Sequence alignment for CL0299

PF10502

A0AEF9_9PSED/50-195LTYNPS--------NSVP-VEWYRVGP---LDH-----------------RTSLPPRRWEVCR--IVLA--PLPAVAASF
B7WYS9_COMTE/46-191LTYNPS--------DSVE-VGWYRIDP---LDH-----------------RTSSPPRPLSVGS--IVLV--PLPAEAAAL
A0KUN2_SHESA/46-191LIYNPS--------DSVA-VGWYRLDP---LHH-----------------PSDSLSHRAEVGS--IVLT--TLPPETAVL
A1AYA9_PARDP/32-169LIWNAS--------ASVP-LGLYAVQP---VGN-----------------........LTLGD--LVAV--TLPEPLAQF
A1B266_PARDP/28-165LVWNAS--------ASVP-IGFYTIAP---VDR-----------------........LAVPD--LVAV--MPPEPFAGF
A1B6X0_PARDP/32-169LIWNAS--------ASLP-IGLYRVEP---PTT-----------------........LTLGD--LVAV--DPPEPLAQF
A1VQA6_POLNA/33-169LVLNVT--------GSMP-DLVYKLGL---GEK-----------------...........GS--LVSF--CSPI.....
A1VUX7_POLNA/38-179VVYNPS--------NSVP-VGWYRIES---VTS-----------------PA....DSLHVGS--IVLA--RLPAEAAAL
A1W985_ACISJ/50-195LIYNPS--------DSVP-VGWYRVDP---IQH-----------------RAGSLARSLSVGS--IVLT--QLPADGAAL
A1W9Z2_ACISJ/54-199LIYNPS--------DSVA-VGWYRVDP---LHH-----------------RPCSLPRPLSVDT--IVLT--TLPPDAAAL
A1WDT4_ACISJ/31-177ARINTT--------KSIP-VGLYWTSS---APV-----------------.........EKGA--YVLW--CPPKVGVFD
TRAF_AGRT9/29-173YRLNLT--------PSEP-LGLWRIEQ---LQR-----------------.......PVAIGD--LVFL--CPPSTAVFA
TRAF_RHISN/41-185YRINLT--------PSEP-LGLWRIVK---IDR-----------------.......PSAVGD--LVFI--CPPRTSAMR
TRAF4_ECOLX/30-176AKVNTT--------KSIP-VGLYWKSN---APV-----------------.........EKGA--YVMF--CPPQVGVFS
Q07JC8_RHOP5/30-167FIWNAS--------ESVP-VGLYRLRA---IRK-----------------........LAVTD--LVAV--QPPEPLATF
Q0ACY7_NITEC/30-172FRLNTT--------ASAP-VGLWRVQE---AVT-----------------........YQKGD--FVEV--CPPDLSIIR
B0T9Q5_CAUSK/35-171LLWNRS--------DSEP-RGLYIRSA---AAP-----------------.........SRGQ--IIAF--PAPPSVLTY
B0SV57_CAUSK/29-166LIWNAS--------ASTP-IGLYSIGP---AGH-----------------........LEVTD--LVAV--DAPEPLARF
Q11BL3_MESSB/30-167FIWNTS--------ASVP-IGLYGIEP---VGQ-----------------........VDVAD--LVAV--APPEPLAEF
Q11FV4_MESSB/29-166LIWNAS--------ASAP-IGLYTVEA---ADR-----------------........LAVPD--LVAV--DPPEPLARF
Q11L03_MESSB/29-166LVWNAS--------ASVP-VGLYEIGS---ATP-----------------........LEVTD--LVAV--NAPEPLAAF
Q1M9U2_RHIL3/40-184YRINLT--------PSEP-LGLWRIIP---LDR-----------------.......PAAVDD--LLFI--CPPETAAMR
Q1QF78_NITHX/30-174LRINMT--------PSYP-RGLWRIEA---LDR-----------------.......PADVGD--RIFI--CPPDTAVFE
Q3IUW1_RHOS4/31-162LTLNAS--------HSLP-EPAYLMWA---WPK-----------------.......VIWKGA--VISA--DPPAAYAAR
B4S9K6_PROA2/32-168VIFNYT--------DSLP-HGVYLIRD---IRT-----------------........CEHGD--VVVF--PVPQHVRKL
TRAF_AGRT5/29-173YRVNVT--------PSEP-LGLWRVEK---LRR-----------------.......PVQSGD--LVFV--CPPHNAFFE
Q84HT6_RHIET/41-185FRINMT--------PSEP-LGLWRIVA---LDR-----------------.......PAVAGD--LIFI--CPPQTTEMR
Q89YA7_BRAJA/29-166LIWNAT--------ASTP-IGLYALHP---LGE-----------------........LRDLE--LVAV--RLPEPIASF
Q8KJJ4_RHILI/45-181LVWNAS--------ASAP-VGLYRVGS---GTP-----------------.........ARGD--LVLA--RPPGFVAYL
Q98NU0_RHILO/29-166LLWNAS--------ASAP-LGLYAIRK---MAV-----------------........PTAGA--LVVV--EPPDKVARF
Q9PBT1_XYLFA/31-177ARVNTS--------KSIP-IGLYWTSS---APV-----------------.........TKGK--YVIF--CPPQRTVFD
Q9R6E9_RHIRD/29-173YRLNLT--------PSEP-LGLWRIEA---LNR-----------------.......SPAVGD--LVFI--CPPSNASFI

PF00717

LEXA_MYCLE/154-222KVTGDSM...VE..AAIC.DGDWVVVR...QQK........................VADNGD..IVAA..MIDGE....
RPC_BP163/172-248YIDGESM....V..PRFR.PGETVWVH...PTK........................PPRRGD..DVVI..QIHPDNEDD
Q859R0_9VIRU/129-201QVEGDSMDTGEE..DGLR.DGDLVLVD...QNL.......................KDLREGR..VYAV..EIIGDG...
Q92NY0_RHIME/142-215SVSGDSM....Y..PRYE.DGEVCFVD...PSR........................RVRKGD..YVIA..QIRLEEGG.
LEXA_BACCR/123-192RISGDSM...IE..AGIF.DGDLVVVR...QQQ........................SAYNGE..IVVA..LTEDNE...
LEXA_AERHH/119-187RVQGMSM...KN..IGIL.DGDLLAVH...KTQ........................EVRNGQ..VVVA..RLDED....
RPC1_BPPH8/149-218PASGDSM....E..PVIP.DGATVAVD...TGN........................KRVIDG..ELYA..INQGDL...
RPC1_LAMBD/145-219EVEGNSMTAPTGSKPSFP.DGMLILVD...PEQ........................AVEPGD..FCIA..RLGGDE...
Q81ID4_BACCR/34-100TVKGASM....R..PTLQ.DGDKVIVN...KLAKQ....................FESYGRED..IIVM..KTDNF....
Q8YCN0_BRUME/136-205EVSGESM...L...PLYR.DGDTLIVA...PNA........................AVRRGD..RVVV..RTRDGE...
Q8RDJ6_THETN/35-105DVPTGSM....M..DTIH.INDKFIVN...KFIYR....................FEPVKRGD..IVVF..RFPDNP...
Q8DTE9_STRMU/206-273IVNGNSM....E..PLFY.NGDVIFVK...KTK........................AIHHGQ..IIVV..IVNNE....
Q9CDG2_LACLA/30-98VVDGHSM....D..PTLA.DKERLVIV...RKS........................TINRFD..IVVA..KEETADG..
Q9JZT1_NEIMB/153-223TLTGDSM....E..EKIA.EDAAIAVD...TGE........................TAIRDG..KIYA..FAQDGM...
LEXA1_XANCP/117-185QVQGDSM...ID..DGIL.EGDLVGVQ...RSS........................DARNGQ..IVVA..RVDGE....
Q8ECY1_SHEON/180-250TVSGNSM....L..PVLR.HGTTVGVD...TSK........................KSIIDG..EMYA..IDHDGM...
Q888E3_PSESM/45-118VVKGDSMTAPTA..PSIP.EGSQILVD...TRA........................EVLPGK..LVIA..KLAGSN...
Q37946_9VIRU/132-205TVRGDSMTSPTG..LSIP.EGMQILVD...PAI........................EPTNGR..LVVA..KLESEN...
Q94MM0_BPBPP/133-207TVEGESMKNPGA.RPSYE.PGDVIFVD...PDV........................AAKPGD..RVVA..RLESQV...
Q81TI5_BACAN/46-122SVLSGSM....E..PTFL.TGSIIAIEPTKDGS........................KYQKGD..VITF..KEKDEK...
Q884H2_PSESM/52-120RVEDEGM...QG..CGMS.RGDMLVVD...RSQ........................YAEHGD..IVVA..SLNTR....
Q895M0_CLOTE/31-101SVDGHSM....Y..PTLN.NRDRLIVE...KVTYY....................FREPKKGD..IVVI..KYPKNP...
Q99YY5_STRP1/167-235KVAGDSM....E..PLIQ.DNDLLFIK...VSS........................QVDMND..IGIF..QVNGK....
Q93M86_CLOPE/277-346RIFGDSMNKMFD.......NDFTIIVR...KTN........................SFINGD..IVVA..IIGDE....
Q8CMP2_STAES/31-99TVKGASM....H..PTFE.NREKVIVS...RIAKT....................LDHIDTGD..VVIF..HANAKQ...
Q8EQZ6_OCEIH/39-107IVEGPSM....F..PTLH.DRDQMIVN...KLSYT....................IGEPERFD..IVVF..HAPTQK...
P71159_DICNO/147-217TLTGNSM....E..PVIP.KGSTLGIN...KAD........................TVLKEG..DIYA..IRQDDL...
LEXA_BIFLO/160-228EVHGDSM...VD..AAIC.DGDYVVVR...EQN........................SAVNGD..IVAA..LLDDE....
Q8Y0I3_RALSO/99-181KIPSGSM....I..PTLQ.IGDFILVN...KYTYGVRLPIV........NKKLVELNQPQRGD..VMVF..RYPKDE...
Q8L2B9_PROVU/54-121RVSGTSM...ID..ANIS.DGDIVIVD...SSL........................QANDGN..IVIA..SIDGE....
Q8TWK2_METKA/54-122TVISESM....Y..PYYN.VGDVLLVV...GVPY......................RDIKVGD..VIVY..RLPGKP...
Q9JPL1_NEIME/162-229AVKGDSM....E..GVLN.HGDNILVN...HAE........................TT.PRD..GLYV..IRIDNH...
Q87LN8_VIBPA/86-169QIPSGSM....M..PTLL.VGDFILVE...KYAYGLKDPVW........RTQLVETGKPERGD..IVVF..KYPPQP...
O58298_PYRHO/33-96YAYSDSM....V..PTIN.RWDVFFIN...PLS........................KGEVGD..IIVF..NLSGR....
LEPS_BACSU/38-105VVDGDSM....Y..PTLH.NRERVFVN...MTVKY....................IGEFDRGD..IVVL..NGDDV....
Q98BD0_RHILO/130-199QVQGDSM...L...PLYR.NGDVLIVE...PGA........................VTRKGD..RVVV..KTTSGE...
Q8SZ24_DROME/33-102LCKGPSM....E..PTLH.SDNVPLTE...RLSKH....................WRTYQPGD..IVIA..ISPIKA...
IMPA_SALCH/59-128RASGESM...NQ..AGVQ.NGDLLVVD...RAE........................KPQHGD..IVIA..EIDGE....
Q9C8S3_ARATH/42-121YAYGPSM....T..PTLHPSGNVLLAE...RISKR....................YQKPSRGD..IVVI..RSPENP...
Q8HAA0_9CAUD/140-208NVRGDSM....A..PTIE.PGDLIFVD...ISI........................NQFDGD..GIYV..FGFDDK...
Q8EDU1_SHEON/160-228WAKGDSM....E..PTIH.SNDTLVVH...LGR........................NSPADG..HIYI..FRNGDD...
Q8ERW7_OCEIH/32-100VVDGKSM....E..PTLF.DGNLLMVN...KFVYE....................LSDVNRFD..VIVF..RASKEE...
Y1416_COXBU/128-197IIQGCAM...E...PLFP.NGTTIIVE...PER........................KPKDRD..FVVV..RLQGEP...
Q8KCH1_CHLTE/43-125RIPTGSM....E..KTLL.AGDFLFVN...KFVYGAKVPFT........DISLPKVHDVRRGD..IIVF..KFPRDR...
Q81CX0_BACCR/33-102MVEGISM....Q..PTLN.EKDYILVN...KVNVC....................LSSFHHGD..VVII..KKEDAP...
LEPQ_BACNA/38-107IVQGESM....K..PTLF.NSERLFVN...KFVKY....................TGDFKRGD..IVVL..NGEEKK...
Q8ISG0_LEIMA/49-114VVLSGSM....E..PGYY.RGDVLLLH......HR...................PEYPVTVGD..IIVY..TLPGQE...
Q8A2V9_BACTN/142-218YISGDSM....Y..PILK.SGDIVGFKEINSFS........................NLIYGEMYLVSF..TIEGDE...
Q82XF6_NITEU/174-244DVQGDGM....K..PTLQ.HGDQVLVD...TAC........................NRFVDD..AIYA..IRQGDM...
Q7DII9_SALET/56-123RAIGDSM...KE..MGLH.SGDLMVVD...KAE........................KPMQGD..IVIA..ETDGE....
Q8EJ32_SHEON/152-221FAKGDSM....E..PTIH.SGDSILVD...ITD........................ANLSDG..SIFV..LRIGDD...
Q8CPU1_STAES/31-99SIKGDSM....D..PTLK.DGERVVVN...IIGYK....................LGGVEKGN..VIVF..HANKKD...
LEXA_HAEIN/118-186KVYGLSM...KN..VGIL.DGDLLAVH...STK........................DVRNGQ..IVVA..RIEDE....
Q8YSV6_NOSS1/47-124YIPSESM....V..PTLY.EGDRLVVE...KVSYN....................FQQPTTGD..IVVF..QPPAELQRR
Q834H4_ENTFA/37-101RVDGHSM....Q..KTLN.QGDMIVME...KFS........................AIKRFD..VVVF..KTDTGS...
LEP_BACCL/33-101VVEGKSM....M..PTLE.SGNLLIVN...KLSYD....................IGPIRRFD..IIVF..HANKKE...
Q38451_BPD31/152-221RIGGDSM....E..PLLC.DGDTVLVD...HTK........................STVQDA..AVYV..VRLDDH...
Q9K509_PSESJ/56-125KILGDSM...IG..AGIF.DRDLIVVD...RSR........................NAEHGE..IVVA..ALNNSE...
LEPU_BACSU/41-110LIEGSSM....A..PTLK.DSERILVD...KAVKW....................TGGFHRGD..IIVI..HDKKSG...
Q92S91_RHIME/136-205EVQGDSM...L...PLYR.DGDVLIVD...PSA........................QVRRND..RVVV..KTRGGE...
Q8D306_WIGBR/74-158QIPSGSM....M..PNLL.IGDFILVN...KFIYGIKNPVN........QDTLIRIKKPERGD..IIVF..KYPLNY...
Q8SBF6_BPSF5/133-202RVIGDSMI..D....EYR.PGDMIFVD...PEV........................PACHGD..DVIA..LMHDTG...
Q8EH82_SHEON/85-167QIPSGSM....M..PTLL.VGDFILVE...KFSYGLKDPVW........RTKLIETGEPKRGD..VIVF..KYPENP...
MUCA_SALTM/57-124RVSGSSM...ED..GRIH.DGDVLVVD...RSL........................TASHGS..IVVA..CIHNE....
LEXA_PSEAE/120-188RVRGMSM...KD..IGIL.DGDLLAVH...VTR........................EARNGQ..VVVA..RIGEE....
Q9A806_CAUCR/46-134TIPSASM....E..PNLY.QGDYIIVS...KFSYGWSKHSIPFS..PPIIKGRIFDRAPKRGD..IVVF..KLPRDN...
LEXA_STAAW/125-194NVVGDSM...IE..AGIL.DGDKVIVR...SQT........................IAENGD..IIVA..MTEEDE...
Q8FET6_ECOL6/120-194EVKGDSMTNPNG.LPTIP.EGATVIVD...PDA........................EPRHGK..IVIA..RLDGTN...
Q98PT9_MYCPU/35-99KISGNSM....F..PTFK.DGSLKLFK...KTNQNL.................NLFQ........IVVF..NKNDN....
Q935H5_SALTI/56-123RASGLSM...VD..AGIN.DGAILVVD...RSL........................TAEHGS..IVVA..LVDGE....
Q88A26_PSESM/128-201VVRGDSMTAPAG..QSIP.EGMLILVD...TGI........................EPTAGK..LVIA..KLPESN...
Q8XHC1_CLOPE/139-208KIENNDM...TG..YRIQ.ENDLALCY...SIK........................EIENNS..ICLV..EFNGK....
Q847G5_PSEPU/56-124KVEGESM...RD..AGIF.TGTRLIID...RTV........................TACSGH..IVMA..YVDNQ....
Q9A6E4_CAUCR/45-133TIPSSSM....E..PALV.IGDYIIVS...KFAYGWSRASLPFN..PPLPDGRLLGKGAERGD..VVVF..RLPRDP...
Q8ZQI4_SALTY/140-208NVRGDSM....Q..GTIE.PGDLIFVD...IGV........................NYFDGD..GIYV..FDFSGD...
Q8XMU1_CLOPE/38-107KVPTGSM....M..PTVE.IGDQLFVT...KIYNP....................NN.IKRGD..IVVF..NSDELK...
Q845L3_BACME/34-102VVDGLSM....M..PTLH.DQNRMIVN...KFSYK....................IGDPDRFD..IIVF..HATAEK...
Q9I551_PSEAE/148-218TVSGNSM....E..PVLP.DGSTVGVD...TSA........................RTIKDG..DMYA..FDHDGQ...
LEXA_DEIRA/115-185RVRGESM...TG..IGVM.DGDYVVVR...PAP........................EVHDGE..VAVV..LVPGDN...
LEXA_SHIFL/114-182RVSGMSM...KD..IGIM.DGDLLAVH...KTQ........................DVRNGQ..VVVA..RIDDE....
Q9RN42_BORPT/96-178HIPSGSM....L..PTLQ.SGDLILVN...KFSYGIRLPII........DRKIIETGSLERGD..VVVF..RYPVDT...
Q8DXX2_STRA5/30-97KVDGHSM....D..PTLA.DKEQLVVL...KQT........................KINRFD..IVVA..NEEEGGQ..
Q92R48_RHIME/38-126TIPSGSM....M..PTLL.VGDYIFVN...KFAYGYSKYSLPFS..PDLFSGRIFASEPDRGD..IVVF..RFPPNP...
Q837I5_ENTFA/96-162PIAGQSM....K..PTLN.AGERVLVQ...RTK........................QVARYD..VIAF..KAPLAS...
Q97FT1_CLOAB/41-111NVDGPSM....M..PTFK.DKDVIFVE...KLSLY....................THSIKKGE..VVTF..YSGDAE...
Q82ZI3_ENTFA/30-95AVNGSSM....E..PTLH.NNDRLWVT...SIK........................KPQRFD..IIAF..PSPRNG...
LEXA_RHOS4/144-213EVKGDSM...IA..AGIN.DGDIVVIR...EQQ........................TADNGD..IVVA..LVADHE...
Q9ABY8_CAUCR/131-200EVTGDDL...A...PVYR.DGDRLLVS...PTL........................EPRKGD..RVVT..RTHGGE...
Q9CNL1_PASMU/128-197SATGDSM...L...PTIH.HGDLLLIN...REV........................NSAKEE..GIYV..IRSGKQ...
O64370_9CAUD/130-204HINGESM....N..QTIP.DGSLIAVKQYNDIQ........................DLKDGD..IVVF....ADDG...
Q8XK50_CLOPE/40-110VVDGSSM....E..DTIH.HGDVLIIN...KKSYS....................TSSPKRYD..IVNI..YAPCKY...
Q8XYP2_RALSO/36-117VVPSGSM....N..PTLI.EGDFILVN...RLAYGIRVPAT........TVWLKRGNEPRRGD..VVVF..SSPENG...
UMUD_SALTY/55-122KASGDSM...IE..AGIS.DGDLLVVD...SSR........................NADHGD..IVIA..AIEGE....
Q8YMM5_NOSS1/113-185RVTGDSM...IE..DLIT.DGDLVFLRPVPEPD........................QLKNGT..IVAA..RVDGYG...
LEXA2_XANCP/128-196KVQGDSM...RD..EGIF.NGDLIGVH...RTR........................DARSGQ..IVVA..RIDEE....
Q8X2C7_ECO57/123-201SMPDDTMHNPSG.SPSIP.VGATVILR...PGE........................SYKNGSIVAVIVPDPLKNEP...
Q81BT6_BACCR/32-101KVEGESM....Q..PTLY.EEDYVFVN...KAVVR....................LSNLQHGE..IVII..KEEDES...
LEP_BACLI/39-108LVEGTSM....D..PTLH.DGERLFVY...KTVRY....................VGEFKRGD..IVII..DGDEKN...
LEXA_CLOTE/119-187KIKGDSM...ID..TGIL.DGDLAIVE...KNN........................SVLNGE..IVVA..LLGDR....
LEXA_CAUCR/150-218EVQGDSM...IE..AGIL.DGDYVIIK...KGD........................TATSGE..IVVA..LVGEE....
RPC1_BPHK0/144-212TVRGDSM....E..GTIN.PGDEIFVD...VSI........................TCFDGD..GIYV..FVYGKT...
Q9KE28_BACHD/39-107EVRGESM....E..PTAY.EGEMFIVN...KLSYE....................FSEPKRFD..LIVF..HATETD...
Q9PCU7_XYLFA/145-214TGTGDSM....S..PKIL.PGETVLVD...TGC........................NTFVGD..GLYL..INTGSG...
LEXA_LISMO/121-190EIDGESM...IN..AGIL.DGDKVIVR...QES........................SAINGE..IVVA..MTDENE...
Q8Y7K8_LISMO/37-103TVNGKSM....D..PTLH.DGEHLFIN...KVS........................DPKRFD..IIVF..PAPDEE...
Q89VA9_BRAJA/135-204EIAGDAL...A...PTYR.NGDVILVS...PGT........................PIRKGD..RVVV..TTKAGE...
Q935U4_STRTR/143-210WVSGDSM....E..PKYH.NGSVALIR...ETG........................FDYDGA..VYAV..VCNNQ....
Q8LTF5_BPP22/127-200DVQGDSMTAPAG..LSIP.EGMIILVD...PEV........................EPRNGK..LVVA..KLEGEN...
Q81GQ1_BACCR/35-103VVEGKSM....M..PTLQ.DGNMLVVN...KVSYQ....................VGDLNRFD..VVVF..HANKKE...
Q45225_BRAJP/44-133YVPSGSM....E..PTLL.IGDALLAS...KFPYGYGTSSLPIQ.INLPESGRVFAEAPKQGD..VVVF..RWPGDR...
RPC1_BPD3/131-204YADGDSM....E..PYIF.EGDVVLFD...TSK........................TDPQDK..QVYV..IRRPDG...
LEXA_RALSO/129-197KVRGMSM...RD..AGIL.DGDLLAVQ...RAA........................EAANGK..IVVA..RLGDD....
Q8W648_9CAUD/130-203EVHGDSMTSPVG..ITFP.EGMSILVN...PDK........................EVFSGC..YVIA..RKKSTN...
LEPP_BACNA/39-108VVEGKSM....D..PTLV.DSERLFVN...KTVKY....................TGNFKRGD..IIIL..NGKEKS...
A9CK98_AGRT5/141-214HVLSDSM...I...PRYD.PGELIYVG....GR........................EAVAGD..HVVI..EMFPDEGA.
Q8X5F7_ECO57/124-198VLESDSMSTSGG.GVSIP.NGSTVFVD...PDR........................IVQPGN..IVLA..LPKGTT...
LEP_BUCBP/77-161QIPSESM....M..PTLL.PGDFILVK...KFSYGIKNPFS........NNVIVFINTPKRGD..IVVF..KHPNNN...
Q99Y69_STRP1/30-97KVDGHSM....D..PTLA.HGERLIVF...NQA........................RIDRFD..IVVA..QEEENGQ..
O28201_ARCFU/35-98YVTSDSM....T..PTLN.RGDLFLIN...PLA........................EAKPDD..IIVF..NLNGH....
Q8A3M2_BACTN/147-223FVNGDSM....Y..PILK.SGDIVGFKGINNFS........................NVIYGEMYIVAF..HLDGDQ...
Q87XP4_PSESM/130-203EVKGDSMTAPTG..VSVP.EGMMILVD...TEA........................DVQPGR..LVIA..KLPASN...
LEXA_BRAJA/147-216EVRGDSM...VE..AGIL.DGDMALIQ...RNE........................SADTGD..IVVA..LIDDEE...
Q8XNL8_CLOPE/31-100VVPTPSM....A..PTIE.PGDQLFAT...RIHNL....................SK.MERGD..MIVF..YSKEFD...
Q8P0Y7_STRP8/147-214WVFGDSM....E..PTYL.NGEVVLIK...QNS........................FDYDGA..IYAV..EWDGQ....
Q8RPE9_LEGPN/132-204KITDDSM...M...PEIR.INDVLVIE...PCV........................LPEPGD..FVAV..KISGKPE..
LEPV_BACSU/29-97KVEGVSM....N..PTFQ.EGNELLVN...KFSHR....................FKTIHRFD..IVLF..KGPDHK...
Q9F190_9ZZZZ/56-123RVTGDSM...QD..ARIH.SGDVLVVD...RSE........................TPEQGS..IVVA..SIDNE....
Q8X5E1_ECO57/122-197EVKGHSMTAPQGVRPSFP.EGMLILVD...PAE........................PVESGD..FCVA..SANGDS...
Q9ZBB1_STRPN/139-206WVFGNSM....E..PTYE.DGSVALIK...QTG........................FDYDGA..IYAI..DWDGQ....
Q9CG39_LACLA/155-229RVKGESM....E..PEFP.NFSIATFL...HTG........................FGRSGD..IYAIAEGDLGEE...
Q9I441_PSEAE/35-105KIPSRSM....E..PTLQ.QGDFILAN...AARYA....................FADPQVGD..LVVF..RFPPQR...
Q9LW08_ARATH/52-124VVLSESM....E..PGFQ.RGDILFL.......RM...................TDEPIRAGE..IVVF..SVDGRE...
LEXA_THEMA/114-182KVKGESM...IE..EHIC.DGDLVLVR...RQD........................WAQNGD..IVAA..MVDGE....
Q9A0R3_STRP1/164-232GIRGDSM...L...PKYE.QGDMLYIV..DKGM........................STYSGQ..LCIV..VHNGN....
Q8Y7K7_LISMO/44-112KVEGTSM....V..PTYQ.DGDRIFIE...KIS........................KPDRFD..IIVF..DEPPMIG..
Q8P0L2_STRP8/189-258PVYGDSM....E..PKYH.SGDYVFVK...LSV........................ELTDGD..IGVF..EYYGD....
Q8XNA8_CLOPE/46-112YIPTGSM....R..PTIM.EEDEVIVS...KIY.......................TSINRGD..IFVF..SHESSE...
Q87Y08_PSESM/145-219RVKGKSMTSDTP..PTFP.EGTPILIR...PEG.......................FDLISGK..FYVA..RNTVSG...
LEP_STRPN/33-98RVEGHSM....D..PTLA.DGEILFVV...KHL........................PIDRFD..IVVA..HEEDGN...
LEP_PHOLA/54-131YIPSESM....L..PTLE.VNDRLIVE...KISYH....................FNPPRRGD..IIVF..HPTEALKQQ
LEXA_CORGL/151-219QVVGESM...RD..AGIL.TGDWVVVR...SQP........................VAEQGE..FVAA..MIDGE....
Q9RLS7_LEGPN/152-226AVKDESM....A..PEFK.FDDILIVD...PDT........................QPNPGD..YIVA..RLENEPE..
Q9MBT4_9CAUD/158-225KVNGDSM....E..PLFK.NGQIIFIE...KSH........................TIKDGQ..IGVF..IINGD....
Q8RIK1_FUSNN/128-198EITGNSM....E..PTLE.DGEFALVD...PDN........................TSYSKN..KIYV..VTYNDE...
Q81BS6_BACCR/35-103LVQGESM....M..PTLK.NNERVLVN...KIGYS....................ISGLDRFD..IIVF..HGKEGY...
Q982T6_RHILO/154-230RVYGTSM...E...PRYF.AGETIWIN...PHE........................PVRSGD..FVVV..QVVGDDDD.
Q8DSC7_STRMU/30-93QVDGHSM....D..PTLA.NGEHLIVV...RTT........................SIKHFD..IVVA..AEGNK....
A9CK86_AGRT5/134-203EVQGESM...M...PLYR.DGDILIVE...PGA........................PVRRGD..RVVL..KSRDGE...
Q88G30_PSEPK/124-194RLKGDSM....A..PAIR.SGWIAVCE...PNH........................RLVPGE..YVMV..TTVDGQ...
P73722_SYNY3/113-185RVMSNDLV..D...DFIV.EGDMLILRSVTGEE........................EIEDGE..LVAA..SIKGGK...
Q97I60_CLOAB/396-464KIKGDSM...IN..ADIN.DGDCVVIK...KTG........................AAENRD..IVAV..NIDGS....
Q8NVM4_STAAW/178-245LVNGDSM....E..PMLK.QGTYAFIK...KED........................SIKDGT..IALV..VLDGV....
Q89K52_BRAJA/39-127NIPSGSM....K..ATLL.VGDYLFVS...KYSYGYSHYSIPFS..PPLFSGRLWGSDPNRGD..IVVF..RLPKDD...
Q8YG73_BRUME/59-147SIPSGSM....R..PTLL.EGDYLFVS...KYAYGYSRYSLPFG..LDLFSGRIWSAEPKRGD..VVVF..KLPSDT...
Q81A78_BACCR/132-202TVKGTSM...N...LEFP.DGSYVLVE...ETP........................YVENGQ..IAVV..KVNGYD...
Q8VUN8_STRSU/66-130HIYGSSM....S..PTLK.AGDMVATV...KTN........................TLSTGD..MVAF..YYNNK....
Q8PB54_XANCP/69-151KIPSSSM....M..PNLL.IGDFILVN...KFAYGFRLPIT........NTKFIPTGEPKRGD..VVVF..KPPHAP...
Q9SSR2_ARATH/52-124VVLSGSM....E..PGFK.RGDILFL.......HM...................SKDPIRAGE..IVVF..NVDGRD...
LEXA_LACPL/125-194TIRGESM...IN..IGIM.NGDQVIVR...RQS........................SADNGD..IIIA..MTDENE...
Y1546_HAEIN/52-118HITNPNM...LA..WGIE.SGDMLVVE...KND........................DLYSGD..LVVL....EENN...
O69884_STRCO/72-146QIPSGSM....E..RGLR.IGDRVLVN...KLAYR...................FDGRPRRGD..IVVF..DGTGSFG..
Q8ERB6_OCEIH/36-103IVEGESM....A..PTLE.NGERVIFN...KVVYM....................LDEPDRGD..IVII..RQPPK....
Q83BK4_COXBU/66-148HVPTGSL....E..PTVM.PGDFIAVE...QFAYGLRLPVL........NKKILPISEPKRGQ..IALF..RWPKDP...
LEXA_ENTFA/126-195TIRGESM...IN..AGIL.DGDQVIVR...KQS........................NANNGD..IVIA..MTDEDE...
Q38089_BPR1T/193-262MVDGHSM...E...PKIP.YGAYVLIE...AVP........................DVSDGT..IGAV..LFHDDC...
O97066_DROME/57-121VVLSGSM....E..PAFH.RGDLLFLT......NY...................KEEPVRVGE..IVVF..KVEGRD...
Q8XI29_CLOPE/43-114SILSGSM....E..PEIN.TGDLAIVK......SI...................DADDVKVGD..IITF..KYEGK....
LEXA_CUPNE/131-199RVRGLSM...RD..AGIL.DGDLLAVK...KAS........................EAANGK..VVVA..RLGDD....
Q87CF1_XYLFT/155-232RVHGDSM....E..RTLF.DNDRVMVN...FAD........................TRIRDG..KVYA..IAIGGE...
Q8DHX1_THEEB/62-137YIPTGSM....E..NTLL.INDRLIIE...KISYY....................FHAPHRGD..IVVF..NPTPTLQQA
LEXA_BACSU/122-191EIMGDSM...ID..AGIL.DKDYVIVK...QQN........................TANNGE..IVVA..MTEDDE...
LEXA_CLOAB/123-191KISGNSM...IE..AGIY.DGDLAIIE...KTN........................YAQNGD..IVVA..LIEND....
Q899K0_CLOTE/135-199KVEDNDM...NG..FRVF.KEDLVLCH...ITG........................EIQNNS..IYLI..EHNDK....
TR96_PRORE/126-200RVKGDSMENPSG.KKSIP.EGAVIVVD...PEL........................PYSSGS..LVVA..RLDDSK...
O26667_METTH/114-183VVSGDSM....Y..PTLK.DGQDLIVL...KTD........................RYTVGD..IVIA..RHPEYG...
LEXA_CLOPE/122-190KVTGDSM...IE..AGIL.DGDLAIIE...QKN........................VATNGD..IVVA..LIENE....
Q97I92_CLOAB/31-101SVDGTSM....Y..STLQ.NNDRLIIE...KISYR....................FGFPKRGD..IIVF..KCPSDT...
LEXA_VIBPA/118-186RVNGESM...KD..IGIM.DGDLLAVH...KTQ........................DVRDGQ..VVVA..RVDDD....
LEP2_SYNY3/47-122YIPSSSM....E..PTLQ.INDRLIIE...KISYR....................LRDPERGE..IVVF..NPTDALKAK
Q9PBL7_XYLFA/241-317HGAGDSM....L..PYIQ.SGDSIMFD......ES....................DTTPHHKHIYVIIT..PGAGAD...
LEP_PSEFL/85-168QIPSGSM....K..PTLD.VGDFILVN...KFSYGIRLPVI........DKKVIEVGDPQRGD..VMVF..RYPSDP...
Q8VMP5_PSEPU/56-125RVEGESM...RD..AGIF.DGGVLIVD...RSI........................TPCSGQ..IVLA..YVDNQ....
Q98J28_RHILO/144-217HVLSDSM...V...PRYE.PGDLIYCG....GR........................DAIPGD..HVVI..ETFPEENE.
O52206_9ZZZZ/57-124RVSGDSM...RD..ARIH.DGDVLVVD...RAE........................EPRHGS..IVIA..SIDNE....
Q8P6K4_XANCP/66-135RAEGWSMI..L...AGVC.DGDILVVD...RSV........................RPIQGD..MVLA..IWDGNQ...
LEXA_SHEON/118-186RVKGDSM...KN..IGIL.EGDLLAVH...KVQ........................QARNGQ..VVVA..RVDDD....
LEXA_OCEIH/124-193VIDGESM...IE..AGIL.DGDMVIVK...QQN........................TAVNGE..IVVA..MTEENE...
Q8DZ52_STRA5/144-211WISGNSM....E..PVYK.DGEVALIR...STG........................FDHDGA..VYAL..NWNGS....
Q52416_PSESX/56-124KIDGDSM...EG..AKIF.HDSLVVVD...RSR........................KPSSGS..IVIA..ALNNE....
Q9AZ21_BPHK6/150-223KVEGDSMTAPVG..LSIP.EGTFVLFD...TGR........................EAINGS..LVIA..KLSDSN...
Q8SDS3_9CAUD/159-226KVNGDSM....E..PMFK.DGEIIFVE...KTH........................NIKNGQ..IGIF..IIEEE....
Q89H60_BRAJA/100-172EIVGDSM...L...PKYE.SGDVIVVYKDQRHP.......................LSSFYGE..EAVV..RLKTGE...
Q889M8_PSESM/144-214AMVGNSM....A..DKIQ.DGSILGVD...REL........................TQVIDG..EIYA..LEHGGI...
LEP2_BACAM/46-115LVEGSSM....Y..PTLH.DGERLFVN...KSVNY....................IGEIERGD..IVII..NGDTSK...
LEXA_LEPIN/122-190RVQGDSM...IE..VGIN.DGDIAIIE...KRD........................IARNGE..IVVA..LIEDE....
Q8DF35_VIBVU/44-110QAMGESM...QE..IGIF.DGDLLIVD...RHV........................AVQNLD..VIVA..NYNGE....
RDGA_PECCC/156-229PAAGDSM....E..PIIP.DGTTVAVD...TNN........................KRIIDG..KLYA..IAQEGGGN.
LEXA_STRCO/153-221KVVGDSM...IE..AAIC.DGDWVTVR...RQP........................VAENGD..IVAA..MLDGE....
LEXA_AGRT5/155-224EVKGDSM...IE..AGIF.DGDTVIIR...NGN........................TANPGD..IVVA..LVDDEE...
O28618_ARCFU/31-104VVLSSSM....E..PLMH.PGDLIVVK...RSS........................DVSLGD..VVAF..KDPSGKK..
Q8DLS3_THEEB/41-118FIPSESM....E..PTLW.PGDRIVVE...KITYR....................QRSPQRGD..IVVF..YTPPLLQTL
LEXA2_PSEPK/118-186KVRGDSM...ID..DGIF.DGDLVGIL...QQA........................DARDGQ..IVVA..RLDGE....
O48418_BPH19/135-204RVKGDSM...W...PRIK.SGEYVLIE...PNT........................KVFPGD..EVFV..RTVEGH...
Q87ZK3_PSESM/155-229KVRGDSMTNPGL.GRSYP.AGCIIFVD...PEV........................EVHTGD..RVIA..RLDRTN...
Q8Y7K6_LISMO/35-99LVDGISM....M..PTLH.NDDRVIIN...RFG........................NVDRFD..VIVF..RESDGK...
Q88FM1_PSEPK/148-220TVENDAMSAVSG..RSVP.QGMRMLVD...PGV........................EAEAGR..LVIA..RQPGKP...
Q8VVM6_VIBCL/62-129RVEGDSM...ID..AGIH.PDDILVVD...RSV........................QAEHGD..IVIA..GIHGE....
Q83CL5_COXBU/69-151RVPTGSL....E..PTIM.PGDMILVN...QYDYGLRVPLW........NKKIVDVGEPKRGQ..IALF..RWPVNP...
Q88GF2_PSEPK/203-272TGWGQSM....E..PTIR.HRDPLIVD...VSI........................REFVGD..GIYF..FSWGDH...
Q8G5K7_BIFLO/20-88QMAGDSM...IN..AGIH.NGDLLIVD...RSL........................APVPGD..VVAA..VMDDE....
Q8H041_ORYSJ/55-125VVVSGSM....E..PGIR.RGDMLIVRERRNDGDG....................DDNIRAGD..IVLF..STELHP...
Q9PFG3_XYLFA/137-204TGKGDSM....T..PTIA.PGEVVLVD...TGT........................HTFEGD..GLYL..VNVGHG...
Q819W7_BACCR/34-102LVDGVSM....A..PTLH.DRDRMIVN...KIGYH....................IGDPKRFD..IIVF..RATEDK...
LEP_AQUAE/27-103TIPSASM....E..PTLL.VGDFILVN...KLVYS....................LSEPMRGD..MIVF..KYPKNP...
LEXA_BACHD/124-193RIQGDSM...IE..AGIF.DGDLVIVR...QQQ........................TADNGD..IIVA..MTEEDE...
Q836K0_ENTFA/34-100VVRGHSM....D..PTLA.DGERVITL...KNT........................EINRFD..IITF..PAPDEP...
Q9ZG05_STACA/31-99TVRGDSM....Y..PTLK.DGEKVIVN...MIGFK....................TGGLEKGN..VIVF..HATKNS...
Q9CMD8_PASMU/54-123RVTNPNM...LA..WGIE.VDDMLVVE...KNE........................SLSVGD..LIVL....DING...
Q9G0C2_BPMV4/136-205KCEGDSM....E..PYIL.DGDIAYIR...QQP........................EVEDGE..IAAV..LVDGDT...
UMUD_SHIFL/55-122KASGDSM...ID..GGIS.DGDLLIVD...SAI........................TASHGD..IVIA..AVDGE....
Q88MM2_PSEPK/197-266TGWGQSM....E..GTIN.DKDPVIVD...RGV........................NDYAGE..GVYV..LTWHGD...
O69885_STRCO/80-151VIPSGSM....E..QTIR.IGDRVLVD...KLTPW...................FGSEPQRGD..VVVF..RDPGGWLQG
Q9T1U7_BPAPS/171-240RCQGESM...M...PRIQ.HGEFVVME...PNY........................KYKPGD..EVLV..QDDHGQ...
Q8G7I8_BIFLO/110-192EIPSRSM....M..DTTV.PGDRVVTS...KLTPK....................IFDLQRGD..VVVF..KDPNNWLNE
Y1476_HAEIN/151-220WANGNSM...L...PTIN.NYDQMLVD...LSR........................KEIQGD..RIYL..VQNGES...
LEXA2_PSESM/118-186RVQGDSM...IE..DGIL.DGDLVGVH...RNP........................QASDGQ..IVVA..RLEGE....
LEP_RICCN/40-130NVPTGSM....K..ATIL.ENDYIFST...KYSYGYSNYSLSFFDFIPLFKGRIFAREPDRGD..IVVF..RPPNDM...
PRTR_PSEAE/157-227QLTGNSM....E..PLIM.DGSTIGVD...TAT........................THITDG..EIYA..LEHDGM...

PF10502

A0AEF9_9PSED/50-195AA.HRGSLRTRI......ALLKRVG--AMVPLEECTADGK.VRIDG..VPSAAVLPAARWGRPRRSRH.QCRRLRPGDLF
B7WYS9_COMTE/46-191AA.QRGYLPTRI......PLLKRVG--AVAPQEVCIADGK.VHIDG..VPSAAVLSADRWGRPLPSWQ.QCHRLRHGELF
A0KUN2_SHESA/46-191AA.QRGYLPDHI......PLLKRVG--AVAPQHVCISADQ.VRIDG..VPVAALLHTDRLGRELQAWP.HCRQLQPGELF
A1AYA9_PARDP/32-169IV.ARGYVGPGV......PLLKRVA--ALPGTRVCRRGST.ITGDG..QVLGEARERDRFGRPLPTWQ.GCRLIAEGEVF
A1B266_PARDP/28-165MV.ARGYVGRDV......PILKHVI--GLPGQRICRDGAA.ITIDG..RHLGEARERDSQGRDLPVWQ.GCRTIAEGEVF
A1B6X0_PARDP/32-169VT.ARGYVGPGV......PLLKRVA--ALPGTRVCRTGAT.ITVQG..EAIGEARERDRIGRPLPTWQ.GCQVVGTDEVF
A1VQA6_POLNA/33-169...PHPSIGHGACPDGSMPLIKRVV--GVAGDLVTATDAG.IDINGQPVPNSRPLDLDTKESALPHLR.GSFSLKQGDIW
A1VUX7_POLNA/38-179AA.QRGYLPPHI......PLLKRIG--AVAPQDVCIVNGV.VRIDG..VPVAAVLRTDRMGRPLLSWQ.QCRALAEGELF
A1W985_ACISJ/50-195AA.QRGYLPAHV......PLLKRVG--AVAPQHVCIVAGQ.VRIDG..VPVAAALPADRLGRPLPSLQ.LCRCLEPGELF
A1W9Z2_ACISJ/54-199AA.QRGYLPARI......PLLKRVG--AIAPQHVCVFDAL.VWIEG..VPVATVRPADRLGRPLPSWP.QCRQLRPGELF
A1WDT4_ACISJ/31-177DAKERGYIGAGFCPGDYGYMMKRVL--AAKDDAVSVADDG.VRVNGELLAHSKPIQADKSGRPLPRFQASTYTLGSAELL
TRAF_AGRT9/29-173EARVRGYLRRGLCAGGVAPLIKTVA--ALPGQRVEITDH..VHIDGRSVPASSVSGTDGDGKVLLPDS..GGVVPPHHLF
TRAF_RHISN/41-185EARMRGYLRAGLCPGGIAPLIKSVI--AVAGQRVEVGVS..VNVDGHPVPSSALALRDGQGRPMKPFS..GGIVPTDYVF
TRAF4_ECOLX/30-176DAKERGYIAGGFCPGDYGYMMKRVL--AAKGDEVAITDAG.VRVNGGLLPHSALIKADPSGRPLPRYQSDSYTLGTAEVL
Q07JC8_RHOP5/30-167LS.EGGYLPRGI......PMLKRVL--ALPGQTVCRNHLL.ITVDD..IALGEALERDRRGRSLPVWQ.GCHVIGEGEVF
Q0ACY7_NITEC/30-172VMVDKGYLATGNCPTNVITLLKPIA--VGKGDIVTIRKGLPVSINGRFLPNTRSMPT......IQAWPDGTYLTKENEIW
B0T9Q5_CAUSK/35-171ASGRMAYMRHM.......PILKEVA--AMSGDTVCTLDGK.LVING..VWRAPVLAHDGESRPLPHWR.ACRRLGEGEFF
B0SV57_CAUSK/29-166LA.DGGYLPRGV......PLMKRVV--ALPGQEVCRIGRD.IMVDG..IAIGSALARDHRGRELPVWQ.GCRRIADGEVF
Q11BL3_MESSB/30-167LA.ERGYLARNV......PLIKRVL--AVSGTVVCRHGTT.IIAYG..HAYGEARNQDALGRPLPSWQ.GCRQLGENEVF
Q11FV4_MESSB/29-166MV.ERGYLARGV......PLLKRVL--GLPGQRVCRSGRT.ITVDA..VEMGEALERDRFGRKLPVWL.GCRVIADGEIF
Q11L03_MESSB/29-166LA.DRGYLPRGV......PLLKRVA--ALPGQTVCRSEGD.ISVDG..ITVGNALDRDRLGRTLPIWR.GCHRIGASELF
Q1M9U2_RHIL3/40-184EARARGYLRSGSCPGGFAPLIKTVM--AVAGQHVEIGDS..VSVDGRGVSSSSLAQRDGKGRPLTPSP..SAIIPPGYVF
Q1QF78_NITHX/30-174RAFKRGYIRRGLCAGGLSPLIKTVA--AIGGQQIDVAAR..VSIDGRVLGHSNVRRMDAAGRPLLPFA..GGVIPAGALF
Q3IUW1_RHOS4/31-162FD........GL......LFTKRVV--GLPGDRIEHRDGA.VCVAGECYPLAL.....KDGAPFAPAL.AEGVIPDGHYA
B4S9K6_PROA2/32-168VQ.DRGWLNEGD......MLMKPVL--ARSGEECCMRDGL.LVING..RTVSRISATDADGRSMPVTE.FCGTVPDGMII
TRAF_AGRT5/29-173EAWLRGYLRSGLCPGWFAPLIKSVL--ALPGQRVEIADR..IVIDGHPVSASTVSATDSEGRAIAPFA..GGVVPPGFLF
Q84HT6_RHIET/41-185EARERGYLRSGTCQGGIAPLIKTVI--AIAGQHIEIGAG..VTIDGRPIAFSELAERDGKGRPMKPFP..GGVVPDESVF
Q89YA7_BRAJA/29-166LA.DGGFLPKGL......PLLKRVM--ALPGQTVCRSGDA.ITVDA..VDVGAAHEHDHRGRPLPRWS.GCHTLEPGEVF
Q8KJJ4_RHILI/45-181AD.QRGYLPRNT......PLVKRLA--ALPDEHVCAFSNA.IIIGG..EIVARRLKIDTQGRPLPWWN.GCRALAHDEVF
Q98NU0_RHILO/29-166AA.ERGYLPLGV......PMLKHIE--GLPGQPVCRLSRL.ITVTG..LAVGVALERDRKGRALPDWQ.GCRVIAATEIF
Q9PBT1_XYLFA/31-177NARKRGYIGPGFCPGGYGYMMKKIL--AAKGDTVSVTPQG.VAVNGKLLPYSKPLLVDGVGRSMPRMSDERYTLGESELL
Q9R6E9_RHIRD/29-173EALERGYLRRGLCRGGFAPLIKTIV--ALPGDRVVISGE..VVIDDRPIPASAVRATDGAGRAIHPYP..GGVVPPGHLF

PF00717

LEXA_MYCLE/154-222.........---------ATVKTFK..RAGGQVWLIP..H----------------------------------------
RPC_BP163/172-248....GAPPR---------GFVKEFV..GWTANKLVLQ..Q----------------------------------------
Q859R0_9VIRU/129-201.........---------IAIKRAR..KLGNRWILIS..D----------------------------------------
Q92NY0_RHIME/142-215......ALL---------AYVKKFV..RHNSSELVLE..Q----------------------------------------
LEXA_BACCR/123-192.........---------ATVKRFY..KEKDHFRLQP..E----------------------------------------
LEXA_AERHH/119-187.........---------VTVKRFQ..RKGSQVWLLP..E----------------------------------------
RPC1_BPPH8/149-218.........---------KRIKQLY..RKPGGKILIR..S----------------------------------------
RPC1_LAMBD/145-219.........---------FTFKKLI..RDSGQVFLQP..L----------------------------------------
Q81ID4_BACCR/34-100.........---------.YVKRVI..GLPGDIIE.....----------------------------------------
Q8YCN0_BRUME/136-205.........---------VMAKILH..RQTPRTIELH..S----------------------------------------
Q8RDJ6_THETN/35-105.......KV---------NFVKRVI..GIGGDVIE.....----------------------------------------
Q8DTE9_STRMU/206-273.........---------AYVKKLY..RKNKEIRLIS..L----------------------------------------
Q9CDG2_LACLA/30-98......STK---------DIVKRVI..GMPGDTIK.....----------------------------------------
Q9JZT1_NEIMB/153-223.........---------FRVKYLI..RQPGNSVLIR..S----------------------------------------
LEXA1_XANCP/117-185.........---------ITIKRLE..RSADAIRLLP..R----------------------------------------
Q8ECY1_SHEON/180-250.........---------LRVKMLY..RTPGGGIRIK..S----------------------------------------
Q888E3_PSESM/45-118........E---------ATFKKLV..EYGGVRYLKP..L----------------------------------------
Q37946_9VIRU/132-205........E---------ATFKKYI..VDAGQKYLKP..L----------------------------------------
Q94MM0_BPBPP/133-207........A---------ATFKQYL..EEDGRKLLKA..L----------------------------------------
Q81TI5_BACAN/46-122.........---------IITHRII..GVKDTNGKVMYET----------------------------------------
Q884H2_PSESM/52-120.........---------QICRRLH..MRGHVVILQS..E----------------------------------------
Q895M0_CLOTE/31-101.......KE---------KFIKRVI..ATGGDRVR.....----------------------------------------
Q99YY5_STRP1/167-235.........---------NFVKKLK..RDYDGAWYLQ..S----------------------------------------
Q93M86_CLOPE/277-346.........---------ATCKEIK..QVENYIYLIP..H----------------------------------------
Q8CMP2_STAES/31-99.........---------DYIKRLI..GKPGDSVE.....----------------------------------------
Q8EQZ6_OCEIH/39-107.........---------DFIKRII..ALPGEHVA.....----------------------------------------
P71159_DICNO/147-217.........---------FRVKRLY..HAPNGMIRIS..S----------------------------------------
LEXA_BIFLO/160-228.........---------ATVKTFR..KENGHVWLMP..H----------------------------------------
Q8Y0I3_RALSO/99-181.......SM---------DYIKRVI..GVPGDVVKYD...----------------------------------------
Q8L2B9_PROVU/54-121.........---------FTVKQLQ..KTPFPALIPM..N----------------------------------------
Q8TWK2_METKA/54-122........I---------PVVHRVI..AKTPEGVITK..G----------------------------------------
Q9JPL1_NEIME/162-229.........---------LFVKQIQ..KLPGKLL.VK..S----------------------------------------
Q87LN8_VIBPA/86-169.......SV---------DYIKRVV..GLPGDIVRYS..G----------------------------------------
O58298_PYRHO/33-96.........---------WTVHRVY..AITEEGYITK...----------------------------------------
LEPS_BACSU/38-105.........---------HYVKRII..GLPGDTVE.....----------------------------------------
Q98BD0_RHILO/130-199.........---------VMAKVLD..RQTVKSIALV..S----------------------------------------
Q8SZ24_DROME/33-102.......DQ---------FICKRIV..AVSGDQVLI....----------------------------------------
IMPA_SALCH/59-128.........---------FTVKRLL..LRPRPALEPVSDS----------------------------------------
Q9C8S3_ARATH/42-121.......NK---------TPIKRVI..GIEGDCISFV..I----------------------------------------
Q8HAA0_9CAUD/140-208.........---------IYVKRLQ..MIPDKLLVIS..D----------------------------------------
Q8EDU1_SHEON/160-228.........---------LFVKRYQ...NAFGSWRLI..S----------------------------------------
Q8ERW7_OCEIH/32-100.........---------DYVKRVI..GTPGDKIE.....----------------------------------------
Y1416_COXBU/128-197........E---------ARLRQII..TEGNDRYLKS..L----------------------------------------
Q8KCH1_CHLTE/43-125.......SL---------NYIKRCI..ALPGDNLE.....----------------------------------------
Q81CX0_BACCR/33-102........T---------YYVKRII..GLSGDNIQ.....----------------------------------------
LEPQ_BACNA/38-107........T---------HYVKRLI..GLPGDTIE.....----------------------------------------
Q8ISG0_LEIMA/49-114........I---------PIVHRVH..RIHQRSED.....----------------------------------------
Q8A2V9_BACTN/142-218........Y---------LAVKYVN..RSEKEGCLKL..V----------------------------------------
Q82XF6_NITEU/174-244.........---------LRIKRIR..LRLDGSIEIR..S----------------------------------------
Q7DII9_SALET/56-123.........---------FTVKRLQ..LKPRIALLPI..N----------------------------------------
Q8EJ32_SHEON/152-221.........---------LFAKRVQ..VHIDGSITII..S----------------------------------------
Q8CPU1_STAES/31-99.........---------DYVKRVI..GTPGDSVE.....----------------------------------------
LEXA_HAEIN/118-186.........---------VTVKRLE..KKGSIIYLHA..E----------------------------------------
Q8YSV6_NOSS1/47-124G...YPKDQ---------AFIKRVI..GTPGEIIS.....----------------------------------------
Q834H4_ENTFA/37-101.........---------ILIKRVI..GLPGEAVR.....----------------------------------------
LEP_BACCL/33-101.........---------DYVKRVI..GLPGDRIA.....----------------------------------------
Q38451_BPD31/152-221.........---------LYAKRLQ..RRFDGSVSII..S----------------------------------------
Q9K509_PSESJ/56-125.........---------PICKRLF..MMDGVVKLQS..E----------------------------------------
LEPU_BACSU/41-110........R---------SFVKRLI..GLPGDSIK.....----------------------------------------
Q92S91_RHIME/136-205.........---------VMAKVLA..RQTPRGIELV..S----------------------------------------
Q8D306_WIGBR/74-158.......KL---------DYIKRVV..GIPGDRITYN..P----------------------------------------
Q8SBF6_BPSF5/133-202........E---------TTFKRLI..EDGTQRYLKA..L----------------------------------------
Q8EH82_SHEON/85-167.......QI---------DYIKRVV..GLPGDRIIYR...----------------------------------------
MUCA_SALTM/57-124.........---------FTVKRLL..LRPRPCLMPM..N----------------------------------------
LEXA_PSEAE/120-188.........---------VTVKRFK..REGSKVWLLA..E----------------------------------------
Q9A806_CAUCR/46-134.......RT---------DYIKRLI..GMPGDKVQ.....----------------------------------------
LEXA_STAAW/125-194.........---------ATVKRFY..KEKNRYRLQP..E----------------------------------------
Q8FET6_ECOL6/120-194........E---------ATVKKLV..IDGPQKFLVP..L----------------------------------------
Q98PT9_MYCPU/35-99.........---------LYVKRII..ALPGDNLI.....----------------------------------------
Q935H5_SALTI/56-123.........---------FTVKILQ..TFPKLMLMPS..N----------------------------------------
Q88A26_PSESM/128-201........E---------ATFKKLV..EDAGRYFLKP..L----------------------------------------
Q8XHC1_CLOPE/139-208.........---------RVIRQIK..KLDNVKALLI..S----------------------------------------
Q847G5_PSEPU/56-124.........---------PVVKRLA..KSAAGWTLES..A----------------------------------------
Q9A6E4_CAUCR/45-133.......SQ---------TWIKRVI..GLPGDRVR.....----------------------------------------
Q8ZQI4_SALTY/140-208.........---------LYVKRLQ..KIKSQLLVLS..D----------------------------------------
Q8XMU1_CLOPE/38-107........E---------PLLKRVI..GLPGEHVE.....----------------------------------------
Q845L3_BACME/34-102.........---------DYIKRII..GLPGDHIE.....----------------------------------------
Q9I551_PSEAE/148-218.........---------LRVKLLY..RLPGGGLRIR..S----------------------------------------
LEXA_DEIRA/115-185........A---------ATLKRLY..HFGQDILLTS..E----------------------------------------
LEXA_SHIFL/114-182.........---------VTVKRLK..KQGNKVELLP..E----------------------------------------
Q9RN42_BORPT/96-178.......DV---------DYIKRIV..GLPGDQVAYL...----------------------------------------
Q8DXX2_STRA5/30-97.......KK---------KIVKRVI..GMPGDVIK.....----------------------------------------
Q92R48_RHIME/38-126.......DI---------DYIKRLV..GLPGDRIQ.....----------------------------------------
Q837I5_ENTFA/96-162.......KG---------TYVKRII..GVPGDRIW.....----------------------------------------
Q97FT1_CLOAB/41-111.......NN---------IYIKRVI..GLAGDVIE.....----------------------------------------
Q82ZI3_ENTFA/30-95........Q---------RVAKRLI..GLPGETVE.....----------------------------------------
LEXA_RHOS4/144-213.........---------ATLKRYR..RRGGMIALEP..A----------------------------------------
Q9ABY8_CAUCR/131-200.........---------VLVRELG..RVTARSIELL..A----------------------------------------
Q9CNL1_PASMU/128-197.........---------VWIKRIQ..GLPNGIRLMS..D----------------------------------------
O64370_9CAUD/130-204........D---------YAVKYFY..NDRQKQIVTF..I----------------------------------------
Q8XK50_CLOPE/40-110.......DN---------FLVKRII..GLPGDTIE.....----------------------------------------
Q8XYP2_RALSO/36-117........T---------KLVKRLI..GLPGDVVE.....----------------------------------------
UMUD_SALTY/55-122.........---------FTVKRLQ..LRPTVQLIPM..N----------------------------------------
Q8YMM5_NOSS1/113-185.........---------NTLKRFY..RSGDRITLKP..A----------------------------------------
LEXA2_XANCP/128-196.........---------ITVKLLK..IGKDRIRLLP..R----------------------------------------
Q8X2C7_ECO57/123-201........S---------MTIKKLV..IDGKLVYLSP..L----------------------------------------
Q81BT6_BACCR/32-101........K---------YYVKRVI..GLPGDVIN.....----------------------------------------
LEP_BACLI/39-108........V---------HYVKRLI..GLPGDTVQ.....----------------------------------------
LEXA_CLOTE/119-187.........---------ATVKRFF..KEKDYIRLQP..E----------------------------------------
LEXA_CAUCR/150-218.........---------ATLKRLR..KKGGSIALEA..A----------------------------------------
RPC1_BPHK0/144-212.........---------MHVKRLQ..MQKNRLAVIS..D----------------------------------------
Q9KE28_BACHD/39-107.........---------DYIKRII..GLPGDTIR.....----------------------------------------
Q9PCU7_XYLFA/145-214.........---------QQIKALH..ERNGYIYVTS..M----------------------------------------
LEXA_LISMO/121-190.........---------ATCKRFY..KEANHFRLQP..E----------------------------------------
Q8Y7K8_LISMO/37-103.......NA---------EYIKRVI..GLPGDKVE.....----------------------------------------
Q89VA9_BRAJA/135-204.........---------VTVATLK..RRTAKALDLL..P----------------------------------------
Q935U4_STRTR/143-210.........---------TYLKRVY..REEEGLRLVS..I----------------------------------------
Q8LTF5_BPP22/127-200........E---------ATFKKLV..MDAGRKFLKP..L----------------------------------------
Q81GQ1_BACCR/35-103.........---------DYVKRII..GLPGDHIE.....----------------------------------------
Q45225_BRAJP/44-133.......SQ---------AWVKRVV..GLPGDRIQ.....----------------------------------------
RPC1_BPD3/131-204........G---------VSIKRLN..QQLTGAWLIR..S----------------------------------------
LEXA_RALSO/129-197.........---------VTVKRFQ..RKGRQVELIA..E----------------------------------------
Q8W648_9CAUD/130-203........E---------ATFKKYI..SEMGKAFLKP..L----------------------------------------
LEPP_BACNA/39-108........T---------HYVKRLI..GLPGDTVE.....----------------------------------------
A9CK98_AGRT5/141-214.....TVGK---------AYVKKLK..GRTKGAIVCE..Q----------------------------------------
Q8X5F7_ECO57/124-198........T---------PVIRKLE..IEGPDILLVP..T----------------------------------------
LEP_BUCBP/77-161.......AI---------NYVKRIV..GLPGDKINYN..I----------------------------------------
Q99Y69_STRP1/30-97.......KK---------EIVKRVI..GLPGDTIS.....----------------------------------------
O28201_ARCFU/35-98.........---------WTVHRVV..AETDGGYITK...----------------------------------------
Q8A3M2_BACTN/147-223........Y---------LTVKYVN..RSEKEGYVKL..V----------------------------------------
Q87XP4_PSESM/130-203........E---------ATFKKLV..EDGGTRYLKP..L----------------------------------------
LEXA_BRAJA/147-216.........---------ATLKRFR..RRGASIALEP..A----------------------------------------
Q8XNL8_CLOPE/31-100........E---------RMIKRLI..GLPGDKVE.....----------------------------------------
Q8P0Y7_STRP8/147-214.........---------TYIKKVF..REDEGLRLVS..L----------------------------------------
Q8RPE9_LEGPN/132-204......AII---------CQYKKLS..YTSSEFELLT..L----------------------------------------
LEPV_BACSU/29-97.........---------VLIKRVI..GLPGETIK.....----------------------------------------
Q9F190_9ZZZZ/56-123.........---------FTVKKLI..LRPRSCLMPM..N----------------------------------------
Q8X5E1_ECO57/122-197........E---------ATFKKYE..KDAGVSYLVP..L----------------------------------------
Q9ZBB1_STRPN/139-206.........---------TYIKKVY..REENGLRLVS..L----------------------------------------
Q9CG39_LACLA/155-229........R---------LYIKQVF..EEEDGQFRIH..S----------------------------------------
Q9I441_PSEAE/35-105.......SI---------AYVKRIA..GIPGDRVR.....----------------------------------------
Q9LW08_ARATH/52-124........I---------PIVHRAI..KVHERGDTKA..V----------------------------------------
LEXA_THEMA/114-182.........---------VTLKKFY..QRGDTVELRP..A----------------------------------------
Q9A0R3_STRP1/164-232.........---------TYFKKVY..TEHDGLRLVS..L----------------------------------------
Q8Y7K7_LISMO/44-112......SGE---------HFIKRVI..GMPGDKVA.....----------------------------------------
Q8P0L2_STRP8/189-258.........---------AYIKQLL..INAEGAFLHS..L----------------------------------------
Q8XNA8_CLOPE/46-112........E---------LLIKRVV..GLPGEKVE.....----------------------------------------
Q87Y08_PSESM/145-219........E---------TTFKQFV..MDAGVGYLVP..L----------------------------------------
LEP_STRPN/33-98........K---------DIVKRVI..GMPGDTIR.....----------------------------------------
LEP_PHOLA/54-131N...PSLNE---------AFIKRVI..GLPGETVQ.....----------------------------------------
LEXA_CORGL/151-219.........---------ATVKEFH..KDSSGIWLLP..H----------------------------------------
Q9RLS7_LEGPN/152-226......III---------RKFKQLS..VSKEKPEFEL..V----------------------------------------
Q9MBT4_9CAUD/158-225.........---------AYVKKVY..VEDNRLTLVS..L----------------------------------------
Q8RIK1_FUSNN/128-198.........---------GYIKRLE..MKDKLRVITL..K----------------------------------------
Q81BS6_BACCR/35-103.........---------DLVKRVI..GLPGDTVE.....----------------------------------------
Q982T6_RHILO/154-230.....DTRD---------SYIKQFM..SRSNSLVRLR..Q----------------------------------------
Q8DSC7_STRMU/30-93.........---------NIVKRVI..GMPGDTIT.....----------------------------------------
A9CK86_AGRT5/134-203.........---------VMAKVLA..RQSPKNIELL..S----------------------------------------
Q88G30_PSEPK/124-194.........---------SMVKELL..FENEEGVNLA..S----------------------------------------
P73722_SYNY3/113-185.........---------IAIKRYY..QDGTKVVLKA..S----------------------------------------
Q97I60_CLOAB/396-464.........---------ATLKRLK..MDKDGIAFMP..E----------------------------------------
Q8NVM4_STAAW/178-245.........---------SLIKRVD..ICEDYINLVS..L----------------------------------------
Q89K52_BRAJA/39-127.......ST---------DYIKRVI..GLPGDRVQ.....----------------------------------------
Q8YG73_BRUME/59-147.......SV---------DYIKRVI..GLPGDRVQ.....----------------------------------------
Q81A78_BACCR/132-202.........---------ATVKKIS..KSGSIITLIP..L----------------------------------------
Q8VUN8_STRSU/66-130.........---------VLVKRVV..ATSGQWVN.....----------------------------------------
Q8PB54_XANCP/69-151.......DQ---------NWIKRVV..GLPGDKIGFH...----------------------------------------
Q9SSR2_ARATH/52-124........I---------PIVHRVI..KVHERENTGE..V----------------------------------------
LEXA_LACPL/125-194.........---------ATCKRFF..KEADHYRLQP..E----------------------------------------
Y1546_HAEIN/52-118........E---------FHVYEFM..AHSGNYLFMA..L----------------------------------------
O69884_STRCO/72-146.......HG---------DYIKRVV..GVGGDHVV.....----------------------------------------
Q8ERB6_OCEIH/36-103.........---------NYVKRII..GLPGEEIE.....----------------------------------------
Q83BK4_COXBU/66-148.......KI---------VFVKRVI..GLPGDHIV.....----------------------------------------
LEXA_ENTFA/126-195.........---------ATCKRFF..REVDHIRLQP..E----------------------------------------
Q38089_BPR1T/193-262........Q---------ATLKKVY..HEIDCLRLVS..I----------------------------------------
O97066_DROME/57-121........I---------PIVHRVI..KLHEKED......----------------------------------------
Q8XI29_CLOPE/43-114.........---------VVTHRVV..EKNEEGFITK..G----------------------------------------
LEXA_CUPNE/131-199.........---------VTVKRLK..KRGDTIELIA..E----------------------------------------
Q87CF1_XYLFT/155-232.........---------AKVKRLY..TLRNNGLRIV..S----------------------------------------
Q8DHX1_THEEB/62-137.....GFHD---------AFIKRVV..GLPGDRVE.....----------------------------------------
LEXA_BACSU/122-191.........---------ATVKRFY..KEDTHIRLQP..E----------------------------------------
LEXA_CLOAB/123-191.........---------ATIKRFF..KEKDKIRLQP..E----------------------------------------
Q899K0_CLOTE/135-199.........---------RQIRQIK..NLDNSKFLLI..S----------------------------------------
TR96_PRORE/126-200........E---------ATFKQLV..IDGEQKYLKP..L----------------------------------------
O26667_METTH/114-183.........---------LIVKRVG..KIEPERVYLM..S----------------------------------------
LEXA_CLOPE/122-190.........---------ATIKRFF..KENGFIRLQP..E----------------------------------------
Q97I92_CLOAB/31-101.......TK---------KFIKRVI..AVEGDKVK.....----------------------------------------
LEXA_VIBPA/118-186.........---------VTVKRLE..RKGSTVLLHA..E----------------------------------------
LEP2_SYNY3/47-122.....NFHD---------AFIKRII..GLPGDEVR.....----------------------------------------
Q9PBL7_XYLFA/241-317........E---------YNVKRCIIDDKHSKRVFFA..A----------------------------------------
LEP_PSEFL/85-168.......NV---------NYIKRVV..GLPGDVVRYT..S----------------------------------------
Q8VMP5_PSEPU/56-125.........---------PLVKRLA.KAPGDGWLLES..A----------------------------------------
Q98J28_RHILO/144-217.....KNGK---------AFVKKLV..KRTASELVVE..Q----------------------------------------
O52206_9ZZZZ/57-124.........---------FTVKQLQ..LRPYPCLMPL..N----------------------------------------
Q8P6K4_XANCP/66-135.........---------PVCKILQ..VAVDHIELHS..R----------------------------------------
LEXA_SHEON/118-186.........---------VTVKRFE..KKGNVVYLHA..E----------------------------------------
LEXA_OCEIH/124-193.........---------ATVKRFF..KEENRIRLQP..E----------------------------------------
Q8DZ52_STRA5/144-211.........---------LYIKKLY..REEDGFRMVS..I----------------------------------------
Q52416_PSESX/56-124.........---------PVSKILI..LQGDHVVLKS..A----------------------------------------
Q9AZ21_BPHK6/150-223........E---------ATFKKLI..IDGGNKYLKG..L----------------------------------------
Q8SDS3_9CAUD/159-226.........---------AYVKKVF..VEDDRLTLVS..L----------------------------------------
Q89H60_BRAJA/100-172.........---------RYLKTIE..RGKSPSVVNL..N----------------------------------------
Q889M8_PSESM/144-214.........---------LRVRYLY..RLPNGGLRLR..S----------------------------------------
LEP2_BACAM/46-115........V---------HYVKRLI..GKPGETVE.....----------------------------------------
LEXA_LEPIN/122-190.........---------ATLKVYY..KEQDQIRLEA..R----------------------------------------
Q8DF35_VIBVU/44-110.........---------.FVCKML..DMTRRSLLSA..N----------------------------------------
RDGA_PECCC/156-229......DKL---------KRIKQLY..RKPGGLLTIH..S----------------------------------------
LEXA_STRCO/153-221.........---------ATVKRFK..REDGHVWLLP..H----------------------------------------
LEXA_AGRT5/155-224.........---------ATLKRFR..RKGASIALEA..A----------------------------------------
O28618_ARCFU/31-104.......SV---------LITHRVV..EIGDGYFKTK..G----------------------------------------
Q8DLS3_THEEB/41-118G...YRADQ---------ALIKRVI..ATAGDTVA.....----------------------------------------
LEXA2_PSEPK/118-186.........---------VTIKRLQ..RQGGTYRLLP..R----------------------------------------
O48418_BPH19/135-204.........---------NMIKVLG..YDRDGEYQFT..S----------------------------------------
Q87ZK3_PSESM/155-229........E---------ATFKVFV..EDAGQQFLKP..I----------------------------------------
Q8Y7K6_LISMO/35-99.........---------EYIKRVI..GLPGDTVE.....----------------------------------------
Q88FM1_PSEPK/148-220.........---------AIFRELA..EEGGQRYLKA..L----------------------------------------
Q8VVM6_VIBCL/62-129.........---------LTVKELQ..LRPCVKLIPR..N----------------------------------------
Q83CL5_COXBU/69-151.......AA---------TFVKRVI..GVPGDRIS.....----------------------------------------
Q88GF2_PSEPK/203-272.........---------IYIKRLQ..IADEDHFEMI..S----------------------------------------
Q8G5K7_BIFLO/20-88.........---------IAIKRLV..SRAGITILHA..E----------------------------------------
Q8H041_ORYSJ/55-125........V---------PIVHRVI..ELHERHDG.....----------------------------------------
Q9PFG3_XYLFA/137-204.........---------HQIKRLQ....DRGRLFVV..S----------------------------------------
Q819W7_BACCR/34-102.........---------DYIKRII..GLPGDEIE.....----------------------------------------
LEP_AQUAE/27-103.......DI---------DFIKRII..ARGGDTVEFF..P----------------------------------------
LEXA_BACHD/124-193.........---------ATVKRFF..REKDYIRLQP..E----------------------------------------
Q836K0_ENTFA/34-100.......DK---------NYIKRVI..GLPGDTIA.....----------------------------------------
Q9ZG05_STACA/31-99.........---------DYVKRVI..GMPGDSIE.....----------------------------------------
Q9CMD8_PASMU/54-123........Q---------FHIYEFM..LQQNNEYVFF..A----------------------------------------
Q9G0C2_BPMV4/136-205........R---------ASLKRVK..KVGNQVFLLP..D----------------------------------------
UMUD_SHIFL/55-122.........---------FTVKKLQ..LRPTVQLIPM..N----------------------------------------
Q88MM2_PSEPK/197-266.........---------LLIKRLQ..RKDEDHLWLI..S----------------------------------------
O69885_STRCO/80-151EQTTKKDDP---------VVVKQVK...............----------------------------------------
Q9T1U7_BPAPS/171-240.........---------VMVKTFL..YQRDDVVHLL..S----------------------------------------
Q8G7I8_BIFLO/110-192EQSSAPGGG---------YLIKRLI..GLPGDVVECK..G----------------------------------------
Y1476_HAEIN/151-220.........---------VWVKRVK..MEWDGISLISDNK----------------------------------------
LEXA2_PSESM/118-186.........---------VTIKRLQ..HRGDQLHLLP..R----------------------------------------
LEP_RICCN/40-130.......SV---------RYIKRLI..GLPGDKIQ.....----------------------------------------
PRTR_PSEAE/157-227.........---------LRVKFVY..RLPGGGIRLR..S----------------------------------------

PF10502

A0AEF9_9PSED/50-195LVSVNNPASFDSRY..FGPI..RAGAV..ICVARPVWQ
B7WYS9_COMTE/46-191LLSVTNPASFDSRY..FGPV..SAASV..IGVARPVWL
A0KUN2_SHESA/46-191LLSVTNPASFDSRY..FGPV..SVSAV..IGIASPVWL
A1AYA9_PARDP/32-169LMNQDAEDSLDGRY..FGPL..PLGSV..TARIVPLWT
A1B266_PARDP/28-165LMNPAVADSFDGRY..FGPF..PTSAV..IGRASPLFA
A1B6X0_PARDP/32-169LMNREVGDSLDGRY..FGPL..PLASV..TARIVPLWI
A1VQA6_POLNA/33-169TAG.EHPNSFDSRY..FGPVKFPRDDH..HNRTRESSF
A1VUX7_POLNA/38-179LLSVTNPASFDSRY..FGPI..AASAV..IGTAQSVYL
A1W985_ACISJ/50-195LLSVTNPASFDSRY..FGPV..SASAV..IGIAHPVWL
A1W9Z2_ACISJ/54-199LLSSTNPASFDSRY..FGPV..SASAV..IGVARPIWL
A1WDT4_ACISJ/31-177LMSDVSDTSFDGRY..FGPI..NRSQV..QTVIRPVIT
TRAF_AGRT9/29-173LHS.SFASSYDSRY..FGPV..PDSGL..LSLARPVFT
TRAF_RHISN/41-185LHS.PFSGSYDSRY..FGPI..PAAGI..LGLAQEVLT
TRAF4_ECOLX/30-176LMSDVSDTSFDGRY..FGPV..NRSQI..ITVIRPVLT
Q07JC8_RHOP5/30-167LMNWQSADSLDGRY..FGVT..LATAI..LGRADPLWT
Q0ACY7_NITEC/30-172LFSTYSSGSFDSRY..FGPV..DVSNI..RGKAVPILV
B0T9Q5_CAUSK/35-171VFSNRIPNSFDSRY..YGPV..RHEAI..VGVFRPIMT
B0SV57_CAUSK/29-166LMNWQVRDSLDGRY..FGPI..PASAI..IGQALPVWT
Q11BL3_MESSB/30-167LMNWDASDSFDGRY..FGPL..PTSSI..TARVIPVWT
Q11FV4_MESSB/29-166LMNWEVRDSHDGRY..FGPI..PASSV..IGRATPLWT
Q11L03_MESSB/29-166LMNIGVRDSLDGRY..FGPL..AVTTV..IGRATPLYT
Q1M9U2_RHIL3/40-184LHS.AFPGSYDSQY..FGPV..PASAI..LGLAQEVLT
Q1QF78_NITHX/30-174LHS.DFAGSYDSRY..FGPI..PASGI..LGLARPVLT
Q3IUW1_RHOS4/31-162AFG.SSADSLDSRYATVGLF..ARETIRAVGVGTTLVP
B4S9K6_PROA2/32-168VGT.AMENSFDSRY..FGPV..AVSSV..TGKAVALLT
TRAF_AGRT5/29-173LHS.SFASSYDSRY..FGPI..PDSGL..LGLARPVFT
Q84HT6_RHIET/41-185LLS.PFRSSYDSRY..FGPL..PASGI..LGLAKPVLT
Q89YA7_BRAJA/29-166LMNPTVPDSLDGRY..FGAL..PVSSI..VARAVPLWT
Q8KJJ4_RHILI/45-181LLGNEKNHSFDSRY..FGPV..PAENI..IGRLVPLWT
Q98NU0_RHILO/29-166VLNRKVEDSLDGRY..FGPF..PASSI..VGAARPLWT
Q9PBT1_XYLFA/31-177LMTDRSSTSFDARY..YGII..SREQV..KSVIRPVLT
Q9R6E9_RHIRD/29-173LHS.SFASSYDSRY..FGPI..PASGL..LGLARPVFT

PF00717

LEXA_MYCLE/154-222---NP..A........FDPI--PGNDA-----------
RPC_BP163/172-248---YN..........PTKKI--EFTRE-----------
Q859R0_9VIRU/129-201---NP...........KGPL--LEPEE-----------
Q92NY0_RHIME/142-215---FN..........PHKEL--RFEAN-----------
LEXA_BACCR/123-192---NS..........SLEPI--ILKQV-----------
LEXA_AERHH/119-187---NE..E........LSPI--EVDLS-----------
RPC1_BPPH8/149-218---IN.RD........YDDE--EADEA-----------
RPC1_LAMBD/145-219---NP..Q........YPMI--PCNES-----------
Q81ID4_BACCR/34-100---....M.......RNDQL--YVNSE-----------
Q8YCN0_BRUME/136-205---LN.PE........HPNR--IFESK-----------
Q8RDJ6_THETN/35-105---....I.......KDGKL--IRNGK-----------
Q8DTE9_STRMU/206-273---NP..D........YDDI--ILKED-----------
Q9CDG2_LACLA/30-98---....F.......DHDQL--TINNK-----------
Q9JZT1_NEIMB/153-223---HNSGF........YGDE--NAPLD-----------
LEXA1_XANCP/117-185---NP..A........HAPI--VVAAD-----------
Q8ECY1_SHEON/180-250---YNNDE........FPDE--FIPPE-----------
Q888E3_PSESM/45-118---NS..A........YPTV--QCTED-----------
Q37946_9VIRU/132-205---NP..S........YHMI--PINGN-----------
Q94MM0_BPBPP/133-207---NP..D........WQPR--YIPIN-----------
Q81TI5_BACAN/46-122---KGDNN.......NGPDL--EPVLA-----------
Q884H2_PSESM/52-120---NA..D........YPPL--HVTDN-----------
Q895M0_CLOTE/31-101---....V.......EDNKV--YVNDE-----------
Q99YY5_STRP1/167-235---LN.KS........YEEI--YLSKD-----------
Q93M86_CLOPE/277-346---ST.NP.......EHQIQ--KYKAD-----------
Q8CMP2_STAES/31-99---....Y.......KKDQL--YLNGK-----------
Q8EQZ6_OCEIH/39-107---....V.......EDNKL--YINGE-----------
P71159_DICNO/147-217---FN.QE.......EYKDE--LVRPE-----------
LEXA_BIFLO/160-228---NP..A........YSPI--DGTHA-----------
Q8Y0I3_RALSO/99-181---.............NKRL--TINGQ-----------
Q8L2B9_PROVU/54-121---PD...........FSPI--PIPSG-----------
Q8TWK2_METKA/54-122---.............DNNP--LPDPW-----------
Q9JPL1_NEIME/162-229---AN.PV........YEPF--EIDLT-----------
Q87LN8_VIBPA/86-169---.............DKQL--CIQSQ-----------
O58298_PYRHO/33-96---.............GDNN--VATDQ-----------
LEPS_BACSU/38-105---....M.......KNDQL--YINGK-----------
Q98BD0_RHILO/130-199---LN.PD........HPDR--DIPMR-----------
Q8SZ24_DROME/33-102---.............QKPI--PIEAE-----------
IMPA_SALCH/59-128---PE...........FRTL--YPENI-----------
Q9C8S3_ARATH/42-121---DSRKSD......ESQTI--VVPKG-----------
Q8HAA0_9CAUD/140-208---NT..N........YREW--SITKD-----------
Q8EDU1_SHEON/160-228---DN.PV........YDKL--DIPKH-----------
Q8ERW7_OCEIH/32-100---....Y.......KHDKL--YINGE-----------
Y1416_COXBU/128-197---NP..E........LEKL--EVARL-----------
Q8KCH1_CHLTE/43-125---....I.......RNQQV--YINGK-----------
Q81CX0_BACCR/33-102---....L.......KEDEV--FINGK-----------
LEPQ_BACNA/38-107---....M.......KNDNL--FVNGK-----------
Q8ISG0_LEIMA/49-114---.............GKKF--YLTKG-----------
Q8A2V9_BACTN/142-218---SY.NA.......HHDPM--DIPFS-----------
Q82XF6_NITEU/174-244---DNSHN........FGIE--TYSQK-----------
Q7DII9_SALET/56-123---PA...........YPTL--YPEEL-----------
Q8EJ32_SHEON/152-221---DN.KE........YREQ--RVPVA-----------
Q8CPU1_STAES/31-99---....Y.......KNDTL--YVNGK-----------
LEXA_HAEIN/118-186---NE..E........FDPI--VVNLE-----------
Q8YSV6_NOSS1/47-124---....V.......NNGKV--YLNGK-----------
Q834H4_ENTFA/37-101---....Y.......ENDQL--YVNNQ-----------
LEP_BACCL/33-101---....Y.......KNDIL--YVNGK-----------
Q38451_BPD31/152-221---EN.KA........YTEM--IVPKA-----------
Q9K509_PSESJ/56-125---NT..A........YPAR--HILEG-----------
LEPU_BACSU/41-110---....M.......KNDQL--YINDK-----------
Q92S91_RHIME/136-205---LN.PD........HPNR--NFEMN-----------
Q8D306_WIGBR/74-158---I............NKEI--KIQPN-----------
Q8SBF6_BPSF5/133-202---NP..N........WPEP--YIKIN-----------
Q8EH82_SHEON/85-167---.............NKQL--MIQKA-----------
MUCA_SALTM/57-124---KD...........FPVY--YIDPD-----------
LEXA_PSEAE/120-188---NP..E........FAPI--EVDLK-----------
Q9A806_CAUCR/46-134---....I.......RGGEV--YINGK-----------
LEXA_STAAW/125-194---NS..T........MEPI--YLDNV-----------
Q8FET6_ECOL6/120-194---NP..R........YPNI--PINGN-----------
Q98PT9_MYCPU/35-99---....F.......ENGKV--FRNDQ-----------
Q935H5_SALTI/56-123---PA...........FKPI--PVNPD-----------
Q88A26_PSESM/128-201---NP..A........YPTL--PVTED-----------
Q8XHC1_CLOPE/139-208---NN.GS........MRTE--TANIK-----------
Q847G5_PSEPU/56-124---TP..T........YKAV--TPDEY-----------
Q9A6E4_CAUCR/45-133---....V.......AGGQV--YVNEV-----------
Q8ZQI4_SALTY/140-208---NP..L........YKEW--QITKE-----------
Q8XMU1_CLOPE/38-107---....IK......SDGSV--YINGN-----------
Q845L3_BACME/34-102---....Y.......RNDTL--YVNGK-----------
Q9I551_PSEAE/148-218---FNSDE........HPDE--RYEPQ-----------
LEXA_DEIRA/115-185---NP..A........MPRL--SFPAE-----------
LEXA_SHIFL/114-182---NS..E........FKPI--VVDLR-----------
Q9RN42_BORPT/96-178---.............DKKL--YINGK-----------
Q8DXX2_STRA5/30-97---....Y.......KNDTL--TINNK-----------
Q92R48_RHIME/38-126---....V.......RNSVL--YVNDK-----------
Q837I5_ENTFA/96-162---....V.......NEGKL--YLSEE-----------
Q97FT1_CLOAB/41-111---....L.......KNGKV--YVNGK-----------
Q82ZI3_ENTFA/30-95---....Y.......RDDTL--YINGV-----------
LEXA_RHOS4/144-213---ND..S........YETQ--VYPEQ-----------
Q9ABY8_CAUCR/131-200---LD.RV........SGER--LLSRD-----------
Q9CNL1_PASMU/128-197---NK.TL........YPPI--DLSFE-----------
O64370_9CAUD/130-204---PD.STD.....KRFSPI--MYTYE-----------
Q8XK50_CLOPE/40-110---....I.......NNSEV--YVNGD-----------
Q8XYP2_RALSO/36-117---....M.......RGEAL--YINHQ-----------
UMUD_SALTY/55-122---GA...........YRPI--PVGSE-----------
Q8YMM5_NOSS1/113-185---NP..K........YNPI--EVAAI-----------
LEXA2_XANCP/128-196---NP..D........YAPI--EVLPD-----------
Q8X2C7_ECO57/123-201---NP..R........YQSS--LLTPE-----------
Q81BT6_BACCR/32-101---....I.......TNGKV--YVNDK-----------
LEP_BACLI/39-108---....M.......KDDTL--YINGK-----------
LEXA_CLOTE/119-187---NE..T........MEPI--IVKQC-----------
LEXA_CAUCR/150-218---NP..K........YETR--IFGPD-----------
RPC1_BPHK0/144-212---NA..A........YDRW--YIEEG-----------
Q9KE28_BACHD/39-107---....M.......EDDIL--YINDE-----------
Q9PCU7_XYLFA/145-214---DK.AL........YPDF--VADEN-----------
LEXA_LISMO/121-190---ND..A........LEPI--LLNNV-----------
Q8Y7K8_LISMO/37-103---....Y.......KEDQL--YINGK-----------
Q89VA9_BRAJA/135-204---LD.AS........QAER--TIAAG-----------
Q935U4_STRTR/143-210---NP..K........YKDI--FITYD-----------
Q8LTF5_BPP22/127-200---NP..Q........YPMI--EINGN-----------
Q81GQ1_BACCR/35-103---....Y.......KQDKL--YINGQ-----------
Q45225_BRAJP/44-133---....M.......RQGQL--FINDR-----------
RPC1_BPD3/131-204---DN.PDK.....SAYPDE--MASES-----------
LEXA_RALSO/129-197---NP..D........FEPI--HVDLD-----------
Q8W648_9CAUD/130-203---NP..Q........YPII--EMDND-----------
LEPP_BACNA/39-108---....M.......KNDHL--FINGN-----------
A9CK98_AGRT5/141-214---YN..P........PKEL--QFDQY-----------
Q8X5F7_ECO57/124-198---NP..R........YPSI--MLDDL-----------
LEP_BUCBP/77-161---L............TKRL--TITPN-----------
Q99Y69_STRP1/30-97---....Y.......NDDTL--YINGK-----------
O28201_ARCFU/35-98---.............GDHN--IATDQ-----------
Q8A3M2_BACTN/147-223---SY.NP.......HHEPM--DLPVD-----------
Q87XP4_PSESM/130-203---NP..A........YKMI--ECDAD-----------
LEXA_BRAJA/147-216---NA..A........YEVR--ILPPN-----------
Q8XNL8_CLOPE/31-100---....IK......DDGTV--NVNNE-----------
Q8P0Y7_STRP8/147-214---NK..K........YSDK--FAPYS-----------
Q8RPE9_LEGPN/132-204---ND..N........WPNI--KVSDD-----------
LEPV_BACSU/29-97---....Y.......KDDQL--YVNGK-----------
Q9F190_9ZZZZ/56-123---PA...........YPPI--YFDPE-----------
Q8X5E1_ECO57/122-197---NP..A........YRTL--DCDHS-----------
Q9ZBB1_STRPN/139-206---NR..N........YSDK--FAPYD-----------
Q9CG39_LACLA/155-229---LNPDP.......QYKDF--YLGQE-----------
Q9I441_PSEAE/35-105---....I.......DGGRL--YVNER-----------
Q9LW08_ARATH/52-124---DV.LT.......KGDNN--DIDDI-----------
LEXA_THEMA/114-182---NR..E........MSSM--FFRAE-----------
Q9A0R3_STRP1/164-232---NK..K........YSDI--FIGYP-----------
Q8Y7K7_LISMO/44-112---....F.......KNGEL--YLNGK-----------
Q8P0L2_STRP8/189-258---NQ.CG.......DYPDI--PIDRD-----------
Q8XNA8_CLOPE/46-112---....L.......KDGLL--YVNDV-----------
Q87Y08_PSESM/145-219---NP..S........YQPV--VLDDG-----------
LEP_STRPN/33-98---....Y.......ENDKL--YINDK-----------
LEP_PHOLA/54-131---....V.......TGGRV--LINGQ-----------
LEXA_CORGL/151-219---ND..T........FAPI--PAENA-----------
Q9RLS7_LEGPN/152-226---AI.NN.......DWPDV--KISKE-----------
Q9MBT4_9CAUD/158-225---NK..K........YKDL--HFYDN-----------
Q8RIK1_FUSNN/128-198---SD.NP.......DYDDI--DIPEE-----------
Q81BS6_BACCR/35-103---....Y.......KNDVL--YVNGK-----------
Q982T6_RHILO/154-230---LNPDE........GENE--TLDFP-----------
Q8DSC7_STRMU/30-93---....Y.......ENDML--SINGK-----------
A9CK86_AGRT5/134-203---LN.PE........HPNR--SFDMA-----------
Q88G30_PSEPK/124-194---VN.AA.......YGERR--VIAWA-----------
P73722_SYNY3/113-185---NN..K........GPGQ--ELKAS-----------
Q97I60_CLOAB/396-464---NE..L........YSPI--KVTED-----------
Q8NVM4_STAAW/178-245---NP..K........YDDI--KVASF-----------
Q89K52_BRAJA/39-127---....M.......KDGLL--YINDT-----------
Q8YG73_BRUME/59-147---....M.......RGGVL--YINDK-----------
Q81A78_BACCR/132-202---SNDPI........HEPK--TYDLS-----------
Q8VUN8_STRSU/66-130---....ID......EQGNV--YANGK-----------
Q8PB54_XANCP/69-151---.............GDTL--YINDK-----------
Q9SSR2_ARATH/52-124---DV.LT.......KGDNN--YGDDR-----------
LEXA_LACPL/125-194---ND..T........MAPI--ILNNV-----------
Y1546_HAEIN/52-118---DS.TT.......Q....--NINTK-----------
O69884_STRCO/72-146---.C.CD.......EEGRV--RVNGQ-----------
Q8ERB6_OCEIH/36-103---....I.......KDHQL--YINGD-----------
Q83BK4_COXBU/66-148---....Y.......KNKRL--YINGQ-----------
LEXA_ENTFA/126-195---ND..A........LAPI--LLDNV-----------
Q38089_BPR1T/193-262---NK..E........FKDQ--FATQD-----------
O97066_DROME/57-121---.............GSVK--FLTKG-----------
Q8XI29_CLOPE/43-114---DN.NN.......ANDTE--IVRGE-----------
LEXA_CUPNE/131-199---NP..D........FQNI--VLHAG-----------
Q87CF1_XYLFT/155-232---DN.QNKDSEGHRIYKDE--IVPPN-----------
Q8DHX1_THEEB/62-137---....L.......RAGRV--YINNQ-----------
LEXA_BACSU/122-191---NP..T........MEPI--ILQNV-----------
LEXA_CLOAB/123-191---NH..T........MDPI--IVDNC-----------
Q899K0_CLOTE/135-199---NS..............T--MVNTE-----------
TR96_PRORE/126-200---NP..Q........YPAI--PINGN-----------
O26667_METTH/114-183---DN.KK........VERI--YTPTS-----------
LEXA_CLOPE/122-190---NK..N........YEPI--IVEDC-----------
Q97I92_CLOAB/31-101---....I.......VNDKV--YVNGV-----------
LEXA_VIBPA/118-186---NE..E........FAPI--QVDLT-----------
LEP2_SYNY3/47-122---....V.......SQGNV--YVNGK-----------
Q9PBL7_XYLFA/241-317---DN.PE.......GDHDW--QLPRW-----------
LEP_PSEFL/85-168---.............DKRL--FINGE-----------
Q8VMP5_PSEPU/56-125---NP..A........YKTI--TPDEY-----------
Q98J28_RHILO/144-217---YN..P........PKTL--TFNRY-----------
O52206_9ZZZZ/57-124---PA...........FPPI--RFDPE-----------
Q8P6K4_XANCP/66-135---SP..H........CAPI--VLAPG-----------
LEXA_SHEON/118-186---NE..D........YSPI--KVDLS-----------
LEXA_OCEIH/124-193---NA..T........MEPL--FYDNV-----------
Q8DZ52_STRA5/144-211---NP..D........VAER--FIPFE-----------
Q52416_PSESX/56-124---NP..A........YPPR--HILEG-----------
Q9AZ21_BPHK6/150-223---NP..A........WPLV--PINGN-----------
Q8SDS3_9CAUD/159-226---NK..D........YDDL--HFYRN-----------
Q89H60_BRAJA/100-172---SF..N........AKPI--VGVKL-----------
Q889M8_PSESM/144-214---HNDAE........YPDE--VFSGE-----------
LEP2_BACAM/46-115---....M.......KNDTL--YINGK-----------
LEXA_LEPIN/122-190---NP..K........YKPI--KTKKA-----------
Q8DF35_VIBVU/44-110---ET...........MMPI--CIHAQ-----------
RDGA_PECCC/156-229---FN..R........ETDE--EAYES-----------
LEXA_STRCO/153-221---NS..A........YEPI--PGDDA-----------
LEXA_AGRT5/155-224---NP..A........YETR--IFGPD-----------
O28618_ARCFU/31-104---DA.VE.......DVDPF--DVHEK-----------
Q8DLS3_THEEB/41-118---....V.......HDGRV--WVNNR-----------
LEXA2_PSEPK/118-186---NP..A........YAPI--DVQPE-----------
O48418_BPH19/135-204---IN.QD........HRPI--TLPYH-----------
Q87ZK3_PSESM/155-229---NP..Q........YPII--KITEE-----------
Q8Y7K6_LISMO/35-99---....Y.......KEDQL--YINGK-----------
Q88FM1_PSEPK/148-220---NS..N........YPAL--LCEEG-----------
Q8VVM6_VIBCL/62-129---QA...........YEPI--HIPEG-----------
Q83CL5_COXBU/69-151---....Y.......QDKVF--YINGK-----------
Q88GF2_PSEPK/203-272---DN.SR........HKDR--MIRRE-----------
Q8G5K7_BIFLO/20-88---NP..R........YPDY--MPSNG-----------
Q8H041_ORYSJ/55-125---.............GARQ--MLTKG-----------
Q9PFG3_XYLFA/137-204---DN.HL........MPSF--EFPEE-----------
Q819W7_BACCR/34-102---....Y.......RNDKL--YVNGK-----------
LEP_AQUAE/27-103---YY.DE.......KNNVL--IYKVA-----------
LEXA_BACHD/124-193---NS..T........MEPI--ILTTC-----------
Q836K0_ENTFA/34-100---....Y.......KDDTL--YINGK-----------
Q9ZG05_STACA/31-99---....Y.......KHDQL--YVNGK-----------
Q9CMD8_PASMU/54-123---LD.ST.......Q.SNI--KTNHW-----------
Q9G0C2_BPMV4/136-205---NP..H........YSPI--VLDQD-----------
UMUD_SHIFL/55-122---SA...........YSPI--TISSE-----------
Q88MM2_PSEPK/197-266---DN.PH........NKDQ--QARID-----------
O69885_STRCO/80-151---.............EGLA--FIGLL-----------
Q9T1U7_BPAPS/171-240---IN.SN........HPPI--RLAVP-----------
Q8G7I8_BIFLO/110-192---A............GQPV--TINGV-----------
Y1476_HAEIN/151-220---EE...........YPPI--SITGE-----------
LEXA2_PSESM/118-186---NP..A........YQPI--IVTPD-----------
LEP_RICCN/40-130---....L.......IDDVI--YINDK-----------
PRTR_PSEAE/157-227---FNREE........YPDE--EYSPE-----------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window