------
Q3IX36_RHOS4/343-430AI................KLYITR.LS..RA..ELDE.....DD.........---------------------------
O28086_ARCFU/211-297EI.........EK.....SVLKCSRHFNDEQLMPLMA................---------------------------
A0B6T7_METTP/241-325RS.........FE.....PVISSS.STGVNQ..EEIL................---------------------------
A3ZXF3_9PLAN/119-204EI.........IQ.....E.LQDR.MK..VS..SY........E.........---------------------------
A5G3F8_GEOUR/366-453DI.........SS.....F.LITL.S...RQ..PLPS.....TN.........---------------------------
A7LS25_BACOV/16-104KI.........DS.....DVEDII.AL..YN..PVAI......D.........---------------------------
Q8U240_PYRFU/93-170IS.........LK.....N..LKD.QT..SS..P...................---------------------------
A1UU23_BARBK/21-109DI.........NE.....KAMTII.CR..RQ..PMAV......D.........---------------------------
Q2SS07_MYCCT/120-207SF.........YD.....LLIDDIRQKTTKA..EAEE................---------------------------
A0RA51_BACAH/351-438KI.........TE.....Y.LVLL.S...EK..PLSP.....TD.........---------------------------
A8ZSJ6_DESOH/119-205EI.........YD.....I.LKGT.GD..TG..NIM.......D.........---------------------------
Q6F1N0_MESFL/119-206EL.........YS.....YLVKALKKAENNE..ELLE................---------------------------
Q2LUX4_SYNAS/460-545DV................EVKESR.....DR..HLVRFYNQIDA.........---------------------------
A5URZ8_ROSS1/121-206CV.........ET.....M.LTHQ.MA..QN..PL........T.........---------------------------
Q2Y4E6_9ARCH/245-318EI.........SQ.....SPAAPS.............................---------------------------
Y409_MYCGE/126-215LV.........LT.....KYYETINKN.E........................---------------------------
A0RXQ8_CENSY/138-229LL.........VR.....LIRSTMVDRRPAGGFDLEDT...DI..........---------------------------
Q3A1F9_PELCD/363-450EI.........TH.....YLMKIYQLEINEE..SAKEI...HS..........---------------------------
A5EXS4_DICNV/20-109DI.........NK.....ECVRLI.AK..RS..PVAS......D.........---------------------------
B2JUR6_BURP8/21-109EI.........DE.....EIHRVI.AR..RQ..PAAR......D.........---------------------------
Q31I87_THICR/133-218KI.........EK.....ELKESL.KT..SP..DKIE................---------------------------
A6GWK5_FLAPJ/140-225QV.........IE.....N.IISE.MK..TN..SK........A.........---------------------------
B8G180_DESHD/121-206QV.........FR.....ELLVFM.ME..AP..K.........T.........---------------------------
Y409_MYCGE/20-112KL.................INESIWTISKNS..PLASHLRLTIT.........---------------------------
A6Q2I6_NITSB/121-210LF.........EK.....ELLENL.CK..DT..TK..................---------------------------
Q3IUH9_NATPD/24-108RA.........RM.....SLMLAVRNPKEAE..ALAP................---------------------------
Q8PZB9_METMA/245-322SL.........ES.....R....GDGG..........................---------------------------
A9KP15_CLOPH/357-444VL.........GT.....Y.LVKL.S...SK..ELSL.....SN.........---------------------------
Q1IMC3_KORVE/122-205NL................VFVRHLENPGGTH..RSES................---------------------------
B2JC47_BURP8/341-428EV................KAYLAR.VS..RE..QLDD.....AD.........---------------------------
Q03GY8_PEDPA/120-205KI.........RN.....E.VLSN.MK..TN..PK........L.........---------------------------
A6VG44_METM7/121-206VL.........CR.....DMTINM.IE..NP..K.........I.........---------------------------
A4G2G4_HERAR/21-109DL.........ST.....AAAKVI.AK..RQ..PVAI......D.........---------------------------
A6LN86_THEM4/16-104KI.........KE.....KALIIL.ST..LM..PMSK......D.........---------------------------
A5ZVN9_9FIRM/463-548HH.........VE.....RLSKGE.............................---------------------------
Q879I2_STRPQ/323-410EL.........TT.....Y.LVDI.S...NE..ALSP.....SE.........---------------------------
Q4FLF7_PELUB/125-210IA.........MN.....E.VANF.LS..KD..KK........N.........---------------------------
A5KLQ2_9FIRM/351-438GI.........TD.....Y.LIRI.S...SL..AINE.....KE.........---------------------------
Y1641_METJA/186-266LL.........LN.....KVLENKREDLNFY......................---------------------------
A6BD84_9FIRM/463-548..................HVQRVNKGKCKAS..LTTP................---------------------------
A5ILH4_THEP1/16-104EI.........QE.....KAMEVL.....GL..F........SP.........---------------------------
A9A622_NITMS/148-240YIIRQLKIAIQNE.....HMLKEMGFRNPRN..CLGYR....L..........---------------------------
PHOU_DEIRA/16-104QL.........EA.....ECLRII.AL..HQ..PVAR......D.........---------------------------
O29778_ARCFU/134-226LA.........VR.....IVNRGMKKIAV.S..NWDE................---------------------------
C0A5V8_9BACT/119-205QV.........YR.....E.LSSF.MI..ER..PD........T.........---------------------------
A8F5R4_THELT/118-203EI.........RS.....ELLNSIRNK.P......DQ................---------------------------
Q11NF9_CYTH3/120-207NA.........NN.....VLA.....E..YI..SGNQD...REK.........---------------------------
Q5V3U8_HALMA/140-232LL.........LR.....LIFTAYQNPNL.A..RAIG................---------------------------
O28916_ARCFU/135-220LV...................LRL.LN..HA..GEGGI....MH.........---------------------------
A4WI32_PYRAR/111-191...........VDKAYEEALLDVLRGADRCK..VAET.....V..........---------------------------
A4J4A5_DESRM/448-534RL.........QM.....SHLIRM.KE..G...SRET................---------------------------
A5UMQ1_METS3/7-91EI.........KK.....ESLVAARSYEDAE..KLTA................---------------------------
A5WHR5_PSYWF/22-110KV.........DE.....QVILLV.AK..RQ..PAAS......D.........---------------------------
Y2861_DEIRA/125-208............R.....AVEQVL.AG..RP............D.........---------------------------
A8AA77_IGNH4/213-294KL.........EM.....EIIKNTAESQEIY..TSTV................---------------------------
A3DLZ0_STAMF/247-329ML.........FN.....KILVGD.............................---------------------------
A1S0L5_THEPD/137-223LA.........VR.....IMRRRIRDPTLSP..DERLR....L..........---------------------------
A4J4V6_DESRM/359-449TI.........TD.....Y.LVKL.SA..NK..TMTE.....EQ.........---------------------------
A0B6T8_METTP/129-214KV.........RD.....VLMRMT.AE..DM..N.........L.........---------------------------
Q0BUY2_GRABC/490-575RR.........LRTEGKAAELENL.............................---------------------------
A4X1M0_SALTO/17-105DI.........EA.....AVPELL.AR..QQ..PVAS......D.........---------------------------
Q8F0J5_LEPIN/12-116QNDN.....LSQN.....AILEAV.AN..RN..SMGM......DQVDGEVVLK---------------------------
Q2S5E3_SALRD/191-276EN.........FR.....G.LVDY.IQ..KN..PE........H.........---------------------------
A5UKP1_METS3/22-110EI.........ER.....SCIRFI.AM..EQ..PLAT......D.........---------------------------
Q971H7_SULTO/145-236LA.........LR.....QLILSQ.S...NR..SLAYMIGVKRI.........---------------------------
Q8FZK0_BRUSU/454-540QT.........SM.....RHFSRLREGSTRS..IETS................---------------------------
A6GWK5_FLAPJ/37-125KI.........DE.....ICQNIF.AL..QQ..PVAS......D.........---------------------------
Q30PB9_SULDN/121-210VL.........EK.....EILNKIIDEKELS..IEYV.....K..........---------------------------
Q8TWZ7_METKA/17-101VL.........KA.....KLALAIRDLEDVR..HLLP................---------------------------
Q9YA54_AERPE/147-239YM.........AR.....Q.MTMA.SS..GR..LPLKDL.GVYS.........---------------------------
Q6WB50_ALCFA/125-210RL.........VA.....DIVTMF.SQ..HT..SYAL......D.........---------------------------
A4ANM1_MARSH/120-205EI................QKDQTL.............................---------------------------
Q896W9_CLOTE/342-429EI.........TK.....Y.LVKL.S...NT..QIST.....KE.........---------------------------
Q1J0M9_DEIGD/118-204QM.........LR.....ASLTRL.HE..RP..H.........D.........---------------------------
A5LNQ6_STRPN/118-204NM.........EK.....KIMNYIFEDDGNV..SEVI.....S..........---------------------------
A3CVF4_METMJ/247-326DI.........NT.....RVLRFDAVT..........................---------------------------
A7IB03_METB6/247-326DI.........SN.....MAFKQDTIA..........................---------------------------
A8DJW4_9BACT/17-106EI.........DE.....MCAELL.VN..AA..ELSQ.....AD.........---------------------------
A6UVP6_META3/180-262...........ID.....TILEKISEKGCES..KYISY....Y..........---------------------------
A3JY90_9RHOB/333-420EV................KLYVAR.LL..RH..ELSD.....RQ.........---------------------------
Q186T5_CLOD6/342-429DI.........LN.....Y.LLKL.S...KE..PLRD.....DE.........---------------------------
A3WCP8_9SPHN/123-208SI.........FR.....N.LVSH.MV..EN..PA........T.........---------------------------
A0JSV0_ARTS2/16-104SL.........DE.....RAIDIL.AL..QG..PVAS......D.........---------------------------
Y1732_METTH/20-108RI.........ED.....ECLKIL.GL..HQ..PVAK......D.........---------------------------
A6TML5_ALKMQ/448-533TL.........RA.....N.HIGR.LN..AR..QC........I.........---------------------------
A9A9E5_METM6/23-112DI.........QK.....KCITIIALQQP.V..FASD................---------------------------
Q0SPC2_BORAP/17-106DI.........EDLCGRIIATEHPVATELRE..ILA.................---------------------------
A6NWS5_9FIRM/352-439EI.........SQ.....Y.ISKV.I...SH..ETNE.....TD.........---------------------------
Q180A4_CLOD6/120-205QV.........QI.....D.CLKI.MH..EN..SN........T.........---------------------------
A4G2G4_HERAR/125-210EI.........FD.....D.ITAL.MK..GS..QQ........Q.........---------------------------
Q05HF3_UNCMA/116-201SV.........FY.....N.SLGE.IV..HE..PE........R.........---------------------------
A3DLZ0_STAMF/142-234MIVRQLALALLDI.....RIMNEL.GI..SN..PVEA.....IN.........---------------------------
A9AVN3_HERA2/16-104QI.........ET.....NALSVI.TR..QQ..PMAR......D.........---------------------------
Q5V0G5_HALMA/139-228MI.........DR.....YFERGLARLDEID..ALGLTRPELFT.........---------------------------
A6LGP6_PARD8/360-451EI.........AN.....YLTEVSEGRLSSE..SKEE................---------------------------
Q30PB9_SULDN/16-104EI.........DN.....EVIKTF.AL..FG..PEAN......E.........---------------------------
A1APX2_PELPD/349-436EI.........TA.....F.LAKL.A...RS..STNT.....AV.........---------------------------
O57974_PYRHO/11-95KV.........KK.....LALEAAKKIDDPE..SMLS................---------------------------
A0PXY5_CLONN/341-428EI.........TD.....Y.MVSL.S...ST..NLSE.....AQ.........---------------------------
Q31I87_THICR/25-113EI.........DR.....LCAKVL.AR..QQ..PTAS......D.........---------------------------
A3DN16_STAMF/122-203NY.........LK.....K..LKE.ME..KV..PKY.......F.........---------------------------
Q73LA1_TREDE/351-442EL.........SV.....YLIKTSQLSLSEK..NRKN................---------------------------
A3ER26_9BACT/119-204DL.........VR.....SMVQEV.SR..DP..G.........K.........---------------------------
A1RUP2_PYRIL/16-99DL.........VM.....ETV....AR..YN..PVAI......D.........---------------------------
Q5UZI8_HALMA/218-302RF.........EA.....WTLRAAADIDDPV..SLRG................---------------------------
A9BNX0_DELAS/363-450AI................KYYMTK.IS..RA..ELDE.....RE.........---------------------------
A9KRG9_CLOPH/120-205TV.........IN.....D.ILNN.IT..EI..KG........L.........---------------------------
Q4J8G9_SULAC/246-327KL.........SE.....NVIMNFHSLKDDS..S...................---------------------------
Q9YG50_AERPE/119-200AM.........LE.....R.IGKV.ES..LS..QTE.......A.........---------------------------
Q12XW7_METBU/17-105DV.........EK.....ATVHLL.AL..QQ..PMAK......D.........---------------------------
A6GE05_9DELT/24-112DI.........DG.....MVLRIL.AQ..RQ..PMGS......D.........---------------------------
B8I417_CLOCE/120-205KI.........VL.....E.LINI.MK..NN..PS........T.........---------------------------
A7VDA3_9CLOT/469-554..................HVIRLQTGDCDID..GGFA................---------------------------
A6DFF6_9BACT/16-104II.........EE.....NALKIL.AL..YQ..PVAS......D.........---------------------------
A5ZXG9_9FIRM/464-549EL.........KR.....R.HINR.LR..SG..EC........T.........---------------------------
Y2861_DEIRA/23-111RI.........EG.....EALHLL.AR..QS..PVAH......D.........---------------------------
A7VSN0_9CLOT/344-431GI.........AE.....Y.LVKI.N...GL..DLED.....YD.........---------------------------
A7VSN0_9CLOT/449-536EL.........KD.....L.HIER.LN..QG..KC........S.........---------------------------
A9KNL1_CLOPH/461-546RF.........QK.....N.HVVR.LT..KN..AC........S.........---------------------------
A3KAI2_9RHOB/452-538RL.........QE.....RHLQRLQDRRSDS..VAST................---------------------------
A3DLY8_STAMF/215-297KM.........IL.....TIIEKFHDNPEEA......................---------------------------
Q8PZB9_METMA/140-232LA.........VR.....QLNISL.....NE..AEIAEKIEIGN.........---------------------------
Q1NQ35_9DELT/126-211QI.........RE.....I.LEEA.IA..HN..PA........R.........---------------------------
A7AA41_9PORP/470-557QL.................KIHNVEDINNKK..YQYQDG..VY..........---------------------------
Q8PUH1_METMA/112-203LI.........SK.....QFRSILCGGRMPD..SAETSIEEYHD.........---------------------------
O29464_ARCFU/138-228LA.........VR.....QEHRLVREFSSPS..KWNE................---------------------------
Q03YL4_LEUMM/120-205KV.........RT.....DSVNGM.....KE..DAEL................---------------------------
A0L7V8_MAGSM/21-109EV.........EN.....QVIRIL.AL..RE..PKAD......D.........---------------------------
Q97CB8_THEVO/140-221YI.........YR.....EVKNHCQYE..........................---------------------------
A5ZVN9_9FIRM/358-445RL.........GE.....Y.LIQL.T...KR..EMNT.....AQ.........---------------------------
Q6F1N0_MESFL/18-106EF.........TS.....TALWKI.AK..QQ..LVAR......D.........---------------------------
A4FWX8_METM5/180-263...........LD.....IMMEKLSENPDEN..LKDIN...QF..........---------------------------
A8AA77_IGNH4/19-103LL.........AL.....QLMVAARDPEDAE..KLLP................---------------------------
A3KAI2_9RHOB/346-434ES................KLYISRLRAGELS..DSQSRQ.TLE..........---------------------------
A3DN11_STAMF/143-235LI.........TR.....Q.LNQL.LL..GE..LSPSNL.GLVA.........---------------------------
Q0BUY2_GRABC/384-472AI.........RS.....YLTRIDPEAMSEA..DHRRV...RE..........---------------------------
A7VZ22_9CLOT/17-105EI.........ES.....VCMNLL.AL..QQ..PIAT......D.........---------------------------
Q8YNR1_NOSS1/26-114QI.........ES.....DCTSIM.TL..QA..PTAQ......D.........---------------------------
A5GUB9_SYNR3/26-114RL.........EEECADLLCHKRLSQTQVRE..VLS.................---------------------------
A3IBD5_9BACI/18-106EI.........ND.....HVILMI.AK..QQ..PVAT......D.........---------------------------
Q31LX7_SYNE7/130-214AL.........YD.....R.LVHD.SQ..AQ..F.........N.........---------------------------
Y1641_METJA/88-172EV.........RI.....LLSMNA.LK..YL..PGA.................---------------------------
Q8TR05_METAC/238-318EL.........HA.....SILKLE.............................---------------------------
A1WT64_HALHL/126-210EL.........FEDEGEIEFHEAVAYS.L........................---------------------------
Q975R4_SULTO/114-201NF.........EL.....KLFE..............KES.ELA..........---------------------------
A2BIZ3_HYPBU/172-264FI.........SR.....QLVSVLAGHRQPG..EIG.................---------------------------
PHOU_STRR6/119-204AL.........SK.....EIIGLMKDQETSI..PNGT.....Q..........---------------------------
A4X1M0_SALTO/122-204RL.........LS.....L.LLAS..W..QY............G.........---------------------------
A0P428_9RHOB/114-199KL.........FK.....VYTRGM.....RD..P.........D.........---------------------------
A5KMQ5_9FIRM/348-435GI.........SE.....Y.IVSL.M...AS..EMNM.....SD.........---------------------------
A6BD84_9FIRM/357-445YL................AALFSAGTMTEQQ..AAQTA...SL..........---------------------------
Q8G3U8_BIFLO/16-104SV.........ID.....QCVKLL.AK..QN..PVAT......D.........---------------------------
A1A0C8_BIFAA/129-212...........HK.....KTFELAQSEDWKG..TNQQ................---------------------------
Q2FUH2_METHJ/133-224LI.........AR.....Q.TNMI.LH..NV..HLSRKM..NMN.........---------------------------
A8F7W8_THELT/123-210RG.........HE.....N.LIDF.AC..KE..TSPR......M.........---------------------------
Q1IMC8_KORVE/16-104EI.........DE.....LALDLL.AM..QQ..PMAV......D.........---------------------------
A3DJ80_CLOTH/353-440AL.........GT.....YLVRLS.....SQ..NLSA.....RD.........---------------------------
A8F7W8_THELT/19-107KI.........QT.....TAFDII.GK..YQ..PLAD......D.........---------------------------
A5UKP6_METS3/187-276SM................HMLQNKSINIIAT..QMAENSFDEKE.........---------------------------

PF01865

Y1799_ARCFU/7-225EEMVERIMQLVETSFSKKEVNRALEYVPIIEQLEHECDLIQIGLHTKLFN..LEN.SNPLDIQLMVTWVVHLGYVAN-AA
PITX_RHIME/3-212AEAIPLLSRIGANAHRLS......AIAEEVTHVEDRSDQLHEQGLKDLFQ..RHGASNPMAYIIGSEIYGELEKVVD-RF
Y1389_PYRHO/1-210KGATLALEDSVDDALM.........LAKKTETQEEDADKIEYDLLRKIFS..RED.ISTYAKLIWNQVITKIGDVAD-RA
Y629_METJA/7-212DRVLDVIEK..GGDLDP........IIKEIKDKEKFIDDVYQNRIYKYLIN..LEVESFWEGKILCDFIDNIVNISD-YI
Y691_CHLTR/4-223AKTIREMDRLLESSFGGNRADKTRVLVSEVSNLEHECDLLQRELMKVFFS..DDFAIGTKGFVLWMQIIKGISGISN-NS
Y637_PYRHO/7-226YEAIKQLDNVLESGFAEKEIKKEYKIIKQIEEVESKIDGLDSKLMEIVFT....SELDWKDGLYILNIARTLSNISD-KA
Y1603_HAEIN/6-225HRVIEEMDKLLETGFKGRELKLVNDMIQELDSIEDDTDQMQIKLRKMLYT..IESRYNPIDVMFLYKIIEWVGVLAD-QA
Y1689_METTH/2-214HECVESLETDLGEAMR.........KVHEIERFEDEADIIERKIITGLYSAYRQDRIGVVKFLDMKEITRKVANISD-RA
Y2149_ARCFU/6-209LDAFNALE...EGGLS........DILLKIKILEEQIDSMKGRIYEKLKN...IDFSGYAEWYYFIKFVEKLLNVSD-LI

PF01895

Q9WWA8_AGRRK/446-532--------------------------------------------...LQT...S..SL....HLD..ILRDLKRINA.HI
Q03SN9_LACBA/120-205--------------------------------------------.........I........YLN..VAQDLSRIGD.YV
Q3K4F6_PSEPF/130-215--------------------------------------------...ISR...V..LS....IIW..VLRSLERIGD.HA
A3IBE4_9BACI/458-543--------------------------------------------...GAA...G..IV....YMD..IVSNLERIGD.HA
Q0C0L6_HYPNA/20-108--------------------------------------------...LRM...I..LS....ALK..TSNELERIGD.LS
A9A7B7_METM6/344-431--------------------------------------------...SQK...LKITS....LIS..NVTSLERIGD.LA
Q1AXT8_RUBXD/17-105--------------------------------------------...LRL...I..YT....VMS..LTNHLVRSGT.LC
Q9HS09_HALSA/241-324--------------------------------------------.........AHHAQ....H.LGLVVDSLSRSAD.YG
Q2NHW3_METST/19-107--------------------------------------------...LRF...V..AN....TIK..IANHLKRIGK.LS
Q14PE5_SPICI/124-211--------------------------------------------...IKV...I........TLTMQQLRSIERAGT.HI
Q3DDJ5_STRAG/121-206--------------------------------------------...GEY...P..ID....VLM..IAKYLERIGD.HT
A1RZ38_THEPD/147-240--------------------------------------------...VEE...V........LPHGMVLKNIERIAD.HA
C0AA68_9BACT/341-428--------------------------------------------...TRW...Q..VA....LMN..FTVELEAIGDLLD
A3DN16_STAMF/16-108--------------------------------------------...VEA............YIN..VYYDIYRISR.YC
A4TA42_MYCGI/121-204--------------------------------------------...PLV...A..AD....LVL..VGRFYERFAD.HG
Q7WH04_BORBR/20-108--------------------------------------------...LRT...L..LA....VSK..MLTDMERSGD.EA
Q3A6T9_PELCD/117-202--------------------------------------------...IQS...L..IC....FLV..ISRYLERIAD.QT
Q2RNF7_RHORT/37-125--------------------------------------------...LRT...V..IT....GLK..VSGMLERVGD.YA
A1VPD2_POLNA/21-109--------------------------------------------...LRL...L..IA....ISK..TTANLERAGD.EA
A6UJ27_SINMW/347-434--------------------------------------------...SRK...G..VE....LID..IAINLEHAGD.IV
Q609Z7_METCA/131-216--------------------------------------------..................LVL..VLKALERIAC.HA
Q8Y4F0_LISMO/121-206--------------------------------------------...IED...V..SQ....LLL..VSQYIERIGD.YV
A3SW68_9RHOB/125-210--------------------------------------------...ITS...C..MH....LHF..IAKNVERMGD.LV
A7VHC0_9CLOT/465-550--------------------------------------------...IEL...G..IA....LEN..LLNNYERVAD.HC
A7NGW7_ROSCS/12-100--------------------------------------------...LRR...V..LA....MLT..VAGELERIGD.YA
A9A7B7_METM6/449-534--------------------------------------------...PKA...S..II....FLD..VIGYLERISD.HA
Q0W1F8_UNCMA/244-323--------------------------------------------.........S.DIS....VPLGIILDSIDRVCD.YG
Q8TLE8_METAC/137-228--------------------------------------------...LIE...A..FY....YRL..AAGELERIGN.LI
Q9V263_PYRAB/138-231--------------------------------------------...PFD...L..IG....ILL..IARNVERIGD.HI
Q7WTY2_MYCSM/16-104--------------------------------------------...LRT...V..VS....AIQ..IIADVDRMGA.LA
Q1Q2E1_9BACT/157-242--------------------------------------------...INL...A..TY....LTW..VSHNLERIAD.RV
A0NT92_9RHOB/344-431--------------------------------------------...AER...S..ME....LVG..FAVNLERAGD.LV
Q5WET9_BACSK/120-204--------------------------------------------...VEA...I..TQ....LAF..IARYIERIAD.YA
Q6AM12_DESPS/122-207--------------------------------------------...SSA...L..ID....VFL..VAGYLERIAD.RA
Q2FUH2_METHJ/240-319--------------------------------------------...VNI...A..VP....LRN..ITDSIRRSGE.YS
Q8RGL5_FUSNN/332-421--------------------------------------------...MNL...L.............ACDEYETIGD.YQ
A6DFF6_9BACT/119-204--------------------------------------------..................YFS..ISRTLERIAD.YF
A5LR94_STRPN/16-104--------------------------------------------...LRF...V..IS....IMS..SCSDLERMGD.HM
A0RIP2_BACAH/120-205--------------------------------------------...ITQ...I..TQ....LSF..VARYIERVAD.HI
A9KP20_CLOPH/121-206--------------------------------------------...ADS...Y..ID....ILM..IAKYMERIGD.HA
Q3R0V0_XYLFA/24-111--------------------------------------------...LRE...I..LA....GLR..IPADIERIGD.YA
D1N4D7_9BACT/120-205--------------------------------------------...YYI...S..VI....F....ISRHLERIGD.CT
Q1QLM7_NITHX/342-429--------------------------------------------...GHR...S..ME....IIA..FAINLEHIGD.II
A6GK60_9DELT/17-105--------------------------------------------...VGT...VDLIR....AIN.TATNNLERIAD.FG
Q3ATH0_CHLCH/112-197--------------------------------------------...IDQ...L..IA....SLS..ISRYIERMAD.HA
Q609Z7_METCA/24-112--------------------------------------------...LRL...V..MA....LSK..AITDLERVGD.EA
Q67RG3_SYMTH/124-209--------------------------------------------...VRP...A..VY....LLL..VAHYLERIGD.HA
A5UKP1_METS3/126-211--------------------------------------------...ALE...I..VN....IIF..IARYLERIAD.RV
A8F5R4_THELT/16-104--------------------------------------------...LRF...V..VG....SIQ..LANIFERIGD.NA
Q8EQ00_OCEIH/120-205--------------------------------------------...IEY...V..MQ....MSF..CARYLERFAD.HI
Q5V6R8_HALMA/168-260--------------------------------------------...FPL...IGYRS.........VAQDVVLMAD.TA
Q3IM37_NATPD/17-105--------------------------------------------...LRF...I..AS....TFK..IITDLERIGD.FA
A7FZ36_CLOB1/450-535--------------------------------------------...ANA...S..AI....FLD..IINNFERVGD.HC
B3EDV7_CHLL2/52-141--------------------------------------------..................ARM..IMQELERIAQ.FA
Q1AXT8_RUBXD/121-207--------------------------------------------..................MRAALIVHYLERIAD.HG
A1RZ34_THEPD/143-235--------------------------------------------..P...............YFN..YGKTLERVGD.VL
Q2RHH1_MOOTA/19-107--------------------------------------------...LRT...L..AT....VLR..VSRELERISD.YA
Q0W7U5_UNCMA/120-205--------------------------------------------...IDI...A..SH....LSF..VARYLERSAD.HA
Q8TSA7_METAC/17-105--------------------------------------------...LRL...V..VS....ALK..IAADLRRILG.LS
A1SXC2_PSYIN/130-215--------------------------------------------...IKN...C..LR....ITW..CARAFERIGD.HG
Q48XB8_STRP1/459-544--------------------------------------------...AQA...G..IN....FID..IISHYTRITD.HA
PHOU_ARCFU/109-184--------------------------------------------..................AVL..TVRHIERIGD.LL
A3IBD5_9BACI/121-206--------------------------------------------...ISQ...I..TH....LTF..ICRYLERSAD.HA
Q8FMP1_COREF/18-106--------------------------------------------...LRQ...V..VS....SIY..IVEDFSRMGA.LG
A3IBE4_9BACI/353-440--------------------------------------------...SVR...H..HT....LLT..NVRDFERIGD.HF
Q18H39_HALWD/153-237--------------------------------------------.......................IATNLEIVGD.RA
Q0TMT3_CLOP1/448-533--------------------------------------------...AYD...G..AI....FMD..LLSNFERIGD.HS
A2SSI2_METLZ/247-326--------------------------------------------...VPE...A..VA....VTQ..ITQSLHRITE.YS
Q5V0F9_HALMA/136-227--------------------------------------------...RET...V..FD....FQS..SARQLERIAD.HA
Q1K0S3_DESAC/368-455--------------------------------------------...SKE...I..SS....LMH..MVNDLEKVGD.YC
A4W1M8_STRS2/121-207--------------------------------------------...YYQ...V..LT....YL........ERVGD.YA
A6Q2I6_NITSB/16-104--------------------------------------------...LRE...L..IA....YIK..LTNEIVRVGD.YA
A8ZSJ6_DESOH/16-104--------------------------------------------...LRF...L..VV....TIK..INNDLERIAD.EA
Q2NHV4_METST/190-278--------------------------------------------............STYYLVLFR..VVKSFERIGD.IS
Q1GAD2_LACDA/16-104--------------------------------------------...LRI...I..SA....SLK..AVYDLERIGE.IG
A7HJE0_FERNB/119-204--------------------------------------------...PRL......IKRGLILLD..ISKILEEISD.FA
A1RSV4_PYRIL/142-234--------------------------------------------...PRD...I..VE....YVI..IAKSIERMAD.HI
Q92PS2_RHIME/340-427--------------------------------------------...GRR...S..IV....IID..YAINLEHMGD.II
Q39UL6_GEOMG/454-539--------------------------------------------..................IIYADMISAFAKVAD.SC
A6LSI4_CLOB8/122-207--------------------------------------------...LQE...G..TQ....LLF..VIKYLERIGD.HV
B0K446_THEPX/17-105--------------------------------------------...LRI...V..LT....GLK..IVTDLERMAD.YA
A2BLI4_HYPBU/116-197--------------------------------------------...AE..............ML..LLRHVERIAD.HA
A0LDJ6_MAGSM/127-212--------------------------------------------...VIG...A..SH....LLF..MARDMERLGD.HL
Q0A7V3_ALHEH/22-110--------------------------------------------...VAI...C..LA....LMS..VAKDAERIGD.YC
A2PVH6_VIBCL/125-210--------------------------------------------...IPH...I..LQ....VIW..SARAIERVGD.RC
Q1AX68_RUBXD/13-97--------------------------------------------..................ILQ..VVQDIEKIGN.AA
B8G920_CHLAD/123-203--------------------------------------------....TA...D..LL....FI....AHNFERVSD.RA
Q0W3W9_UNCMA/337-424--------------------------------------------..................VLLVRISSAIENLGD.AG
A5VLT3_LACRD/120-205--------------------------------------------..................YLA..VLRNLERAGD.HI
Q2RHH2_MOOTA/339-427--------------------------------------------...EQM...VAQTR....LLY..IANDLEHIGD.VT
Y2053_DEIRA/72-160--------------------------------------------...LAF...Y..LM....VFR..SLANLERVGD.YA
Q6MP49_BDEBA/19-107--------------------------------------------...LRL...I..IS....VLK..INNDLERMGD.QT
Q2FTF7_METHJ/119-204--------------------------------------------..................YVI..IDRYLERCGD.QA
Q6MP49_BDEBA/123-208--------------------------------------------...VEA...G..MD....LIL..IARNLERLGD.HA
Q9YAE0_AERPE/200-281--------------------------------------------..................LIL..FLRSLEDFSD.AA
A6P1M5_9FIRM/363-450--------------------------------------------...STQ...V..SE....LLH..TLSDFERMGD.YS
A5INX6_STAA9/348-434--------------------------------------------..................AVMFDVNRSILKVAE.LT
Q7A1Z9_STAAW/452-537--------------------------------------------...TKG...G..LL....YID..MIGVLERIGY.HS
O28477_ARCFU/135-226--------------------------------------------...YRT.................VVRTLERVAD.HA
A0LDJ6_MAGSM/24-112--------------------------------------------...LRA...T..VA....AMR..MAHHLERMGD.YT
Q6AAV0_PROAC/147-230--------------------------------------------...VES...A..VD....TAL..LGRYYERIAD.HA
Q0TTG5_CLOP1/17-105--------------------------------------------...LRN...V..YA....LST..IAMELERVGD.YS
A4FL22_SACEN/121-205--------------------------------------------...VAA...A..IN....LAL..LARFYERFAD.QA
A5V0U4_ROSS1/126-211--------------------------------------------...FDA...A..LA....SLE..ITRALERVAD.RA
Q5SM00_THET8/16-104--------------------------------------------...LRL...I..FT....VIK..ALTDLERAGD.YA
A6LEN2_PARD8/122-207--------------------------------------------...ALA...G..LY....MAG..VIRKMERFGD.HC
A8MCD0_CALMQ/253-330--------------------------------------------...MLK...AYNIT....GPLNLVIESIGRLAA.YA
A2SSH8_METLZ/116-201--------------------------------------------...IPF...G..SA....CHL..VNRYLERCGD.HA
Q3ZA57_DEHE1/17-105--------------------------------------------...LRI...I..VA....VLN..IIVDLERIGD.HA
A6FRR4_9RHOB/21-109--------------------------------------------...LRL...I..LS....VMK..IAGNLERIGD.YS
A0RXC3_CENSY/117-197--------------------------------------------............CA....LAEALLLRYLERIAD.HA
O28916_ARCFU/230-309--------------------------------------------...LEV...VQLMN....LKT..ILDSVSRVAG.YS
A6CFS1_9PLAN/358-447--------------------------------------------.......................MADEYESISD.YL
Y1732_METTH/119-196--------------------------------------------...SNR...D..FSESGNLML..VARNLLSMGH.HV
Q2Y4E8_9ARCH/231-312--------------------------------------------.........VSGTE....MRS..VIESLQRIAE.YS
Q0ASG2_MARMM/127-212--------------------------------------------...VGP...G..VH....ILF..VAKNLERIGD.HA
A2SSH8_METLZ/16-104--------------------------------------------...LRM...I..SS....CMD..IVTSSERIGR.YA
A3IMM3_9CHRO/129-213--------------------------------------------...IEP...F..LL....LAL..IIRHLERMAD.HA
Q8F0J5_LEPIN/132-214--------------------------------------------.......................LILCLERTAD.YA
Q30YR4_DESDG/121-206--------------------------------------------.........A..VH....TIL..VSRALERVGD.LS
A2REA1_STRPG/17-105--------------------------------------------...LRM...V..IT....VLK..ASSDIERMGD.HA
B2JUR6_BURP8/126-211--------------------------------------------...VSI...A..LE....YLF..IAKAMERIGD.HA
Q1K267_DESAC/120-205--------------------------------------------...VGS...SHNLEALLLWLA..VSRHMERIAD.LA
A3ZZ51_9PLAN/120-205--------------------------------------------...LDW...M..ME....MLT..ISRHVERIAD.HA
Q8FMP1_COREF/123-206--------------------------------------------...TRE...A..VD....MAL..LSRFYERYAD.HT
Q0W7U5_UNCMA/17-105--------------------------------------------...LRF...I..ST....VLK..ILTECRRFSR.LA
Q9UZU5_PYRAB/16-100--------------------------------------------...LRF...I..QG....ALD..TSYDLYRISR.YA
A6UUI6_META3/119-204--------------------------------------------...TSK...V..TE....IIF..VGKYLERNGN.LI
Q2FTF7_METHJ/16-104--------------------------------------------...MRE...I..VA....SLR..IIYNFERIGR.MG
Q1NKG6_9DELT/478-564--------------------------------------------..................YLD..LLNRLEKIGD.HV
A3DN11_STAMF/248-325--------------------------------------------.......................ILDSIRRIKA.YS
A3CVF4_METMJ/140-231--------------------------------------------.........GIPATRAAYCFQ..VSRIIERIAD.HA
Q7A5Q4_STAAN/19-107--------------------------------------------...LRM...M..IS....SLK..IASDLERIGD.NA
Q18H40_HALWD/245-326--------------------------------------------..................YVLGLLLDSLKRSAE.YG
Q1IMC8_KORVE/119-204--------------------------------------------...TRY...S..LD....VLL..IARNLERIAD.HA
Q5HG35_STAAC/121-202--------------------------------------------........................ARHLERIGD.HI
Q251M5_DESHY/359-447--------------------------------------------...SDQ...R..YR....VLQ..VIGDMERVGD.HS
A3ER26_9BACT/16-104--------------------------------------------...LRF...I..IT....AMK..IITDLERMSD.LA
A4A3L4_9GAMM/129-214--------------------------------------------...IDG...V..VH....EMW..ALRGLERVGA.HA
A3DLY8_STAMF/20-104--------------------------------------------..................VYR..MANALDKLSD.SA
B4SH22_PELPB/118-203--------------------------------------------...IEQ...L..IA....VLS..VSRYLERIAD.HA
Q186T5_CLOD6/447-532--------------------------------------------...IDA...G..VL....YLD..LLTNLERISD.HS
B1YLB2_EXIS2/122-207--------------------------------------------...VDE...I..MQ....FTN..ICRYIERMGD.HL
A1RZ38_THEPD/253-333--------------------------------------------...PEE...I..LA....VRL..MVGSYRRIFD.YS
Q3IM38_NATPD/147-240--------------------------------------------...AGR...R..TV....FTQFRVARQLERIAD.HA
O27757_METTH/89-175--------------------------------------------............MA....FTE..IAYDLERIGD.HS
Q53W26_THET8/300-379--------------------------------------------.........TPALP....LLK..AASELEHLAD.LA
A3CVT1_METMJ/216-300--------------------------------------------..................LLY..MSSFAQAISD.SA
Q834B5_ENTFA/121-206--------------------------------------------...VIS...G..TD....YLH..VAQYLERIGD.YV
A4IQY4_GEOTN/16-104--------------------------------------------...LRR...I..VA....AIK..IASDIERIAD.FA
A0NJJ5_OENOE/131-216--------------------------------------------..................YLV..VVGYLKRTAD.HA
A3CRL4_METMJ/338-425--------------------------------------------...ATE...V..VF....LVR..MSNEIERLGD.LG
Q9YA54_AERPE/253-331--------------------------------------------...GSL...L........RYL..VIDSMRRITG.YS
Q0YRH7_9CHLB/17-105--------------------------------------------...LRT...I..VT....IMK..INDDLERIGD.LA
Q74KF7_LACJO/16-104--------------------------------------------...FRN...V..IS....ILK..ATNDLERIGE.NA
A8AA37_IGNH4/119-200--------------------------------------------...VPC...A..VV....EAL..SIKFLERAAD.HS
Q6G4T5_BARHE/125-210--------------------------------------------...ITV...C..TH....LLF..CIKNIERIGD.HV
A9BHU2_PETMO/25-113--------------------------------------------...LKA...C..FM....SSK..LVQIFENMGD.IC
Q2LUX4_SYNAS/355-442--------------------------------------------...SRT...L..FN....YTA..MVDDIERIAD.HA
Q4FLF7_PELUB/22-110--------------------------------------------...LRL...T..IS....TLK..ISSDLERIGD.LA
A0RXC3_CENSY/16-103--------------------------------------------...FRL...V..RS....SIE..ISYAYSRFGR.YA
A5ILH4_THEP1/119-204--------------------------------------------...MES...PKYVKRALLLLE..IAGNIEIIAD.YA
A6LP09_THEM4/121-202--------------------------------------------...IDE...L..IL....NIL..IARDLERIGD.HL
Q2S080_SALRD/18-106--------------------------------------------..................IMAVKINTDFERIGD.HC
A9BNX0_DELAS/469-555--------------------------------------------..................SLHIDLISDLKRINS.LL
Q9YAE0_AERPE/15-99--------------------------------------------..................IVE..LAAAFDRASD.AA
Q5WET9_BACSK/17-105--------------------------------------------...LRR...L..IV....VMK..MAGDLERVAD.FA
A5ZNC6_9FIRM/16-102--------------------------------------------...LRE...V..SA....ALK..MISDMERIGD.QA
A0LAE5_MAGSM/412-500--------------------------------------------..................LVN..AVDALENIGDIIE
A6CFS1_9PLAN/465-550--------------------------------------------...PYI...N..VS....YTS..TLNALRRVRD.HV
A6DAS5_9PROT/94-175--------------------------------------------.......................IAKKLERISD.SV
B8G180_DESHD/18-106--------------------------------------------...LRK...I..VA....AFK..ISINLERIGD.LS
A4IQY4_GEOTN/119-204--------------------------------------------...LAQ...M..NV....LAL..VARYMERTAD.HA
Q8TX17_METKA/93-179--------------------------------------------..................LLE..ISHCIERIGD.YA
Q2NHW3_METST/123-208--------------------------------------------...INT...L..VP....FLL..IARYLERIAD.RS
A5G3F8_GEOUR/471-558--------------------------------------------..................LLYGDIIAAFTKIAQ.MS
A4FX70_METM5/17-105--------------------------------------------...LRE...M..IT....MIK..IISKLEKVGD.MA
PHOU_METTH/21-109--------------------------------------------...LRF...I..EA....CIK..VGSHLKRIGY.LA
Q662X1_BORGA/126-211--------------------------------------------..................ILF..LNSFLERVGD.HV
A1VDV5_DESVV/122-207--------------------------------------------...MER...A..LS....FLI..MARRLERIAD.LA
Q0PIQ4_DESVU/19-107--------------------------------------------...LRT...V..IA....TMR..TSNDVERIAD.EA
Q8PZB8_METMA/122-207--------------------------------------------...ISR...A..TY....LLF..LIRYIERIAD.HC
Q9CEW9_LACLA/121-206--------------------------------------------...VTT...G..KE....YLL..TLVYLERITG.YA
B9LHB3_CHLSY/122-207--------------------------------------------...FEA...A..LD....LLD..MVHALERTAD.RA
A5D1M0_PELTS/120-205--------------------------------------------...AEM...A..IQ....LLF..AGHCLERIAD.HA
Q2RHH2_MOOTA/445-531--------------------------------------------..................SVHMELINHLLRLNI.HN
Q9YG50_AERPE/17-103--------------------------------------------...LLE...A..KS....LIR..TSYDLYRIAR.YC
A9B5P2_HERA2/131-216--------------------------------------------...AAA...T..IH....LLT..LAHNLERLGD.RV
A4YI56_METS5/245-324--------------------------------------------..................LLL..ITDSFRRISR.YS
Q47KT1_THEFY/132-215--------------------------------------------...VEA...T..MD....VTL..AGRFYERFGD.HA
E0THQ4_PARBH/20-108--------------------------------------------...LRR...A..MT....AIK..IAAEMERIGD.LA
Q6D018_ERWCT/339-425--------------------------------------------...SRR...W..AE....VIE..VALNLEQAGD.II
Q5Z0T5_NOCFA/22-110--------------------------------------------...LRH...V..VT....AMQ..IADQLSGIGT.LT
A4E7E4_9ACTN/16-104--------------------------------------------..................IIY..VDFNLQRMTD.KV
PHOU1_THEMA/18-106--------------------------------------------...LRY...I..IT....ILK..FSNDLERIGD.LS
PHOU_AQUAE/117-202--------------------------------------------...IKR...A..MH....LSF..VARHYERIAD.HA
A6UVP6_META3/82-166--------------------------------------------.....Q...S..MR....LSV..IAANIERCGD.YI
A5Z3H1_9FIRM/450-535--------------------------------------------...IEA...G..LI....FTD..LVIGLERIAD.HA
A7H7E1_ANADF/124-209--------------------------------------------...IRR...A..TS....LMF..AAKHLERFGD.HA
A5Z3H1_9FIRM/345-432--------------------------------------------...RER...L..GG....LFH..VVIDVERIGD.HA
A3CXV2_METMJ/119-204--------------------------------------------...ITQ...C..TN....YVM..IARYLERCGD.HA
Q1K0S3_DESAC/473-558--------------------------------------------...VTP...G..LI....FID..MLHNFEKIGD.HT
B4S7F4_PROA2/163-246--------------------------------------------...ITN...F..TG....ILS..VVEHVKMSAD.IS
A9B5P2_HERA2/20-108--------------------------------------------...LRL...V..SV....VLS..LLPELERMGD.YA
Q5V0G4_HALMA/118-213--------------------------------------------...VEQ...L..LDDVSRLLL..TVRDLERVGD.HA
A7I9M4_METB6/16-104--------------------------------------------...MRT...I..VC....SLK..MIAASERIGR.YG
A8MCD0_CALMQ/144-239--------------------------------------------...LLS............CLL..VSKSLERSGD.HS
Q8TX17_METKA/194-284--------------------------------------------...ADR...L..FG....LSR..ITKDIERIAD.KA
B8CZG2_HALOH/119-206--------------------------------------------...INQ...V..IQ....FLN..IAKSLERIGD.HA
A8MBU9_CALMQ/146-238--------------------------------------------...PRT...I..LD....YAL..INKSLERLSD.HI
A7VHC0_9CLOT/360-447--------------------------------------------...SKR...V..SN....GLH..CIGDLERISD.HA
Q0RZA9_RHOSR/121-204--------------------------------------------...VTA...A..VD....ATL..LGRFYERFGD.HT
Q3A1F9_PELCD/468-553--------------------------------------------..............PGLWYID..IMAYLERIGG.YC
A3ZZ51_9PLAN/16-104--------------------------------------------...LRF...V..IT....VQT..VINELERIGD.QA
A4J4V6_DESRM/467-552--------------------------------------------...GAE...G..SV....FLD..LLSNMERIGD.HS
Q4KBC7_PSEF5/340-427--------------------------------------------...ADR...S..QE....ILL..LVINLEHAGD.IL
Q6ADH5_LEIXX/144-227--------------------------------------------...GQA...VDTVD....ATL..ASRYHERFAD.HA
Q1WUX0_LACS1/120-205--------------------------------------------...AEE...G..ID....YLS..IIAHIKRIND.YI
Q0F0C9_9PROT/122-207--------------------------------------------...ITS...G..LL....AYS..IGKNLERIGD.HA
Q2YM24_BRUA2/348-436--------------------------------------------..................LLG..ACVKLEQVGDIIV
Q6XYS9_SPIKU/16-104--------------------------------------------...LRR...I..VG....FIL..IVKEVERIAD.YA
A5KMQ5_9FIRM/453-538--------------------------------------------...PQS...G..IV....FSE..ILTDFERMGD.HA
B8CZG2_HALOH/16-104--------------------------------------------...VYN...N..VA....LVK..IAGDLERVGD.LA
A6GE05_9DELT/129-214--------------------------------------------...VAV...G..IR....VQE..AGRLLERMGD.HA
A8MGX2_ALKOO/16-104--------------------------------------------...LRS...V..GT....LLK..IITDMERIGD.YG
A5UQ39_ROSS1/16-104--------------------------------------------...LRS...L..LA....AIA..IAGELERAAD.YA
A4YI56_METS5/143-234--------------------------------------------...ATQ...I..VD....IYS..AVKSIERIAD.HA
Q05HF3_UNCMA/14-101--------------------------------------------...LRV...V..LG....TYR..MIVDLEHIGD.YS
A7HJE0_FERNB/16-104--------------------------------------------...LRF...I..FG....SVL..VAKVLLDISS.RL
Q3IX36_RHOS4/343-430--------------------------------------------...VRR...A..NE....ITS..FAINLEHMGD.II
O28086_ARCFU/211-297--------------------------------------------..................IVE..IAYCSELIAD.AA
A0B6T7_METTP/241-325--------------------------------------------...MRM...V.............ISSSIARFLD.HI
A3ZXF3_9PLAN/119-204--------------------------------------------...IEP...G..LH....CFS..ASRHIERIAD.HA
A5G3F8_GEOUR/366-453--------------------------------------------...AVE...I..PT....MIQ..IINELEHIGD.QS
A7LS25_BACOV/16-104--------------------------------------------...LRF...V..LA....MLK..INTNLERLGD.FA
Q8U240_PYRFU/93-170--------------------------------------------....VE...A..L..........IMRHLERISD.HA
A1UU23_BARBK/21-109--------------------------------------------...LRE...I..VG....AIR..ISSDLERIGD.MA
Q2SS07_MYCCT/120-207--------------------------------------------...IAA............VLK..QLFNLERAGD.HL
A0RA51_BACAH/351-438--------------------------------------------...SEK...H..SV....LAG..VVGDIERVGD.HV
A8ZSJ6_DESOH/119-205--------------------------------------------...TEY...L..LN....MFL..ISRHLERIAD.HA
Q6F1N0_MESFL/119-206--------------------------------------------...ISE............AMK..QAKNLERAGD.HL
Q2LUX4_SYNAS/460-545--------------------------------------------...AES...G..PI....FIE..LLIQLERISD.HC
A5URZ8_ROSS1/121-206--------------------------------------------...VAW...N..AG....LLF..AAHYLERVAD.RA
Q2Y4E6_9ARCH/245-318--------------------------------------------...IEI.................ILDSFNRISD.YA
Y409_MYCGE/126-215--------------------------------------------...VTERIFL..ID....LVA..SVKHIERIND.YC
A0RXQ8_CENSY/138-229--------------------------------------------..................LDYRMAANLLEGAGD.AV
Q3A1F9_PELCD/363-450--------------------------------------------..................FFR..MANNFEKIGD.AV
A5EXS4_DICNV/20-109--------------------------------------------...LRF...I..TA....CDR..IATDLERIGD.EN
B2JUR6_BURP8/21-109--------------------------------------------...LRL...L..MA....MSK..CVTNLERMGD.EA
Q31I87_THICR/133-218--------------------------------------------....CL...MEMII.........ALRAAERVSD.HA
A6GWK5_FLAPJ/140-225--------------------------------------------...VGS...G..TN....LIL..ALKHLERIGE.HC
B8G180_DESHD/121-206--------------------------------------------...INQ...A..TY....LIF..VGRFLERMGD.YC
Y409_MYCGE/20-112--------------------------------------------..................IIM..SSRDLERICD.YA
A6Q2I6_NITSB/121-210--------------------------------------------...LTD...F..LN....VLS..SCRKLERTAD.RA
Q3IUH9_NATPD/24-108--------------------------------------------..................VLG..IVAGADHVSD.AA
Q8PZB9_METMA/245-322--------------------------------------------.........SRNIA....LSM..ILESLRRVAE.YS
A9KP15_CLOPH/357-444--------------------------------------------...SNS...V..SM....FLH..SIGDLERISD.HA
Q1IMC3_KORVE/122-205--------------------------------------------..................FHVVFMTQALERAGD.HV
B2JC47_BURP8/341-428--------------------------------------------...SRR...W..TD....IIA..LTINLEHAGD.II
Q03GY8_PEDPA/120-205--------------------------------------------...VTG...G..AG....YLM..VANYIERIGD.HV
A6VG44_METM7/121-206--------------------------------------------...ISE...A..SD....FIV..VGTYLERVGN.SC
A4G2G4_HERAR/21-109--------------------------------------------...LDE...V..LA....ELR..IVEDLERIGD.LA
A6LN86_THEM4/16-104--------------------------------------------...LRM...V..TG....SFV..ISSYFQDISE.KT
A5ZVN9_9FIRM/463-548--------------------------------------------...CGL...EEGTV....FND..ILNSFGRIAA.HS
Q879I2_STRPQ/323-410--------------------------------------------...NEV...L..AG....ILD..SSRDLERIGD.HS
Q4FLF7_PELUB/125-210--------------------------------------------...LDL...A..TH....LLF..VTKNIERAGD.HI
A5KLQ2_9FIRM/351-438--------------------------------------------...HQH...V..AS....LLQ..IVSDIERISD.YC
Y1641_METJA/186-266--------------------------------------------..................VQFGMFLKDIERFGD.RC
A6BD84_9FIRM/463-548--------------------------------------------..................FTN..ILHLIDRMGN.SC
A5ILH4_THEP1/16-104--------------------------------------------...IGK...P..LLTVTAGIR..VAELIENIAD.KC
A9A622_NITMS/148-240--------------------------------------------.......................VVKNIERTGD.HA
PHOU_DEIRA/16-104--------------------------------------------...LRL...V..AL....ILK..SLSDIERMGD.YV
O29778_ARCFU/134-226--------------------------------------------...LRF...L..LG....SRI..IAKFYEEIAD.TL
C0A5V8_9BACT/119-205--------------------------------------------...ITR...A..LE....LMF..ISKSIERIAD.HA
A8F5R4_THELT/118-203--------------------------------------------...IEK...N..ML....LAE..IAQRIEEIAD.LS
Q11NF9_CYTH3/120-207--------------------------------------------...VLQ...A..VY....LLS..MIRKTERVGD.YI
Q5V3U8_HALMA/140-232--------------------------------------------...LNDGFPL..IG....YRS..IAKNLELTAD.NA
O28916_ARCFU/135-220--------------------------------------------...AVD...A..MN....YRS..VVRNLERVSD.HI
A4WI32_PYRAR/111-191--------------------------------------------.......................VLRLLERASD.HA
A4J4A5_DESRM/448-534--------------------------------------------...ERT...S........FSHMELINCYIRMSE.HL
A5UMQ1_METS3/7-91--------------------------------------------..................LLE..VAEAAESIAN.AA
A5WHR5_PSYWF/22-110--------------------------------------------...LRL...I..MA....LSK..GVVDLERIGD.EA
Y2861_DEIRA/125-208--------------------------------------------...AAL...ADTLE....ASH..AWRAAERLGD.HL
A8AA77_IGNH4/213-294--------------------------------------------.......................LVRSLEKMTD.AA
A3DLZ0_STAMF/247-329--------------------------------------------............ISDQEKIVLTMVFDSLRRITR.YS
A1S0L5_THEPD/137-223--------------------------------------------..................LDMRLTAKNLENLGD.SY
A4J4V6_DESRM/359-449--------------------------------------------...SKY...A..ST....LLQ..AVNDLERIGD.HA
A0B6T8_METTP/129-214--------------------------------------------...MDQ...T..IP....LLM..VNRHIERIGD.HI
Q0BUY2_GRABC/490-575--------------------------------------------..................YLD..VLRDLKLMNT.HL
A4X1M0_SALTO/17-105--------------------------------------------...LRL...V..LC....AIR..IAADLERMGD.LA
Q8F0J5_LEPIN/12-116--------------------------------------------RDPLRF...A..LS....AIR..ITRNLERMGD.QI
Q2S5E3_SALRD/191-276--------------------------------------------...AEV...A..AH....LIT..ASKAIERISD.HS
A5UKP1_METS3/22-110--------------------------------------------...LMY...I..ES....SIR..VISHVKRIAY.LC
Q971H7_SULTO/145-236--------------------------------------------....QL...IGNRI.........LIKAIEEAAD.EI
Q8FZK0_BRUSU/454-540--------------------------------------------..................SIHLDTIRDLKQINS.LL
A6GWK5_FLAPJ/37-125--------------------------------------------...LRF...I..IS....AMQ..ISSEIERIGD.LA
Q30PB9_SULDN/121-210--------------------------------------------..................VLG..SLRKLERSCD.RS
Q8TWZ7_METKA/17-101--------------------------------------------..................IME..LTQSMEVITD.AA
Q9YA54_AERPE/147-239--------------------------------------------...PAE...I..VH....LFL..AVKSIERVAD.HA
Q6WB50_ALCFA/125-210--------------------------------------------...LTQ...L..LF.........CAKGLERIGD.HV
A4ANM1_MARSH/120-205--------------------------------------------............IKEALFLFS..VIKKLERVGD.LI
Q896W9_CLOTE/342-429--------------------------------------------...IDV...V..TS....MFR..VVKDIERIGD.HG
Q1J0M9_DEIGD/118-204--------------------------------------------...TEV...A..LM....AQR..MARSLERLGD.HL
A5LNQ6_STRPN/118-204--------------------------------------------..................ALD..IIHHLDKIAH.TT
A3CVF4_METMJ/247-326--------------------------------------------.........A..IP....TGQ..IADSIRRIGE.YS
A7IB03_METB6/247-326--------------------------------------------.........A..IS....VGY..ISESIRRAGE.YS
A8DJW4_9BACT/17-106--------------------------------------------...LRF...V..IG....VIR..TAPMIERIAD.HA
A6UVP6_META3/180-262--------------------------------------------..................IQFGMFLKDIERFGD.RC
A3JY90_9RHOB/333-420--------------------------------------------...SRR...A..IA....VVD..YVINLEHVGD.IA
Q186T5_CLOD6/342-429--------------------------------------------...RFR...T..DL....LFN..TVNDIERVSD.HA
A3WCP8_9SPHN/123-208--------------------------------------------...ISS...A..AQ....LLF..VARNLERIGD.HA
A0JSV0_ARTS2/16-104--------------------------------------------...LRM...I..VG....SLR..MSASLERMGD.LA
Y1732_METTH/20-108--------------------------------------------...LRL...A..SS....IMR..SAIELERINI.LL
A6TML5_ALKMQ/448-533--------------------------------------------...PGS...G..VV....FLD..IISNLERIGD.HS
A9A9E5_METM6/23-112--------------------------------------------...LKI...V..MS....IIK..ILTKFKEIRN.IA
Q0SPC2_BORAP/17-106--------------------------------------------..................IIK..IISSLERIAD.HA
A6NWS5_9FIRM/352-439--------------------------------------------...SAA...V..SA....YFK..ITGNIERIGD.HA
Q180A4_CLOD6/120-205--------------------------------------------...IDQ...G..VK....LLL..IGRYLERIGD.HI
A4G2G4_HERAR/125-210--------------------------------------------...VVG...L..VH....LLF..CAKNIERIAD.HA
Q05HF3_UNCMA/116-201--------------------------------------------...STN...I..IY....LIM..AARALERIGD.HI
A3DLZ0_STAMF/142-234--------------------------------------------...YRI...L..............ARNLERIAD.HA
A9AVN3_HERA2/16-104--------------------------------------------...LRV...V..SM....FLE..LASELERIGD.YA
Q5V0G5_HALMA/139-228--------------------------------------------..................LWG..TANELERVAD.HA
A6LGP6_PARD8/360-451--------------------------------------------...IRI............MLR..AVSEIESIAD.SC
Q30PB9_SULDN/16-104--------------------------------------------...LRF...L..IT....FLK..MTNELISIGG.GV
A1APX2_PELPD/349-436--------------------------------------------...SFQ...I..PG....LLQ..MVTDLEKIGD.CC
O57974_PYRHO/11-95--------------------------------------------..................VIE..MANINEQISD.SA
A0PXY5_CLONN/341-428--------------------------------------------...SEL...I..TS....LFH..VVSDIERIGD.HA
Q31I87_THICR/25-113--------------------------------------------...LRL...I..LA....AIR..IAIDLERMGD.EV
A3DN16_STAMF/122-203--------------------------------------------...ATK...T..I..........LARHIERIGD.HA
Q73LA1_TREDE/351-442--------------------------------------------...VRL............MLG..IVDDIENMTD.QI
A3ER26_9BACT/119-204--------------------------------------------...TSP...V..IR....LLF..VGRSLERFAD.HA
A1RUP2_PYRIL/16-99--------------------------------------------...LRF...L..KS....ALF..ISYDLYRIAR.YA
Q5UZI8_HALMA/218-302--------------------------------------------..................LVH..LARSTEVISD.AA
A9BNX0_DELAS/363-450--------------------------------------------...GQR...W..TE....IIS..FTINMEQIGD.II
A9KRG9_CLOPH/120-205--------------------------------------------...LKQ...G..TK....LLF..LGRYLERIAD.HS
Q4J8G9_SULAC/246-327--------------------------------------------..................TLI..VLDSIRRVTR.YS
Q9YG50_AERPE/119-200--------------------------------------------...VD..............LL..IVRHLERIAD.HA
Q12XW7_METBU/17-105--------------------------------------------...LRL...I..TA....SYK..IAIDLERMSD.FA
A6GE05_9DELT/24-112--------------------------------------------...LRL...L..TR....ALK..MVTDIERIGD.LA
B8I417_CLOCE/120-205--------------------------------------------...VEQ...A..TD....YMF..VVKYLERIGD.HA
A7VDA3_9CLOT/469-554--------------------------------------------..................LVD..ILTSLDRIGS.HC
A6DFF6_9BACT/16-104--------------------------------------------...LRE...V..IS....FLK..INNDLERVGD.LC
A5ZXG9_9FIRM/464-549--------------------------------------------...IEM...G..FI....LTD..LLTSLERIAD.HC
Y2861_DEIRA/23-111--------------------------------------------...LKL...T..LL....ILQ..STPDLERAGD.YA
A7VSN0_9CLOT/344-431--------------------------------------------...RQA...L..GS....MYH..VISDMERIGD.HS
A7VSN0_9CLOT/449-536--------------------------------------------...VVA...G..TV....FMD..MLTNLERIAD.HC
A9KNL1_CLOPH/461-546--------------------------------------------...AET...G..MI....FSD..LLSNLERVAD.HG
A3KAI2_9RHOB/452-538--------------------------------------------..................NMHQECLRLLKQINT.SF
A3DLY8_STAMF/215-297--------------------------------------------............TG....LLS..FVISMENVAD.AA
Q8PZB9_METMA/140-232--------------------------------------------...PQD...C..LG....YRL..ITKSIERMGD.HA
Q1NQ35_9DELT/126-211--------------------------------------------...HAY...L..AK....LIG..VARSLERIAD.HC
A7AA41_9PORP/470-557--------------------------------------------..................YMD..IIGEAEKLGD.YV
Q8PUH1_METMA/112-203--------------------------------------------...FRM.................AAGPIERIAD.HS
O29464_ARCFU/138-228--------------------------------------------...LRL...I..LG....IRT..VAKLIEEIAD.SL
Q03YL4_LEUMM/120-205--------------------------------------------...VDS...A..AD....YLV..IAGYLKRIGD.YT
A0L7V8_MAGSM/21-109--------------------------------------------...LRR...V..VS....IMK..TATDLERMGD.LS
Q97CB8_THEVO/140-221--------------------------------------------...DSN......VF....MLV..LSRILERMAD.HT
A5ZVN9_9FIRM/358-445--------------------------------------------...TTQ...V..SL....YLH..TINDFERIGD.HA
Q6F1N0_MESFL/18-106--------------------------------------------...LRL...A..VG....GIL..LAREIEIIAD.YS
A4FWX8_METM5/180-263--------------------------------------------..................IQFGMFLKDVERFGD.RS
A8AA77_IGNH4/19-103--------------------------------------------..................ALR..LGMSMDLATE.AA
A3KAI2_9RHOB/346-434--------------------------------------------..................LVT..VANGLEEAADRIA
A3DN11_STAMF/143-235--------------------------------------------...LPE...A..LY....MII..SVKSIERIAD.HA
Q0BUY2_GRABC/384-472--------------------------------------------..................ILS..FGTNIENAGDVIE
A7VZ22_9CLOT/17-105--------------------------------------------...LRV...I..AS....CLK..IITDVERVAD.QC
Q8YNR1_NOSS1/26-114--------------------------------------------...LRC...L..SA....FMQ..LVRDLERIGD.YA
A5GUB9_SYNR3/26-114--------------------------------------------..................YMH..CLRDLERFGD.YC
A3IBD5_9BACI/18-106--------------------------------------------...LRR...L..MV....LVK..AAADMERVGD.YA
Q31LX7_SYNE7/130-214--------------------------------------------...LEA...T..VL....LVL..VIRHIERMAD.HA
Y1641_METJA/88-172--------------------------------------------.....Y...A..NA....LAT..IASNLERLGD.YI
Q8TR05_METAC/238-318--------------------------------------------.........SHETM....ISLGMIVDSLSRIGD.LG
A1WT64_HALHL/126-210--------------------------------------------.......................LARHYKRVAA.HL
Q975R4_SULTO/114-201--------------------------------------------.....F...M..ML....TKD..IGDRLEDCAD.LL
A2BIZ3_HYPBU/172-264--------------------------------------------.........LGSAAEAGLILM..ASKHVERAGD.HV
PHOU_STRR6/119-204--------------------------------------------..................YLY..IIGHLERFAD.YI
A4X1M0_SALTO/122-204--------------------------------------------...VES...A..ID....LAL..VGRYYERYAD.HA
A0P428_9RHOB/114-199--------------------------------------------...RSP...ADIAN....SLL..VASEFQRMGE.SL
A5KMQ5_9FIRM/348-435--------------------------------------------...SRK...I..NG....YYA..IISNLERIGD.HA
A6BD84_9FIRM/357-445--------------------------------------------...................MY..ILSDVERMGT.LS
Q8G3U8_BIFLO/16-104--------------------------------------------...LRV...V..VS....TMR..LASTFERMGD.LA
A1A0C8_BIFAA/129-212--------------------------------------------.........L..ID....VVL..IGRFMERLGD.HA
Q2FUH2_METHJ/133-224--------------------------------------------...ISE...M..LP....HFQ..VARIIERVGD.HS
A8F7W8_THELT/123-210--------------------------------------------...MRL...Y..LE....EAF..LIRHLERIAD.HL
Q1IMC8_KORVE/16-104--------------------------------------------...LRF...I..LA....VVK..INADLERVGD.QA
A3DJ80_CLOTH/353-440--------------------------------------------...TTE...A..AK....LLF..LIGEFERIAD.YA
A8F7W8_THELT/19-107--------------------------------------------...LRF...V..VA....MIG..LSVDLERIAD.EC
A5UKP6_METS3/187-276--------------------------------------------..R.........SNYFMYLFR..VVKAFERIGD.IS

PF01865

Y1799_ARCFU/7-225ARASDRFRIMILG
PITX_RHIME/3-212EDVANEISGIVIE
Y1389_PYRHO/1-210EDASDQIMLIAIK
Y629_METJA/7-212EDVADELHIIYLH
Y691_CHLTR/4-223EKLAYRVSMTLEE
Y637_PYRHO/7-226KDTAERIRVLMNK
Y1603_HAEIN/6-225QRVGSRIELMLAR
Y1689_METTH/2-214EDASDRALIIIAK
Y2149_ARCFU/6-209EDAGDTIQVLSVS

PF01895

Q9WWA8_AGRRK/446-532TSVAHPI------
Q03SN9_LACBA/120-205TNVCEWI------
Q3K4F6_PSEPF/130-215RNISELV------
A3IBE4_9BACI/458-543VNIADSI------
Q0C0L6_HYPNA/20-108KNIAKRA------
A9A7B7_METM6/344-431EDIADHA------
Q1AXT8_RUBXD/17-105EHICHAV------
Q9HS09_HALSA/241-324GNIAETA------
Q2NHW3_METST/19-107FNMAEIA------
Q14PE5_SPICI/124-211INIAETL------
Q3DDJ5_STRAG/121-206VNIAKWV------
A1RZ38_THEPD/147-240ASIAQAL------
C0AA68_9BACT/341-428KHLCDLV------
A3DN16_STAMF/16-108GEISRID------
A4TA42_MYCGI/121-204VEIACRV------
Q7WH04_BORBR/20-108EKIATAV------
Q3A6T9_PELCD/117-202TNIAEDT------
Q2RNF7_RHORT/37-125ANAAKRG------
A1VPD2_POLNA/21-109AKIARMV------
A6UJ27_SINMW/347-434SKTLVEI------
Q609Z7_METCA/131-216ENLAEYV------
Q8Y4F0_LISMO/121-206TNVCEWI------
A3SW68_9RHOB/125-210TSIAEQV------
A7VHC0_9CLOT/465-550SNVAASL------
A7NGW7_ROSCS/12-100KQVAERV------
A9A7B7_METM6/449-534VKIATGL------
Q0W1F8_UNCMA/244-323CNIAEIA------
Q8TLE8_METAC/137-228VKIVHDL------
Q9V263_PYRAB/138-231IRIAENP------
Q7WTY2_MYCSM/16-104LHVAKIA------
Q1Q2E1_9BACT/157-242TNIAERT------
A0NT92_9RHOB/344-431AKNLLEL------
Q5WET9_BACSK/120-204TNLSEWI------
Q6AM12_DESPS/122-207TNIAEEV------
Q2FUH2_METHJ/240-319ADIAENV------
Q8RGL5_FUSNN/332-421NRIANRL------
A6DFF6_9BACT/119-204TNICEDI------
A5LR94_STRPN/16-104AGIAKAV------
A0RIP2_BACAH/120-205TNIAENV------
A9KP20_CLOPH/121-206VNICEWT------
Q3R0V0_XYLFA/24-111ANVAKRS------
D1N4D7_9BACT/120-205TNICEDV------
Q1QLM7_NITHX/342-429DKNLSEL------
A6GK60_9DELT/17-105VNIVGQL------
Q3ATH0_CHLCH/112-197VSIANEV------
Q609Z7_METCA/24-112VKIASCV------
Q67RG3_SYMTH/124-209TNLGEWT------
A5UKP1_METS3/126-211VNIGERV------
A8F5R4_THELT/16-104RRISQIT------
Q8EQ00_OCEIH/120-205TNIGESI------
Q5V6R8_HALMA/168-260VEIASLA------
Q3IM37_NATPD/17-105TNLAGYA------
A7FZ36_CLOB1/450-535TNIAQTV------
B3EDV7_CHLL2/52-141LNIAEKA------
Q1AXT8_RUBXD/121-207VDIGALT------
A1RZ34_THEPD/143-235VSIARAL------
Q2RHH1_MOOTA/19-107VNIAEAA------
Q0W7U5_UNCMA/120-205CVIASWT------
Q8TSA7_METAC/17-105INIAKIP------
A1SXC2_PSYIN/130-215KNICEYV------
Q48XB8_STRP1/459-544LNLAEKV------
PHOU_ARCFU/109-184AKIAARQ------
A3IBD5_9BACI/121-206TNIAEHL------
Q8FMP1_COREF/18-106MHVASAA------
A3IBE4_9BACI/353-440ENILELL------
Q18H39_HALWD/153-237CFIADVV------
Q0TMT3_CLOP1/448-533TNIAESV------
A2SSI2_METLZ/247-326SDIAEIL------
Q5V0F9_HALMA/136-227TKIASLS------
Q1K0S3_DESAC/368-455ENLWELG------
A4W1M8_STRS2/121-207KNICEWV------
A6Q2I6_NITSB/16-104KSYAKNM------
A8ZSJ6_DESOH/16-104VNIAQRV------
Q2NHV4_METST/190-278IEITEAT------
Q1GAD2_LACDA/16-104ADIADLV------
A7HJE0_FERNB/119-204VQIIEIT------
A1RSV4_PYRIL/142-234CRIAYVS------
Q92PS2_RHIME/340-427EKGLCEQ------
Q39UL6_GEOMG/454-539LTIIETR------
A6LSI4_CLOB8/122-207TNICEWT------
B0K446_THEPX/17-105VDIAKTT------
A2BLI4_HYPBU/116-197VYIAAEA------
A0LDJ6_MAGSM/127-212TDVVEDI------
Q0A7V3_ALHEH/22-110KNVFEIG------
A2PVH6_VIBCL/125-210QNICEYI------
Q1AX68_RUBXD/13-97YDIAKIV------
B8G920_CHLAD/123-203LNMAEKM------
Q0W3W9_UNCMA/337-424EDVGSLA------
A5VLT3_LACRD/120-205VNLAEWI------
Q2RHH2_MOOTA/339-427VEMARQW------
Y2053_DEIRA/72-160FSVARDL------
Q6MP49_BDEBA/19-107VNISYSG------
Q2FTF7_METHJ/119-204CNIAEMT------
Q6MP49_BDEBA/123-208TNIAEDV------
Q9YAE0_AERPE/200-281ARAAGLV------
A6P1M5_9FIRM/363-450VNISESA------
A5INX6_STAA9/348-434EEYVAQL------
Q7A1Z9_STAAW/452-537RNVSEAL------
O28477_ARCFU/135-226ANMAESL------
A0LDJ6_MAGSM/24-112KDVARRI------
Q6AAV0_PROAC/147-230VAVGSRV------
Q0TTG5_CLOP1/17-105VNIAMET------
A4FL22_SACEN/121-205VSVARRL------
A5V0U4_ROSS1/126-211TNIAERT------
Q5SM00_THET8/16-104MHVAEDA------
A6LEN2_PARD8/122-207TNIAEEL------
A8MCD0_CALMQ/253-330YDIAEIT------
A2SSH8_METLZ/116-201CRMAEKV------
Q3ZA57_DEHE1/17-105EGNAKIA------
A6FRR4_9RHOB/21-109KNMAKRT------
A0RXC3_CENSY/117-197LFMSDAV------
O28916_ARCFU/230-309ADIAEVV------
A6CFS1_9PLAN/358-447QRIAKFR------
Y1732_METTH/119-196MGMDDRI------
Q2Y4E8_9ARCH/231-312ADIAEVS------
Q0ASG2_MARMM/127-212TNIAEAV------
A2SSH8_METLZ/16-104KDITELV------
A3IMM3_9CHRO/129-213TNIAQRV------
Q8F0J5_LEPIN/132-214VNIAEEL------
Q30YR4_DESDG/121-206TNIAEAV------
A2REA1_STRPG/17-105ASIAKAT------
B2JUR6_BURP8/126-211KNIAEFV------
Q1K267_DESAC/120-205AHIAEDV------
A3ZZ51_9PLAN/120-205TNIAETV------
Q8FMP1_COREF/123-206VNVAARV------
Q0W7U5_UNCMA/17-105WDIGLIT------
Q9UZU5_PYRAB/16-100MEIGRTA------
A6UUI6_META3/119-204ASIGDRI------
Q2FTF7_METHJ/16-104YDIGDTI------
Q1NKG6_9DELT/478-564FNVQEAL------
A3DN11_STAMF/248-325LDIAESI------
A3CVF4_METMJ/140-231TRVAHNA------
Q7A5Q4_STAAN/19-107SSIANIR------
Q18H40_HALWD/245-326INIASIA------
Q1IMC8_KORVE/119-204TNIAEDV------
Q5HG35_STAAC/121-202INIAESV------
Q251M5_DESHY/359-447VNLIELT------
A3ER26_9BACT/16-104ANVCERV------
A4A3L4_9GAMM/129-214TNIAEQV------
A3DLY8_STAMF/20-104ADIAMLV------
B4SH22_PELPB/118-203TKTAREA------
Q186T5_CLOD6/447-532TNIVKQV------
B1YLB2_EXIS2/122-207TNVGEHL------
A1RZ38_THEPD/253-333TDILEAT------
Q3IM38_NATPD/147-240ERIADVG------
O27757_METTH/89-175AIIANFA------
Q53W26_THET8/300-379KRALRKA------
A3CVT1_METMJ/216-300HSIVDVL------
Q834B5_ENTFA/121-206TNICEWI------
A4IQY4_GEOTN/16-104VNIAKAC------
A0NJJ5_OENOE/131-216TDIAEWL------
A3CRL4_METMJ/338-425ADLGEFF------
Q9YA54_AERPE/253-331LDIAEAA------
Q0YRH7_9CHLB/17-105VHIIDRM------
Q74KF7_LACJO/16-104NSIAWET------
A8AA37_IGNH4/119-200VQVASQV------
Q6G4T5_BARHE/125-210TNIAETL------
A9BHU2_PETMO/25-113EKNAKLI------
Q2LUX4_SYNAS/355-442VNIIELA------
Q4FLF7_PELUB/22-110KSVAKKI------
A0RXC3_CENSY/16-103YDIAQVR------
A5ILH4_THEP1/119-204TNIVEVS------
A6LP09_THEM4/121-202NNLCEEI------
Q2S080_SALRD/18-106RNLSRNA------
A9BNX0_DELAS/469-555CSVAYPI------
Q9YAE0_AERPE/15-99GDLAQLV------
Q5WET9_BACSK/17-105VDIAKVS------
A5ZNC6_9FIRM/16-102SDIADLS------
A0LAE5_MAGSM/412-500TNLVHIG------
A6CFS1_9PLAN/465-550INLAEAL------
A6DAS5_9PROT/94-175KTITKYL------
B8G180_DESHD/18-106VDVAKHT------
A4IQY4_GEOTN/119-204TNIAEHL------
Q8TX17_METKA/93-179CNIAEVA------
Q2NHW3_METST/123-208ESIGGRV------
A5G3F8_GEOUR/471-558LTIIEIE------
A4FX70_METM5/17-105SRIAKIT------
PHOU_METTH/21-109ANIAEAA------
Q662X1_BORGA/126-211ATIGELL------
A1VDV5_DESVV/122-207TNIGESV------
Q0PIQ4_DESVU/19-107ANVAERA------
Q8PZB8_METMA/122-207CNICESV------
Q9CEW9_LACLA/121-206VNLCEWI------
B9LHB3_CHLSY/122-207TNIGERV------
A5D1M0_PELTS/120-205TNIGESI------
Q2RHH2_MOOTA/445-531VSIAQAV------
Q9YG50_AERPE/17-103REINRVI------
A9B5P2_HERA2/131-216TNLAEQI------
A4YI56_METS5/245-324LDLAETT------
Q47KT1_THEFY/132-215VHVADNL------
E0THQ4_PARBH/20-108KNVAKRT------
Q6D018_ERWCT/339-425ERMADDI------
Q5Z0T5_NOCFA/22-110SAVADQV------
A4E7E4_9ACTN/16-104RQICRAT------
PHOU1_THEMA/18-106CNIAEKC------
PHOU_AQUAE/117-202ENVAEAA------
A6UVP6_META3/82-166SNIAEEI------
A5Z3H1_9FIRM/450-535VNIAYSI------
A7H7E1_ANADF/124-209TNLAEMV------
A5Z3H1_9FIRM/345-432VNIMDDA------
A3CXV2_METMJ/119-204CKIAEKV------
Q1K0S3_DESAC/473-558HSVSRAL------
B4S7F4_PROA2/163-246CDIARML------
A9B5P2_HERA2/20-108ATICKLQ------
Q5V0G4_HALMA/118-213VNIAART------
A7I9M4_METB6/16-104KSTAKIV------
A8MCD0_CALMQ/144-239WRIAQWM------
Q8TX17_METKA/194-284VDVVDFT------
B8CZG2_HALOH/119-206TNIGEET------
A8MBU9_CALMQ/146-238VQIANEL------
A7VHC0_9CLOT/360-447LAIAEIY------
Q0RZA9_RHOSR/121-204AVVGRRV------
Q3A1F9_PELCD/468-553FNIAQAI------
A3ZZ51_9PLAN/16-104HDIGQGV------
A4J4V6_DESRM/467-552VNLAEYV------
Q4KBC7_PSEF5/340-427ATSLAHL------
Q6ADH5_LEIXX/144-227VSIAKKV------
Q1WUX0_LACS1/120-205TNLAEWI------
Q0F0C9_9PROT/122-207VNIAEMV------
Q2YM24_BRUA2/348-436RNMLAQV------
Q6XYS9_SPIKU/16-104KSICRYY------
A5KMQ5_9FIRM/453-538LNIAQQY------
B8CZG2_HALOH/16-104TDIADTV------
A6GE05_9DELT/129-214TNLAEQV------
A8MGX2_ALKOO/16-104VNIAKVT------
A5UQ39_ROSS1/16-104KGIAKKV------
A4YI56_METS5/143-234SRISGLT------
Q05HF3_UNCMA/14-101VSVSRVT------
A7HJE0_FERNB/16-104KDIAEDI------
Q3IX36_RHOS4/343-430ETGLADA------
O28086_ARCFU/211-297RDIAQVL------
A0B6T7_METTP/241-325KNIGEFT------
A3ZXF3_9PLAN/119-204TNIAEDV------
A5G3F8_GEOUR/366-453EAIMEYM------
A7LS25_BACOV/16-104EGIARFV------
Q8U240_PYRFU/93-170KEIGARV------
A1UU23_BARBK/21-109KNIAKRA------
Q2SS07_MYCCT/120-207LNVQQII------
A0RA51_BACAH/351-438ENLVELV------
A8ZSJ6_DESOH/119-205TNIAEEV------
Q6F1N0_MESFL/119-206LTVQEIV------
Q2LUX4_SYNAS/460-545QNIAESV------
A5URZ8_ROSS1/121-206TNIGERV------
Q2Y4E6_9ARCH/245-318ANIAELT------
Y409_MYCGE/126-215YNIIKSF------
A0RXQ8_CENSY/138-229VEIAAAV------
Q3A1F9_PELCD/363-450EHLAHLS------
A5EXS4_DICNV/20-109CKIAYLL------
B2JUR6_BURP8/21-109RKVSKRL------
Q31I87_THICR/133-218RNIVESI------
A6GWK5_FLAPJ/140-225TNIAESI------
B8G180_DESHD/121-206TNIAEEV------
Y409_MYCGE/20-112NNLTKFI------
A6Q2I6_NITSB/121-210VEIAKLL------
Q3IUH9_NATPD/24-108ADIAKIV------
Q8PZB9_METMA/245-322ADIAEVS------
A9KP15_CLOPH/357-444VNILDLA------
Q1IMC3_KORVE/122-205KNMAEEV------
B2JC47_BURP8/341-428ERIVTDI------
Q03GY8_PEDPA/120-205TNVVEWI------
A6VG44_METM7/121-206KSIGDRV------
A4G2G4_HERAR/21-109KNIARRA------
A6LN86_THEM4/16-104LDIARKI------
A5ZVN9_9FIRM/463-548ASAMTAL------
Q879I2_STRPQ/323-410ESLGILI------
Q4FLF7_PELUB/125-210TNIAEAL------
A5KLQ2_9FIRM/351-438ENISEYA------
Y1641_METJA/186-266VNIVDIA------
A6BD84_9FIRM/463-548VNLADVA------
A5ILH4_THEP1/16-104HDIAKNV------
A9A622_NITMS/148-240AFIAKDL------
PHOU_DEIRA/16-104VHVAEDG------
O29778_ARCFU/134-226LIFSRYI------
C0A5V8_9BACT/119-205TNIAEEM------
A8F5R4_THELT/118-203TNVVETV------
Q11NF9_CYTH3/120-207TNISEEI------
Q5V3U8_HALMA/140-232EDIAEIA------
O28916_ARCFU/135-220SQMSEAT------
A4WI32_PYRAR/111-191VYIANHA------
A4J4A5_DESRM/448-534KNIAMLM------
A5UMQ1_METS3/7-91KDLADLV------
A5WHR5_PSYWF/22-110SKIARMA------
Y2861_DEIRA/125-208VNVAQRT------
A8AA77_IGNH4/213-294TSMAQMA------
A3DLZ0_STAMF/247-329SGIAEAT------
A1S0L5_THEPD/137-223ESLARLD------
A4J4V6_DESRM/359-449ENIVEST------
A0B6T8_METTP/129-214CNICESI------
Q0BUY2_GRABC/490-575VAAAAYP------
A4X1M0_SALTO/17-105VHIAKVV------
Q8F0J5_LEPIN/12-116VNCAKCF------
Q2S5E3_SALRD/191-276TNIAKGV------
A5UKP1_METS3/22-110RNIAESA------
Q971H7_SULTO/145-236SEAANDL------
Q8FZK0_BRUSU/454-540ASMAYPV------
A6GWK5_FLAPJ/37-125ISVIKNS------
Q30PB9_SULDN/121-210VNIANLM------
Q8TWZ7_METKA/17-101NDIAETV------
Q9YA54_AERPE/147-239TILSVRV------
Q6WB50_ALCFA/125-210AHIVHAG------
A4ANM1_MARSH/120-205KNIAEEI------
Q896W9_CLOTE/342-429KNIADLS------
Q1J0M9_DEIGD/118-204VNVAERL------
A5LNQ6_STRPN/118-204QAIYKWI------
A3CVF4_METMJ/247-326GDICESV------
A7IB03_METB6/247-326ADISENV------
A8DJW4_9BACT/17-106VNIARHA------
A6UVP6_META3/180-262IKIFEAS------
A3JY90_9RHOB/333-420EKGLAAM------
Q186T5_CLOD6/342-429ENIAELA------
A3WCP8_9SPHN/123-208TNVAEMV------
A0JSV0_ARTS2/16-104RHIAQLA------
Y1732_METTH/20-108AYIARYA------
A6TML5_ALKMQ/448-533SNIAMAV------
A9A9E5_METM6/23-112GDIAHKT------
Q0SPC2_BORAP/17-106TKIVRVV------
A6NWS5_9FIRM/352-439INICEYS------
Q180A4_CLOD6/120-205TNVCEKI------
A4G2G4_HERAR/125-210THLAENA------
Q05HF3_UNCMA/116-201TEIAERV------
A3DLZ0_STAMF/142-234VNIAKRT------
A9AVN3_HERA2/16-104EGIAELV------
Q5V0G5_HALMA/139-228ERIGTIA------
A6LGP6_PARD8/360-451NNLARSI------
Q30PB9_SULDN/16-104KKYARRM------
A1APX2_PELPD/349-436EKILDCI------
O57974_PYRHO/11-95YEIADLV------
A0PXY5_CLONN/341-428DNIVEIA------
Q31I87_THICR/25-113VKLAKLV------
A3DN16_STAMF/122-203TYIAEKV------
Q73LA1_TREDE/351-442FELGLFI------
A3ER26_9BACT/119-204TNVAEII------
A1RUP2_PYRIL/16-99YDIAIVV------
Q5UZI8_HALMA/218-302LEMSEGV------
A9BNX0_DELAS/363-450ERVLLDI------
A9KRG9_CLOPH/120-205TNICERT------
Q4J8G9_SULAC/246-327MDIAEAT------
Q9YG50_AERPE/119-200VYIARQA------
Q12XW7_METBU/17-105VNIAELV------
A6GE05_9DELT/24-112VNLGKLA------
B8I417_CLOCE/120-205TNIAEWV------
A7VDA3_9CLOT/469-554SNIGLHI------
A6DFF6_9BACT/16-104SNICRYI------
A5ZXG9_9FIRM/464-549SNISVCI------
Y2861_DEIRA/23-111KHVARRL------
A7VSN0_9CLOT/344-431ENLCELA------
A7VSN0_9CLOT/449-536TNIAYSM------
A9KNL1_CLOPH/461-546TNIAFSI------
A3KAI2_9RHOB/452-538TYAAYPI------
A3DLY8_STAMF/215-297AELVTPL------
Q8PZB9_METMA/140-232VKIATNA------
Q1NQ35_9DELT/126-211TNISEDV------
A7AA41_9PORP/470-557LNVVQAV------
Q8PUH1_METMA/112-203QRMATVA------
O29464_ARCFU/138-228YNFSTYA------
Q03YL4_LEUMM/120-205TDIAEWI------
A0L7V8_MAGSM/21-109ANISKRA------
Q97CB8_THEVO/140-221VNICIAM------
A5ZVN9_9FIRM/358-445SYIAHMA------
Q6F1N0_MESFL/18-106KKLCIFF------
A4FWX8_METM5/180-263LKIFEFG------
A8AA77_IGNH4/19-103SDMATTV------
A3KAI2_9RHOB/346-434VNMLAIA------
A3DN11_STAMF/143-235VLISEII------
Q0BUY2_GRABC/384-472RNLLSQA------
A7VZ22_9CLOT/17-105ADICDII------
Q8YNR1_NOSS1/26-114KDLAQIA------
A5GUB9_SYNR3/26-114KELATLG------
A3IBD5_9BACI/18-106VNIAKEA------
Q31LX7_SYNE7/130-214TNVGQRI------
Y1641_METJA/88-172ANIAEEV------
Q8TR05_METAC/238-318SNIAEIA------
A1WT64_HALHL/126-210TNIASAV------
Q975R4_SULTO/114-201RDTANNI------
A2BIZ3_HYPBU/172-264SRMARSA------
PHOU_STRR6/119-204ANICERL------
A4X1M0_SALTO/122-204VNVARQV------
A0P428_9RHOB/114-199RSISEAL------
A5KMQ5_9FIRM/348-435VNLAEYG------
A6BD84_9FIRM/357-445VEVAKCV------
Q8G3U8_BIFLO/16-104RHVAEAA------
A1A0C8_BIFAA/129-212VSAARRV------
Q2FUH2_METHJ/133-224VRIALNA------
A8F7W8_THELT/123-210TNISEKL------
Q1IMC8_KORVE/16-104VNIAQRV------
A3DJ80_CLOTH/353-440LNIVDSA------
A8F7W8_THELT/19-107VNIAQLS------
A5UKP6_METS3/187-276IEIIDVA------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window