Sequence alignment for CL0298

PF02403

SYSM_SCHPO/49-157ILNYKYIYQ....NAEAVQRNCINRNL..QAIAET-----VPKIRSLIDEKESLKNEFFPLLSL-KKEIT-LQIERCSDP
SYS_SYNE7/1-112MLDLRLLRE....NPEATQARLDRR.....HSSYD-----IQPLLSLDQQVRQWEQERTQLQAR-SNEIG-RSVGQKMRE
SYSC_MOUSE/2-113VLDLDLFRVDKGGDPALIRETQEKRF....KDPGL-----VDQLVKADSEWRRCRFRADNLNKL-KNLCS-KTIGEKMKK
SYSC_SCHPO/1-112MLDINLFQVEKGGNPEIIRESQRKRG....ADVGV-----VDKVIEMYKEWVSLRFELDNTNKS-INRVQ-KEIGLKMKA
SYS_CORGL/1-106MIDLKFLRD....NPDVVRASQITRG....EDPAL-----VDELISADESRREAIKAADDLRAE-QKAFG-KKIGQASPE
SYS_BORBU/1-106MLDLKFIRD....NLDLVKRSIKARG.....LVLD-----IDKLIYLDDKRKKLITKIGELNAK-RNENS-SKMQENLDK
SYS_XANCP/1-108MLDPALLRQ....HPADLAERLRSTR....GFDLN-----TAELESLESERKRIQVRTQELQSL-RNSKS-KAIGQAKAK
SYS_AQUAE/1-109MIDINLIRE....KPDYVKERLATRD...KELVSL-----VDKVLELDKRRREIIKRLEALRSE-RNKLS-KEIGKLKRE
SYS_CALS4/1-107MLDIKFIRS....NPDVVRRAIELKG.....EKAD-----LDRLLLLDEKRREMLVELEALKNK-RNTES-DNIARLKRE
SYS_FUSNN/1-107MLELKFMRE....NVEMLKEMLKNRN.....SNVD-----MDAFVELDSKRREVLSEVENLKRE-RNNAS-AEIANLKKE
SYS_TREPA/1-106MLDYRFIRE....NVDAVKENVKVRN.....VHAD-----VDAIVHLYDQRVKLLAELQELQRA-RNENA-QTMKSSLDA
SYS_CHLTR/1-107MLDIRLIRK....EPKECESRLQ.KK....DPAIS-----LERLLDLDKTVRQLKADSEALLAK-RKVLS-GQIHKAKVA
SYS_ENCCU/1-115MIDINLIRDP..KTREKVVESEKKRF...R.DGLA-----VGKAYELDRKRIEMNFRLDQINTR-INQLN-REIKSGYRQ
SYSC_YEAST/1-112MLDINQFIEDKGGNPELIRQSQKARN....ASVEI-----VDEIISDYKDWVKTRFELDELNKK-FNKLQ-KDIGLKFKN
SYS_AGRFC/1-109MHDIKWIRE....NPEAFDAALARR.....SVEPA-----AAGLIALDEKRRSVIQSLQDMQSR-RNAAS-KEIGAAMAQ
SYS_CLOPE/1-110MLDLKKLRS....NTEEVKKALSNRGE..DFDVNV-----IDEVIALDEERRKILVDVEALKKQ-RNEVS-AEIPKRKKA
SYS_BACSU/1-108MLDTKMLRA....NFQEIKAKLVHKG....EDLTD-----FDKFEALDDRRRELIGKVEELKGK-RNEVS-QQVAVLKRE
SYS_RALSO/1-107MLDIQLLRK....DIDAVAARLN.DR....GYELD-----VAGFAALEAERKAIQTRTEELQAR-RNSLS-KQIGMLKGK
SYS_COXBU/1-107MLDPKILRQ....NLEHVVEKLR.RR....GFEMD-----SDTFLQLENKRKEAQLAIQSFQTK-RNQLS-KTIGMAKSK
SYS_LISMO/1-108MLDVKLLRN....NFDEVKQKLQNRG....EDLGE-----FEKFGELDKRRRTLIVETEALKSQ-RNEVS-QEIAKLKRE
SYS_HAEIN/1-108MIDPNLLRN....NLAEVAEKLKVKR....NFMLD-----TEKLTALEDQRKNLQVTTENLQAE-RNARS-KAIGAAKAR
SYS_NOSS1/1-112MLDIKQIRE....NPQLIQERLNSR.....NGTYD-----IQPILQLDKQQRELEATRSQIQAR-SNEIG-KIVGQKIKS
SYS_HALMA/1-110MLSRQFVRE....HPETVRDAIERK....GVTGVD-----LDEILDIDEEWRELKAEGDGLRQE-RNEVS-SKIGELKQD
SYS_HELPY/1-109MIDRKLLLQ....DFDKVALSLKKRN...NAMDDE-----LERLREVITHYKKRLIELEGLQAF-QNKVS-KEFGIKMAQ
SYS_BUCAI/1-107MLNPYLLRN....ELHLTAKKL.LKK....GYKLN-----ISKISSMEEKRKTLQIQTENLQFK-HNALS-NLFKENKNI
SYS_PASMU/1-108MIDPNLLRN....NLEEVAEKLKVKR....NFVLD-----VALLSELEEQRKSLQVKTESLQAE-RNARS-KNIGQAKAR
SYS_RHIME/1-109MLDIKWIRE....NADALDEALAKR.....GAEPL-----SASLIALDERRRAVLQSLQDMQSR-RNAAS-KEIGAAMAQ
SYS_BUCBP/1-107MLNPNLLRN....HIEFVFKNL.ARR....GFSLD-----VKQFTEMEKKRKILQTKVEELQSR-HNTLS-KHIGRIKLI
SYS_SYNY3/1-114MLDLKQIRE....NPTAIQNRLNQRG...GGASYD-----LEPILAIAAEQKAKESERTVLQSR-SNEIG-KLIGQKIGQ
SYS_MYCPN/1-104MLDRNKLRN....NLDFFKKKLVERG....VSESQ-----FEAYVQADKAMRKLLHQIELANQK-QTLLA-QQVAKKKGD
SYS1_CLOAB/1-110MLDLKRIRT....NPEEIKKALTNRGE..DFDISV-----IDELVSLDEERRKNLVEVENLKSK-RNKDS-GEIAKLKKS
SYS2_CLOAB/1-108MLDLDLIRN....DTEKVKKALLKK.....IDNVD-----FTELLKLDDERRKLIHEVEVLKNK-KNEAS-KQISNIKSQ
SYSC_CAEEL/2-114VLDIDMFRTEKGGNPEIIRKSQQDRF....KDPKL-----VDEVIELDEKWRKERFVADQLNRQ-KNAIS-KAIGEKMKK
SYS_RHILO/1-114MLDIKWIRD....NPKALVEALAKRSWSAGEAQST-----VDDLIARDEARREHVTELQTKQER-RNAAS-KEIGNAMRS
SYSC_ARATH/1-112MLDINLFREEKGNNPEIIRESQRRRF....ASVEI-----VDEIIKLDKEWRQRQFEVDSFRKE-FNKLN-KQVAQLKIK
SYS_MYCPU/1-107MLDLKKILN....NPDYYRNILLNKK....ANISL-----FDELVKIGKKRGELMQKSQSLKAK-INELS-KSFIKLKTN
SYS_VIBPA/1-109MLDSKLLRT....ELDETAAKL.ARR....GFKLD-----VETIRKLEEQRKSIQVEVENLQST-RNSIS-KQIGQKMAA
SYS_PSESM/1-107MLDSKLLRT....QLQDVADRL.ASR....GFTLD-----VARIESLEAQRKVVQTRTEQLQAE-RNARS-KSIGQAKQR
SYS_CAUCR/1-109MHDIKAIRE....NPKAYDRHWSGK.....GRSGA-----ADEAVRLDAELRAAQTTLQEAQAK-RNESS-KLIGMAKAK
SYS2_LACPL/1-108MLDVKMIRQ....NPDFVKEQLGHRG....VAASD-----IDDLLAADEKRRELIAKSEQLKST-RNQVS-GEISQKKRN
SYS_MYCLE/1-106MIDLQLLRE....DPDVVRRSQLSRG....EDPAL-----VDALLTADTARRAAISAADSLRAE-QKATS-KSLGAASAE
SYS1_LACPL/1-108MLNPKFVRN....NPELVKTKLQTRK....VDPAE-----VDEYLQLDQQNRDAITKVEGLKKQ-KNQLT-EQIGQSDPQ
SYS_LACLA/1-108MLDIKKIRA....DFDGVAAKLATRG....VEKEK-----LEKLHDLDIKRRELIVKSEALKAE-RNSVS-DEISQVKRA
SYS_CLOTE/1-110MLDLKRIRS....NPEEIKKALAGRGE..DFDVSV-----IDKVLQLDEERRNILVEVESLKNK-RKQES-AKIPQFKKE
SYS_BRADU/1-109MHDIKSIRD....NPQAFDAGLARR.....GLKPL-----SASLLAIDERRRAAILASEQAQAR-RNAAS-KEIGDAKKA
SYSC_CANAL/1-112MLDINAFLVEKGGDPEIIKASQKKRG....DSVEL-----VDEIIAEYKEWVKLRFDLDEHNKK-LNSVQ-KEIGKRFKA
Q89ZR4_BACTN/1-112MLTIKQITE....NTEAVLRGLEKKHF..KNAKET-----IDEVIALNDKRRTTQNLLDKNLAE-VNSLS-RTIGQLMKE
SYS_THEAC/1-108MIDVKLLRS....NRELFEKNCEYRG....VDKAP-----VEDFFRLDEEWRSINRELNGLRSQ-KNRET-RKIAELIK.
SYS_HALSA/1-109MLSRQFVRE....HPEKVRDALDAK....GVD.AD-----LDRILEVDEEWRELKARGDELRHD-RNEVS-SKIGELKQA
SYS_WIGBR/1-107MIDHKLIIK....NIEEVCKKLILRN.....FYLD-----KKKILLQDQKRKILQIEVEKLQNK-RNLQS-KIISKIKIN
SYS_BACHD/1-108MLDIKRLRK....DFAGIREKLQTRG....EDISG-----LEKFGSLDEKRRQVIVKVEELKSR-RNQVS-QEVAQLKRE
SYS_THEEB/1-112MIDLKQLRE....NPQAFGDRLRRR.....GGDFD-----LDRILELDAQQRQLEQQRSQLQAR-SNEIG-ALVGKKIKS
SYS_STRMU/1-108MLDIKRIRN....DFDQIAEKLARRG....VDEKT-----LHDLKELDFKRRQLLIKSEEAKAE-RNTAS-AAIAQAKRN
SYS_CAMJE/1-104MLDLKNLQN....NFDEVAKKLKNKK....VDENI-----LKKLAELFASLKKEKIALEEFQAF-QNKFS-KELATAE..
SYS_STRA5/1-108MLDLKRIRT....DFDVVAKKLATRG....VDQET-----LTTLKELDIKRRELLIKAEEAKAQ-RNVAS-AAIAQAKRN
SYS_SHEON/1-107MLDPKFLRN....ELAVTAERL.ATR....GFILD-----VAHLTQLEEKRKSLQVATEELQAS-RNAIS-KSIGQAKAR
SYS_UREPA/1-109MFDINLIRK....DIATTKEKMLNKK....VPSNL-----FDQIFDLDVLVRSLMQQEQNLNAK-KNQLS-KEIGILAKN
SYS_OCEIH/1-108MLDMKYLRQ....NFEEVQQRLQHRG....EDLAD-----LDKFGELDTNRRQLIAETEKLKAQ-RNEAT-KKISELKRE
SYS_DEIRA/1-105MLDLKFIRE....NPDAVREAIRVK....NVA.LD-----LDDLLQRDRDLVALKQRVEAMQTE-RNANA-KLVPKAS..
SYS_MYCPE/1-109MINKSIIRN....DFKTLETSLKNRN.....SKLD-----ISSLKDLDKKQSELLLIIESCNKK-RNEIS-KSIGIYIGK
SYS_LEPIN/1-109MLDLRYITE....NTEDLKKVLELRG...FKEIGI-----IDELKSIIQRKREFQKEADILREE-RNKAS-KEVGKIKQS
Q9VQL1_DROME/2-115VLDLDLFRSDKGGNPDLVRENQKKRF....KDVAL-----VETVIAKDTEWRQCRHRADNLNKV-KNVCS-KVIGEKMKK
SYS_BIFLO/1-106MLDIQFIRE....HTDIVKESQRKRG....ESVEL-----VDEVLSSDTARREALKAFEEARAQ-QKEIG-KKVASAPAD
SYS_THEMA/1-110MIDIKLIRQ....NPDFVKEALRKRG....EDPAI-----IDEILKIDADWRATITKTNELRSR-RNEIS-KNVARLKKE
SYS_STRCO/1-106MIDLRLLRE....DPDRVRASQRARG....EDVAL-----VDSLLSADERRRSSGVRFDELRAE-QKGLG-KLIGKAAGD
Q8IBS3_PLAF7/2-115VLDINLFRKEKGGNPDKIKESERKRY....HDENN-----VDKVIEYDDKWRKCIFELEELKKN-INMIN-KEIGNKKKV
SYS_CHLTE/1-111MLDITYIRQ....NPDDVKEMLRRRQQ..QGDAPK-----VDRLLERDAERKAMVQRTDDLKAL-RNRVS-KEIANIKRT
B6TBG7_MAIZE/74-177.IDFKWIRD....NRDAVADNIRTR.....NSTAN-----LDLVFELYDQYLTLQKEVERLRAE-RNAVA-NKMKGKLDP
C4YXW5_9RICK/1-107MLNIKWIRE....NQELFDEKLSQRF.....IEPM-----SSKIAMLDGEKRKITSLIQEFQHA-RKVKS-KILGNMASK
C5ACG9_BURGB/1-106MLDIQLLRK....DLDGVAKRLADR.....GYILD-----VAAFSSLEAERRAIQTRTEELQAR-RNSLS-KQIGAMKGR
C5WTV8_SORBI/1-114MLDINLFRADKGGNPDLIRESQRSRF....ASVEL-----VDEVIALDMAWRGKQFDLDKIRQE-LNATS-KKIGKLKAS
F4IAJ4_ARATH/79-182.IDFKWIRD....NKEAVEINIRNR.....NSNAN-----LEAVLQLYENMVNLQKEVERLREE-RNNVA-KKMKGKLEP
SYS_STAA8/1-107MLDIRLFRN....EPDTVKSKIELRG....DDPKV-----VDEILELDEQRRKLISATEEMKAR-RNKVS-EEIALKKRN
SYS_MYCTU/1-105MIDLKLLRE....NPDAVRRSQLSRG....EDPAL-----VDALLTADAARRAVISTADSLRAE-QKAAS-KSVGGASP.
SYS_BRUA2/1-109MLDIKWIRE....NPETLDKALAKRG.....AAPL-----SSELIALDEKRREHVGKVQAAQER-RNAAS-KEIGKAMAA
SYS_SHIDS/1-107MLDPNLLRN....EPDAVAEKLARR.....GFKLD-----VDKLGALEERRKVLQVKTENLQAE-RNSRS-KSIGQAKAR
SYS_NEIG1/1-109MLDIQLLRS....NTAAVAERLARR.....GYDFD-----TARFDALEERRKSVQVKTEELQAS-RNSIS-KQIGALKGQ
SYS_THET8/1-102MVDLKRLRQ....EPEVFHRAIREKG.....VALD-----LEALLALDQEVQELKKRLQEVQTE-RNQVA-KRVPKAPP.
SYS_STRR6/1-108MLDIKRIRT....DFEAVAEKLATRG....VDAAV-----LNEMKEIDAKRRNILVKVETLKAE-RNTVS-AEIAQAKRN
SYS_STRP1/1-108MLDLKRIRT....DFDTVAAKLKNRG....VSEDT-----LTHLKELDEKRRALLVQSEELKAE-RNIAS-AAIAQAKRQ
SYS_XYLFA/1-108MLDPTLLRQ....QLAKLAECLSTVR....GFTLD-----VAALEALESERKRIQVHTQELQSL-RNSKS-KAIGQARSK

PF02912

D3F0H4_CONWI/20-88------------------------------ATTDA.....LEHA------------RVRWL.GR.KAELP.NMLRGVAQL
D5QGH9_KOMHA/20-88------------------------------PDLRA.....WDEV------------RVATM.GK.SGRLT.GLLKELGRM
S5R845_9PROT/19-87------------------------------VSISS.....LENA------------KSYYL.GK.NGKLT.QYIKNIKNI
R6HCE9_9FIRM/20-88------------------------------TSPAA.....LEEL------------RVKLL.GK.KGELT.AVLKQMGKL
D3PN96_MEIRD/14-82------------------------------PNLER.....LQGL------------KVHYL.GK.NGQVT.QAMKTLGQL
D3FWH7_BACPE/20-88------------------------------QDVKA.....LQEV------------RVAYL.GK.KGPIT.EVLRGMGKL
B3SFN1_TRIAD/20-86------------------------------EN..E.....LNDI------------RVKFL.GK.NGIVT.SEAKKIALV
I4WNQ8_9GAMM/19-87------------------------------DTLEA.....LDAL------------RVALL.GK.SGVVT.AALKTLGAL
A5EXT2_DICNV/25-93------------------------------NDLVA.....LEGV------------KNTYM.AK.KGIFA.GYMQTLNAL
B2HR20_MYCMM/28-96------------------------------DDLEA.....LARA------------KTEHL.GD.RSPLA.LARQSLGTL
R5HWY3_9FIRM/20-88------------------------------DGLER.....LNEV------------RQAVL.GK.KGELT.AVLKGMKDV
R5B0T6_9BACT/18-86------------------------------ATLDE.....VEEL------------RIKYI.SK.KGEVQ.ALVDEFRGL
R7AGA8_9BACE/21-89------------------------------DSLER.....LNEI------------KVGLL.GK.KGELT.EVLKGMKDV
R6GYM5_9FIRM/20-88------------------------------ESAKE.....INEL------------RVEVL.GK.NGELT.LLLKGLKDV
SYFA_CORGL/21-89------------------------------QNLDE.....LAAL------------RRDHL.GD.AAPIP.QARRSLGTI
SYFA_AQUAE/19-87------------------------------SSLKE.....LQEV------------RSKFL.GS.KGVIK.ELLKKIKEV
SYFA_WOLSU/12-80------------------------------QSSAE.....LEEL------------RIKAL.GK.KGILT.AQFALLKNL
R6NQ38_9FIRM/20-88------------------------------GELGK.....LNDV------------RVAFL.GK.KGELT.AVLKGMKDV
R6X2S6_9CLOT/20-88------------------------------QDIKT.....LEEA------------KVKYL.GK.KGELT.AILRGMGAL
C5ZZ75_9HELI/12-80------------------------------KNTTE.....LEEI------------RISVM.GK.KGSLT.AKFAALKNC
SYFA_CORDI/32-100------------------------------SNLDE.....LNIA------------RRDHL.GD.AAPIP.QARRSLGTL
G2TKP8_BACCO/20-88------------------------------ADLKT.....LNEI------------RVAYL.GK.KGPIT.EVLRGMGKL
D2PM91_KRIFD/36-104------------------------------PDLAA.....LQEA------------KVAHL.GE.RSPIA.LANREIGAL
E6U0I2_BACCJ/20-88------------------------------TTIKE.....LKDL------------RVSYL.GK.KGPIT.EVLKGMGKL
C7N307_SLAHD/22-90------------------------------ADTAA.....LDQV------------RIGVL.GK.KGTLT.SYLRSMGQV
E8RJU7_DESPD/20-88------------------------------DDLAQ.....LETF------------RVTYL.GR.KGGLLSGALRQLGSV
R6AP89_9FIRM/31-99------------------------------GDEKA.....LQDA------------KVFFL.GK.KGKLT.AILRSMKDL
R6U1C4_9CLOT/20-88------------------------------KNSNE.....IEEL------------RVAFL.GK.KGKVV.EVLKNLKNV
D3QAE4_STANL/38-106------------------------------GDADT.....LASI------------KHLHL.GD.KAPIS.LARREIGSL
SYFA_PELPD/20-88------------------------------STGEA.....LQNI------------RIKYL.GR.KGAMT.ALMKGLGAL
R6CNS1_9FIRM/20-88------------------------------ADLKS.....LDDI------------RVRFL.GK.KGEIT.AILKQMGKL
R6XDT9_9FIRM/18-86------------------------------TTMQE.....LNEL------------RAYYM.GK.KSPLA.EIMKTLASA
SYFA_PROMM/29-97------------------------------ADADA.....LEQL------------RVSLL.GK.KGRLS.GVLGAMGKL
SYFA_GEOKA/20-88------------------------------RDLKA.....LNDV------------RVAYL.GK.KGPIT.EVLRGMGAL
D2RJL9_ACIFV/20-88------------------------------KSVED.....LKNI------------RVQYL.GK.KGALT.SILRSLGDV
G2KW84_LACSM/22-90------------------------------TDVKS.....LNEI------------RVQLL.GK.KGPIT.QALRGISKL
R5MRT4_9FIRM/18-86------------------------------ENIKE.....LNDL------------KVSYQ.GK.KGIIT.ELMSKMKDL
SYFA_PSEPK/19-87------------------------------EDINA.....LEQI------------RVNYL.GK.KGELT.QVMKTLGNL
SYFA_LACBA/22-90------------------------------TDLKD.....VNQV------------RVSLL.GK.KGPIT.EVLRGMRDL
SYFA_RUTMC/19-87------------------------------QDLQD.....LEDL------------RTNVL.GK.KGELT.TLLKGLGKL
K4KFC7_SIMAS/19-87------------------------------QDLQA.....LDYV------------RVEYL.GK.KGKIT.ELLKGLGKL
H5WKC4_9BURK/19-87------------------------------PTAAE.....LENA------------KARFL.GK.AGRVT.ELLKGLGAL
R6MN70_9FIRM/20-88------------------------------GDSNE.....LESL------------RVRFL.GK.KGELT.AVLKTMGKL
C6XKF6_HIRBI/23-91------------------------------TNEAA.....LEEL------------RVAEL.GK.KGRVS.LMMRELGKM
A7IGN3_XANP2/31-99------------------------------EDEAG.....LEEV------------RIAAL.GK.KGSVS.ELLKSLGTM
B1WVT1_CYAA5/33-101------------------------------DSLEA.....LEQL------------RINYL.GK.KGKLS.QILRGMGKL
E1VUN8_ARTAR/40-108------------------------------GDLNE.....LKEA------------RLSHT.GE.KSALS.LANRQIGKL
M5DSW2_9GAMM/19-87------------------------------QDVAA.....LDQV------------RVQYL.GK.KGEIT.SLMKNLGNV
F2NPL4_MARHT/13-81------------------------------EDLEA.....LQAL------------RVRYL.GK.KGRLT.QELKALGQL
D3EQU2_ATETH/27-95------------------------------ISLKD.....LEQL------------RIFYL.GK.KGKLS.QILRGMSKL
E6SIV5_THEM7/50-118------------------------------ADLAE.....LERL------------RVEWL.GK.KGRIS.LLLRQMGSV
SYFA_STRR6/25-93------------------------------GNEKE.....MQDL------------RVSVL.GK.KGSLT.EILKGMKDV
D7BE71_MEISD/14-82------------------------------PSLEA.....LHTL------------KVQYL.GK.NGLVT.QEMKTLGKL
SYFA_DEIGD/13-81------------------------------PDLPA.....LQAV------------KTRYL.GK.SGLVT.RELGALGKL
I5AR65_EUBCE/24-92------------------------------STPDA.....LNEI------------RVNVL.GK.KGELK.ELMKSMKDV
J9S5B5_9ACTN/37-105------------------------------VDLDQ.....LAAA------------KSAHL.GD.RSPIA.LARRALGSI
R5Y6B3_9FIRM/20-88------------------------------DTKEQ.....IEEA------------RIKYL.GK.KGELT.SILKQMGKL
SYFA_GEOSL/20-88------------------------------ASEDA.....LQEL------------RVRYL.GK.KGELT.AVMKGLGSL
SYFA_CHRVO/19-87------------------------------ADLIE.....LEQV------------KARFL.GK.SGELT.ELLKQLGKL
L0DY04_THIND/19-87------------------------------EGLAD.....LDAL------------RVRYL.GK.KGALT.ALLKELGRL
SYFA_CHESB/19-87------------------------------GDEQT.....VEAV------------RVAAL.GK.KGTVS.EKLKTLGSM
F6B409_DESCC/20-88------------------------------NTPDE.....LNVI------------RVKYL.GK.KGEVT.QVLRGMGAL
SYFA_LACLA/22-90------------------------------ADEKT.....LNNL------------RTVML.GK.KGELT.EILKGMKDL
SYFA_ECOLI/19-87------------------------------SDVAA.....LDNV------------RVEYL.GK.KGHLT.LQMTTLREL
R5L2F8_9CLOT/20-88------------------------------KSSER.....LEEL------------RVKYT.GK.KGLLV.SVLKGLKDV
S5TIM3_9CORY/29-97------------------------------PSLAE.....LQEA------------RREHL.GD.SAFIP.RARQAIGTL
W6AA06_9MOLU/21-89------------------------------SSRGD.....IEEL------------KKEFI.GK.NSPLN.SILQELRNA
SYFA_LARHH/19-87------------------------------QDLNE.....LEQV------------KARYL.GK.TGQIT.ELLKQLGKL
W0GLM9_9MOLU/20-88------------------------------SSLEE.....LNNM------------QIKYL.GK.KSTIN.DLLRGLKDL
K4IPC1_BIFAP/27-95------------------------------SDLAE.....LKAI------------KAKYA.GT.GSALA.GSGRMIGRL
SYFA_HISS2/21-89------------------------------KSIES.....LEAI------------RVEYF.GK.KGHFT.QLMQGLRDV
R5R3I5_9FIRM/20-88------------------------------SSLKE.....LNEI------------RVLYL.GK.KGPIQ.EAMKSMKDM
E6U2U6_ETHHY/21-89------------------------------RESSE.....LEAL------------RVRFL.GK.KGELT.AILKQMGKL
E4U4K5_OCEP5/13-81------------------------------ASLEA.....LQEI------------KVRFL.GK.KGRLT.QAFKAMKGL
X2GVA3_9BACI/36-104------------------------------ANLKE.....LNDV------------RVAYL.GK.KGPIT.DLLKGMGKL
G2KS35_MICAA/23-91------------------------------TDLAA.....LDAA------------RVAAL.GK.NGRIT.ALMKNLGTM
SYFA_THISH/19-87------------------------------TDTQA.....LDAL------------RVQYL.GK.KGVLT.EQLKALGKL
R7L9W5_9BACT/20-88------------------------------KTKSD.....VASI------------GAEIT.GP.NGTLT.ALMKIIPTL
E8SFJ6_STAPH/22-90------------------------------QDEKA.....LQDV------------KVKYL.GK.KGQVT.GLMKQMKDL
E6WZU0_NITSE/12-80------------------------------STLEA.....LEKV------------RIEIF.GK.KGILA.AEFAKLKDV
SYFA_STRMK/19-87------------------------------QSPDV.....LEQL------------RVALL.GK.SGSIT.SQLKQLGAL
A8F395_PSELT/17-79------------------------------TDLQQ.....LEKI------------RVSLL.GK.KGTIT.EQMKNIASL
E6VRJ1_DESAO/27-95------------------------------CSLKE.....LDEL------------RIEFL.GR.KGKLA.QSMGQLGRL
Q2VYY9_MAGSA/19-87------------------------------TTLDQ.....LEAA------------RVAAL.GK.KGTIT.GLMKSLGGM
SYFA_ERYLH/19-87------------------------------TSLDA.....LEEQ------------RVAAL.GK.KGWVS.LALKTLGGM
Q6KHX3_MYCMO/11-79------------------------------ETLED.....LKIA------------KSNFL.NN.DLELK.QLMNDLKLA
K0J3E3_AMPXN/20-88------------------------------TSLAD.....LEKV------------RVAYL.GK.KGPIT.EVLRGMGKL
E6S8E4_INTC7/36-104------------------------------ATLDD.....LKAT------------RIAHQ.GE.KSALA.LANREIGAL
A0RQC7_CAMFF/12-80------------------------------LSLDE.....LEKI------------RVELF.GK.KGIIT.NEFAKLKDI
U5LEE3_9BACI/20-88------------------------------ENLKE.....LNDI------------RVSYL.GK.KGPIT.EVLKGMGKL
C7LV64_DESBD/24-92------------------------------SSLEE.....LEEL------------RVRFL.GR.KGLLA.DLMSGLTAL
D5UZC0_ARCNC/12-80------------------------------DSIEA.....LENL------------RIEIL.GK.KGFLT.KEFARLKDI
SYFA_THET8/13-81------------------------------RDLEE.....LKAL------------KARYL.GK.KGLLT.QEMKGLSAL
R5TBA8_9FIRM/87-155------------------------------IDEKE.....LQDT------------KVAFL.GK.RGKLT.SILRGMKDL
R6RV93_9CLOT/20-88------------------------------SSKQE.....LEAL------------RVKYL.GK.KGELT.AILKQMGKL
D4H1G6_DENA2/19-87------------------------------ATSEE.....LYQI------------KVKYL.GK.KGLIS.GLNKQLKDV
I0KCE2_9BACT/18-86------------------------------TSKDE.....LEQY------------RLRYL.SK.KGAVT.ELFDGLKTA
R5NL52_9FIRM/20-89------------------------------TNSKA.....VYDF------------KKSFLDSK.VGQIG.QLMKEMRNI
E1VIK1_9GAMM/19-87------------------------------NNEPD.....LDNV------------RVQYL.GK.KGEIT.DQLKALGKL
SYFA_FLAPJ/18-86------------------------------QNKEK.....LEEF------------RIKFL.GS.KGLVK.DIFAEFKNV
SYFA_CAMJE/12-80------------------------------ENLND.....LEAI------------RISVL.GK.KGILT.EGFTKLKEL
J9YYI7_9PROT/18-86------------------------------NSQAD.....IQNL------------KVSYL.GK.KGKIT.ELLKSLKDL
R5IR39_9FIRM/20-88------------------------------KDAGE.....LDAL------------RVRFL.GK.KGELT.GVLKTMGKL
R5BTJ9_9FIRM/20-88------------------------------TDLQA.....LQDA------------RVKYL.GK.KGEVT.ALLKGLGKL
U6B4B0_9RHIZ/26-94------------------------------SSTDQ.....IDSI------------RVSAL.GK.KGSIT.SLLKELKYL
K4L6C1_9FIRM/20-88------------------------------TSSEE.....LQEL------------KVRVM.GK.KGSLT.SLLKQMGQL
E8N9J4_MICTS/27-95------------------------------ATTAD.....LKAA------------RAAHT.GE.QSALA.RLNAQMRHV
D6Z8H5_SEGRD/20-88------------------------------EDLPA.....LAAA------------KAEHL.GE.RSALA.LARRSLGSL
K9V4Y0_9CYAN/27-95------------------------------DSLER.....LEEL------------RLSYL.GK.KGQLS.VILGMMGKL
D7BP30_ARCHD/27-95------------------------------SSLDE.....LKDA------------RLAHS.GD.NAPIT.HANMQIKSL
R5ZBV6_9CLOT/21-89------------------------------KDMPS.....LMNS------------KAKYL.GK.KGPLT.SLFAQMKNI
SYFA_RICPR/19-88------------------------------HNLKD.....LQEY------------KVEFL.GR.NGIVT.SELKKLGSL
D5A3B3_ARTPN/27-95------------------------------ETLSG.....LEQL------------RINYL.GK.KGQLS.KVLGGMGKL
L0FSK7_ECHVK/19-87------------------------------SNPEE.....LEAF------------RMRYI.SK.KSVVA.ALFAEMKNV
SYFA_STRA5/24-92------------------------------NHTKE.....LQDL------------RVQVL.GK.KGSLT.ELLKGLKDL
SYFA_NOVAD/19-87------------------------------ATPEA.....VEAI------------RVSAL.GK.QGWVS.ALLKSLGGM
B1ZQM9_OPITP/20-88------------------------------KTRPE.....FEAA------------KARFV.GP.HGELT.ALMKQMGTV
K9RTF0_SYNP3/30-98------------------------------QALGE.....LEQL------------RIGYL.GK.KGQLS.IILGAMGKL
J3VU78_9ENTR/19-87------------------------------NDLET.....LDLI------------RIAYL.GK.KGLLN.KKIKILKNV
Q12BQ9_POLSJ/22-90------------------------------TTPAD.....LENA------------KAQFL.GK.SGRVT.ELMKGMAAL
M1E4N2_9FIRM/18-86------------------------------SSSQE.....VLEI------------YSRYL.GR.KGLIN.ELFNKMKDL
C7RDV0_ANAPD/20-88------------------------------KSLDD.....LEKL------------RIKYL.GK.KGEIT.DLKKSIAKL
SYFA_RHOCS/19-87------------------------------PDLPA.....LEEA------------RVAAL.GK.KGRIT.AMMGDMRSL
SYFA_EXISA/20-88------------------------------STQKS.....LNDV------------RIKYL.GK.KGPMT.EVLRGMGKL
R5QB69_9BURK/19-87------------------------------NAAAA.....LEDA------------KARYL.GK.TGSLT.MLMKELGRL
E3DR66_HALPG/22-90------------------------------EDLDQ.....LEDL------------RIKYL.GK.KGAIQ.SVFSKMGKI
Q98QL3_MYCPU/9-78------------------------------KTLEE.....LKQY------------KFKIY.GK.DGELA.KKQEQIKKA
SYFA_COXBU/20-88------------------------------QSEIV.....LEEI------------RVDYL.GK.KGKLT.ELLKSVGQM
SYFA_STRT2/24-92------------------------------EHSKE.....LQEL------------RVAVL.GK.KGSLT.ELLKGLKDL
R7MHN4_9CLOT/20-88------------------------------SSVKD.....LEDI------------KFKYL.SR.KGEFN.EIKKGLKDL
SYFA_HAMD5/19-87------------------------------QNTEA.....LDLI------------RVSYF.GK.KGHFS.THMASLSQL
SYFA_SYNPX/29-97------------------------------SDAAA.....LEQL------------RVGLL.GK.KGRIS.GVLWAMGKL
R6U6G1_9CLOT/20-88------------------------------HNLVE.....LDKV------------RVSYL.GK.KGSVT.GLLKAMKDL
V4IYP3_9GAMM/24-92------------------------------ANLAE.....LEQV------------RIRYL.GK.SGLLT.AQLKALGTL
R6VD34_9FIRM/20-89------------------------------NASSS.....LEEL------------RRNFL.SK.KGYVS.GLMKELGKV
I7GZ45_9HELI/16-84------------------------------QTLQE.....VENL------------RVEIM.GK.KGILT.QQFAELKNL
L0IXQ8_MYCSM/42-110------------------------------ADLDE.....LARA------------KTEHL.GD.RSPIA.LARQALGSL
SYFA_XANCP/19-87------------------------------HTPDQ.....LETL------------RVALL.GK.NGSIT.AQLKQLGTL
SYFA_METPP/19-87------------------------------RTPAE.....LEDA------------KAAFL.GK.SGELT.ARMKQLASL
C1A064_RHOE4/37-105------------------------------ADLDA.....LAHV------------KVEHL.GD.KSPIA.LARRGLGSL
E3PXU7_CLOSD/20-88------------------------------EEMDI.....LENL------------RVQYM.GK.KGELT.NILKEMGKL
V6F5W0_9PROT/19-87------------------------------DTIEA.....LETA------------RVAAL.GK.KGSIS.ALMGALGKM
C8WKG2_EGGLE/39-107------------------------------ADTAA.....LEQV------------RIGVL.GK.AGTLT.GYLRQMGQI
A7I0N3_CAMHC/33-101------------------------------QNLAE.....LEAI------------RLSLF.GK.NGEIT.ELFSKLKSL
F7YY40_9THEM/17-85------------------------------DKLSE.....LDRV------------KALYL.GK.KGIIT.EQMKNIANL
SYFA_NITEU/25-93------------------------------ESIVD.....LEQI------------KAQYL.GK.TGEIT.ILLKGLREL
D2S8R2_GEOOG/36-104------------------------------GDLEQ.....LAAV------------RPAHL.GD.RAPVL.LARRELGAL
R5UWU8_9FIRM/20-88------------------------------TDAKQ.....LDAI------------RVQYL.GK.KGALT.AILKQMGKL
R7G4R5_9FIRM/19-87------------------------------KDVNE.....LQQL------------RVLYL.GK.KGPIQ.EVMKSMKDL
SYFA_PHYAS/21-89------------------------------NSLEN.....LIYL------------EQKFL.GK.KSFLQ.ELNQTLKNI
E3CXV9_9BACT/23-91------------------------------RSLGD.....LEAL------------RLEYL.GK.KGALT.GLLRLLGQA
SYFA_SULSY/22-90------------------------------FDEKV.....LNEI------------KVKYL.GK.KGLIT.SVLKSLGSL
F4LW88_TEPAE/20-88------------------------------DNIDE.....LNEL------------RVKIL.GK.KGELT.QILRDMAKL
B8HPR9_CYAP4/30-98------------------------------ASLDA.....LEQL------------RITYL.GK.KGQLS.QVLGGMGKL
F7V6I9_CLOSS/20-88------------------------------EDLNS.....LNEV------------RVSVL.GK.KGTLK.AVLKGMKDV
A1SJI4_NOCSJ/36-104------------------------------GDLTE.....LKQA------------RLEHA.GD.RSPLA.LANREIGAL
X5ECJ7_9CORY/27-95------------------------------DDLDS.....LAEL------------RRAHL.GD.DAPVP.SARRNLGSL
D5X0W5_THIK1/19-87------------------------------TDSAT.....LENA------------KARYL.GK.TGLIT.IEMKALAAL
D1A1M3_THECD/36-104------------------------------GDLEE.....LKKV------------RLEHA.GD.RSPLA.LANREIGAL
R6LMC9_9FIRM/20-88------------------------------DVPEK.....LNDV------------RVKFL.GK.KGELT.AVLKGMKDV
D4J8P1_9FIRM/20-88------------------------------GGMDA.....LNDI------------RVSFL.GK.KGELT.AIMKSMRDI
E3H0H0_ROTDC/56-124------------------------------QDFDS.....LKEV------------RLGFF.GD.KGSLS.LANRQMRDL
F0S361_DESTD/21-89------------------------------SSLEE.....LEKL------------RVEFI.GR.KGKVT.ELLKSIPTL
I4B6L1_TURPD/23-89------------------------------ADAEA.....LAQV------------TQNFT.GK.KGALT.GVMKQLGSL
SYFA_AGRFC/19-87------------------------------ADEPA.....IEAV------------RVSAL.GK.KGSVS.ELLKTLGSM
SYFA_EUBR3/20-88------------------------------DGLEK.....LNDV------------RAAIL.GK.KGELT.AVLKGMKDV
E8RRV8_ASTEC/45-113------------------------------QDLAA.....LDAV------------RVSAL.GK.TGRVS.GLLKTLGAL
SYFA_PELTS/20-88------------------------------CSLEE.....LNEI------------RIRYL.GK.KGELT.RVLRSMGSL
SYFA_MYCLE/22-90------------------------------VNLDA.....LALI------------KAEHL.GD.RSPLA.LARQALASL
I0GK52_CALEA/19-87------------------------------NNLEE.....LKQI------------EVFFL.GK.KGKIQ.ELFKQIKSI
SYFA_GLUOX/20-88------------------------------QDRAQ.....WDAI------------RVGTL.GK.SGALT.GLLKQLGRL
SYFA_DESVH/22-90------------------------------SSLQE.....LEEQ------------RIAFL.GR.KGRLA.QVMAHLPEL
E3D9C2_GARV3/41-109------------------------------KTMEE.....LKAA------------KTKYA.GA.QSAMT.LASKSIGSL
F4F3N9_VERMA/36-104------------------------------GDPDA.....LAAV------------RPAHL.GD.RAPVS.LARREIGAL
F9ZSL9_ACICS/15-83------------------------------QDLRA.....LEAL------------RVQYL.GK.KGMLT.QAMQALAGL
S6ATC8_PSERE/19-87------------------------------EDVNA.....LEQI------------RVHYL.GK.KGELT.QVMKTLGDL
SYFA_CLONN/20-88------------------------------SNKAE.....LENI------------RVKYL.GK.KGELT.QILRGMGKL
R7KBS2_9CLOT/18-86------------------------------KDMKS.....LNDL------------KVKYL.GK.KGIIT.ELSSKIKEI
G7UR80_PSEUP/19-87------------------------------QTPDA.....VEAL------------RVALL.GK.SGQVT.AQLKTLGTL
R6HCP7_9CLOT/20-88------------------------------KDLKE.....LNDL------------RVKYL.GK.KGELT.AVLRGLGSL
SYFA_MARHV/19-87------------------------------DNLQA.....LDQI------------RVEYL.GK.KGVIT.QQAKTLGKL
D7GNY8_9FIRM/20-88------------------------------ESKEQ.....LGEF------------WQNFL.GK.KGSIA.DLMKGLGSV
W8FCV6_9BACT/19-87------------------------------TSAEQ.....LDQF------------RIAYT.GR.KGQLA.DLFDQLKTV
D9QKI2_BRESC/19-87------------------------------TTVAE.....VEAV------------RVAAL.GK.TGAIS.GLLKGMGAM
D9SF45_GALCS/31-99------------------------------SDEAE.....LEQV------------KAKYL.GR.DGALT.ALLKGLGKL
F7ZZ47_CELGA/39-107------------------------------RDLDE.....LKSV------------RLAHA.GD.RSPLA.LANRAIGGL
R5ASX9_9CLOT/22-90------------------------------KSAEE.....LEQL------------RVQLL.GK.SGQLT.GILRQMGKL
D5BDU7_ZUNPS/18-86------------------------------TTKEE.....IENF------------RIKYL.GK.KGILN.GFFAEFKNV
F4H7U9_CELFA/29-97------------------------------ADLDQ.....LKAA------------RLAHL.GE.TSPVA.LANRAIGGL
SYFA_MARMS/19-87------------------------------ESESA.....LDDV------------RVHYL.GK.KGALT.ALLKQLGNV
E4RLI2_HALHG/22-90------------------------------ADLDQ.....LEEL------------RIKYL.GK.KGAIQ.SIFSQMGKI
SYFA_ACAM1/24-92------------------------------DTLDA.....LETL------------RVSYL.GK.KGQLS.QILKGMGKL
X4QN04_9ACTO/26-94------------------------------NSLDE.....LKEA------------RLAHS.GD.NAPIT.HANMLIRNL
SYFA_HELHP/12-80------------------------------ENLND.....LERL------------RVEVM.GK.KGILT.QQFALLKNL
R6G2K4_9FIRM/20-88------------------------------AGIDK.....LNDV------------KVAFL.GK.KGQLS.SLLKGMKDV
V5UA03_9BURK/18-86------------------------------PDAAA.....LENE------------KARFL.GK.TGQLT.ELLKGLGKL
I2F4U8_9BACT/19-87------------------------------SDLNE.....LQEE------------KSRLT.GK.QGLIT.SLMKKLKEI
SYFA_SERP5/19-87------------------------------QDVAA.....LDLV------------RVEYL.GK.KGHFT.LQMQSLRDV
D6GSI9_FILAD/20-88------------------------------KDVNL.....LEQV------------RVQFL.GK.KQELA.SLLKEMGKL
R5A3Q5_9CLOT/20-88------------------------------KDEFS.....INNT------------KSKYL.GK.KSEFS.QIMSNMKTL
SYFA_MESFL/20-88------------------------------KTIEE.....AEKL------------KKSLL.GK.ESELS.EILKSLKDS
R7LG46_9BACT/19-87------------------------------SDAQG.....LEEL------------RIKYL.SK.KGVVN.DLMNEFRNV
SYFA_HELMI/20-88------------------------------DTMEA.....LQDW------------RVRIL.GK.KGVLT.GILRGLGAL
SYFA_COLP3/23-91------------------------------SDPTA.....LDQV------------RVNFL.GK.KGLFT.EQMKGLGKL
R4U488_9MOLU/20-88------------------------------TSLEQ.....LNNL------------QVEYL.GK.KSVLN.EFLKGMKDL
SYFA_MYCMS/20-88------------------------------KDLNS.....WEEL------------KKEFI.GK.DSSLT.TILKSIKTI
SYFA_ACISJ/19-87------------------------------ATPAE.....LENA------------KAQFL.GK.SGRLT.ELMKGMAQL
G8PDN9_PEDCP/22-90------------------------------GDLSK.....LNDI------------RVNLL.GK.KGPLT.EVLRGMRDL
K9UIS3_9CHRO/23-91------------------------------QTLEA.....LEQL------------RVDYL.GK.KGEIS.KILGGMGKL
R5HFN5_9SPIR/20-88------------------------------ASISD.....LDEI------------RGKYL.SR.KGEFN.EIKKNLKNL
R6TA42_9FIRM/20-88------------------------------RTAVD.....LEAV------------RVRYL.GK.KGELT.AVLKQMGKL
R6FW94_9CLOT/20-88------------------------------ENSAA.....LEEI------------RVKYL.GK.KGELT.TILRGMGSL
R6NNV6_9FIRM/20-88------------------------------NSLDK.....LNEV------------RVAFL.GK.KGELT.AVLKGMKDV
SYFA_HERAR/19-87------------------------------DDAAA.....LENA------------KAKYL.GK.TGQIT.EQMKSLGKL
SYFA_AZOSB/19-87------------------------------SDSAQ.....LEQA------------KARYL.GK.SGALT.EQLKGLGKL
S5XVV2_PARAH/19-87------------------------------SDAPA.....LEEV------------RLAAL.GK.KGEIS.GKMKELGKM
A5IXK6_MYCAP/11-79------------------------------KSFEE.....YKQA------------KNLVF.GA.GSEIE.ELKAKIKNS
Q01SP8_SOLUE/21-89------------------------------QTPEE.....LEAV------------RVDAI.GR.KGALA.EISKGMGKL
B9KHH4_ANAMF/26-95------------------------------SSVEE.....LDEV------------RGRYI.GR.GGALT.ALLRQISTI
E1X2F2_HALMS/20-88------------------------------TNQAD.....ILNL------------KSEFI.GK.KGLIS.EVLKSLKDA
R6MS00_9FIRM/20-88------------------------------TDIDA.....LEEA------------RIKFL.GK.KGELT.AVLKGMGQL
X4ZW87_9BACL/20-88------------------------------QDPQT.....LNDL------------RVKYL.GK.KGELT.EVLRGMGSL
SYFA_EXIS2/20-88------------------------------STQKE.....LNDV------------RVKYL.GK.KGPIT.EVLRGMGKL
SYFA_PETMO/22-91------------------------------TDMQE.....FQNL------------KSKYL.GK.KGLIK.SLMNSLKDI
R6DM83_9FIRM/20-88------------------------------KDASE.....LETL------------RVNFL.GK.SGHVT.ALLKGMGKL
R7BVH7_9FIRM/20-88------------------------------QTSQD.....LNDV------------RVKYL.GK.SGEIS.LLMRDMANV
B1XPE3_SYNP2/28-96------------------------------TDLDA.....LEKL------------RVNYL.GK.KGQLS.QILRGMGKL
SYFA_GLUDA/20-88------------------------------TDRRE.....WDAV------------RVGTL.GK.SGRLT.ALLKELGRM
E8MZH5_ANATU/22-90------------------------------NDSAS.....LEAW------------RVAYL.GR.NAPVM.QVFSRLGQA
SYFA_STAEQ/22-90------------------------------NDAQA.....LQEV------------KVKYL.GK.KGSVS.ALMKNMKDL
D2UDK3_XANAP/19-87------------------------------QSPEA.....LEQL------------RVALL.GK.SGSIT.AQLKQLGGL
E7ACE4_HELFC/15-83------------------------------TALKE.....LEDL------------RLQAL.GK.KGVLT.QEFAQLKNL
T0VHA3_9ENTE/22-90------------------------------RSINE.....LNQI------------RVDVL.GK.KGPIT.EVLRGMKEL
R7IK97_9BURK/19-87------------------------------TQPAA.....LEDA------------KAKFL.GK.SGTLT.TMMKGLRDL
H1XPD0_9BACT/20-89------------------------------KSPAD.....LEPI------------RVKFL.GR.KGLVS.TSFERISEL
K4ISW6_PSYTT/18-86------------------------------DNTED.....LEQF------------RIQYL.GK.KGILN.TFFAEFKNV
A8HWM7_AZOC5/27-95------------------------------SGEAE.....LEQV------------RVYAL.GK.KGSVS.ELLKSLGTM
R5GEX2_9PORP/19-87------------------------------KTEEE.....LEAL------------RLKYL.SK.KGLIN.QLMADFKSV
SYFA_AERHH/19-87------------------------------SDIAA.....LDEI------------RVKYL.GK.KGFFT.EQMKGLGAL
SYFA_TOLAT/19-87------------------------------TDNNA.....LEAL------------RVEYF.GK.KGVFT.EQMKALAGL
R6IN57_9CLOT/20-88------------------------------DSAEQ.....LEKA------------RIQYL.GK.KGELT.AILKQMGKL
R6LN02_9CLOT/20-88------------------------------EHLDR.....LNEI------------KVSFL.GK.KGELT.SVLKAMKDV
A5WHW5_PSYWF/67-135------------------------------ATSAD.....LQQM------------RVNLT.GK.KSALT.QWSKQMGKL
R7KRG6_9FIRM/20-88------------------------------GDLKV.....MEEL------------RVKFL.GK.KGELT.AILKQMGGL
R5YA39_9MOLU/18-84------------------------------NDLKS.....LNEI------------KVLYL.GK.TGIIT.ILQNGIKEA
SYFA_CLOTH/20-88------------------------------GTIAE.....LENI------------RVKYL.GK.KGELT.AVLRGMGSL
C7NHA7_KYTSD/44-112------------------------------STLEE.....LKTA------------RLAHL.GD.KAPIS.LANRSIGGL
G0VPM6_MEGEL/21-89------------------------------EHLQD.....VQDI------------RVKFL.GK.KGELT.AIMKEMKNF
A5GUT5_SYNR3/29-97------------------------------PDAAA.....LEQL------------RIDLL.GK.KGKLS.GVLGAMGKL
R7D5X6_9ACTN/22-90------------------------------DDAEK.....LEAA------------RVALL.GR.KGRVT.GLMRMMGKL
C7M0T2_ACIFD/36-104------------------------------ADRDE.....LAAI------------REAAL.GP.QSPLA.VLSRSIRNL
J3TWY8_9ENTR/56-124------------------------------QDINA.....LEAV------------RVEYL.GK.KGYFC.RHMTALRAL
K9P790_CYAGP/29-97------------------------------EDAAA.....LEEL------------RVGLL.GK.KGRLS.GVLGAMGRL
R6B6R7_9BACT/19-87------------------------------QNAEE.....VEQL------------RLKYL.SK.KGSIN.ALMADFRTV
SYFA_CELJU/19-87------------------------------GDLNA.....LEAV------------RVDYL.GK.KGHIT.ALMKNLGGL
Q189P4_PEPD6/20-88------------------------------QSIES.....VESL------------RVKYL.GK.KGEIT.AILKEMGKL
D9QUN5_ACEAZ/20-88------------------------------ADLEE.....LEEL------------RIKYL.GK.NGEVT.EILQNIGDL
F2JID4_CELLD/20-88------------------------------NSLAV.....LEEL------------RVQYL.GK.KGELT.AVLRNMKDL
SYFA_RALPJ/20-88------------------------------EDNAS.....LENE------------KARFL.GK.SGVLT.DLLKGLGKL
R7IV52_9CLOT/20-88------------------------------KNSQD.....LQEL------------KVQFL.GK.KSELS.NLLKGLGAL
D6S5A6_9LACO/43-111------------------------------ENEKK.....LNDV------------RVTLV.GK.KGELT.EILHSMKEV
R6P7N0_9CLOT/20-88------------------------------ENIKE.....LNEI------------KVKYL.GK.KGELT.VVLRGMGAL
I3VXF5_THESW/20-88------------------------------ENLKT.....LEEI------------RVKYL.GK.KGELT.KILRGMGNL
I4CA98_DESTA/20-88------------------------------KDQRI.....LSEI------------RTRLL.GR.KGELT.SILRSLKDL
C7RCY1_KANKD/29-97------------------------------QSLPD.....LEQV------------KARFV.GK.KGLIT.AQMQQMAKL
R6ZH22_9CLOT/22-90------------------------------TTLKE.....LNDL------------KVEYL.SK.KGPIS.ELSSLMKEI
R7GMW7_9FIRM/19-87------------------------------ADAKE.....LNDL------------RVFYL.GK.KGPIQ.AAMKSMKTM
G2SPC6_LACRR/22-90------------------------------DNSQK.....INEI------------RVNLL.GK.KGPIT.EVLRGMRDL
SYFA_ACIF2/20-88------------------------------SDLNT.....LEQI------------RLRWL.GR.KGVLT.EAMQQLGQL
A9WQ67_RENSM/39-107------------------------------SDLEQ.....LKEA------------RLAHT.GE.KSPLS.LANRGIKDI
SYFA_DECAR/19-87------------------------------SDPDA.....LEQV------------KARFL.GK.SGQIT.ELLKGLGKL
SYFA_GEOLS/20-88------------------------------TTEEM.....LNEV------------RVRYL.GR.KGELT.GLMKGLGSL
K0CI96_ALCDB/20-88------------------------------GDARV.....LDEV------------RVRYL.GK.KGEIS.ALLKSLGGL
SYFA_GEOUR/20-88------------------------------STEDG.....LQEL------------RVKYL.GK.KGELT.AVMKGLGAL
A1SUQ5_PSYIN/31-99------------------------------ADGNE.....LEQI------------RLQYL.GK.KGLMT.EQMKGLGKL
D5WS18_KYRT2/20-88------------------------------EDSNQ.....LEAW------------RLRFL.GK.KGQLT.AVLRGMAKL
Q03Z09_LEUMM/28-97------------------------------NDKNA....DIEQL------------RVKLL.GK.KGELT.GLLKGMKDV
D9T5W1_MICAI/36-104------------------------------TDPDA.....LTAL------------RPAHL.GD.RSPVS.LARREIGAL
C6WX39_METML/19-87------------------------------ASMND.....LEIA------------KAKYL.GK.SGSLT.DALKSLGKL
R6TDN0_9FIRM/20-87------------------------------ESASE.....LETL------------KIEYL.GK.KGRVA.ALMSDLKNV
R7GHP6_9CLOT/22-90------------------------------KNKIE.....LTNE------------KANVL.GK.KGPFA.QIMANMRNL
R7N4V7_9FIRM/25-94------------------------------KNSKE.....LYEF------------KNVYLEGK.KSKIS.ELMKDMGKL
C0Z9E7_BREBN/20-88------------------------------TEAAQ.....LQDL------------RVKYL.GK.KGELT.ELLRGMGSL
D7GEE1_PROFC/31-99------------------------------KDSAQ.....LKQA------------RAAHA.AD.KSPLA.LANRRIGSM
F2I081_PELSM/19-87------------------------------ESKES.....LEKL------------KIEIL.GK.KGTLS.KLFQDLATI
C4XL15_DESMR/25-93------------------------------LALEE.....LEAA------------RVEFL.GR.KGQLA.AVMSRLPGL
B3DYQ7_METI4/16-84------------------------------SKKEE.....IEAI------------RIKYF.GR.KGLVP.SLLEKIGQM
F3YW55_DESAF/27-95------------------------------SSLQD.....LESA------------RVEYL.GR.KGRLA.QAMSAMAGL
SYFA_LACC3/22-90------------------------------KSLDE.....LNQI------------RVQLL.GK.KGPIT.GVLRGMKDL
SYFA_IDILO/18-86------------------------------DSPTA.....LDEV------------RVEYM.GK.KGQLT.ELLKGLGKL
D0LY94_HALO1/25-93------------------------------SSEQE.....IRAF------------QAQFM.GK.KGEIS.QLMKQMGKV
R5B562_9CLOT/20-88------------------------------REEKE.....LEEL------------NSSVL.GR.SGSLT.GILRTMGQL
M4REU1_9BIFI/27-95------------------------------SSSEE.....LKAI------------KTQYA.GA.ESAMT.QASKAIGSL
C7Q9J1_CATAD/36-104------------------------------ASLDA.....LHQV------------KIAVA.GD.RAPLA.LANREIGAL
SYFA_FRATT/19-87------------------------------KDKKT.....LDDI------------RVKYL.GK.KGELT.EMMKLIATL
SYFA_ZYMMO/19-87------------------------------GDLAG.....LESV------------RVHAL.GK.QGVVT.ALLKSLGKM
M4R8Y3_BIBTR/19-87------------------------------NDIAA.....IEAL------------RVEYF.GK.KGHFT.ALMQGLRDV
I0DZ93_PROSM/19-87------------------------------QDVAT.....LESV------------RVEYL.GK.SGHFT.LQMKTLRDL
S6BY94_9ACTN/22-90------------------------------DTSAA.....LEAV------------RVAVL.GK.SGTLT.GYLRSMGQV
I3UCD6_ADVKW/20-88------------------------------TDSAS.....LENE------------KAKFL.GK.NGVIT.GFMKGLAQL
SYFA_LACJO/22-90------------------------------ENQKM.....LDKI------------RVELM.GR.KGELT.EILHSMKDI
SYFA_BACSU/20-88------------------------------SSLKV.....VNDI------------RVQYL.GK.KGPIT.EVLRGMGKL
I0GPD3_SELRL/20-88------------------------------ADMTA.....LNDI------------RVKYL.GK.KGEFT.AILRGMGSL
B0JLL0_MICAN/27-95------------------------------TTLED.....LEQL------------RVNYL.GK.KGELS.QILREMGKL
D5X800_THEPJ/20-88------------------------------ATMDE.....VNEI------------RIKYL.GK.KGLLT.GILRGMGSL
SYFA_LACPL/22-90------------------------------DVLKK.....VNQV------------KVDLL.GK.KGPIT.EVLRGMRDL
K0K6A5_SACES/36-104------------------------------VDLDE.....LAAA------------KPGHL.GD.RAPVL.LARREIGAL
D7CNG9_SYNLT/20-88------------------------------SSLNE.....VKEV------------RVRFL.GR.KGEIT.QVLRGIKDL
R4HZV7_9ENTR/19-87------------------------------QDAAA.....LDLV------------RIKYL.GK.KGYFA.IQMQSLHNI
R7MJD6_9FIRM/20-88------------------------------GEIKE.....LEAL------------KIKYL.GK.KGELT.AILKQMGKL
B8D293_HALOH/22-90------------------------------KDLDH.....LEQL------------RVKYL.GK.KGEIT.SVLRQMGKI
F3YAD3_MELPT/22-90------------------------------QSLTK.....LNQI------------RVEIL.GK.KGPIT.EILRGMKNL
SYFA_PASMU/19-87------------------------------EDGKA.....LDAI------------RVEYF.GK.KGPFT.ALMQGLRDV
R7CPG5_9FIRM/22-90------------------------------EGLEK.....LNEV------------RVAYL.GK.KGELT.AILKSMKDV
D5CSM8_SIDLE/19-87------------------------------EDATE.....LENA------------KARYL.GK.EGSLT.GLLKGLGKL
W0ELN7_9PORP/18-86------------------------------SKSED.....LEAI------------RIKYL.SK.KGEIS.QLFNDFRSV
H0UKB5_9BACT/28-91------------------------------..........LQDI------------KVRFF.GK.KGDMT.QLQKLLGKM
L0F475_DESDL/20-88------------------------------ATLEE.....LQEL------------KVKVL.GK.KGSLT.AQLRKMGGL
R6DZH5_9BACT/19-87------------------------------QNAEE.....LEQL------------RLKYL.SK.KGEIN.ALMADFRNV
F7XVN5_MIDMI/19-87------------------------------SNFTE.....LFNL------------KAKFL.GK.KSLLV.EQMAKLGAL
H5WWU4_9PSEU/36-104------------------------------TDLDE.....LAAA------------KPAHL.GD.NSPLL.LARRAIGSL
R6N1T7_9CLOT/18-86------------------------------TKQNE.....LNDI------------KSKYL.GK.EGVIT.LLQSKIREI
F7XXQ9_MOREP/19-87------------------------------QDLDA.....LEHV------------RVEYF.GK.KGIFT.QKMKMLQDL
SYFA_OCHA4/19-87------------------------------ADEPA.....IEAV------------RVAAL.GK.KGSVS.EKLKTLGSM
R7EK62_9FIRM/20-86------------------------------D..AD.....LEAL------------RVRYL.GK.KGELT.AVLRGMAGL
G4QLB8_GLANF/18-86------------------------------KTPAE.....LDAV------------RVAYM.GK.KGKIT.DLMKGLGKL
SYFA_METS4/19-87------------------------------ADEAA.....LEGV------------RVAAL.GK.KGAVS.ELLKTLGSL
R5RYR4_9FIRM/20-88------------------------------EKAED.....LEAL------------RVQYL.GK.KGELT.AVLKQMGKL
E3GNL2_EUBLK/20-88------------------------------SDMKS.....LDDI------------RVKYL.GK.KGVLT.AALKEMGKL
T2GAK0_DESGI/37-105------------------------------ALADA.....LEAV------------RVEFL.GR.KGRLA.GLMAKLGTA
D1AVE8_STRM9/20-88------------------------------DSMQD.....FNDM------------KVRYL.GK.KGEFT.AIMKEMGNI
R4KE67_CLOPA/20-88------------------------------VKKEE.....LEKL------------RVKYL.GK.KGELT.QILRGMGAL
Q0AAL9_ALKEH/24-92------------------------------ENPTA.....LDAV------------RVAYL.GK.KGRLT.EALKGLGKL
D3DJY1_HYDTT/20-88------------------------------KSLQK.....LLEV------------KAKYI.GK.EGIIT.QALKAIREV
SYFA_XYLFA/21-89------------------------------QNLDH.....LEVL------------RVALL.GK.NGSIT.LQLKQLGKL
SYFA_SYMTH/20-89------------------------------ADVGA.....IQEM------------RVRYL.GK.KSELS.QVLGGLGRL
SYFA_CLOPE/22-90------------------------------KDSTT.....IDTI------------RVKYL.GK.KGELT.TILRGMGSL
R5R6S6_9FIRM/20-88------------------------------RTLEQ.....LNEV------------RVSQL.GK.KGALT.EILKGMKDV
S6B2P5_9PROT/19-87------------------------------DNPAE.....LEQA------------KARYL.GK.SGVLT.EQLKQLGKM
F8C4E3_THEGP/21-89------------------------------EDFSQ.....LENF------------RIKYL.GK.KGKIT.SFLKLLKEL
B1MAZ4_MYCA9/32-100------------------------------DNLDG.....LAQA------------KIDHL.GE.KSPLA.QARQALGSL
F2NFL0_DESAR/21-88------------------------------GSAPA.....LDQI------------RVKYL.GR.KGIIT.QALRSLGGL
D5EXW8_PRER2/19-87------------------------------KNAEE.....VEQL------------RLKYL.SK.KGEIT.ALMNDFREV
R5V6J1_9FIRM/20-88------------------------------QTVKE.....LQEL------------RIEIL.SK.KGVFA.SFMETLKQV
R6E265_9FIRM/31-99------------------------------DTIQD.....AEDV------------RIKVL.GK.KGELT.EMLKSMGKM
R6QQ94_9CLOT/20-88------------------------------DAPEK.....LNDV------------KVRFL.GK.KGELT.AVLKGMKDV
R6R5N3_9FIRM/20-88------------------------------DNLDK.....LNEI------------RVAYL.GK.KGELT.EVLKGMKDV
R5JDE9_9BACE/18-86------------------------------ANAEE.....LEAL------------RIKYL.SK.KGAIN.DLMADFRNV
R7XSC5_9ACTN/36-104------------------------------ADLDE.....LKQV------------RLDHA.GD.RSPIA.LANREIGAL
F2LY11_HIPMA/16-84------------------------------ENQEQ.....LKQL------------KAQFL.GK.KGKIT.AFFKQLKGL
A7HPL0_PARL1/20-88------------------------------VDSDT.....LEAV------------RVAAL.GK.KGRVS.DLMKGLGSM
R6QXL8_9FIRM/20-88------------------------------DAMDT.....LNDI------------RIAVL.GK.KGELT.QVLKGMKNV
Q4A6A0_MYCS5/9-77------------------------------NNLED.....LKKL------------KAKLN.AA.DSEMS.LLKEEIKKV
D1C4D6_SPHTD/20-88------------------------------CDSQA.....LAAW------------YAQYL.GR.KGEVT.SLTRRLGAL
R6BMJ6_9FIRM/20-88------------------------------NRLDK.....LNEV------------RVSFL.GK.KGELT.AVLKGMKNV
SYFA_ACIAC/19-87------------------------------ATPTD.....LENA------------KAQFL.GK.AGRVT.ELLKGLAQL
SYFA_ALCBS/19-87------------------------------GDIRA.....LDDV------------RVKYL.GK.KGEIS.ALMKGLGKL
M4SHK9_9SPHN/19-87------------------------------DSLEA.....IEAV------------RVTAL.GK.ASEIA.ALMKTLGGM
A1WU57_HALHL/24-92------------------------------SDLAG.....LDQV------------RVAYL.GK.KGKLT.ALLKGLGQL
R6T031_9CLOT/18-86------------------------------TDLNS.....LNEL------------KVKYL.GK.KGMLT.ELNQEIKNI
R5YQL5_9FIRM/20-88------------------------------ENLDK.....LNEI------------RVAYL.GK.KGQLT.EVLKGMKDV
G2J1F0_PSEUL/35-103------------------------------QDLVE.....LEQV------------KARYL.GK.SGELT.ELLKQLGKL
SYFA_SORC5/25-93------------------------------GDLDE.....LNRL------------YASLL.GR.RGSLN.ALMKQLPGA
L0RXE4_MYCC1/8-76------------------------------NTLED.....LKKA------------KAKVY.GK.EGEIA.KLQNELKLA
SYFA_DESDA/22-90------------------------------SSLEG.....LEAL------------RVDFL.GR.KGRIA.QIMSRLPSL
D3IE04_9BACT/19-87------------------------------NNAEE.....IEQL------------RIKYL.SK.KGEIS.LLMNDFRDV
SYFA_MYCPA/28-96------------------------------GDLDA.....LARL------------KTEHL.GD.RAPLA.LARQALGGV
L0H1M4_9GAMM/23-91------------------------------VDLTT.....LDQV------------RVRYL.GK.SGRLT.ALLKGLGKL
K7RLS0_PROA4/36-104------------------------------SSTAE.....LKQV------------RIAHT.GD.RSPLA.LANREIGAL
U5RSK4_9CLOT/23-86------------------------------..........IEDI------------RVKYL.GK.KGELT.KILRGMKDL
R7GEQ5_9CLOT/20-88------------------------------KDLKQ.....LQDL------------KVKYL.GK.KGELT.QVLRTMGTL
SYFA_METRJ/19-87------------------------------SDEAA.....LDAV------------RVAAL.GK.KGSVS.DLLKTLGSM
E1VCP7_HALED/19-87------------------------------ESMAA.....LDEL------------RVRYL.GK.KGEIT.ALLKGLGQL
B1VH38_CORU7/34-102------------------------------TNLEE.....LAEA------------RRAHL.GD.DAPIP.AARRSLGSL
A4SX37_POLSQ/19-87------------------------------ADSAA.....LEDA------------KAKYL.GK.SGVLT.ERLKALGGM
SYFA_METSB/19-87------------------------------ADESA.....LEAV------------RVASL.GK.KGSIS.ALLSGLGKM
B2UP39_AKKM8/20-88------------------------------SDRRG.....VEDA------------RVAIL.GK.KGELT.LAQTGMKDV
SYFA_SPHWW/16-84------------------------------ATLAD.....LEAI------------RVRTL.GK.SGTIT.ALLKTLGAM
R5F0P7_9CLOT/20-88------------------------------EALER.....LNDI------------RVSYL.GK.KGELT.NLLKSMKDV
SYFA_BUCAI/19-87------------------------------KKISE.....LDKI------------RIKYL.GK.KGVLT.AFMKKLKDF
SYFA_AZOPC/18-86------------------------------NNSKE.....LETL------------RIRFL.GK.KGEIA.SLMSGFRNV
L0EXG1_LIBCB/19-87------------------------------NNEDE.....LDAV------------RVAAF.GK.NGSFN.ILLKQLKEL
C8W0F2_DESAS/20-88------------------------------ENLGQ.....LNDI------------RVRVL.GK.KGSLT.QVLRGMGSL
D3RRM3_ALLVD/24-92------------------------------ADAAA.....LDQV------------RVHYL.GK.SGELT.ALLKQLGTL
SYFA_HELPY/12-80------------------------------TNSKE.....LEEA------------RLNAL.GK.KGVFA.DKFNQLKHL
A8LE36_FRASN/36-105------------------------------DDLAA.....LSAV------------RTAHVDGQ.QAPLM.LARRELGAL
Q31LH5_SYNE7/27-95------------------------------SDREA.....LEQL------------RIAFL.GK.KGELS.AILGAMGKL
E0TF60_PARBH/21-89------------------------------PDEAA.....LEAV------------RVAAL.GK.KGAVS.DRLKTLGKM
U3GUI6_9CORY/29-97------------------------------DNLEE.....LSEA------------RRAHL.GD.DAFIP.TARKTLGSL
SYFA_DEHM1/22-88------------------------------TELKD.....LEAW------------RVRYL.GK.KSLLT.GALRNLASL
R7B7I6_9ACTN/22-90------------------------------ATSDA.....LEAI------------RIKVV.GK.SGSLT.GYLRSMGQV
D4JWI3_9FIRM/20-88------------------------------VDVKQ.....LDEL------------RVKYL.GK.KGELT.AILKSMGKL
R7H7C7_9FIRM/20-88------------------------------KDARE.....LDAV------------RVKYL.GK.KGAIT.GILKQMGKL
C4Z1H7_EUBE2/32-100------------------------------DSLDK.....LNDI------------RVAFL.GK.KGELT.EVLKGMKEV
Q1LT08_BAUCH/19-87------------------------------NDLKT.....LELT------------RIKFL.GK.KGYFN.QQVLYLRHQ
SYFA_PELUB/19-87------------------------------LDLNQ.....VNQI------------KTELF.GK.TGLIS.SQFKQLGKL
R6F3S1_9FIRM/20-88------------------------------TSLQE.....AEET------------RIKVL.GK.KGALT.EILRSMGGL
J9W5T8_LACBU/22-90------------------------------NDLKA.....LNEI------------RVHLL.GK.KGPIT.AALRGIKEL
W0BIG8_9GAMM/19-87------------------------------QEISQ.....LEAI------------RVDFL.GK.KGRLT.EILKGLAHL
R6WVX3_9BACT/19-87------------------------------KSAEE.....VEQL------------RLKYL.SK.KGAIT.ALMAEFRDV
W5WXT0_9CORY/32-100------------------------------QDLDD.....LAAA------------RRDHL.GD.DAPIP.AARRSLGSL
F8E9V3_FLESM/19-87------------------------------DSLER.....LYAV------------KVKYM.GK.KGQIS.SLNKQMKSV
SYFA_LACRD/22-90------------------------------EDLKR.....INEI------------RVKML.GK.KGPIT.SVLRGMRDL
R5E803_9CLOT/20-88------------------------------KDLDS.....LNDI------------KVAVL.GK.KGELT.AVLKSMKDV
SYFA_LEGPH/24-92------------------------------TDIVA.....LEQI------------RVDFL.GK.KGKLT.ELLKGLANL
D9RXS8_THEOJ/20-88------------------------------GNLEE.....LNDL------------KIKFL.GK.KGKLT.VILRGMADL
C8XIG1_NAKMY/48-116------------------------------ADLDA.....LKTV------------RLAHA.GD.RSPLA.LTNRALADL
Q03G90_PEDPA/29-97------------------------------NELSK.....LNEV------------RVNFL.GK.KGPIT.EVLRGMRDL
SYFA_CLOAB/20-88------------------------------VDKKN.....IEEI------------RVKYL.GK.KGELT.QILRGMGAL
A4CII5_ROBBH/18-86------------------------------DTPEA.....IEAF------------RIKYL.GK.KGLLT.AFFAELKNV
K9YL41_CYASC/24-92------------------------------DNLKK.....LEEL------------RVAYL.GK.KGELS.LILKGMGKL
R5LKL7_9MOLU/20-81------------------------------KKLED.....LQEV------------TREIT.GK.KSELT.EALKSLSEL
R5SN45_9CLOT/20-88------------------------------EQLEH.....LNDV------------KVAFL.GK.KGELT.SVLKSMKDV
SYFA_CHLT3/18-86------------------------------TDKDS.....AEAF------------RLKFL.VR.KGSIP.QLFEQMKTV
E6K031_PARDN/27-95------------------------------TNLDE.....LKAV------------RGQYA.GG.DSVLA.KSSKAIGSL
SYFA_RUEST/16-84------------------------------TDENA.....LEAV------------RLAAV.GK.KGEVA.LKMRELGKM
K9Q3B2_9CYAN/28-96------------------------------GDLDE.....LDKL------------RVSFL.GK.KGKLS.QILRGMGKL
X2HAV3_9NEIS/19-87------------------------------IDLPA.....LELV------------KASYL.GK.TGELN.ALLKTLGKM
SYFA_ACIAD/22-90------------------------------QDLAA.....LDQV------------RVLFT.GK.KSQLA.EQSKALGKM
SYFA_CLOK5/25-88------------------------------..........IESI------------RIKYL.GK.KGELT.HILRGMKEL
R5Z7J1_9FIRM/19-87------------------------------QNSKD.....LNDL------------RVYYL.GK.KGPVQ.SLMKNMKDL
SYFA_DESAG/22-90------------------------------SSLEM.....LEEL------------RIDFL.GR.KGRLA.QIMGRLPEL
SYFA_ACTSZ/21-89------------------------------KGIEA.....LENF------------RVEYF.GK.KGHFT.QLMQGLRDV
F8IB26_SULAT/18-86------------------------------HDLRQ.....LDAV------------RHQWV.GR.KGWLT.EQMKALSQL
R6XTB5_9CLOT/20-88------------------------------KTLQE.....LENV------------RVKYL.GK.KGELT.AVLKGMKDL
J7QS32_METSZ/19-87------------------------------ADEAA.....LEAV------------RLAAL.GK.KGAIS.ALLATLGKM
F5XS48_MICPN/36-104------------------------------TSLAE.....LKAA------------RLAHA.GD.KSPIA.LANREIGSL
K9VJX0_9CYAN/27-95------------------------------NTLEQ.....LEQL------------RVGYL.GK.KGQLS.QILGMMGKL
H2FW09_OCESG/19-87------------------------------ATAAE.....LDEI------------RVRYM.GK.KGTFT.EQSKALGKL
R5YBL9_9BACE/18-86------------------------------TKAEE.....LENL------------RIKYL.SK.KGEVS.QLFNDFRNV
I1YF39_METFJ/26-94------------------------------DDLRA.....LDAI------------RVDYL.GK.KGQIT.AYLKALGDV
F6IJP6_9SPHN/18-86------------------------------SDLDT.....LEAL------------RVEFL.GK.QGSIS.GLLKTLGKM
R5YC76_9FIRM/20-88------------------------------DGLAK.....LNDV------------RVSIL.GK.KGELT.AVLKGMKDV
W0HTN2_9ENTR/19-87------------------------------QDMDA.....LELV------------RVEYL.GK.KGHFT.QQMQALRDL
F0RKC4_DEIPM/13-81------------------------------QDLDT.....LQQV------------KTRYV.GK.KGLVT.QELGALGKL
SYFA_GLOVI/20-88------------------------------ADLTI.....LERI------------RVDFL.GK.KGKLS.ALLGGMARL
R5W508_9DELT/19-87------------------------------TSLSA.....LQDL------------KVKYL.GK.SGELT.VLLKSIKDL
F5Z2P0_MYCSD/31-99------------------------------ADLDA.....LAHA------------KTEHL.GD.KAPLA.LARQALAKL
SYFA_SULDN/12-80------------------------------QSVEK.....IEEI------------RISLF.GK.KGVLA.AEFARMKEA
C4LID3_CORK4/26-94------------------------------TTLDD.....LVQA------------RKEHL.GD.SAPIP.LARRSLGSL
R5R807_9PROT/19-87------------------------------SDIKM.....LEEA------------RVAIL.GK.KGRIT.EMMKGLGAL
R7DDA6_9PORP/18-86------------------------------SKADE.....IEAL------------RIKYL.SK.KGEIS.LLFNDFRNV
F8HZ92_WEIKK/23-91------------------------------KNAQD.....LQNA------------RVNWL.GK.KGSLT.NILRGMKDL
R5Q106_9PROT/19-87------------------------------ATAAE.....LDAV------------RVSVL.GK.KGIIT.EKMKTLGAM
SYFA_LEPIN/22-90------------------------------ISEED.....LDKN------------KNDFI.GK.KGKLT.AVLKNVASL
F8GLG0_NITSI/19-87------------------------------EDPIE.....LENV------------KARYL.GK.SGILT.ELLKGLGKL
R6FA66_9FIRM/26-94------------------------------ENTKG.....VYEY------------KKTIL.DK.NGIIG.GLMKQMGSV
S6CG63_9GAMM/20-88------------------------------ADLRA.....LDEV------------RVRYL.GK.SGVFT.GQLKQLGKL
J7L2J3_NOCAA/36-104------------------------------ADLAE.....LKEV------------RLAHA.SD.RSPLA.LANREIGAL
SYFA_BURPS/18-86------------------------------ADITT.....LENE------------KARFL.GK.SGALT.ELLKGLGKL
SYFA_ALKOO/20-88------------------------------DSTAV.....LEQA------------RVHYL.GK.KGELT.EILRGMGAL
R7JLX9_9FIRM/26-95------------------------------KSSKE.....LYEF------------KSEYLEGK.KSKIS.GLMKEMKNI
C5J6V7_MYCCR/13-81------------------------------NNLED.....LKLA------------KNSFF.GK.NSYLA.ELQNKIKSA
SYFA_STACT/22-90------------------------------ADEKA.....LQDV------------KVKYL.GK.KGSVS.GLMKQMKDL
A5FVF5_ACICJ/37-105------------------------------GDPAA.....LDAV------------RIALL.GK.TGQVT.ALLKTLGSL
F8J8M0_HYPSM/41-109------------------------------ADLAT.....LDAV------------RVSSL.GK.KGRVS.ELMSKLGSL
V5SCH8_9RHIZ/22-90------------------------------RDLAG.....IEAV------------RVAAL.GK.KGRIA.AQMAKLGGL
A9WDN0_CHLAA/23-91------------------------------ADLSA.....LTEW------------KSRFI.GK.QGRLS.RLSRGLGAL
D1CFI1_THET1/22-88------------------------------SDERS.....LENW------------RVTFL.AR.RGRLA.DIISRIPSL
R6CQE1_9CLOT/20-88------------------------------QDLKD.....LDAV------------RVKYL.GK.KGELT.AILKQMGKL
U5QL78_9CYAN/20-88------------------------------ADLNV.....LERI------------RVDFL.GK.KGRLS.AILGGMGRL
B4U9B8_HYDS0/20-88------------------------------SSLQD.....LEKL------------KSKYL.GK.TGVVK.ELSKAIKDI
Q2JNE8_SYNJB/27-95------------------------------DGLEA.....LEQI------------RIDYL.GK.KGKLS.KILGGMGKL
G4RBQ6_PELHB/43-111------------------------------QDEAA.....LEAV------------RVSAL.GK.KGSIS.ALLATLGKM
F4HFT5_GALAU/19-87------------------------------QDGKA.....LEAI------------RVEYF.GK.KGPYT.LLMQGLRDL
SYFA_BLOFL/21-89------------------------------NTIQD.....VESI------------RIQFL.GK.HGYIN.QQLKKINSL
R5E9Q6_9BURK/19-87------------------------------ATPAA.....LEDA------------KAVYL.GK.NGSLT.ALLKGMAKL
SYFA_RHISN/19-87------------------------------ADEGA.....IEAL------------RVGAL.GK.KGSIS.ELLKTLGTM
R6HX36_9FIRM/15-88------------------------------KSSEAGKVSELEEL------------RIEFL.GK.KGHIA.NLMSELRAL
R7HDC0_9MOLU/16-82------------------------------NNLNE.....LNDV------------KVKYL.GK.SGVIT.ELQSKIRE.
SYFA_LACSS/22-90------------------------------VDLDA.....LNQI------------RVEVL.GK.KGPIT.EVLRGMRDL
R5AT24_9FIRM/20-88------------------------------DDITA.....LENL------------RVKYL.GK.KGELT.AILKQMGRL
I4BW85_ANAMD/23-92------------------------------ENIEA.....LNEL------------RVRYL.GR.RGTVT.QMLKSLGTL
R5MLL8_9FIRM/20-88------------------------------RDATE.....LENF------------RVQVL.GK.KGELT.GILKQMGSL
R6N5W0_9CLOT/20-88------------------------------KLPQE.....IDEL------------RVRFL.GK.KGELT.GILKQMGKL
SYFA_LACAC/22-90------------------------------TDEKT.....LNEV------------RVELV.GR.KGELT.KILHSMRDV
SYFA_METFK/19-87------------------------------ASIAD.....LEQA------------KARYL.GK.SGSLT.EALKGLGKL
K0C0P2_CYCSP/20-88------------------------------SSLSV.....VEEI------------RVTYL.GK.KGVFT.RQMKTLGKL
R6JU62_9PROT/19-87------------------------------ADMKS.....LEEV------------RVSVL.GK.KGRIT.ELMKSLGSL
SYFA_DICTD/20-88------------------------------QNLTE.....LEEV------------KRVYL.GK.QGFLT.QILRSIGKM
R5CK85_9BACT/19-87------------------------------STPEE.....IEAL------------RLKYL.SK.KGEIN.TLMADFRNV
Q2GLQ9_ANAPZ/20-89------------------------------SSREE.....LDEV------------RVKYL.GK.SGLLT.ALLKQISKI
G8QHY1_AZOSU/19-87------------------------------QDPDA.....LEQI------------KARYL.GK.SGQIT.ELLKGLGKL
R7IM63_9FIRM/20-88------------------------------EDLDK.....LNEV------------KVAVL.GK.KGALT.EVLKGMKDV
F9YU16_CAPCC/18-86------------------------------TTKEE.....IEQF------------RIQYL.GK.KGILN.DFFAAFKQV
H8L6D3_FRAAD/19-87------------------------------DSLDA.....LEGL------------RVSLL.GK.SGVVT.QALKALGGL
C7N020_SACVD/36-104------------------------------ADLDA.....LAAV------------KPAHF.GD.QAPLS.LARRAIGAL
G4L7X2_TETHN/22-90------------------------------SDLDS.....LNDI------------RVKTL.GK.KGPIT.EVLRGMKDL
K9SR28_9SYNE/27-95------------------------------ETAEQ.....LEQV------------KVEFL.GK.KGVLP.QLLGGMGKL
R7JWN9_9CLOT/20-88------------------------------DKLDK.....LNEI------------KVSFL.GK.KGELT.SILKSMKDV
E2S9J5_9ACTN/36-104------------------------------GTLAE.....LKQV------------RIDHA.GD.RSPLA.LANREIGAL
D5DLS6_BACMD/20-88------------------------------SALKE.....LNDV------------RVAYL.GK.KGPIT.EVLRGMGKL
SYFA_SHEON/19-87------------------------------SDLKA.....LDDI------------RVDYL.GK.KGKIT.DMMKMMGSL
R7BYI8_9BURK/19-87------------------------------TQPAA.....LEDA------------KARYL.GK.SGAVT.MLMKGLGAL
R5ZWN0_9BACT/19-87------------------------------ADEKA.....LEEL------------RIKYL.SK.KGVIN.GLMGEFRDV
U5T6F3_9GAMM/20-88------------------------------TSVAE.....LDAV------------RVAYL.GK.KGQIT.EQLKSLGRL
SYFA_MAGMM/22-90------------------------------ENLKD.....LEDV------------RIRFM.GK.KGSIT.QQYGLMKTC
R6KV21_9FIRM/22-90------------------------------DGPDK.....LNEV------------KVAYL.GK.KGELT.AILKSMKDV
R5DV22_9FIRM/21-89------------------------------DSLEK.....LNEV------------RVSIL.GK.KGELT.EVLKGMKDV
I0AJJ2_IGNAJ/21-88------------------------------DSFKK.....LEEI------------RIKYL.AR.NGSVT.LLFDKLKEA
B7K1Q7_CYAP8/27-95------------------------------PNLEE.....LEQL------------RINYL.GK.KGQLS.QILRGMGKL
K9THI8_9CYAN/27-95------------------------------TTLDE.....LEQL------------RVNYL.GK.KGQLS.QILRGMGKL
K9VZG7_9CYAN/27-95------------------------------DTLEQ.....LEQL------------RVGYL.GK.KGQLS.QILRGMGQL
SYFA_BACCR/20-88------------------------------KELKG.....LNDV------------RVAYL.GK.KGPIT.EVLRGMGKL
SYFA_BIFLO/27-95------------------------------SNLEE.....LKAI------------KTTYA.GA.DSAMT.KASKAIGSL
SYFA_BACHD/20-88------------------------------QEKKV.....VQEI------------RVKYL.GK.KGPVT.EVLRGMGKL
E3EFH5_PAEPS/20-88------------------------------ATPKE.....LADL------------RVKYS.GK.KGALT.EILRGMGKL
F2N8Y7_CORGP/22-90------------------------------SDAEA.....LSAA------------RVALL.GR.KGEIT.AIMHLMGTI
R6Q2L8_9BACT/19-87------------------------------KNAEE.....VEQL------------RIKYL.SK.KGEIN.ALMADFRTV
C5B035_METEA/18-86------------------------------GDEAG.....LEAL------------RVAAL.GK.KGSVS.ELLKTLGAM
SYFA_SYNY3/24-92------------------------------DDLDG.....LDKL------------RVQYL.GK.KGELS.LILKGMGKL
F4B166_DOKS4/18-85------------------------------ETLEE.....VEAF------------RIKYS.GK.KGLVN.DFMADFRNV
D4KXP0_9FIRM/24-92------------------------------GDLSK.....LNDV------------RVAVL.GK.KGELT.AVLKSMKDV
E3H642_ILYPC/20-88------------------------------ASLKE.....LDEL------------RVGIL.GK.KGELT.EIMKGMREL
SYFA_OENOB/22-90------------------------------SSVDL.....IENI------------RVHLL.GK.KGDLT.KILKGLKDL
K9SD43_9CYAN/25-93------------------------------ETLDQ.....LEQL------------RVKYF.GK.KGQLS.SVLGGMGKL
R6AWJ2_9CLOT/20-88------------------------------KSEEE.....LSEL------------NTSVL.GR.NGALT.AILRTMGKL
I6XQ41_PROPF/36-104------------------------------SSTAE.....LKQV------------RFDHA.GD.RSPLA.LANRGIGAL
F4A076_MAHA5/21-89------------------------------SDSEA.....LEAL------------RVKYM.GK.KGLIT.SLLKGMGKL
Q0SI49_RHOJR/42-110------------------------------ADLDD.....LAKA------------KVEHM.GD.KSPIA.LARRGLGAL
D1BIH6_SANKS/80-148------------------------------DSLDA.....LRAV------------RTAVT.GD.RSPIA.LANREIGGL
F8AZV1_FRADG/122-191------------------------------GDLDE.....LAAL------------RTLHLDGR.GAPLA.LARRALGAL
H8GQ78_METAL/20-88------------------------------QDLTQ.....LDQV------------RVHYL.GK.KGLLT.QLMKELGAL
C1F7U6_ACIC5/40-108------------------------------TSAEA.....VEAF------------RLHWL.GRKQGRLK.AVSDAWLKA
G8PRE9_PSEUV/19-87------------------------------DSEAA.....LEDV------------RVAAL.GK.KGSVS.EKMKTLGKM
V5RUZ4_9BACT/20-88------------------------------PDLRS.....LSEW------------HSKYL.GK.KGVLR.SLTSDVSGL
W0DTW8_9GAMM/20-88------------------------------TQLAE.....VEQL------------RVDLL.GK.KAEVT.ALMKTLGQL
F6FT27_ISOV2/27-95------------------------------RDLDE.....LKAV------------RTRHT.GD.RSPLA.LANRAIGAL
R5I3P4_9PORP/18-86------------------------------SKADE.....IEAL------------RIKYL.SK.KGEIS.QLFNDFRNV
SYFA_NOCFA/23-91------------------------------ADLDA.....LAVA------------KTEHL.GG.KAPLA.LAQRALGAL
E4N815_KITSK/36-104------------------------------ADLDE.....LKQA------------KVAHT.GD.RSPLS.LANREIGAL
D6ZI01_MOBCV/29-97------------------------------ADVDT.....LKAV------------RSRYN.GD.KAPLT.QAKKLIGKL
R5Y1E4_9PROT/19-87------------------------------EDAKA.....LDEA------------RVAAL.GK.KGQIT.ELLKTLGSM
J7IPX0_DESMD/23-91------------------------------ESTEA.....LQEL------------KVKIL.GK.KGSLT.AMLRQMGSL
R5GWV2_9FIRM/20-88------------------------------ENLDK.....LNEV------------RVSAL.GK.KGALT.ELLKSMKEV
D5V9Q9_MORCR/35-103------------------------------TDERT.....LQEL------------RVSLS.GK.KSALT.ALSKQMGAL
SYFA_DESVM/22-90------------------------------SSLTE.....LEEL------------RVAFL.GR.KGRLA.QIMGRLPEL
B2GD93_LACF3/22-90------------------------------DDLDR.....VNDV------------RVKLL.GK.KGPLT.SVLRGMKDL
SYFA_DEIRA/13-81------------------------------ETLEA.....LQAV------------KTKYV.GK.SGLVT.KELGSLGKL
D3R2H8_MAGIU/23-91------------------------------ESLSD.....LEAI------------RVKLL.GK.NGELT.AVLRSMGKL
D4J2D3_BUTFI/20-88------------------------------KNSEE.....LENI------------RVSYL.GK.KGSVT.AAMKEMGKL
B0RHC8_CLAMS/26-94------------------------------TDSAS.....LAQA------------RSAHI.GE.ASPLA.RLNGSLRSL
SYFA_METCA/20-88------------------------------GSVAE.....LDQV------------RVRYL.GK.KGEFT.EQMKTLGTL
R7A9X2_9FIRM/19-87------------------------------VSLSE.....LNEL------------RVLYL.GK.KGPVQ.ELMKGMKDL
A4APM8_MARSH/18-86------------------------------ESNEA.....LEAF------------RIKYL.GK.KGLLN.EFFAEFKNV
SYFA_STRU0/24-92------------------------------DHSKE.....LQDL------------KVSVL.GK.KGTLT.ELLKGLKDL
SYFA_ALKMQ/20-88------------------------------TSTDS.....LEKV------------RVKYL.GK.KGELT.EVLRGMGSL
R6WB22_9FIRM/20-88------------------------------DLPEK.....LNDV------------RVKYL.GK.KGELT.AVLKGMKDV
C7MEH9_BRAFD/33-101------------------------------ATTAE.....LKQV------------RIEHV.GD.ASVLS.SANRAIKDL
SYFA_PARUW/24-92------------------------------QTTLE.....LEQL------------KIKFL.GK.KGSLQ.GLMKELKNV
SYFA_NITMU/19-87------------------------------EDLAE.....LEQV------------KARYL.GR.HGQLT.ELLKGLGKI
H8MFB8_CORCM/20-88------------------------------SEPSQ.....VEAL------------RIRYL.GK.KGELS.AVLGGMGKL
B1GZU6_UNCTG/18-86------------------------------ADLAV.....LEDI------------KTRYL.GK.NGVLT.QILKSLLQY
SYFA_GEOMG/20-88------------------------------GSEEA.....LQEL------------RIKYL.GK.KGALT.AVMKGLGAL
B2GKE9_KOCRD/33-101------------------------------ADLPE.....LKSV------------RLAHA.GE.KSPLA.LANRAIGGL
U3U840_9ENTR/19-87------------------------------SDIKT.....LEVL------------HADFL.GK.KGYFT.LQIRALHKL
D9QA48_CORP2/32-100------------------------------QTLED.....LAEA------------RRAHL.GD.SAPIP.QARRALGSI
SYFA_SALRD/18-87------------------------------ESAEE.....AEAF------------RIKYL.GRNQGAIP.DLFDQIGDL
Q10YV2_TRIEI/25-93------------------------------ENREK.....LEDL------------RIYYL.GK.KGQVS.KILGAMGKL
F0JBI7_DESDE/27-95------------------------------CSLKE.....LEEL------------RIEFL.GR.KGKLA.QIMGRLGKL
SYFA_LEPBP/22-90------------------------------TTEQE.....LDAL------------KNQFL.GK.KGKLT.SVLKGLASL
SYFA_CLOB8/20-88------------------------------KTSSE.....LEEI------------RVKFL.GK.KGELT.TILRGMGNL
K4RKV4_HELHE/15-83------------------------------GDLHA.....LEEV------------RLLVL.GK.KGLLA.RAFAELKSL
K9ZZ43_DEIPD/13-81------------------------------DTLEA.....LQSV------------KTQYL.GK.NGLVT.AQLKTLGTL
Q3XZW1_ENTFC/22-90------------------------------QDLNE.....LNQI------------RVETL.GK.KGPIT.EVLRGMKDL
S5LX10_9MOLU/20-88------------------------------KTKEE.....LDEL------------KKQFA.GK.DSPLT.DILKNLKSA
E0WUU8_9ENTR/19-87------------------------------KDVTT.....LDSI------------RIEYL.GK.KGHFA.AEMKRLADL
R6UE69_9STAP/20-88------------------------------TTFLK.....LNEI------------RAFYT.GK.KSPLA.EIMKTLSNA
F7YQE4_VIBA7/19-87------------------------------DSLVA.....LDEV------------RVQYL.GK.KGELT.TQLQSLGKL
C9RN05_FIBSS/22-90------------------------------TNQEA.....VNNL------------RVKYL.GK.KGAVT.DLMKQMGSL
SYFA_BRADU/19-87------------------------------GDEAA.....LEAV------------RVAAL.GK.KGSIS.ALLATLGKM
R5NNB7_9CLOT/20-88------------------------------QDINL.....LNDI------------KVSIL.GK.KGELT.QVLKSMKDV
G8UN57_TANFA/18-86------------------------------DNAEE.....LEAL------------RIRYL.SK.RGEIN.ALMNDFRNV
SYFA_MOOTA/20-88------------------------------TSSEE.....LEAL------------RVRYL.GK.KGELT.RVLRGMGKL
R5LX85_9FIRM/20-89------------------------------TNSKE.....VYEF------------KKKYMDSK.AGKIG.QLMKEMKNI
R7CS04_9FIRM/88-156------------------------------VDERE.....LQDA------------KVFYL.GK.KGKLT.AILKNMKDV
F2KTT9_PREDF/19-87------------------------------QNAGD.....VEQL------------RLKYL.SK.KGEIS.ALMGEFRNV
A6LLV5_THEM4/18-86------------------------------NDIAI.....LNQI------------RVKYL.GK.KGVIT.LMMKKLKEL
V9XCC6_9NOCA/37-105------------------------------TDLDE.....LAQA------------KIDHL.GD.KAPIS.LAKRALGSL
R6CCB5_9CLOT/36-104------------------------------DALDK.....LNEV------------RVNVL.GK.KGELT.AVLKSMKDV
SYFA_FUSNN/20-88------------------------------KTLQR.....LEEI------------RVNYM.GK.KGIFT.ELSKKMKDL
C0QWI2_BRAHW/19-88------------------------------NTQSE.....IDDI------------RIRYL.GR.KGKIT.ELLKSLSSI
SYFA_AGRVS/19-87------------------------------SDEVG.....IEAV------------RLAAM.GK.KGSVS.ELLKTLGSM
R6P9M9_9CLOT/20-88------------------------------CSTAD.....IEEV------------RNTFL.SR.KSELN.NIKKNLKDM
SYFA_PROA2/18-81------------------------------TSNET.....LEEF------------KLTYL.VR.KGSIA.NLFKQLKDV
R7BI32_9FIRM/19-87------------------------------RSESQ.....LSDV------------WKTYL.SK.NGSVQ.GLMNGIKEV
E1QZ45_OLSUV/22-90------------------------------DTLDA.....LDRI------------RVASL.GK.KGSLT.AIMRSMGKV
K9SNU2_9CYAN/26-94------------------------------ITPEQ.....LEQV------------RLEFL.GK.KGALS.KVLGGMGKL
SYFA_STRCO/21-89------------------------------DSLDA.....LQEA------------KVAHT.GG.ASPLA.LANREIGAL
E8T2V8_THEA1/22-90------------------------------STLED.....LEKL------------RVEFI.GR.KGKVT.ELLKQIPKL
A4FKE1_SACEN/36-104------------------------------GDLDE.....LAAA------------KPAHL.GE.RSPLL.TARREIGAL
C3PGJ4_CORA7/29-97------------------------------SDLDE.....LTSA------------RREHL.GD.GGYIP.QARQSLGQL
K0AXN7_CLOA9/20-88------------------------------SNLNG.....LEEI------------RIEYL.GK.KGELT.NILKGMKDL
R7KRN5_9BURK/19-87------------------------------TTPAA.....LEDA------------KAKFL.GK.TGSIT.VLMKGLSKL
R6E968_9FIRM/20-88------------------------------DALEK.....LNDV------------KVKYL.GK.KGELT.AVLKSMKDV
T2KRJ3_9FLAO/18-86------------------------------QSKEE.....VETF------------RIKYL.GK.KGLLN.DYFAEFKNV
SYFA_DESRM/20-88------------------------------KTPEA.....LNDI------------RVKYL.GK.KGEVT.QLLRGMGAL
SYFA_BACSK/20-88------------------------------KSEQD.....IQAI------------RVAYL.GK.KGPIT.EVLRGMGKL
M5AM53_9ACTN/24-93------------------------------STPDA.....VASM------------TTRFA.GK.KGELA.GLKKRLGSL
R5CH99_9FIRM/21-89------------------------------FSPEE.....INQI------------KVDFL.GK.KGQLT.GILKGMKDV
D9SN34_CLOC7/20-88------------------------------ASKEQ.....LEAL------------RVKYL.GK.KSEFT.SILRGMGSV
A0A068NSJ4_9BACT/19-87------------------------------ESTAA.....LREI------------ESRFL.GK.SGSIP.ALMKLLGGL
R5Q976_9CLOT/20-88------------------------------TTSQE.....LKEL------------KAKVL.GK.KSELT.EILRGMGQI
M9WA58_9MOLU/20-88------------------------------HFLND.....LEEL------------KKEFL.GK.ESELN.LILKSIKNI
D3SN50_THEAH/19-87------------------------------SALHQ.....LQEI------------KAKYL.GK.KGVLT.QALKELPSL
R6WI12_9CLOT/20-88------------------------------KTLND.....VNNV------------KVKIF.GK.NGDFT.IAMRGLKDV
SYFA_MYCTU/22-90------------------------------DTLDV.....LARV------------KTEHL.GD.RSPLA.LARQALAVL
K9WK55_9CYAN/27-95------------------------------DTLEQ.....LEQL------------RISYL.GK.KAQLS.QVLGGMGKL
R7FB92_9FIRM/20-88------------------------------ADSKL.....LENL------------RVQYL.GK.KGELT.AILKQMGKL
SYFA_THEMA/18-86------------------------------SNVQE.....LESF------------RIEFL.GK.KGKIT.GLMKNLKNL
D5EJ34_CORAD/20-88------------------------------TSRAE.....FEAY------------KATVS.GP.KGSLT.EVMKGMGKV
F2I8L5_AERUA/22-90------------------------------SSLDD.....VQAI------------RVKYL.GK.KGPIT.EALRHMKDI
A4VVH9_STRSY/42-110------------------------------QGEKE.....LQDL------------RVAVL.GK.KGSLT.DLLKGLKDL
D3P8P0_DEFDS/19-87------------------------------TNLDE.....LYQI------------KVKYL.GK.KGSIT.LLNKQLKNI
R5A683_9CLOT/20-88------------------------------QNSDT.....VEKL------------RVAYL.GK.KGSVT.ELLKGLKSV
F5WTB7_ERYRF/18-86------------------------------ETLEH.....LNDV------------RIEYL.SK.KGLLT.KVMGQMKDL
R7KAP7_9FIRM/20-88------------------------------ADSKS.....LTDI------------RVKFL.GK.NGEMT.SVMKGMGKL
R6GEY2_9FIRM/20-88------------------------------KDISV.....LNDV------------RVEIL.GK.KGQLT.EVLKGMKDV
R6UUP1_9FIRM/19-87------------------------------EDLAQ.....LQQL------------RVLYL.GK.KGPIQ.EVMKSMKDL
W6S064_9CLOT/20-88------------------------------VTKED.....IEAV------------RVKYL.GK.KGEVT.LILRGMGGL
D5UDW9_CELFN/30-98------------------------------SDLDG.....LKAA------------RLAHT.GD.ASPLA.LANRAIGGL
R6SEA7_9FIRM/23-92------------------------------ESSKE.....VYEF------------KKSYLDSK.KGKIG.QLMKEMRNI
SYFA_PSYA2/43-111------------------------------SDVRL.....LQDL------------RVQLT.GK.KSPLT.GWSKQMGKL
L7VMV5_CLOSH/20-88------------------------------RDVKT.....LEEI------------RVLFL.GK.KGKLT.GILKGMGTL
R5J6Z6_9FIRM/20-88------------------------------TSPEE.....VEKL------------RVDLL.GK.KGELT.KILKEMGKL
L7WD78_NONDD/18-86------------------------------DSKEA.....VEAF------------RIEYL.GK.KGKLK.DFFDAFKEV
N0AYS7_9BACI/20-88------------------------------TNLKE.....LNDI------------RVAYL.GK.KGPIT.EVLRGMGKL
R5IRS3_9CLOT/20-88------------------------------KDLSG.....LNDL------------RVNYL.GK.KSELN.SLSSAMRDL
U5N4Q5_9BURK/19-87------------------------------RTAAE.....VENV------------KAAYL.GK.SGQIT.LCMQGLGAL
V5RIT9_SPIAP/20-88------------------------------KTKEQ.....LEEV------------KKEYT.GK.ESPLN.LVLNNLKQL
SYFA_RHIEC/19-87------------------------------NDEAA.....LEAV------------RVSAL.GK.KGSVS.ELLKTLGSM
R6H367_9FIRM/20-88------------------------------NNLQD.....IVEL------------KAKYI.GK.SGCIT.ELTKNMKDL
SYFA_RHORT/19-87------------------------------GDLDA.....LDAI------------RVSAL.GK.KGQIT.GLMKTLGAM
R7PSJ3_9FIRM/89-157------------------------------LNEKE.....LHEV------------RVAFL.GK.KGRLT.GILRMMKNL
R6XQI6_9FIRM/18-86------------------------------ENVPA.....LNEL------------KGKLL.GK.KSKLS.SVFSMMKDL
R6GR40_9CLOT/20-88------------------------------NSLKN.....LEEI------------KVKYL.GK.KGELT.AILKQMGKL
R4KNF9_9FIRM/20-88------------------------------NDLEE.....LNNI------------RVRYL.GK.KGLLT.GVLRGMGAL
SYFA_HAHCH/19-87------------------------------ESEQS.....LEQL------------RVDYL.GK.KGRIT.QLLKELGRL
F4KPG6_HALH1/22-90------------------------------ANAEA.....IEQF------------RLRFL.GS.NNVIK.PLMGEIRNV
SYFA_CHLTR/22-90------------------------------HSSKD.....LFDV------------KVKYL.GK.KGIFR.GFADQLRKY
R5TQ47_9CLOT/20-88------------------------------DALEK.....LNEI------------RVAYL.GK.KGELT.SVLKSMKDV
G0HB85_CORVD/21-89------------------------------TDLDQ.....LPEL------------RRAHL.GD.DAPIP.AARRGLGSL
I0HEG5_ACTM4/36-104------------------------------ADLDA.....LAAL------------KPAHL.GD.RSPIS.LARREIGSL
R5XNZ9_9CLOT/20-88------------------------------TDLKS.....LNEL------------KVKFL.GK.KGELT.SVLRGMGAL
C8WQJ4_ALIAD/24-92------------------------------SDSKA.....LNDW------------RVEVL.GK.KSALG.QMSKAMGGL
SYFA_CLOPH/20-88------------------------------DTLDA.....LNEI------------RVNFL.GK.KGELT.SVLKSMKDV
K7X996_MYCHR/13-81------------------------------NNLED.....LKLA------------KNAFF.GK.DSYLA.KLQNQLKSV
G4Q6B2_ACIIR/20-88------------------------------KCVDD.....LKNI------------RVQYL.GK.KGALT.EILRGLGSV
E3JA61_FRASU/38-107------------------------------ADLAD.....LAAV------------RTAQVDGR.SAPLM.LARQKLGTV
R5P7G9_9BACT/19-87------------------------------TNAAE.....LEQL------------RLKYL.SK.KGAIS.LLMNDFRSV
N0B946_9RHIZ/22-90------------------------------KDLTA.....LDAV------------RVSAL.GK.KGRIS.ELMSKLGSL
SYFA_HERA2/20-88------------------------------QSLDD.....LAAW------------RTQWT.GK.KGALA.QASQSIGKL
R7NGC3_9FIRM/20-88------------------------------QNLVD.....LDKV------------RVAYL.GK.KGSVT.GLLKGMKEL
C5BW27_BEUC1/44-112------------------------------GDLDA.....LKDV------------RLAHA.GD.RSPLA.LANRAIGTI
R5KSX4_9CLOT/20-88------------------------------QSAQQ.....IEEV------------RIKYL.GK.KGELT.AILKQMGKL
SYFA_LEPCP/19-87------------------------------TTPAQ.....LEDA------------KARFL.GK.TGRVT.ELLKGMAAL
K4LET7_THEPS/36-104------------------------------GKREE.....LQDL------------KVKYL.GK.KGLLT.KVLRGMGSV
SYFA_TROWT/22-90------------------------------DTLRD.....LTKL------------KNDNL.GS.TSWLA.KYSASIKIL
W8T5S4_EUBAC/20-88------------------------------VSIEE.....VESI------------RINAL.GK.KGEIT.AVLKGMKDL
R6PQP5_9FIRM/20-88------------------------------SDLQA.....LESL------------RVEIL.GK.KGELT.QILKGMGSL
R5XLV9_9CLOT/20-88------------------------------SAIDE.....LDSI------------KVKYS.GK.KGELT.KLLKGMGKL
W8SMQ5_9RHOB/19-87------------------------------GDEAA.....LEEI------------RVAAI.GK.KGEIS.LKMRELGKM
C7JGH2_ACEP3/20-88------------------------------TDLKA.....WDAV------------RVSTL.GK.SGRLT.ALLKALGKM
C7R3Q7_JONDD/31-99------------------------------STLDD.....LKDI------------RTAHA.GD.KSPLA.LANREIGGL
R6QBU0_9FIRM/20-88------------------------------DNLAD.....IENI------------RVSYL.GK.KGSVT.DLLKGMKEL
C5CIP0_KOSOT/21-89------------------------------TNSAE.....LQVI------------KARYL.GK.QGLVT.SMLKKIREL
G8LZS0_CLOCD/20-88------------------------------ESIQE.....LENI------------RVKYL.GK.KGELT.SVLRGMGAL
B7KBP6_CYAP7/27-95------------------------------TTLED.....LEQL------------RVQYL.GK.KGQLS.QILREMGKL
R7I8A9_9FIRM/20-88------------------------------ANMVD.....LEAL------------RVNYL.GR.KGKVT.DALKGMGSL
E4U296_SULKY/18-86------------------------------DSIDK.....IEEI------------RIAVF.GK.KGIMN.AEFARMKDI
R6ZGA4_9ACTN/22-90------------------------------TDAKK.....LEEA------------RVALL.GR.KGEIT.QIMHMMGKV
SYFA_AZOVD/19-87------------------------------EDVNA.....LEQL------------RVHYL.GK.KGELT.QLMQTLGKL
D8K1Q0_DEHLB/20-86------------------------------ETTEA.....LETW------------RVNYL.GK.KSELT.AVLRGLGAL
SYFA_CHLPD/18-86------------------------------ASIKD.....IEAF------------RLRYT.VR.KGLIA.GLFGQLKSV
K9TZG2_9CYAN/27-95------------------------------DCLER.....LEEL------------RVAYL.GK.KGQLS.AIMRQMGQL
F5ZBG0_ALTSS/18-86------------------------------QDAAT.....LDQV------------RVEFM.GK.KGKLT.DLLKGLGKL
G2IRD2_9SPHN/19-87------------------------------DTLDA.....VESL------------RVGAL.GK.NGVVT.ALLKTLGAM
D7FN85_ECTSI/107-175------------------------------TTLQE.....LEDL------------RRKYM.TK.KGPVQ.KVMGQMRLL
F9D0B9_PREDD/35-103------------------------------KNAED.....IEQL------------RLKYL.SK.KGEIN.AVMADFRNV
R7M5S9_9CLOT/20-88------------------------------KDNTE.....LNNL------------KVEYL.GK.NGKIT.ELSKSMKDI
SYFA_FLAJ1/18-86------------------------------KNKES.....LEQF------------RIKYL.GS.KGLLK.ELFNEFKNI
C6CWJ4_PAESJ/20-88------------------------------DNPQQ.....LNDL------------RVKYL.GK.KGALT.EILRGMGGL
R5GSS1_9FIRM/21-89------------------------------ADMKE.....IDAL------------RVKFL.GK.KGELT.AILKQMGGL
A5CE07_ORITB/17-85------------------------------NEKKA.....LNDL------------KLSYL.GK.SGIIT.LQLKKIVEL
R5FIC0_9FIRM/20-88------------------------------ANTKD.....ISDV------------KVRFL.GK.SGEFT.LAMRLLKDV
K9Z449_CYAAP/24-92------------------------------ESLSQ.....LEEL------------RVSYL.GK.KGQLS.LILKEMGKL
K9XQV8_STAC7/27-95------------------------------TNLEE.....LEQL------------RVKYL.GK.KGDLS.QILRGMGKL
SYFA_AGRRK/19-87------------------------------TDEQS.....IEAV------------RVAAL.GK.KGSVS.ELLKTLGSM
A6Q2R4_NITSB/8-76------------------------------LSLDE.....LEEL------------RIELF.GK.KGYFA.KEFEKLKSL
Q1GPD5_SPHAL/20-88------------------------------ADAGA.....IEAV------------RVAAL.GK.AGRIT.ALLKTLGGM
R6DHE0_9CLOT/20-88------------------------------GELEK.....LNDI------------RVAFL.GK.KGELT.SVLKGMKDV
W0JHP2_DESAE/16-84------------------------------KTQED.....IKQI------------RSFFL.GK.NGLIT.NLFKQLASL
D5AR72_RHOCB/19-87------------------------------ADEAS.....LEEL------------RLAAL.GK.KGEIS.LKMRELGQM
D1AGH7_SEBTE/20-88------------------------------NSLEN.....LDEL------------RIAIL.GK.KGELT.SIMKEMGNI
W6AHF9_9MOLU/20-88------------------------------NTKQD.....IEEL------------KKVYA.GK.DSPLN.EVLKNLKSC
C6XAN7_METGS/20-88------------------------------DNLND.....LEQA------------KARFL.GK.SGALT.DALKGLGKL
R7R058_9FIRM/20-88------------------------------DELGK.....LNDV------------RVAFL.GK.KGELT.AVLKGMKDV
SYFA_THIDA/19-87------------------------------PDLPS.....LEQI------------KAGYL.GK.SGQLT.ELLKSLGAM
E4TJZ0_CALNY/18-86------------------------------ENLEQ.....LYQV------------WVKYL.GK.KGLIS.LLNKELKNV
K8E4Z9_CARML/22-90------------------------------ENLDS.....LNQV------------RVAYL.GK.KGPLT.EVLRGMKDL
R7DQ22_9FIRM/20-88------------------------------DDLET.....LGTI------------RNAYL.SK.KSPLM.ALMSRMKEL
D3UFP7_HELM1/12-80------------------------------KNTAE.....LEAV------------RIEFF.GR.KGSIT.QKFAMLKEL
F8KZ83_PARAV/20-88------------------------------HSSAD.....LEQI------------KVKYL.GK.KGPLQ.NLMKSLRDV
C8W7P2_ATOPD/22-90------------------------------TNLEE.....LEKV------------RVASM.GK.KGSLT.AIMRMMGQV
F4GU13_PUSST/20-88------------------------------NDAAA.....LENA------------KARFL.GK.QGALT.ALMKGLAQL
A8EWE7_ARCB4/12-80------------------------------KSLEE.....LENL------------RIDTL.GK.KGVLT.LEFAKMKSV
G0FYK5_AMYMS/34-102------------------------------TGLER.....LAEV------------KPAHL.GD.HAPLM.LARREIGAL
D0L966_GORB4/31-99------------------------------ADLEA.....LAQA------------KTAHL.GD.RSPIA.LARRALGSL
SYFA_PERMH/22-90------------------------------SDIGK.....LNDI------------RVNYL.GK.KGKIK.SILKTLGKL
A1R577_ARTAT/34-102------------------------------SSLDE.....LKAV------------RLAHT.GE.KSPLS.LANREIGGL
R6I3G5_9FIRM/20-88------------------------------DSPEN.....LEAL------------RVKYL.GK.KGELT.AILKQMGKL
F7UZW8_EEGSY/22-90------------------------------ADTAA.....LEQV------------RVAVL.GK.AGSLT.GYLRSMGQV
D0L0C8_HALNC/50-118------------------------------MDVVA.....LEEV------------RVAYT.GK.KGVVT.QFMKELGTL
SYFA_SACD2/19-87------------------------------EDLAG.....LDAI------------RVNYL.GK.KGEIT.AQLKNLGGL
W0E4U7_9FIRM/20-88------------------------------TSLDT.....LQEL------------KVKVL.GK.KGSLT.ALLRQMGSL
D3SG51_THISK/19-87------------------------------TDLKA.....LDDV------------RVHYL.GK.KGSIT.AQLKELGKL
Q0ATG1_MARMM/22-90------------------------------TDEAG.....LDAV------------RVAAL.GK.KGSVS.LMMRELGKM
I4D0B3_DESAJ/23-91------------------------------DKSEA.....LQEL------------KVKVL.GK.KGTLT.ALLRQMGSL
SYFA_PROAC/36-104------------------------------STTAE.....LKQV------------RITHT.GD.RSALA.LANREIGAL
SYFA_CLOBH/20-88------------------------------LSKDQ.....LEAI------------RVKYL.GK.KGELT.QILRGMGAL
R5SBM3_9GAMM/20-88------------------------------QSISD.....IDEI------------RLKYL.SR.KGEFN.SIKKGLKDL
G7Z7V0_AZOL4/17-85------------------------------ADLSA.....LDEV------------RVSAL.GK.KGRIT.GFMKELGAL
M1MX81_9CORY/29-97------------------------------QDLAE.....LSAA------------RRAHL.GD.DAPIP.QARRSLGTL
F8AAU5_THEID/21-87------------------------------RDEKA.....LEAT------------RVKFL.GR.KGELT.QVLKSIAKL
R7F2A4_9BACI/22-90------------------------------QTSKD.....LQDL------------RVKYL.GK.KGMVT.ALTKDMSSL
R6D728_9CLOT/20-88------------------------------TSIKT.....LNDV------------RVEYL.GK.QGKIT.ELSKMMKDV
D4KCR5_9FIRM/20-88------------------------------SSKET.....LASF------------WQEYL.SK.NGKIP.ALMKNLRTV
G4L0S9_OSCVS/20-88------------------------------KAASE.....LEAL------------RVKYL.GK.KGELT.GLLKQMGGL
R6VYL1_9FIRM/20-88------------------------------KDGTA.....LEAA------------RVKYL.GK.KGELT.AILRGMGSL
A6WCT9_KINRD/39-107------------------------------GDLGE.....LKAA------------RLAHA.GD.RSPLA.LANREIAAL
A0LUC7_ACIC1/32-100------------------------------ADLAE.....LQAV------------RIAHV.GD.RSPLA.LANREIGAL
H6L2Q9_SAPGL/22-90------------------------------QNKEE.....LEQF------------RLKFL.GT.KNQLK.PLFGEMRNV
K6ZLC3_9ALTE/18-86------------------------------QDVNF.....LDAV------------RVDFM.GK.KGRMT.ELLKGLGKL
W8KPJ2_HALHR/13-81------------------------------KDLRN.....LEDL------------RVHFL.GK.KGVIT.EQLKTLGSL
C6W5N1_DYAFD/19-88------------------------------SNKEQ.....LEAF------------RLKYI.SK.KGAVT.ELFDNLKNI
C7MKS3_CRYCD/22-90------------------------------SDTAA.....LEQV------------RVGVL.GR.SGTLT.GYLRSMGQI
I7A000_MELRP/20-85------------------------------HDLKS.....LEEL------------RLKFL.SR.KGIIQ.NFFEEFKKL
R5ACG5_9FIRM/20-88------------------------------REIKD.....VDDL------------KVKFL.GK.KGELT.AILKEMGKL
R5FLC5_9ACTN/22-90------------------------------SDTEA.....LEKI------------RVEVV.GK.SGSLT.GYLRSMGQI
SYFA_VIBF1/19-87------------------------------GSLVA.....LDEV------------RVQYL.GK.KGHLT.LQLQGLGKL
I1XIS6_METNJ/26-94------------------------------TDAKT.....LDNV------------RVEYL.GK.KGLIT.GYVKELGNL
SYFA_PELCD/20-88------------------------------DSAVE.....LQEI------------RVRFL.GK.KGELT.AIMKGMGQL
R6I2V1_9PROT/19-87------------------------------ADIKS.....LEEI------------RVSVL.GK.KGRIT.EMMKSLGGL
SYFA_BORPE/28-96------------------------------SDAAA.....LENA------------KARFL.GK.EGALT.VLLKALGKL
R5KHV4_9CLOT/20-88------------------------------DVLTS.....LNDV------------KVSVL.GK.KGELT.QVLKGMKDV
D6Z312_DESAT/20-86------------------------------TDPEE.....LEPF------------RVEYL.GR.KGRFT.GLMRSLGQA
R6CXH4_9FIRM/20-86------------------------------ATETE.....LQDI------------KAALL.GK.QGSLT.ELMKELPKL
R5RI45_9FIRM/24-92------------------------------DALDK.....LNDV------------RVSFL.GK.KGQLT.SVLKSMKDV
D6Y1Z3_THEBD/33-101------------------------------RDLDE.....LKQV------------RIAHA.GD.RSPIA.LANRRIGTL
D5C008_NITHN/19-87------------------------------PNLET.....LDEL------------RVRYL.GK.KGELT.GYLKKLGQL
SYFA_THEEB/30-98------------------------------STLDA.....LEQL------------RVAYL.GK.KGELS.QILALMGKL
C8WZ74_DESRD/27-95------------------------------SVFED.....LETL------------RVEYL.GR.KGKLA.QAMTSMRDL
R7I3S7_9CLOT/20-88------------------------------EHLES.....LNDV------------RVAFL.GK.KGELT.SVLKSMKEV
I3TGZ9_TISMK/19-87------------------------------ADLDA.....LEEV------------RVQAF.GR.KGRIT.EMLKGLGAL
D1B028_SULD5/12-80------------------------------ESLGE.....LDKI------------RVSLF.GK.KGHFA.AQFEALKKL
F6CQH9_DESK7/20-88------------------------------DSLEA.....LEEI------------RIRYL.GK.KGELT.RVLRGMSAL
SYFA_RHILO/23-91------------------------------ADEPA.....IEAV------------RIAAF.GK.KGTVS.EMLKTLGAM
E3EXL9_KETVY/16-84------------------------------GDESA.....IEDL------------RVQAL.GK.KGEIA.LLMRGLGAM
R5D8P1_9FIRM/20-86------------------------------RSEAE.....LQEV------------KALLL.GK.QGSLT.GLLKELPKL
F4CLG6_PSEUX/40-108------------------------------PDLAA.....LAAV------------RPAHL.GD.KAPLL.LARRELGSL
C9LUD7_SELS3/21-89------------------------------VTLAD.....LDGI------------RVKVF.GK.KGELT.AIQRGMGKL
H1ZB84_MYROD/25-92------------------------------DNKEQ.....LEAF------------RIKFL.SK.KGILN.ELFAYFKTV
G9WG33_9LACT/22-90------------------------------KTDDA.....VEDI------------RVHLL.GK.KGDLT.KILKGLKDL
D3HP56_LEGLN/19-87------------------------------QDVSG.....LEQI------------RVDFL.GK.KGKLT.EILKSLAHL
R6YSU1_9CLOT/20-88------------------------------KNSQE.....LQEL------------KVKML.GK.KSELS.NLLKGLGKL
Q1AWF9_RUBXD/23-91------------------------------ESTAA.....LEQA------------RVRYL.GR.SAELT.EIKKSIGRL
D7CWW6_TRURR/35-103------------------------------ADQAA.....LQAL------------RVKLL.GK.KGVLT.AQLKGLGAL
E9T014_RHOHA/37-105------------------------------ADLDA.....LAKA------------KIEHL.GD.KAPIA.LAKRGLGAL
C6XHP7_LIBAP/26-94------------------------------TDMDS.....LNAI------------RVATL.GR.KGSIS.SLLKDLKNL
K9YBC7_HALP7/27-95------------------------------SNLES.....LEQL------------RVQYL.GK.KGQLS.QVLRGMGKL
R6FU47_9BACT/32-100------------------------------SNAEE.....IEQL------------RLKYL.SK.KGEIT.ALMADFRNV
C6BRG7_DESAD/26-93------------------------------.SLSE.....LEDI------------KIDML.GR.KGRVA.KIMSGLPSL
Q0BRZ9_GRABC/47-115------------------------------ADLRA.....WDAV------------RVGVL.GK.SGKLT.ALLKTLGQA
G0A2F3_METMM/20-88------------------------------KDLAE.....LDLV------------RVNYL.GK.KGLFT.QHMKQLGNL
K9T1C5_9CYAN/28-96------------------------------TTLAQ.....LEQL------------RIDYL.GK.KGKLS.QILREMGKL
SYFA_SYNWW/20-88------------------------------SSMEE.....LNEF------------RIKTL.GR.KGEVT.LLLRGLKDL
D5EE62_AMICL/23-91------------------------------SSADE.....IQDL------------KVKYL.GK.KGKVT.SLLKTLGSL
SYFA_FERNB/22-90------------------------------ENSKV.....LNDL------------RVKYL.GK.SGIVT.SLMKQLKDL
SYFA_BIFA0/27-95------------------------------STMEE.....LKAI------------KAKYA.GA.NSAMT.RASKAIGSL
D5UR26_TSUPD/32-100------------------------------TDLDA.....LNAA------------RLAHL.GE.KSPLA.LSKRALGSI
C4XE66_MYCFP/16-84------------------------------KTFED.....LKLA------------KSKVY.SK.DSEIV.QLQTKIRTA
M1WYG6_DESPC/27-95------------------------------CSLKE.....LDEL------------RIEFL.GR.KGMLA.QAMAQLGAL
C7NDS1_LEPBD/20-88------------------------------ENLEE.....LNDL------------RVKIL.GK.KGEFT.AIMKGMAGI
SYFA_PROMP/29-97------------------------------KSDSE.....LDQL------------RVSLL.GK.KGELS.IILKTMGKL
A2TYD7_9FLAO/26-94------------------------------TTKDE.....VESF------------RIKYL.GS.KGLLK.DLFSEFKNV
F0SWT1_SYNGF/20-88------------------------------LTRDE.....LQEL------------KVKVM.GK.KGSLT.ALLKQLGSL
D7A232_STAND/25-93------------------------------ADEAG.....LEAV------------RVSAL.GK.KGSVS.ELLKSLGGM
SYFA_LISMO/20-88------------------------------SDLKT.....LNDL------------RVKYL.GK.KGPMT.EIMKQMGKL
H8XNL0_FLAIG/18-86------------------------------DNKER.....LEEF------------RIKYL.GG.KGILK.EFFAEFKNV
R5VLV5_9FIRM/20-88------------------------------NSMKE.....LQDV------------KNEYF.SK.KGEIS.NLAASLSTM
D6XSV7_BACIE/20-88------------------------------VTLSD.....LRDV------------RVKYL.GK.KGPMT.ELMKGMGKL
E6W567_DESIS/57-125------------------------------PGTRQ.....LDEL------------RIHYL.GK.KGFIA.AAMQQLKDV
SYFA_CALS4/20-88------------------------------KSLQE.....IESL------------RVKYL.GK.KGELT.QILRGMGSL
D4LEX7_RUMC1/20-88------------------------------GSIKG.....LDDL------------RVRFL.GK.KGELT.GILKQMGGL
I0HS10_RUBGI/19-87------------------------------PNPAE.....LENA------------KARYL.GK.SGRVT.ELLKGLAAL
E6UDG8_RUMA7/20-88------------------------------SDIKL.....LEDF------------RVRFL.GK.KGELT.AILKQMGKL
SYFA_SYNAS/20-88------------------------------KTETD.....LAAV------------RVRYL.GR.KGLLT.QFLRNLGQL
C5CAN9_MICLC/41-109------------------------------ADLDE.....LKAA------------RLAHT.GD.RAPLT.LANKAIGAL
R6B2V2_9CLOT/20-88------------------------------KDSQA.....LNDF------------KVKVL.GK.KGELT.EILRGMKDI
SYFA_CAUSK/19-87------------------------------GDLAA.....LDAV------------RVSAL.GK.TGRVS.GLLKTLGAM
R5JC33_9FIRM/18-86------------------------------LTEHD.....LNEV------------KAKYL.GK.KGEIT.VLYSKMKDL
SYFA_BEII9/19-87------------------------------ADEGE.....LENV------------RVGAL.GK.KGTIS.ALLATLGKM
SYFA_HYPNA/19-87------------------------------ADLAA.....LDAV------------RVAEL.GK.KGRVS.ALMGALGKM
E8UCS6_TAYEM/20-88------------------------------KTPAS.....LEDK------------KAIYL.GK.NGSIT.LLMKSLASL
V5WNC2_9SPIO/20-88------------------------------QSLPD.....MAQF------------KAEYL.GK.KGRLK.GLMAGMRDL
D2R2G0_PIRSD/25-91------------------------------TSPAA.....LEEA------------RIEFL.GAKSGKLK.DAQKGLGQV
F2J3M3_POLGS/19-87------------------------------ATEAA.....LEEV------------RIAAL.GK.KGSIS.ELMKTLGSM
SYFA_LACS1/22-90------------------------------KDLKK.....INDI------------RVSLL.GK.KGPIT.EVLRGMRDL
H6LK10_ACEWD/20-88------------------------------EELKS.....LDNV------------RIKYL.GK.KGELT.IVLKGMGKL
B9L9K2_NAUPA/11-79------------------------------LDLEE.....LEKT------------RVKLL.GK.NGVIT.QKFKELKNV
M4UK68_9GAMM/19-87------------------------------IDGNQ.....LEEI------------RLQYL.GK.KGLMT.EQMKGLGKL
F6EI06_AMYSD/42-110------------------------------GSLDD.....LAHA------------KTQHL.GD.RSPIA.LARRALGTL
W5WG41_9PSEU/36-104------------------------------ADLDA.....LAAV------------KPAHL.GD.KSPLL.LARREIGAL
B9KYT7_THERP/32-100------------------------------TTQAA.....LAEW------------YARYL.GR.RGELT.QLLRALGTL
SYFA_CAUCR/19-87------------------------------SDLQA.....LDAV------------RVAAV.GK.TGSIS.GLLKTLGAM
R6WGM8_9BACT/19-87------------------------------SNAEE.....IEAL------------RLKYL.SK.KGEIN.AVMADFRNV
SYFA_TERTT/19-87------------------------------NDLAA.....LDTV------------RVNYL.GK.KGPLT.ALRKTLGKL
A7HBJ0_ANADF/23-91------------------------------ADEKA.....LEDL------------RVRFL.GK.KGELS.AVLRGMGAL
R7M6T9_9CLOT/20-81------------------------------KTVEE.....LQNI------------AKELT.GK.KSELG.EVLKSISTL
F8L5F2_SIMNZ/20-88------------------------------QHTKE.....LEDL------------RVKYL.GK.KSPVQ.TLMKSLRDV
SYFA_GEODF/20-88------------------------------ATEDS.....LQDL------------RVKYL.GK.KGELT.AVMKGLGSL
B8I1X0_CLOCE/20-88------------------------------GSSAE.....VEEL------------RVKLL.GK.KGELT.EMLKDLKNM
SYFA_CLOTE/20-88------------------------------VDKET.....IESI------------RVKYL.GK.KGELT.KILRGMGGL
F0SQV1_RUBBR/22-89------------------------------SDSAA.....LEDA------------RILFL.GKKKGRLK.DLQSELSKA
K9XCP2_9CHRO/27-95------------------------------DSLDR.....LEEL------------RVVYL.GK.KGQLS.GLLRSMGQL
SYFA_NATTJ/20-88------------------------------SSLDK.....LKDV------------QVKYL.GK.KGELT.KILRGMGNL
SYFA_BDEBA/21-89------------------------------PSSKD.....LYDL------------KVQYL.GK.SGSLT.EIMKEMASL
D1BMZ2_VEIPT/20-88------------------------------ADQQA.....LQDI------------RVKYL.GK.KGEVT.ALLKGLGKL
R5BQR4_9BACE/19-87------------------------------KSQKE.....VEEA------------RVRFL.GK.KGEVT.ALFEEFRLM
I0JPK4_HALH3/20-88------------------------------ENVQS.....LKDV------------RVEYL.GK.KGPIT.EVLRGMGKL
W0DY81_MARPU/24-92------------------------------PDLAT.....LDQA------------RVRYL.GK.SGELT.ALLKRLGTL
B0VGJ1_CLOAI/20-89------------------------------SSPND.....LLNV------------KAKYL.GK.KSLLS.SLYAQMRNI
L0KD16_HALHC/20-88------------------------------SNLDE.....LDDL------------RVKYL.GK.KGEVT.QILRSMGEL
R7L3S6_9CLOT/20-88------------------------------NDEKV.....LNDA------------RVKYL.GK.KGELT.LILRGMGEI
K9R6E2_9CYAN/24-92------------------------------DSLES.....LEGL------------RVNYL.GK.KGQLS.ILLRGMGKL
R7FQ60_9CLOT/20-88------------------------------DSLPA.....LNEA------------KSRYA.GK.KSELS.KAMQSLKDM
A3HVJ8_9BACT/19-87------------------------------NTPEE.....LESF------------RMEFI.SK.KSVVG.GLFAEMGKI
SYFA_CHRSD/19-87------------------------------EDVQS.....LDEV------------RVRYL.GK.KGEIT.ALLKGLGKL
SYFA_PROMA/29-97------------------------------NDKES.....LENL------------RIQLL.GK.KGRLS.KILGSMATL
W5UZV8_9MOLU/13-81------------------------------ENLED.....LKLA------------KNQFF.GK.DSFLA.SLQLQLKTA
R5KEN7_9CLOT/20-88------------------------------NDLDA.....LNDI------------KVNVL.GK.KGELT.QVLKGMKDV
C9RBR1_AMMDK/20-88------------------------------EDLAG.....LEAV------------RVRFL.GR.KGELT.GILRRVSQL
C6WA94_ACTMD/36-104------------------------------GDLDA.....LAAA------------KPAHL.GD.RSAVL.QARREIGAL
H6NGI2_9BACL/20-88------------------------------ESPQQ.....LGEL------------RIKYM.GK.KGPLT.EILRGMGAL
SYFA_ACHLI/20-88------------------------------LTLND.....LEAL------------RVEYL.GK.NGILT.SQMSLIRTL
H0Q2C1_9RHOO/19-87------------------------------ADAVL.....LEQT------------KARYL.GK.TGALT.ELLKGLGKL
R6SNF3_9CLOT/21-89------------------------------HSGAE.....LKEF------------FSTYL.GR.NGSIS.ALMKELGKL
D7WD04_9CORY/43-111------------------------------EDLTA.....LQAA------------KRAHL.GE.QSPIM.QSRKALGTL
B3R0A3_PHYMT/28-97------------------------------KTLDD.....VINL------------EIQFL.GK.KSLIK.DFLNHLKNN
SYFA_ACTP2/20-88------------------------------QGLDA.....LEEF------------RVEYF.GK.KGHFT.ALMQELRNV
SYFA_DESAP/20-88------------------------------STAEV.....VEEV------------RIRYL.GK.KGVLT.QVLRSMGSL
D5BT76_PUNMI/19-87------------------------------ETLEA.....LDNV------------RIEAL.GK.KGRVS.LMMRDLGGM
SYFA_CALS8/20-88------------------------------KNLKE.....LEEF------------QIKYL.GK.KGIVK.NMLKELSTL
SYFA_LEIXX/27-95------------------------------GDSEA.....LKVV------------RHDHT.AE.GSPLA.QLNAGIRSL
D4KEL4_9FIRM/20-88------------------------------SNLNA.....LNDV------------RVKYL.GK.KGSLT.SILRGMGKL
SYFA_GRAFK/18-86------------------------------KTKDE.....IEAF------------RIKYL.GK.KGILN.DFFAEFKNV
B2KBL6_ELUMP/25-93------------------------------ASSDA.....LEAA------------RVNCL.GR.KGVLT.ELLKNLKDF
SYFA_GEOBB/20-88------------------------------STEEG.....VQEL------------RVKYL.GK.KGELT.SVMKGLGAL
I3Y983_THIV6/24-92------------------------------ADLMG.....LDQV------------RVRYL.GK.TGDLT.VLLKQLGAL
R6S4L0_9FIRM/20-86------------------------------ANENE.....LQNV------------KNAYV.GK.QGALS.MLMKEMPKL
SYFA_PROMT/29-97------------------------------ENSES.....IEKL------------RLSFL.GK.KGKLS.LLLGGMKNL
F9VJE9_ARTSS/20-88------------------------------DSISK.....FEEL------------RVRYL.GK.KSELS.NILKNMKNL
Q2J858_FRASC/36-105------------------------------ADLDA.....LAAV------------RTAHIQGA.SAPLV.LARRELGAL
J4A015_9GAMM/20-88------------------------------KNIKK.....LEEI------------RIRYF.GK.KGKLT.IQLKYIKQL
G4T3A1_META2/20-88------------------------------QDLNQ.....LDQV------------RVHYL.GK.KGLFT.LQMKELGRL
R5TIJ3_9CLOT/20-86------------------------------KTVNE.....LNNL------------KVEYM.GK.KGIIT.ELQSGIKD.
D6YVW7_WADCW/20-88------------------------------CSTAS.....LEEL------------KIKYL.GR.KGPVQ.DLMKSLKNA
SYFA_THEFY/36-104------------------------------STLEE.....LKKV------------RIAHA.GD.RSPLA.LANREIGAL
SYFA_CARHZ/20-88------------------------------SDLNE.....LQTV------------KVKFL.GK.KGEVT.LALKNLKNL
X2H4N4_9GAMM/19-87------------------------------NDINT.....IEQI------------RVEYF.GK.KGYFT.LQMASLRDV
SYFA_LACDA/22-90------------------------------ESEKS.....LNDV------------RVKLV.GK.KGELT.QILHQMKDV
F9VFQ4_LACGL/22-90------------------------------VEERM.....LNDL------------RTAIM.GK.KGELT.EILKGMKDL
R7K564_9FIRM/20-88------------------------------SDFDS.....LQTI------------KVKFL.GK.SGELT.GQLKCMKEL
M4V8I4_9DELT/21-89------------------------------QNSQE.....LYGF------------KVQYL.GK.SGSLT.ESMKLMATL
R5FXT5_9FIRM/24-92------------------------------KNVNE.....LNES------------KAEFL.GK.KSPIS.EIMSKMKEL
R6N304_9FIRM/20-88------------------------------SDLVE.....LDKI------------RVAYL.GK.KGSIT.ALLKGMKDL
B5YG19_THEYD/17-85------------------------------SSIQE.....LVNL------------KAKYI.GK.KGIIT.EKIKNLGRL
SYFA_HAEDU/19-87------------------------------TDVAT.....LETL------------KVEFF.GK.KGHFT.QLMQGLRDI
R5CA95_9FIRM/22-90------------------------------DALDK.....LQEI------------RVSYL.GK.KGQLT.SLLKGMKDV
W5XT44_9CORY/46-114------------------------------TTLEE.....LQEA------------RRGHL.GD.KSFIS.QARQSLGTL
SYFA_OCEIH/20-88------------------------------KDMKS.....LQDL------------KVKYL.GK.KGSLT.SVLRGMGKL
SYFA_ROSS1/22-90------------------------------ADLTA.....LAEW------------KSAYL.GK.QGALS.RLSRGLGAL
SYFA_HAEIN/21-89------------------------------KSLTA.....LDEI------------RVEYF.GK.KGHFT.QLMQELRNV
B0S1P6_FINM2/26-94------------------------------IDLKS.....LEDI------------RVKVL.GK.KGDLT.LVLRNMGKL
SYFA_PHEZH/19-87------------------------------ADVAA.....LEAI------------RVEAL.GK.SGSIS.EMLKGLGKM
S5MHW4_9MOLU/20-88------------------------------NSKND.....LEEI------------KKEFT.GK.NSKLM.EVLKSLKSF
E1SRF2_FERBD/19-87------------------------------DDLKA.....LDDI------------RVNYL.GK.KGEIT.ALMKSLGQL
E0URM0_SULAO/16-84------------------------------KDVES.....LEEI------------RIAVF.GK.KGVLA.AEFAKMKDA
SYFA_SULNB/12-80------------------------------DSLEV.....LEKV------------RIELF.GK.KGLLA.AQFAKMKDI
SYFA_THICR/20-88------------------------------SELVH.....LDEI------------RVQYL.GK.KGELT.AMMKTLGQL
SYFA_EHRCR/21-90------------------------------SSLEE.....LESI------------KLYYF.GK.SGTIT.ACLKSIATI
B7FQJ6_PHATC/32-100------------------------------TSVAD.....AEVI------------RREYL.GK.KGPIN.KAMGYMRLL
SYFA_ONYPE/21-89------------------------------HDLDQ.....LMTL------------DKEFL.GK.KGILF.ELTQELKSL
SYFA_NEIG1/19-87------------------------------QDFNA.....LEQI------------KARYL.GK.TGELT.GLLKTLGQM
Q091T0_STIAD/20-88------------------------------SEVSA.....VEAL------------RIRYL.GK.KGELS.GVLGGMGKL
K9ZQ20_ANACC/24-92------------------------------DTLER.....LEEL------------RVNYL.GK.KGQLG.ALLRSMGQM
E3I177_RHOVT/26-94------------------------------SDLAA.....LDAI------------RVSAL.GK.KGEIS.ELMKKLGAL
W8WXH2_CASDE/20-88------------------------------GDAAT.....LENE------------KAAFL.GK.QGSLT.ALLKGLAAL
C7RRQ2_ACCPU/19-87------------------------------DDPDA.....LEQI------------KASFL.GK.NGQIP.GLLKGLAKL
R5NQN3_9CLOT/20-88------------------------------SNLRE.....LEDV------------RVKYL.GK.KGKLT.AILKTMGSL
W0ITG1_9BACT/20-88------------------------------KTRPE.....FEAA------------KARYV.GP.NGALT.ACMKQMGSL
L0EDN6_THECK/20-88------------------------------ADPAR.....LNDL------------RVKYL.GK.KGALT.EILRGMGSL
I0HYQ7_CALAS/16-84------------------------------QSLTE.....TEAW------------YHEYL.GR.KGRLT.AILRSLGQL
SYFA_SHEAM/19-87------------------------------TDLKV.....LDDI------------RVDYL.GK.KGQIT.DLMKLMGTL
SYFA_MACCJ/22-90------------------------------TDKKA.....LQDI------------KVSYI.GK.KGVIT.GLMKEMKSL
R5MB29_9MOLU/20-88------------------------------KDINS.....LTEL------------KNKYL.SK.KGEIS.GLLANLGSM
K8GT05_9CYAN/27-95------------------------------DSLDQ.....LEQL------------RVKYL.GK.KGPIP.QVLGGMGKL

PF10458

SYV_OCEIH/818-883------------------------------DFDKE-----IKRL------------ENEL--AKWTKEVE-RVQKKLSNQ
A3DC83_CLOTH/816-881------------------------------DIEKE-----IERL------------EKEL--SNLQKELD-RVNSKLANE
B1YJU7_EXIS2/812-877------------------------------NIEEE-----IARL------------NKEL--VKYTKEVE-RVEKKLNNP
Q2KY84_BORA1/893-958------------------------------DVAAE-----RVRL------------DKEI--ARLEGEIA-KANGKLNNP
Q28LL8_JANSC/961-1026------------------------------DVDEE-----KARL------------EKTL--GKLAKELG-GLRGRLNNP
SYV_PROMT/868-933------------------------------DIASL-----RSRL------------EKDL--NKAQKEIE-SLSGRLANK
Q39X26_GEOMG/819-884------------------------------DVEEE-----EKRL------------LKEI--GKLDKDIE-FLAKKLANP
Q587B4_TRYB2/907-972------------------------------DVQKE-----VAKL------------EKQL--AGLQKQIE-GVNKKISMP
Q3Y009_ENTFC/813-878------------------------------NIEEE-----IKRL------------EKEL--EKWTSEVK-RVQGKLSNE
SYV_DEIRA/848-913------------------------------DIADW-----VKKQ------------QKRL--AELDKQIK-QAQGKLNNE
Q2RTE9_RHORT/814-879------------------------------DLDRE-----RARL------------GKEL--LRLDGEVA-RIDKKLSNP
A4J7L1_DESRM/814-879------------------------------DLDKE-----IARL------------NKEL--KTIQGDLA-RVQGKLNNQ
SYV_NITMU/860-925------------------------------DIAAE-----RERL------------TKEL--DRVQTEME-KAQTKLANS
Q2RL27_MOOTA/814-879------------------------------DLEKE-----QARL------------EKEL--QKARAELE-KVEKKLARP
A5D455_PELTS/817-882------------------------------DVEKE-----IARL------------QKEL--AVTEKELA-RVRGKLANP
SYV_CARHZ/810-872------------------------------DLEKE-----KERL------------NKEL--KKVLAEIE-RLNQKLNNP
SYV_PROMP/853-918------------------------------NLEAL-----KDRL------------TKDL--KKVNSDIE-TLNKRISNK
A5UPL6_ROSS1/836-900------------------------------DLEAE-----RARL------------LKDL--EAALAEAA-RREARLATP
B1WSM7_CYAA5/844-909------------------------------DIASL-----RAKL------------EKNL--GKVEAEIK-SLSGRLNNP
SYV_PSYA2/917-982------------------------------DPTAE-----LARL------------GKSY--DKLKGQSE-GIARKLGNE
SYV_THET8/797-862------------------------------DVEEW-----RRRQ------------EKRL--KELLALAE-RSQRKLASP
SYV_PROMM/864-929------------------------------DLDAL-----RGRL------------EKDL--AKAEKEIA-GLAGRLANP
SYV_BACCR/815-879------------------------------NLDEE-----RARL------------EKEL--EKFDKEVE-RVQKKLSNQ
SYV_LEPIN/816-881------------------------------DVAKE-----KTRL------------EKEL--QKSELEKE-KLEIKLSNP
R7D4I6_9FIRM/822-882------------------------------....E-----IERL------------KKEQ--ERLAKEIA-RCQGMLSNP

PF02403

SYSM_SCHPO/49-157N.....-.ERGKLVNEAKGLKKKTEEYNK.IISKVTNDLYQYCLAVPNTT
SYS_SYNE7/1-112GADPQS-EEIAALREEGNQLKQQIADLEQ.QERQVRSELDTYLLTLPNLP
SYSC_MOUSE/2-113K.....-.EAVGDDESVPENVLNFDDLTADALAALKVSQIKKVRLLIDEA
SYSC_SCHPO/1-112K.....-EDASELLEEKNSLTERKKNLIE.QETAKNKEMLNVVSSIGNIV
SYS_CORGL/1-106D.....-..RPALLEGSNELKAKVKDAEA.AQEAAEAKVNELQMKLSNVV
SYS_BORBU/1-106......-VLKISLIETGKILKKQLIDLEE.ELERVSVDFDLENKKVPNIL
SYS_XANCP/1-108G.....-EDVAALMAEVAGFGDELKASED.ALDVIRAQLEGIALGIPNLP
SYS_AQUAE/1-109G.....-KDTTEIQNRVKELKEEIDRLEE.ELRKVEEELKNTLLWIPNLP
SYS_CALS4/1-107G.....-KDASELIAKMKELSDKIKDMEQ.ELREIEEEMEKILWTIPNIP
SYS_FUSNN/1-107K.....-KNADHIIEKMGEVSTKIKDLDA.ELVEIDEKIKDIQLNIPNVY
SYS_TREPA/1-106L.....-.ARSACVETGRALKDRIAHSER.LLVQISDQLLSATQALPNMT
SYS_CHLTR/1-107N.....-ENADALIQEVNTIADQLVAFET.TLQEQEALLEDLMARLPNYP
SYS_ENCCU/1-115GKNKED-GDLSEKVAEIKGLSDEAKGLRD.DVKAVEDELNKVMKGIGNII
SYSC_YEAST/1-112K.....-EDASGLLAEKEKLTQQKKELTE.KEQQEDKDLKKKVFQVGNIV
SYS_AGRFC/1-109KN...M-ELAEKLKAEVADIKENMPRAEE.EDRQVSAELNDALSRLPNMP
SYS_CLOPE/1-110G.....-EDVTEVMAEMREIGDKIKADDA.KVAELNDKINYIMLRIPNIP
SYS_BACSU/1-108K.....-KDADHIIKEMREVGEEIKKLDE.ELRTVEAELDTILLSIPNIP
SYS_RALSO/1-107G.....-EDASAVMAEVAGIGDELKASAA.QLDVVQGRLQDLLLSIPNVP
SYS_COXBU/1-107G.....-ENPELLMAEVSQLNDELKQEEA.NFETIQKAFSDFQLAIPNLP
SYS_LISMO/1-108K.....-QDADAKIEEMRVVGDRIKTLDI.ELREIDEKLDMILMSIPNIP
SYS_HAEIN/1-108G.....-EDIAPLLAEMDDMGNQLTEAKA.QLDAVLAEINQIALSIPNLP
SYS_NOSS1/1-112GINPQD-PEIQALRDEGNAIKAQLSELEP.REKELKAEIEQLILALPNLP
SYS_HALMA/1-110GK...D-EEAQEAIDRSQELKDELQDIEE.RADELESQLEEALLELPNIP
SYS_HELPY/1-109K.....-VDTSDLKKELENNKIKLNELSK.SVGELEQQIDLKLSIIPNLV
SYS_BUCAI/1-107K.....-NKNELLRHQVIQSSKDLNASKI.ELNSLKEKIHHFSMCIPNIP
SYS_PASMU/1-108G.....-EDISALLNEVEHMGIELSTTKA.HLDEVLAEINQIVLAIPNLP
SYS_RHIME/1-109KN...S-ELADRLKAEVADLKNALPAAEE.ESRRIEAELSDALSRIPNTP
SYS_BUCBP/1-107H.....-PNIQCMKERIITLKKKIDVMKK.ELKILLEQIHIFLMNIPNLP
SYS_SYNY3/1-114GADPKG-EEIQTLREEGNSLKIQLADLEP.QEKDLKEQLQKLLLELPNLP
SYS_MYCPN/1-104P.....-.K...LLKESKELKQKLEQLNI.AFKEAETLSQELLLNLPNIA
SYS1_CLOAB/1-110G.....-QNADELLAEMKKISDDIKGIDA.KVSEIDEKMQYIMLRIPNIP
SYS2_CLOAB/1-108G....G-KVDESFFKDIKEISNKISELET.SLEPIKGKMDTFLEALPNIP
SYSC_CAEEL/2-114KE...P-QGTD.DSVADDIVARLAELKID.ELSQLTVVQLKKLRVLVDEK
SYS_RHILO/1-114GD...A-ALAEKLKAEVGDIKTFIQNGEA.RERELDKALTDALAVLPNVP
SYSC_ARATH/1-112K.....-EDASEIIQQTEKNKQDSTAKEA.EVREAYAALKAKLEQVGNLV
SYS_MYCPU/1-107......-EEKNELKAKISKIKKEQEQKEK.KSELIDDRVFFLLANLPNII
SYS_VIBPA/1-109GD...K-EGAEEIKKQIGTLGSDLDAKKV.ELEQVMAQLDEFTLSVPNIP
SYS_PSESM/1-107G.....-EDIAPLMADVERMGNELSEGKV.ELDAIQAELDALVLNIPNLP
SYS_CAUCR/1-109KD...E-AEAARLMAEVESLKGVMATAAE.AENLADGQLKDLLASLPNIP
SYS2_LACPL/1-108K.....-EDASAEIAEMQKVSADVKTLDE.ERRTVDAQVQDMAAHLPNMP
SYS_MYCLE/1-106D.....-..RPALLERAKDLAEQVKAAET.TQAETAAAFAAAYMAISNVV
SYS1_LACPL/1-108S.....-EAGQALIQQVKQLNGDIKSTEA.AQTEVNDRLHYLAIRFPNLP
SYS_LACLA/1-108K.....-GDASAQIAAMQKVSAEIKAIDA.ELAEIEENLNEIIIMLPNLP
SYS_CLOTE/1-110G.....-KNVDDIMAEMKELAGKIKKLDE.RLSEIDGSIEYIMLRIPNIP
SYS_BRADU/1-109KD...E-ARAATLMAEVAELKTTMPQLEA.AAKAADEELTKELSAIPNIP
SYSC_CANAL/1-112K.....-EDAKDLIAEKEKLSNEKKEIIE.KEAEADKNLRSKINQVGNIV
Q89ZR4_BACTN/1-112GK...K-EEAEAARARVAELKESNKALDA.TMTQAATDMQNVLYTIPNIP
SYS_THEAC/1-108NN...G-DASAEKK.AVEDINARISDLEN.KLKKIEEERDRILWTIPNLV
SYS_HALSA/1-109GD...E-DAAQEAIERSQALKDELADVEA.RADDLEAELERLLLTLPMVP
SYS_WIGBR/1-107N.....-KNIDIYKNKSNKINILLNEKKQ.KLKKIKKEIDNYLSTIPNIL
SYS_BACHD/1-108K.....-KDADHLIKEMRDVSDEIKGLDE.TLRQLDEELDQLLLAIPNVP
SYS_THEEB/1-112GIAPTD-PEIQALKAEANALKQKLSDLEP.QERQLKEELESLLLTIPNPP
SYS_STRMU/1-108Q.....-EDASEQIADMQKLSAEIKALDA.QLVEIDGQLKTFTTTLPNIP
SYS_CAMJE/1-104......-.DKESLKAKLSENKSKINEQSA.KVNALENELEEIAHAIPNIP
SYS_STRA5/1-108K.....-ENADEQIAAMQTLSADIKAIDA.ELADVDANLQSMVTVLPNTP
SYS_SHEON/1-107G.....-EDVDAIMAQVGDLGAQLDAKKV.ELAAVLEEVNAIAMSMPNLP
SYS_UREPA/1-109K....D-PKLQQTLDLVNNIKNELQDISL.TLSNKQDELNKLLLVIPNMP
SYS_OCEIH/1-108K.....-KDAEPAIKEMREVGQEIATLDK.QLKDIEEKLEQIMLSIPNLP
SYS_DEIRA/1-105.....P-EDRPGLIQKGKDLSEDLKALEP.QLREQEDALKQLLLRVPNIP
SYS_MYCPE/1-109KD...N-KKVDELKKEMESIKNTLETTNE.ELKTISAKVDDILLSIPNIP
SYS_LEPIN/1-109G.....-GDITKISASVKLVGEKIKEIES.KLEQEENALLNINLGLPNIL
Q9VQL1_DROME/2-115KE...P-VGAMSEDLPADVTKDLTEIVAE.TLQPLTVNQIKQLRVLIDDA
SYS_BIFLO/1-106......-.EKAKLIAETKELSQKVSEYKS.KADSAAEEYTTAMWKLSNIV
SYS_THEMA/1-110GK...N-AEAEALIEEGKRLGEEIKALEE.KEKELQKKLNDLLLMIPNIP
SYS_STRCO/1-106E.....-..KAELLKRAEQLKTDVKAADA.ERDAADAETQELLQRLGNLV
Q8IBS3_PLAF7/2-115DK...N-ADVEDLKKKSLNIKEEIPKYQL.KEKELLKERNKYISKIGNLL
SYS_CHLTE/1-111G....Q-GSADELIGQMKQVSDEIADLDL.ALSALEAEIEELLLTLPNKL
B6TBG7_MAIZE/74-177S.....-.VRQALVEEGKNLKEGLIALEE.DLVQLTDKLQLEAQSIPNT.
C4YXW5_9RICK/1-107S....G-EEFEGLQRDVKHINEKLEELEQ.DLNN.NNELNELLNMLPNIP
C5ACG9_BURGB/1-106G.....-EDTSAVMAEVGGIGDEMKASAA.KLDEIQSAMSELMLGMPNL.
C5WTV8_SORBI/1-114KQ...E-EEAKKLMESTDEIKKRLAAKEV.EVQEAKSTLDAKVTTIGNIV
F4IAJ4_ARATH/79-182......-SERERLVEEGKNLKESLVTLEE.DLVKLKDELQHVAQSIPNM.
SYS_STAA8/1-107K.....-ENADDVIAEMRTLGDDIKEKDS.QLNEIDNKMTGILCRIPNL.
SYS_MYCTU/1-105......-EERPPLLRRAKELAEQVKAAEA.DEVEAEAAFTAAHLAISNV.
SYS_BRUA2/1-109KD...M-GTAEKLKAEVGELKDFLAHAEE.DERRLSKELSDALSTIPNIP
SYS_SHIDS/1-107G.....-EDIEPLRLEVNKLGEELDAAKA.ELDALQAEIRDIALTIPNLP
SYS_NEIG1/1-109GK...H-EEAQAAMDQVAQIKTDLEQAAA.DLDAVQKELDAWLLSIPNLP
SYS_THET8/1-102......-EEKEALIARGRALGEEAKRLEE.ALREKEAQLEALLLQVP...
SYS_STRR6/1-108K.....-ENTDDKIAAMQNLSAEVKALDA.ELAEIDAKLTEFTTTLPNIP
SYS_STRP1/1-108K.....-EDATQQIADMQKVSADIKTIDN.QLVAIDQQVTDIITVLPNTP
SYS_XYLFA/1-108G.....-EDVSSLMAEVAAFSDDLKASEI.ALEEIRTELEKVALGIPNLP

PF02912

D3F0H4_CONWI/20-88P----P.EQRGAVGKAANEARKALEALID-ARNAD...LAAAELDV.QL-
D5QGH9_KOMHA/20-88S----P.EERKLRGSALNRLRDELSREIA-ARGEA...LEAEALNA.RL-
S5R845_9PROT/19-87S----I.NERKRYGEIINSIKINIKKELN-IHRDI...LKKKQLKV.SL-
R6HCE9_9FIRM/20-88S----P.EERPVMGQLANTVRAEIEARLE-RRKSA...IHAAALEA.RL-
D3PN96_MEIRD/14-82P----P.EERREKGRVLNEWKRALELALE-AREAQ...LKEQALQA.QL-
D3FWH7_BACPE/20-88S----A.EERPLIGQMANEVRDEIKSAIE-TKEVA...LETAAVEA.KL-
B3SFN1_TRIAD/20-86S----K.DEKKEFGAKVNKLKDYIQKEIQ-EVKSH...IEEKILNE.KL-
I4WNQ8_9GAMM/19-87A----P.EERKARGAEVNKVKDCLADALA-VRKQL...LEQAELDR.RL-
A5EXT2_DICNV/25-93P----A.TERPQFGKIVNQAKAHFQNAFN-AKKTA...VSQAALQQ.KL-
B2HR20_MYCMM/28-96P----K.EQRADAGKAVNLARGDAQCSYD-ERLAV...LRAERDAA.VL-
R5HWY3_9FIRM/20-88A----P.EDRPKVGQWVNDTRSAIETILE-EKMKK...LEADALKK.RY-
R5B0T6_9BACT/18-86S----P.EEKRAAGQALNALKAVALDKIN-SLRDA...VNAAASKE.EA-
R7AGA8_9BACE/21-89A----P.EERPQVGQIVNETRQAIEEMLE-NARTD...LAKKKREL.QM-
R6GYM5_9FIRM/20-88S----E.AERPFIGKLINETRSAIEQQIS-QAASV...FEKQELNR.KL-
SYFA_CORGL/21-89P----K.DQRKDAGRFVNMALGRAEKHFA-QVKVV...LEEKRNAE.VL-
SYFA_AQUAE/19-87P----S.EERKEYGKRVNLLKEEAEKLIK-EKEEE...LKERELEE.KL-
SYFA_WOLSU/12-80D----E.EEKKEKAKELNQLKGEFEREWT-LKKEI...IATEELHK.KL-
R6NQ38_9FIRM/20-88A----P.EDRPLVGQLVNETREAIEKKLD-ETKQK...LEAAQMEL.KL-
R6X2S6_9CLOT/20-88S----T.EERPVIGSLVNEVREKIETVFN-QKEEE...LKNKEMEE.KL-
C5ZZ75_9HELI/12-80D----E.AQKKTLAKELNLLKMEFEKALA-NKKEE...LSFKELQE.KL-
SYFA_CORDI/32-100P----K.DQRKDAGRLVNMARGRLEKHFA-QVKEV...LEAKHLEE.ML-
G2TKP8_BACCO/20-88S----A.EERPKMGALANEVRAAIQTGIE-KKQAA...LEAEAVER.QL-
D2PM91_KRIFD/36-104P----P.QGRKEAGQRIGSARKAINEAYA-SRLAV...LEAEHEQR.ML-
E6U0I2_BACCJ/20-88S----A.DERPKVGQAANEVREAVATVIE-EKEQK...LEEAALTE.KL-
C7N307_SLAHD/22-90A----K.EERAVVGKTVNEVRQTIEAALD-EHKAI...LERSELLA.KM-
E8RJU7_DESPD/20-88A----A.DERPRLGQLANAIKQEIEDRFE-TLKAQ...FQASALT..RA-
R6AP89_9FIRM/31-99S----A.AERPVIGALANTVRTDVEAVIA-AKAAE...LKAKRLEE.RI-
R6U1C4_9CLOT/20-88E----A.DKRKEVASFANNVKSKIEEEIE-NKKAS...IKEKEYND.KI-
D3QAE4_STANL/38-106P----P.AAKADAGKRVNTARQAVTVAYE-ARAEV...LAAEAAQR.VL-
SYFA_PELPD/20-88S----A.EERPVVGQMVNSIRDEIESGIE-AGLFA...ARERARDE.KL-
R6CNS1_9FIRM/20-88S----P.EERPVIGQLANKVRADIEQAVT-SAQNA...IKSKAAAM.KL-
R6XDT9_9FIRM/18-86T----I.EEKKTIGAASNKVKQEIELAIA-NKRVA...IENAEINA.QL-
SYFA_PROMM/29-97P----S.EERPLVGQRANVLKTQVQNLLG-ERLQV...VKAAALAD.RL-
SYFA_GEOKA/20-88P----P.EERPKIGALANEVREAIQQALE-AKQAK...LEQEEVER.KL-
D2RJL9_ACIFV/20-88A----A.EERPKIGKMVNEVRAKMEQRIN-EQMKL...LEAHQMEE.KL-
G2KW84_LACSM/22-90P----V.EERPVVGSFANTIRDELATAIT-TKQTE...LENAKLNA.KL-
R5MRT4_9FIRM/18-86N----P.EERKTFGMEVNDVRNSFNEIYE-TKLKE...LNEKELNE.KL-
SYFA_PSEPK/19-87P----A.EERPKVGALINDAKERVTVVLN-ARKAA...FEEAELSA.RL-
SYFA_LACBA/22-90D----A.EERPKVGAFANEIRDDLTAALT-KRREE...LENAVLNA.RL-
SYFA_RUTMC/19-87S----K.EQRPKMGEAINQIKVNIQVLLA-DKKNN...LELIALEK.RF-
K4KFC7_SIMAS/19-87S----A.EERPAAGAEINKAKQAVQDQLN-LRKQA...LEEAEINA.KL-
H5WKC4_9BURK/19-87P----V.EEKKTRGAEINQAKQAIETALT-ARRQA...LADAELNA.QL-
R6MN70_9FIRM/20-88S----A.EERPVMGQMANNVRAAIEEKLE-EAKTT...LKAKALEQ.KL-
C6XKF6_HIRBI/23-91S----P.EERQEAGPKLNGLKTRLADTIT-ARKEV...LETEALNA.QL-
A7IGN3_XANP2/31-99S----P.DQRKVMGPAINGLRDRVTGLIT-HRRSA...LKTKALEA.RL-
B1WVT1_CYAA5/33-101S----A.EERPRVGSLANEVKESLQSHLD-NQRNS...LETAKLKA.QL-
E1VUN8_ARTAR/40-108D----K.SEKAVAGKLVGSARGRVNKALA-ARTVV...LEEAEAAR.IL-
M5DSW2_9GAMM/19-87A----P.EDRPKIGAVINVAKDQVQDAIN-ARKLA...LETAALNA.KL-
F2NPL4_MARHT/13-81P----P.EERREKGRLLNEWKRALEAAFE-ERAEA...LKRAALEA.KL-
D3EQU2_ATETH/27-95D----S.SKRPYVGSFANKVKNVVQKQLD-EKLHD...LSFAELKA.KI-
E6SIV5_THEM7/50-118P----P.DLRPAFGQRANAAREAVEAALA-RRRQE...LEAQQEQR.RL-
SYFA_STRR6/25-93S----A.EMRPIIGKHVNEARDVLTAAFE-ETAKL...LEEKKVAA.QL-
D7BE71_MEISD/14-82S----P.EERKEKGRALNEIKEKLTAALA-AREAA...IKEQSLQE.QL-
SYFA_DEIGD/13-81P----P.EERKRRGAELNALRQAIDAALT-EREAV...LKRAALDA.RL-
I5AR65_EUBCE/24-92A----P.EDRPKVGQLVNEARDQITEKLE-AAKQK...IEMQQMEL.KM-
J9S5B5_9ACTN/37-105P----K.DQRSEAGKLVNQVRGRVSAALE-ARTAV...LDAERDAA.VL-
R5Y6B3_9FIRM/20-88S----A.EERPVIGQLANEIRADIEKKIA-EKSAQ...IKEAELKH.RL-
SYFA_GEOSL/20-88S----P.EERPRMGQMVNTVKDRLETTLE-ETLQR...VRAAAKKE.RL-
SYFA_CHRVO/19-87A----P.EERKAAGATINQAKQAFEAAHN-DKRDQ...LNAAKLEA.QL-
L0DY04_THIND/19-87P----A.EERPRAGQAVNEAKGELSGRIE-ARQRE...LAAAEVAR.KL-
SYFA_CHESB/19-87S----P.EERQVMGPAINGLKNRVTEALA-ARRAE...LRDIAIAA.RL-
F6B409_DESCC/20-88P----A.EERPRIGQIANEVRQQIEAALE-ARNQA...VKEAQKAK.QL-
SYFA_LACLA/22-90T----N.EERPVIGALANAFRDEFGAKFE-AKKVE...IEQAVMNA.AL-
SYFA_ECOLI/19-87P----P.EERPAAGAVINEAKEQVQQALN-ARKAE...LESAALNA.RL-
R5L2F8_9CLOT/20-88A----A.EKRKEVGQKANNLRDFIESQIE-LKKEE...LKELEYER.KI-
S5TIM3_9CORY/29-97P----K.TERKDAGKMVNIARGSVEKHFA-EVHDR...IEAKEKAE.QL-
W6AA06_9MOLU/21-89D----A.QTRQEAGKLANEIKTQILNTIN-ELQEK...FDQDDLKL.QL-
SYFA_LARHH/19-87P----P.EEKKAAGATINVAKQQFEAAHN-ARRDA...LNAARLEA.QL-
W0GLM9_9MOLU/20-88K----H.EKRVAMGALANKAKSELTTLWQ-TKKQE...LELVYLNN.KL-
K4IPC1_BIFAP/27-95P----A.DQKKTAGRLAGKLKADFGRAYG-LKERQ...LRQEEESR.RL-
SYFA_HISS2/21-89S----A.EERPAVGAKINEAKQKVQAILN-AKKVE...WEEIALNE.RL-
R5R3I5_9FIRM/20-88A----P.EERKTFGQTSNLVKQELSKAVE-DKKEA...LENQAILD.KI-
E6U2U6_ETHHY/21-89S----A.EERPVIGALANEVRASIEDKIA-AAAAA...LRERQMQE.QI-
E4U4K5_OCEP5/13-81D----P.EERKARGQELNRVKQAIEKALE-EREAE...IKAAELAA.KL-
X2GVA3_9BACI/36-104S----A.EERPKMGALVNTVRENVTAVLE-TKATV...LEEAAIAE.KL-
G2KS35_MICAA/23-91T----P.DERKETGAALNVLKDEIADLIA-RQDAA...LKKQAMDQ.KL-
SYFA_THISH/19-87P----P.EERPAAGQAINRAKETVNEALS-ARLEA...LSAAEQEA.RL-
R7L9W5_9BACT/20-88D----K.AQRPIAGKLINQAKQKIEPMIA-AAYAR...IENEEMAA.AL-
E8SFJ6_STAPH/22-90P----K.EDRPAYGQRVNEVRQAIEGAVA-ERQTL...LAEAQLNQ.QL-
E6WZU0_NITSE/12-80P----G.PEKKAFAEGLNRKKAQLQARFD-ERLSA...LKEARLQE.QL-
SYFA_STRMK/19-87P----A.DERKAAGEAINQARDVLTRALG-ERKAL...LEDAALDA.RL-
A8F395_PSELT/17-79P----V.HERPGAGKILNELKDAVQRAIE-QKKEM...LK.......KI-
E6VRJ1_DESAO/27-95D----A.TEKPAGGKKANEVKQCITTLLD-AWQAE...LSQAESGR.AL-
Q2VYY9_MAGSA/19-87G----P.DERKAAGAALNAARGEVEGALA-AAKAT...LEAKAWTS.VW-
SYFA_ERYLH/19-87D----P.EERQKAAPAIQAVRAEVADAIA-ARKDA...LEREALEA.QL-
Q6KHX3_MYCMO/11-79S----K.EQKASIGQKINFYKQEIEQFFL-TKKEE...IEKKEVLK.KI-
K0J3E3_AMPXN/20-88S----P.EERPVIGELANKVRGAIADAIE-KEKAT...LEEAALNE.RL-
E6S8E4_INTC7/36-104P----P.SAKAEAGQRVGQARGRVSAALT-ARQAE...LEAERDAR.IL-
A0RQC7_CAMFF/12-80P----S.DEKKAFAENLNIKRDTLTVHIN-DKKSI...LEKEFIKA.KM-
U5LEE3_9BACI/20-88S----A.EERPKMGALANEVRDSISSAIE-EKQEK...LERAAVEQ.KL-
C7LV64_DESBD/24-92G----P.EERPAAGKAANQVKVAMTSLWE-EQVAA...LKSRAREQ.AL-
D5UZC0_ARCNC/12-80P----N.EEKKAFAQDLNTKKIEITNALE-SKKEI...LEKIELNK.KL-
SYFA_THET8/13-81P----L.EERRKRGQELNAIKAALEAALE-AREKA...LEEAALKE.AL-
R5TBA8_9FIRM/87-155S----E.SERPVMGALANTIRETVEKQFT-EKLEE...LKAKKLEE.KI-
R6RV93_9CLOT/20-88S----P.EERPVIGQLANEVRENITQLLE-SAQAD...IKTKERNA.KL-
D4H1G6_DENA2/19-87P----N.EDKKEFGMKLGELRNGFEALFN-SKETE...IAKSELDA.KL-
I0KCE2_9BACT/18-86P----A.DERRALGQQLNGLKNRAQERFA-AFQEV...VDAQQQAA.AA-
R5NL52_9FIRM/20-89A----P.EERASYGKGVNELKEWAINYFA-EIEEK...IKAKELEE.KY-
E1VIK1_9GAMM/19-87P----A.EERPQAGAEINQAKVQVQDALN-LRKAL...LEQQALER.RL-
SYFA_FLAPJ/18-86P----N.DQKKEFGQVINLLKTIAEEKVK-TITEE...LESKEEIK.SL-
SYFA_CAMJE/12-80E----D.EAKKEFAAKLNAQKEIFNEAYL-AKFKD...LENLALEE.RM-
J9YYI7_9PROT/18-86S----L.EEKKTIGAQINSIRDKVDTLIK-EKLLE...IKTNEINS.KL-
R5IR39_9FIRM/20-88S----A.EERPVMGQAANNVRAAIEEKIE-TVRAE...LKEKAMEA.RL-
R5BTJ9_9FIRM/20-88S----A.EERPRMGALVNTVRQELEAMID-DVQAK...LEAEVLAA.KL-
U6B4B0_9RHIZ/26-94D----P.DLKCSRGAILNRIKDELSKRIS-SRRES...LKSSSICF.KI-
K4L6C1_9FIRM/20-88S----A.EERPKMGQIVNELRTQLEDAWD-KKWRE...FEKNALES.RL-
E8N9J4_MICTS/27-95A----P.DHKAAFGKLVGQARGQVNQALA-ARETE...LAEAETAA.QL-
D6Z8H5_SEGRD/20-88P----P.EERAESGKAVNAAQAEIKAAHN-ARQTQ...LEAERERF.VL-
K9V4Y0_9CYAN/27-95P----P.EEKPKIGAIANTVKEAIQTSLE-RQRTS...LESVKIRA.QL-
D7BP30_ARCHD/27-95D----K.SERPIAGKLMGGARKEIQAALA-EATER...IEAAAEAR.ML-
R5ZBV6_9CLOT/21-89P----N.EEKKAFGQRINEIKEKLASIFD-EQKKL...IEERKLNE.RL-
SYFA_RICPR/19-88I----NGQKRKEFGLKINTLKDKIHDIIK-AKAQN...LEAEELHL.KL-
D5A3B3_ARTPN/27-95E----P.EARPRIGAIANEVKQALQTQLD-QRRTA...LELALIEA.QL-
L0FSK7_ECHVK/19-87P----N.DQKKAYGQLVNSVKQAAEEKFK-ALIDK...VNEGERTS.KS-
SYFA_STRA5/24-92S----N.DLRPVVGKQVNEVRDILTKAFE-EQAKV...VEAAKIQA.QL-
SYFA_NOVAD/19-87T----P.EQRQSEGPKIHAAREAVTTALA-ERKSA...LEGAALEA.RL-
B1ZQM9_OPITP/20-88P----K.EQRPALGKLINETKGQLQQQLD-AALRT...IEAGELQA.QL-
K9RTF0_SYNP3/30-98P----P.ADRPRLGALANILKDEVQASLE-QKKAA...LQTAQIEA.QL-
J3VU78_9ENTR/19-87K----A.NERAPLGLIINKAKETIQKALT-DRKQT...IEKLTLQK.RL-
Q12BQ9_POLSJ/22-90S----V.EEKKSRGAAINLAKQAIEAALN-DRRQA...LANAELEK.QL-
M1E4N2_9FIRM/18-86T----P.EEKRKMGMQLNSIKTFINEIRD-KKLKI...IKEREIYN.NL-
C7RDV0_ANAPD/20-88P----N.EEKPAAGKLINKTSKEIEEKLL-LKNEE...IKKALLEE.KV-
SYFA_RHOCS/19-87T----P.EERKERGQQLNALKDRVAEAIE-ARRTV...LKKEALAQ.RL-
SYFA_EXISA/20-88S----A.EERPIIGELANTVRTAIQSTLD-ARIEE...VKAIELEE.KL-
R5QB69_9BURK/19-87A----P.EERRARGQEINRAKQQVEAALN-ARREA...LAEEALAA.KL-
E3DR66_HALPG/22-90E----A.EQRPIVGKNANILKNKIQNWIN-EHQQK...LAAEAAEK.RL-
Q98QL3_MYCPU/9-78P----V.DQKKILGQELNDLKQKYEKIFE-EINEN...IKSYNIKKRND-
SYFA_COXBU/20-88P----A.DQRPLLGKAVNEIKREIQQLLN-AKSTQ...LREKSLQE.KL-
SYFA_STRT2/24-92P----S.EERPTVGKMVNEVRDVLTEAFD-EAAKV...VEAAKIQA.QL-
R7MHN4_9CLOT/20-88S----V.EDKKIVGSLANEITQKLESSIK-DKFKL...FYEKELNE.KL-
SYFA_HAMD5/19-87S----V.EDRPAAGRVINQAKKQIQQWLD-TRKKT...LQSELLAR.RL-
SYFA_SYNPX/29-97P----G.SERPLVGQRANVLKTQVQSLLA-ERLAA...VKQAAMAE.RI-
R6U6G1_9CLOT/20-88S----N.EERKDFGKRVNDLKGAVAKSIE-EKTAE...LKEKEIQM.EI-
V4IYP3_9GAMM/24-92P----K.EQRPAVGQIINQVKTAVQEQID-VRKQA...LQRVALEQ.RL-
R6VD34_9FIRM/20-89P----P.EQKKTTGQLINTFKQEVIAKFE-EKEKE...LIRLEEERAIN-
I7GZ45_9HELI/16-84P----D.EQKKIQAKILNTFKQEFESKLT-EKKES...LFVAQMNE.NL-
L0IXQ8_MYCSM/42-110P----K.ADRADAGKRVNVARTEAQRAFD-DRLAA...LRAERDAA.VL-
SYFA_XANCP/19-87P----A.DQRKAAGEAINLARDALTTALS-ERKQV...LETAALDA.RL-
SYFA_METPP/19-87P----V.DEKKARGAEINAAKQQVEAALT-ARRQA...MADAELAQ.QL-
C1A064_RHOE4/37-105P----G.KEKADAGKRVNIFRTRINNAYD-ARREV...LLAERDAA.VL-
E3PXU7_CLOSD/20-88S----A.EERPVIGKIANEVRGEIESIIE-EKKSS...LKLAVINQ.KL-
V6F5W0_9PROT/19-87D----P.DARKAAGAAMNKVKDEVAEAIN-VAKTL...LEAKALDQ.RL-
C8WKG2_EGGLE/39-107A----K.EERAAVGKTANEVRAAVEGALA-ARKEE...LAASELAA.AI-
A7I0N3_CAMHC/33-101P----N.NEKKEFAKKANEKKELYNNLIS-EKRSE...LEAKKQNE.FL-
F7YY40_9THEM/17-85S----P.EERPKVGKLLNELKDKIEAMIE-EKRYQ...LKQEEERK.AI-
SYFA_NITEU/25-93T----P.EERPVMGERINQAKKLLEDALI-ERRNL...IQEKNMSA.RL-
D2S8R2_GEOOG/36-104P----P.AARADAGKRVNAARVAVTEAYE-TRRAE...LEAERDAR.VL-
R5UWU8_9FIRM/20-88S----A.EERPVMGQLANAVRSDIESAIT-KQQAA...IAEAALEQ.KL-
R7G4R5_9FIRM/19-87S----A.EERPIFGQKVNDVKKLMSEAIE-ARKEV...LESEEMER.RI-
SYFA_PHYAS/21-89P----S.EKKPAIGKLINEFKKTIILSLQ-KEKQY...LKTQKMNL.EL-
E3CXV9_9BACT/23-91A----P.EERPALGQAVNRLRDACEESLK-VRAAE...LREQEEEA.AE-
SYFA_SULSY/22-90S----P.EERKEVGQLANSIKEFLEEALK-AKQEE...IEKKKLEE.IL-
F4LW88_TEPAE/20-88T----P.EERPIIGKLANEVKADLEQKIS-EKMQQ...LRKTLKDS.KM-
B8HPR9_CYAP4/30-98S----A.EDRPRIGALANDVKEALQTALE-QKRSD...LQTAQIQA.QL-
F7V6I9_CLOSS/20-88A----P.EDRPKVGQMVNEASRKIEGQLD-ARKRE...MEQQELLR.RL-
A1SJI4_NOCSJ/36-104P----P.QARKEAGQRIGQARGAVNQALA-ARQAV...LETEQEER.ML-
X5ECJ7_9CORY/27-95P----K.DQRKDAGRLVNQARGRIEKAYA-SAKSA...LEEKRNAE.VL-
D5X0W5_THIK1/19-87P----T.EEKRARGAEINLAKQAIEQALQ-RRREA...IEQAALQA.QL-
D1A1M3_THECD/36-104P----P.HARAEAGKRVGAARKAVAEALK-RRQAE...LEEERDQR.VL-
R6LMC9_9FIRM/20-88A----P.EERPKVGQLVNETRAAIEELLD-ETKKK...MDAAIREE.KL-
D4J8P1_9FIRM/20-88P----P.EERPAFGQMVNEARQEIENSLD-TMKKD...LAAKAREL.QL-
E3H0H0_ROTDC/56-124E----N.QHKGPVGKLLGQARAALTEAIE-ARTAE...LEAEREAR.IL-
F0S361_DESTD/21-89P----P.EERKEFGKACNILKGEIESLIK-EKQSY...FKEIEKKK.KL-
I4B6L1_TURPD/23-89T----P.EERTAVGKAANTFKAKLDELLA-AKEKQ...LTESKFAS...-
SYFA_AGRFC/19-87T----P.EERQTRGAAINQLKTEITDLIG-ERKNA...LKDAAIAA.RL-
SYFA_EUBR3/20-88A----P.DERPKVGQWVNETREAVEKLLD-EKVKK...FEAEALKR.KY-
E8RRV8_ASTEC/45-113P----P.EERKATGAAINAVRDQIQAALD-ARKDV...LEAEHLSR.RL-
SYFA_PELTS/20-88S----A.EERPRIGQAANEIRDFIEKELA-ARTAA...LKEMVKEQ.KL-
SYFA_MYCLE/22-90P----K.IDRAAVGKQVNTARSEVQRDYD-ERLAT...LQAERDAA.VL-
I0GK52_CALEA/19-87A----D.KDRKEFGENVNKLKEYIENTIK-EKERK...LLDILKEE.KL-
SYFA_GLUOX/20-88E----P.QERKERGQALNRLRDELTAAIE-ARGRD...IEEEALQA.RL-
SYFA_DESVH/22-90A----P.AERPRVGQAANTVKQALTELFE-QRKVV...LEQAKEAA.AL-
E3D9C2_GARV3/41-109Q----V.EEKKEAGKIMSALRADFGREFA-AAQER...IKAIEEAN.ML-
F4F3N9_VERMA/36-104P----P.AAKADAGKRVNEARRSIEQAYA-ARSEV...LDREQAQR.VL-
F9ZSL9_ACICS/15-83D----P.QARREAGQKLNVLKDDIQEWLE-ARRRV...LEEEAMVA.RL-
S6ATC8_PSERE/19-87P----A.EERPKVGALINAAKERVQEALN-TRKES...LEQAALSA.KL-
SYFA_CLONN/20-88S----S.QERPVIGKLANEVRGSIEELIE-KAVTE...IKLKEKEA.KL-
R7KBS2_9CLOT/18-86P----N.EEKKEFGMKMNELKTSFNSLYD-SKKTL...FEEEALNE.KL-
G7UR80_PSEUP/19-87P----A.DQRKAAGESINRARDVISQALT-QRKAV...LEDAALDA.RL-
R6HCP7_9CLOT/20-88S----P.EERPIIGGLVNEAKAVLENLIE-EKETK...FEQEELNK.KL-
SYFA_MARHV/19-87S----A.EERPAAGQKINEAKGQVEQAIN-ARRAD...LEKAAIEA.RL-
D7GNY8_9FIRM/20-88P----K.EERPNVGKTINEFKNQVEARYQ-EMKNK...MDELELAA.RN-
W8FCV6_9BACT/19-87P----Q.EDRRAVGQELNQLKQAAQTRFE-QRQQE...LEAASANA.PA-
D9QKI2_BRESC/19-87S----P.DERREQGPVINGLRDRVTSAIA-EKKAG...LEAAELDA.RL-
D9SF45_GALCS/31-99S----N.EERPAAGARINQVKQVIEAALQ-QRRDT...LAQAKLDA.KL-
F7ZZ47_CELGA/39-107A----P.ADKGAAGRLVGQARGRLTAAIA-ARQTT...LEAERDAR.VL-
R5ASX9_9CLOT/22-90A----P.EERAAVGAEANRVKQAVEAALN-ERRAA...LEAAAQAA.RF-
D5BDU7_ZUNPS/18-86P----N.EQKKDFGQTVNELKTAAQEKVD-ELKER...LDSLEEEK.GV-
F4H7U9_CELFA/29-97A----P.ADKGVAGRLLGGARARLQQALA-ERQTQ...LEAERDAR.VL-
SYFA_MARMS/19-87S----A.EDRPKFGQMVNEAKDQVQEKIT-ERKAS...LAKAALDA.KL-
E4RLI2_HALHG/22-90A----S.DKRPVVGKEANQLKSKIENWLN-EQKEV...LESKAAKE.RF-
SYFA_ACAM1/24-92D----A.SERPKIGGLANQVKEALQQGLE-QKKSD...LNQAAIAA.QL-
X4QN04_9ACTO/26-94D----K.ADKPTAGKLMGAARKAIQEALA-EATAR...LEAADQER.VL-
SYFA_HELHP/12-80E----G.ETKKTFAKELNKNKENFEKMLE-SKRES...LLKVQMNE.NL-
R6G2K4_9FIRM/20-88A----P.EDRPKVGQMVNEARAGIEAKME-EKRTA...IQKKLREE.KM-
V5UA03_9BURK/18-86D----P.EARKTEGARINAAKQQIEGALQ-ARRQA...MADALLDA.RL-
I2F4U8_9BACT/19-87P----P.EERREYGKTVNEYKNFIEEALN-RRKSE...LENKAKKE.RE-
SYFA_SERP5/19-87P----A.EDRPAAGAVINQAKQAVQEALN-ARKNA...LESAALNE.RL-
D6GSI9_FILAD/20-88S----P.EERPTMGKIVNEVRDEIETAIR-EKKEH...LENIALEQ.KL-
R5A3Q5_9CLOT/20-88S----N.EEKKEVGALSNEFRIELNDAIN-LKLKE...IKEETLKK.KL-
SYFA_MESFL/20-88D----T.NDKQAIGIASHELRTFIASTID-EFVAR...IKKEALDA.KL-
R7LG46_9BACT/19-87P----A.DQKREIGMKLNELKTALQNKFN-ELRQN...LATQEDDY.TD-
SYFA_HELMI/20-88P----A.EERPLMGALVNEVRAELEFKLE-EKSRE...LKAREKEA.RL-
SYFA_COLP3/23-91P----K.EEKPKMGQVINIAKQAVQKLLT-ERGEL...LRAQEIKE.KL-
R4U488_9MOLU/20-88P----H.EERLIVGQLANKIKGELTALWQ-ATRKE...LELAELTA.KL-
SYFA_MYCMS/20-88S----S.DKKQEIGKLANQIRVEIINQLN-EKQEQ...LKNKELLV.KL-
SYFA_ACISJ/19-87S----P.EEKKTRGAAINVAKQAVEAALA-ARRQE...LADAELQA.QL-
G8PDN9_PEDCP/22-90S----K.EDRPKVGEFANRVRDNLTATIE-KRRTE...LEKERLNR.KL-
K9UIS3_9CHRO/23-91S----A.EERPAIGAAANVVKDAIQARLD-RSKTD...LQTAQIQA.QL-
R5HFN5_9SPIR/20-88S----D.EDKRIVGSLANEITQKLEASLK-EKHDE...FYKQELDA.KL-
R6TA42_9FIRM/20-88S----P.EERPVMGQLANDVRAALEAAIE-SRSDA...LAQEAMAA.RL-
R6FW94_9CLOT/20-88S----P.EERPVVGKLVNIAKNEVEAKLE-EVGSK...IKEKEKNA.KL-
R6NNV6_9FIRM/20-88A----P.EDRPKVGQWVNEVRAELEGLLE-ETKAK...LEAEALEK.KL-
SYFA_HERAR/19-87A----P.DERKTQGAVINSAKEKIEAALT-ARRDA...LSNAQMES.RL-
SYFA_AZOSB/19-87P----P.EEKREAGAAINRAKTAIEAALE-ARRNA...LREAALLA.QL-
S5XVV2_PARAH/19-87S----P.EERQTTGASLNRLRDEIDAALR-ARREG...LENAALDA.RL-
A5IXK6_MYCAP/11-79S----P.EERKLIGIKISELKIFYEAKFK-EVEKR...LEKEKINK.II-
Q01SP8_SOLUE/21-89A----P.EERKRIGQVLNAAKQELETALD-ARKRE...FDDAVLRA.RL-
B9KHH4_ANAMF/26-95Q----DMNERKAVGSAANAACAALKLAIQ-DRESQ...LAREQLHS.RL-
E1X2F2_HALMS/20-88T----P.EQRKAIGPKANDIKNNITDMVA-AKLTA...IEAQEINE.KL-
R6MS00_9FIRM/20-88S----K.EERPQIGALANEIRGVIENHID-TKKAE...ISEKLEEI.KL-
X4ZW87_9BACL/20-88S----A.EERPVIGQVANTVRSAIEEIIS-AKQEA...FQEQETLK.RL-
SYFA_EXIS2/20-88S----A.EERPVVGEIANAVRSVIQTELE-QRLVD...VKQQEMDA.KL-
SYFA_PETMO/22-91D----DVELKKEYGKSVNELKEELETLFD-EKLSE...LKEKEREE.KE-
R6DM83_9FIRM/20-88S----P.DEKKTMGQAVNTFKQSVADAIG-RKAEE...LHKLAVKR.EL-
R7BVH7_9FIRM/20-88P----K.EERPVMGKLVNELRTAVESVLN-QKTQL...VEEQEKLA.RL-
B1XPE3_SYNP2/28-96S----A.EERPKIGAIANQVKEVLQGALD-TKLET...LQKAKIEA.QL-
SYFA_GLUDA/20-88T----P.EARKLRGAAVNRLRDDLTREIE-ARGAE...IESAILNA.RL-
E8MZH5_ANATU/22-90P----K.ELRPQIGQSANAVKQALEAAYQ-EKLEA...VRRAALEE.EL-
SYFA_STAEQ/22-90P----N.EEKPAYGQKVNELRQTIQSELD-ERQKL...IKEEKLNQ.QL-
D2UDK3_XANAP/19-87A----P.EQRKQAGEAINRVRDTVSAALA-ARRAL...LDTAALDA.RL-
E7ACE4_HELFC/15-83S----G.QEKAQKAQELNRFKEAFTHAHA-KRKQV...LQDLELEA.KL-
T0VHA3_9ENTE/22-90S----A.EERPKVGSYANEIRDAVTQAIE-EAKTS...LEAAALEK.AL-
R7IK97_9BURK/19-87A----A.DQRKAAGAEINAAKRAVEEALN-ARREA...LAQAALEK.KL-
H1XPD0_9BACT/20-89P----K.E