Sequence alignment for CL0300

PF10399

UCRI_RHOCB/1-41MSHAEDNAGTRRDFLYHATAATG-VVVTGAAVWPLINQMNAS-
UCRI_ALLVD/10-50PMSAQGVNKMRRRVLVAATSVVG-AVGAGYALVPFVASMNPS-
Q5NNY0_ZYMMO/20-60GQPETSDSLDRRDFLNVAAAGLA-GIGVCGAAIPFIAQMNPS-
UCRI_BRADU/2-42TTASSADHPTRRDFLFVATGAAA-AVGGAAALWPFISQMNPD-
Q9AAX0_CAUCR/5-45TEPEHGGDPSRRDFIHIAAIAAA-AGGAATLAWPFIDQMNPS-
Q1GCS0_RUEST/1-41MSHAEDHEGTRRDFLYYATAGAG-AVTAGAAVWPLVNQMNPS-
Q2RXH6_RHORT/7-47TASTPGGESSRRDFLIYGTTAVG-AVGVALAVWPFIDFMNPA-
A8LTC3_DINSH/1-40MMEA.SENTARRDFLYYATVGAG-VVATGAALWPLVNQMNPS-
Q7CXJ6_AGRFC/6-46TNHDASGEPTRRDFLYLVTGMAG-AVGAAAVAWPFIDQMRPD-
A0L4J1_MAGMM/1-41MSTVNEHDENRRDFLIMATGAVG-AVGVAGAAWPFIDSWSPS-
Q15PI5_PSEA6/13-53VTENQPQDNNRRRFLTVATSVVG-GVGVAGAAIPFIGSWNPS-
Q6NB14_RHOPA/1-41MTAITSEQPSRRDVLYLATGALA-AVGTAAMVWPFVSQLNPD-
Q1GTG3_SPHAL/7-47LNAGIEDGVRRRDFINIAAVSFA-GVGAVAAVLPLVNQMNPS-
A5V644_SPHWW/10-50PGEGAGDGVRRRDFINLAAVSFA-GVGAATVLLPLINQMNPS-
Q2VZT3_MAGSA/8-48AQPSSVDGQTRRDFLLYATAGVG-AIGTGLALWPFVHSMNPA-
Q0ARQ8_MARMM/7-47APGADGQEPSRRDFIYIAAGGVA-AVGGGLVAWPFIDQMNPA-
A5WDK7_PSYWF/10-50MSHAEGVNIKRRRVLIASTAAIG-AVGVASVATPFVRSWYPS-
Q3SPC1_NITWN/1-41MTTSSSAGQSRRDFLFVATGAVA-AVGAAAAAWPLVAQLNPD-
Q217F6_RHOPB/2-42TSATIPDQPTRRDVLFVATGAVA-ALGAAAVAWPLVAQLNPN-
Q4FPG5_PELUB/1-38MSE...KKPERREFLFTASYAVG-AVGVGAVVWPLVDQMNPD-
Q212B8_RHOPB/3-43TATLLPEQPTRRDVLYIATGAVA-AVGAVAAVWPLVVQLNPD-
Q1QLI7_NITHX/10-50IKKPSGRSPTRRDFLYIATAAVG-TVGVAAAIVPMISQLEPD-
A4SV32_POLSQ/1-40MSDKPCMDKDRRNWL.IATSAVG-GVGAAAALYPFVDSFEPS-
A7HVC3_PARL1/1-41MADIHAVEPTRRDFLYVATGSLA-AVGAAFTVWPLIDQMNPD-
Q0C5B3_HYPNA/4-44ETHAEAVDEDRRNFIHIATGSVA-LGGAAMFAWTLVDQWNPA-
Q28VM0_JANSC/1-41MSDTHDPSGDRRDFLYYATAGTG-VVVAGAAAWPLVNSMNPS-
Q92PE6_RHIME/6-46TSSETMGEPTRRDFLYLATGMAG-VVGAGAAAWPFIDQMRPD-
A7IJK0_XANP2/2-42AHTETSDTTTRRDFLYIATGAVG-AVGAAAMVWPFISQLQPD-
Q2RV52_RHORT/12-52PSLDDDGFKTRRDFLIYGTLAVS-AAGAALAAWPFIDFLNPA-
Q98HU4_RHILO/1-41MSATDIHDPNRRDFLYVATGMAA-VVGAGAVAWPFIDQMRPD-
Q11GB7_CHESB/4-44TDSTHIPEHSRRDFLYVATGMAG-AVGAAAVAWPFIDQMRPD-
A1B4F2_PARDP/11-50.EHAGDHGATRRDFLYYATAGAG-TVAAGAAAWTLVNQMNPS-
A6WZD5_OCHA4/1-41MSAHDTAEPTRRDFLYIATGMAG-VVGVGGLAWPFIDQMRPD-
B2FJ96_STRMK/7-44...HDPVNTGRRRFLSATTAVVG-AVGVGFTAVPFIKSWNPS-
B7JAL3_ACIF2/7-45.SEHGHKNITRRRFLAAATSAVG-AVVAGMVAVPLVDSLEP.-
F2IZP4_POLGS/1-41MAHSDSAEPTRRDFLYIATGAMG-AVGVGALAWPFIDQMNPD-
Q6NAJ3_RHOPA/35-74.TTEASAEPTRRDFLYIATGAVA-AVGAAAAVWPFISQMNPD-
UCRI_RICPR/5-44.EDNKNKQTTRRDFIVLTASSVA-AVGAACAFWPIIDSFNPS-

PF10518

A0JVR7_ARTS2/4-29-------HISRRNLLRGA.GAAA.LGIS.VA..GWVTS-----
A0KQC3_AERHH/10-35-------NLSRRNLLKGL.GACA.ALPL.LA..GIFPK-----
A0L513_MAGMM/11-36-------PLPRRQFIKGT.LAAT.ATAA.VA..APAIV-----
A0L6Y4_MAGMM/13-38-------DLSRRRFLQGT.AATA.ASGV.LG..APYVQ-----
A0LBZ4_MAGMM/3-28-------KLTRRNFIKTT.GAAA.AVGA.MG..VAAPA-----
A0LHR3_SYNFM/2-27-------KLTRRDFLKIS.SAAT.AGLA.LS..GMGFN-----
A1K1D5_AZOSB/7-32-------NVSRRDFLKAG.AGLT.LSVS.LP..GAVLA-----
A1K404_AZOSB/10-35-------ELSRRGFLKAS.AAAG.TATL.LS..GLFPG-----
A1R315_ARTAT/40-65-------DASRRNFLKLS.GAVG.AAAA.FT..ASLSA-----
GH109_SHEAM/3-28-------GIDRRGFLKAS.MASV.AAAA.LA..GCASQ-----
A1S679_SHEAM/37-62-------GITRRDFMKWS.ASVT.AMLA.LP..LPFST-----
A2BJT3_HYPBU/2-27-------KISRRDFIKIA.AVAG.ASVA.LP..LSLPR-----
A4XP83_PSEMY/1-26-------MPSRRRFLHGS.ASLA.ALAA.LA..PWLPS-----
A4XZP0_PSEMY/33-58-------DPTRRNLLKGG.LGLA.ALGF.FG..GGLAA-----
A5GCL4_GEOUR/2-27-------EIKRRDFLKVT.AAAG.AVAA.IG..LPKLN-----
A5USL5_ROSS1/14-39-------EISRRNLLKFG.LGAA.VAAA.LP..VGSAH-----
A6LD73_PARD8/3-29-------NISRRSFLKTG.AVAA.AGLTIVP..GSVLG-----
A6LIE3_PARD8/1-26-------MITRRNFLKAG.AAVA.ALSV.VP..NGFAS-----
A6Q3L4_NITSB/59-84-------GVSRRDFLKWA.SATT.AMLM.LP..SSFTP-----
NAPA_NITSB/2-27-------ALSRRDFLKSS.AAAA.AASA.VG..LSVPK-----
A6X2W6_OCHA4/4-29-------ELSRRQFLGGT.GAVV.AASA.LG..SFGFG-----
A6X4A5_OCHA4/16-41-------TASRRDFLKYL.GAAA.ATSA.FA..CSSPG-----
A7H7P3_ANADF/2-27-------AITRRDLLKGA.AVAG.AATA.LA..GKAEA-----
NAPA_CAMHC/1-25-------.MNRRDFIKST.AAAA.ACAS.AG..IALPA-----
A8AEI2_CITK8/5-30-------KLSRRTFLTAG.SALA.ALPV.LH..SPFAR-----
A8EUQ9_ARCB4/37-62-------GISRRDFMKWA.TAMT.AMLA.LP..ATFTP-----
A8FCL8_BACP2/3-25-------QLSRRQFLK...GAAG..ASI.LG..FLATT-----
A8IA30_AZOC5/6-31-------RLSRRSALKGL.GALA.AAPL.AA..PAVIT-----
A8ZYN4_DESOH/2-27-------DINRRQFLKFS.GASI.AGIA.FG..TLGLD-----
A9AY10_HERA2/3-28-------KISRRNFLKTA.ASLG.AAVA.MP..SFLTA-----
A9WJR3_CHLAA/14-39-------EISRRNLLKFG.LGAA.VAAV.AA..PLTAE-----
B1LZ75_METRJ/6-31-------KPSRRTLLKGA.AALA.ATPV.TG..FPAVH-----
B1MKF6_MYCA9/9-34-------DVNRRNFLRGA.AVGA.AGTA.IT..GAALV-----
B1MMN5_MYCA9/3-28-------PISRRDVLKYA.AAIP.AAAL.AG..AVSAA-----
B1ZMF7_OPITP/1-25-------.MNRREFLKSS.AAAA.AGVL.LS..SRVSA-----
B1ZUW0_OPITP/3-26-------S..RRDFLKHS.LALG.AAVA.LT..PWRRL-----
B2HPL9_MYCMM/2-27-------SVSRRGVLKFA.AATP.GLVG.LG..AAAAS-----
B3E2Y6_GEOLS/15-40-------GFSRRDFIKTA.AVVG.AGVL.AV..QAVGS-----
B3E5J5_GEOLS/10-35-------EVTRRSFLKTT.GAVA.AAAG.LA..MTGLA-----
B3E655_GEOLS/2-27-------ELTRRDFLKAS.AAAA.AFAA.AG..AQALA-----
B3ELT9_CHLPB/4-29-------KISRRQFLKAA.GVLG.GMAL.LR..PVWDS-----
B3PE60_CELJU/30-55-------MTQRRQFLKGS.LSTA.VAAF.MG..ASLVS-----
B3PIX6_CELJU/19-44-------VVNRREFMKGG.AAGA.AAIS.LA..AMANS-----
B3QY63_CHLT3/4-29-------KNSRRDFLRTA.AAGT.FGAM.LA..AAPMS-----
B4R7Y2_PHEZH/5-30-------EFSRRRLLKVG.AAGA.AAAG.TA..PLLLP-----
B4R8R6_PHEZH/18-43-------DPNRRDFIHIA.AGAA.AVGA.VA..ALAWP-----
B4U786_HYDS0/2-27-------NITRRGFLKGM.AATG.AATL.VG..KKLLT-----
B5E8K8_GEOBB/2-27-------EVSRRNFLKIS.GVGV.AATT.LG..LNLDP-----
B5H919_STRPR/4-29-------HLSRRGILKAS.AAAA.LVPA.LA..PATAA-----
B7VRI2_VIBTL/26-51-------NLSRRNVLKGG.LGIS.AMTA.FG..AFGLA-----
B8DLA6_DESVM/2-27-------TVNRRQFLKLS.AGAT.LASA.FG..GLGIS-----
B8DP54_DESVM/1-25-------.MSRRSFLKGL.IASG.ALAT.LP..CGLLL-----
B8F5V6_HAEPS/2-27-------SCSRRDFISGA.GAVI.AVAG.TT..GLATS-----
B8F7I4_HAEPS/3-28-------NLTRRSLLLGL.GGAA.ALAI.TP..SIANS-----
B8F941_DESAA/3-28-------KISRRSFIKGS.LAAA.GALS.VS..AAPLP-----
B8F9Y4_DESAA/3-28-------KLTRRNFMKGA.GALT.LGAA.IS..PLAPR-----
B8FMN2_DESAA/25-50-------GFSRRDVLKWA.VAGA.AAGA.IP..MGAGC-----
B8GPX0_THISH/2-27-------SISRRHFLKAL.GAGG.AATA.LA..ACAQM-----
B8GTL8_THISH/22-47-------TTSRRGFLKAS.AALG.AGAI.LG..APYIG-----
B9JJT3_AGRRK/9-33-------PSSRRTFLKGA.GAVS.ATA..LA..GFPMP-----
B9JL30_AGRRK/1-25-------.MERRSFLKAS.AVAT.LATG.VA..AVAGG-----
B9JLP2_AGRRK/40-63-------EINRRRFLQ...GAAG.AAAV.AG..FTQIN-----
B9JN60_AGRRK/5-30-------EMNRRSLLKHS.AGVM.ALAA.IG..GGTSL-----
B9L5P6_NAUPA/1-25-------.MKRRDFLKTG.VALG.TAAA.MP..SVVSA-----
B9L6C0_NAUPA/6-31-------NLKRRNFLKGS.AAAA.AGVT.LA..STSAY-----
B9L8N2_NAUPA/35-60-------GFTRRDFLKWS.AAMA.AMLS.LP..TSFTP-----
B9LMU9_HALLT/8-33-------SVSRRSFVKYS.GAAG.VTGA.LA..GCSSN-----
B9LN21_HALLT/90-115-------ELGRRDFMKAG.AAVG.AMSG.LA..GCTSI-----
B9LT83_HALLT/14-39-------GVSRRQFLEVT.GATG.AAVG.LA..GCSGG-----
B9LYZ8_GEODF/1-25-------.MNRRQFLKAS.GLAL.AATA.AP..GLIGS-----
C0QJF4_DESAH/6-31-------PMTRRTFISGS.LALG.AGVA.LA..GCAVN-----
C0QTS6_PERMH/14-39-------ELSRRDFLKTA.AAVS.AAAA.VG..MKVPE-----
C1A2S4_RHOE4/2-27-------HVSRRNLFKYA.AAGS.AAAG.LA..ALSGT-----
C1A5D1_GEMAT/2-27-------PSNRRDFLKVG.AAVA.AGSL.VA..SSPLL-----
C1DAH1_LARHH/68-93-------VVTRRQLLKAG.AAGG.AALV.LA..GWWAQ-----
C3MF45_RHISN/9-34-------MMSRRNFLTSG.AALA.ALAA.AG..EITQP-----
C3MIF9_RHISN/6-31-------VFSRRQFLRAS.GLAI.ASAG.LA..GCTSS-----
C4LL14_CORK4/2-27-------PTSRRNFLKSS.LAIA.ALAT.TA..GVVSA-----
C4XNT4_DESMR/20-45-------GVSRRDFMKFC.AAVA.AAMG.MG..PAFAP-----
C4XTE0_DESMR/2-27-------EWNRREFLKIA.GATT.AVTA.FG..GLGFD-----
C5AXI0_METEA/17-42-------RFSRRDLMRGS.LAAA.LAAG.LA..PQTVA-----
C6BZ71_DESAD/7-32-------GISRRNFLKGL.GAGS.AAML.LP..ARDVA-----
C6C1Z9_DESAD/2-27-------KLSRRSFIKAA.GAVA.GYAV.LG..VNIAK-----
C7JAS8_ACEP3/4-29-------NVQRRDVIKAG.AGAT.LASL.VG..GAIGR-----
C7N347_SLAHD/10-35-------AVSRRSFMKGS.AATV.ALAG.LA..SVAAC-----
C7N3D9_SLAHD/4-28-------DVSRRSFLKGS.AVAA.GAAA.F...GLAAC-----
C7N7C6_SLAHD/9-34-------GLSRRTFLKGS.LAAG.AAAG.AT..YLTAC-----
C7NBZ8_LEPBD/13-38-------KISRRDFLKKA.GMVG.AGAA.IG..ASGAS-----
C7NZM6_HALMD/4-29-------SLNRRTLLRST.GAIA.AAGL.LA..GCSGD-----
C8WGB9_EGGLE/7-32-------SLKRRDFLKGT.AAAA.AATA.AF..GLSGC-----
C8WK93_EGGLE/2-27-------DINRRNFLKGA.LVTG.AAAA.AA..VALPA-----
C8WKT8_EGGLE/2-27-------ELNRRDFLKGS.LAFG.GVAA.LG..GLAGC-----
C8WL99_EGGLE/4-30-------SVTRRTFLKGS.AATA.ALAA.TGA.GVCSL-----
C8WLA4_EGGLE/5-30-------TVSRRTFLKGS.AATA.ALAC.AA..GSISL-----
C8WLF2_EGGLE/5-30-------TLTRRSFMKAM.AVTG.AAAS.LT..AVAEP-----
C8WLM5_EGGLE/2-27-------NLNRRDFLKGG.ALIG.GTAA.LG..TMFGC-----
C8WM27_EGGLE/6-31-------SMDRRSFLKGA.TVAG.AAAA.AA..GTLGL-----
C8WMF2_EGGLE/2-27-------ELNRRDFLKGA.LATG.ALAA.TG..SALAA-----
C8WMK5_EGGLE/6-30-------NVSRRTFLKGT.AAV..AGAA.LA..GGAYE-----
C8WN35_EGGLE/4-29-------NVSRRDFLKGS.IVVA.LGAA.GA..ATLSS-----
C8WN49_EGGLE/4-29-------AMNRRNFLKAA.IASG.AVIA.AG..GALAG-----
C8WPQ0_EGGLE/8-33-------GFTRRSFIKGA.AALT.ATGA.LV..GCSPQ-----
C8WZQ3_DESRD/2-27-------TFTRRHFLKLS.ASAA.AVTA.FG..GLGFS-----
C9Z273_STRSW/5-30-------QPSRRTVLAGT.AAAA.ALTT.FP..APTAQ-----
C9Z623_STRSW/3-28-------PIDRRSLLKAA.AVAG.AAAQ.FS..WALGS-----
D0J379_COMT2/1-26-------MMNRRDFVQTA.AAAG.IATG.LA..GCAAA-----
D0L1U4_HALNC/3-28-------TMNRRNFLKLT.TAAT.AAAA.TF..GAGSA-----
D0L2E2_GORB4/27-52-------GLGRRQFIKLL.AGTG.AALA.TG..GAPRG-----
D0L2I8_GORB4/12-37-------HLSRRSFLLAA.GAVP.IAVA.LA..GCESE-----
D0LBI4_GORB4/7-32-------ALSRRAVLRGG.LAVT.AGVA.LA..GVSAC-----
D0MHZ0_RHOM4/3-28-------ASSRRDFLKGL.GVAA.AGGL.IT..SSGLS-----
D1B0Y8_SULD5/2-27-------SLSRRDFLKTS.AAAS.AAAA.VG..ISVPA-----
D1B210_SULD5/37-62-------GISRRDFMKWA.AGVT.AMLS.LP..SSFTP-----
D1BDP1_SANKS/3-28-------DITRRSMLRAS.LALG.GAAV.LG..GLLGG-----
D1BR60_VEIPT/7-32-------DISRRQFIGGA.LALA.AASA.VP..SFIRG-----
D1CF24_THET1/4-29-------TISRRDFLRLS.GGVA.AGTA.LG..GLVAM-----
D1CGM3_THET1/9-34-------KMTRRQILRMG.AAAG.LALT.LG..GTYGC-----
D1CGN2_THET1/6-31-------KINRREFLRAS.ALAA.AGIT.LA..ACGAN-----
D1CI07_THET1/10-35-------AISRRQFLKWT.ALAG.TASV.LA..ACGAN-----
D1YUM9_METPS/1-25-------.MSRRSFLKAA.VAAA.AVAV.TG..CVSAS-----
D2AQN4_STRRD/7-32-------QPSRRDVLRGA.LAAG.ASLT.LA..GSLSA-----
D2BAA9_STRRD/3-28-------KLSRRNMLKAG.GALG.ALGA.LG..VASPA-----
D2RQA7_HALTV/8-33-------DPSRRQFLGAA.AGTA.ATVA.TA..GCLGA-----
D2RZH1_HALTV/21-46-------GASRRTFLKGS.AVSA.GMLA.TA..GCFGE-----
D2S1H3_HALTV/11-36-------GPTRRDALKYG.GAIA.AGTA.LA..GCSEL-----
D3DHG4_HYDTT/1-27-------MLSRRSFLKGS.LVAT.AGGLLVP..KYVLA-----
D3DHT5_HYDTT/2-27-------ELTRRSFLKFS.GASI.GAGL.VG..GLGFD-----
D3PTP0_MEIRD/1-25-------.MKRRDLIKAG.VVAG.AAAA.LS..AQAQS-----
D3PZF1_STANL/6-31-------PTSRRNLLRGA.IVVG.AGTA.VG..GAALL-----
D3SAQ3_THISK/1-25-------.MHRRNFLKAG.MALS.AGMV.VP..GAAGL-----
D3SWX0_NATMM/10-35-------HVSRRTVLKAS.GSAA.AVPV.LG..AGRVS-----
D3SXZ4_NATMM/6-31-------PTTRRTILKVS.GAVG.AGAF.LA..GCADN-----
D3T0T6_NATMM/9-34-------DIDRRRFIKST.AAIG.AAGL.FA..GCVGT-----
D3T1E3_NATMM/14-39-------NISRRTVLKTT.VAGG.AAAA.AG..CLGGG-----
D4GQX7_HALVD/1-25-------.MNRRNFVKFA.SGAA.AGAA.LA..GCAGN-----
D4GSP2_HALVD/1-25-------.MERRTFLKGS.AGAA.AAFT.LA..GCLGG-----
D4GX43_HALVD/5-30-------SPSRREFLKAA.VAAG.GAAA.LS..ACLDR-----
D4GYQ7_HALVD/6-31-------KLSRRRFLKAT.GGAA.TAAA.LA..GCTGG-----
D4H228_DENA2/12-37-------EVTRRTFLKGA.SAAG.AAAA.LY..GCGGG-----
D4H2E4_DENA2/14-38-------DVSRRTFMKWS.ALLG.AAAT.VG...CGSL-----
D4H8J7_DENA2/8-33-------DLSRRSFLKTG.AAGA.AVVA.AS..AAFPG-----
D4IJZ9_9BACT/5-30-------KIDRRKFLKTF.GVGA.AAAT.AG..LYGCK-----
D4JYD9_9FIRM/9-34-------TITRRSFLKGA.GAVG.AAGL.LA..GCGGS-----
D4JZ20_9FIRM/4-29-------MISRRNFLKVA.GASA.AALG.LA..ACGGS-----
D4JZG4_9FIRM/5-30-------KISRRNFLRVA.GASA.TAAA.MG..GLVPA-----
D4K0E7_9FIRM/4-29-------AISRRDFLKVS.GAVG.AAGL.LA..ACGGS-----
D4K0J6_9FIRM/4-29-------MISRRNFLAAA.GVVA.AAGV.LT..ACGGS-----
D4K1N6_9FIRM/5-30-------MISRRRFLKSA.GAAA.LAVA.AA..GVLAG-----
D4K1U7_9FIRM/3-28-------KISRRSFLTAA.AACG.AAAA.LS..ACGGS-----
D4K1Y7_9FIRM/2-26-------.ITRRDFLKVT.GVAA.AAAA.LT..ACGGS-----
D4K2D0_9FIRM/4-29-------EFNRRSFLKYS.AAAA.VAVA.GS..SLLVG-----
D4K5J0_9FIRM/4-29-------KISRRQFLQVA.GASA.AALL.LA..SCSGN-----
D4K764_9FIRM/3-28-------MISRRDFLKAS.AVVG.ATAA.MT..ACGGS-----
D4K818_9FIRM/3-28-------KISRRNFLLAS.GVVT.VGAA.LA..ACGGG-----
D4K9M2_9FIRM/5-30-------KISRRSFLKAG.AVAS.AVGM.LS..AAPVA-----
D4KAW3_9FIRM/3-28-------KINRRNFLKVT.GVLA.AASA.LA..ACGGS-----
D4KBR9_9FIRM/3-27-------.ISRRNFLAVA.GAAA.AAAA.LT..ACGGS-----
D4KBW6_9FIRM/5-30-------KISRRSFLKVS.AVTT.AMAA.MG..LPAFA-----
D4KDR7_9FIRM/3-28-------NLSRRNFFKLG.AGVL.AGAA.LF..DLTGL-----
D5BP71_PUNMI/3-28-------KLTKRQFLGGS.AVVG.AAAT.LG..APAIH-----
D5C2Y9_NITHN/2-27-------DVNRRAFLKGL.ALSG.LAAA.TP..GFASS-----
D5CSH3_SIDLE/5-30-------DAQRRQFLKTS.LGAA.AVAI.AP..GMLLF-----
D5SUJ0_PLAL2/12-37-------QANRRDFLKTS.AVGA.TAVA.LA..SQIAT-----
D5UZL6_ARCNC/2-27-------TLSRREFLKSS.AAAS.AAAA.IG..MNIPT-----
D5VBY2_MORCR/26-51-------TVSRRTILKGG.VGLT.AAAM.FG..SLPLM-----
D5X3K8_THIK1/11-36-------QMDRRTLIKAG.GAAG.LAAL.LG..TQVPS-----
D6E7P6_9ACTN/7-32-------SLSRRTFMKTT.GALG.ALAA.VG..GSVAA-----
D6E7Z6_9ACTN/13-38-------ELSRRGFVKAS.AAAT.AALA.VG..GLAGC-----
D6E9S6_9ACTN/7-32-------NVTRRTLLKGA.GALG.AAAA.LG..SSLTY-----
D6EAN0_9ACTN/3-28-------EISRRNFLKGA.AVAG.AAVA.GS..AALAG-----
D7A9Y9_STAND/3-26-------N..RREFLKAG.AALA.AGVA.LP..HHALA-----
D7A9Z1_STAND/4-29-------ELSRRTFLKTS.GAGI.AGTT.LG..AFGFS-----
D7BIL7_MEISD/3-28-------KLNRRQLLKAG.AALT.AAGT.LA..SQAFA-----
D7DI56_METV0/3-28-------TLNRRNFMKVG.GALA.AALL.SA..GILTN-----
D7GG92_PROFC/47-72-------SPTRRTFLKWS.AAVG.GTAA.LA..STVTN-----
D7WB90_9CORY/11-36-------QPTRRQFLHGA.GVAG.AAGM.VA..AGASA-----
D8IRV3_HERSS/7-32-------KITRRNFLKTA.SVAS.AAAA.TG..LVSTS-----
D8IXF6_HERSS/9-34-------QVTRRNMLKAG.AVGA.ALPL.FS..ILSRP-----
D8J4L1_HALJB/6-31-------DISRRTVLKGA.GAAA.AGAV.AG..RPAGA-----
D8J9Y2_HALJB/1-25-------.MNRRQYLKTG.GATG.LALG.TA..GCLGW-----
D8JCN5_HALJB/10-35-------SIGRRTFLKAT.GAAG.LLTG.VA..GCTGG-----
D8K216_DEHLB/7-32-------TLSRRDFMKAL.GVAG.AGLG.VG..MAVNP-----
D8K2J4_DEHLB/7-32-------TVSRRDFMKGL.GLAG.AGLG.AA..SVAGP-----
D8K350_DEHLB/4-29-------QVTRRDFLKAS.GGVA.GLFA.TA..GLFRG-----
D8P7G7_9BACT/2-27-------EIDRRNLMKGL.LAGG.ALLA.LG..TPSWT-----
D8PIW1_9BACT/14-39-------PLDRRQLLKGL.GVAG.SVMA.LG..GPGRL-----
E0SKD2_DICD3/16-41-------VFSRRQFLVGS.AALG.GAML.LP..GIMNC-----
E1QHR6_DESB2/6-31-------KINRRSFLKLA.GVAG.AAAA.LP..LASPA-----
E1QI68_DESB2/4-29-------RVSRRDFLKSG.LAAA.TVAA.SG..AALPR-----
E1QY59_OLSUV/4-29-------NLSRRQFMRGT.AALA.VTLG.LG..GCGGT-----
E1SM85_FERBD/3-25-------...RRQFLLAG.LVGT.AAVA.TG..VVLWP-----
E1SMW2_FERBD/2-27-------QLERRDFLKMS.AALG.AAAA.VT..GCSPE-----
E1SNU8_FERBD/4-28-------NLSRRHFLGSS.AALG.ALA..LT..GCQSN-----
E1SRD1_FERBD/5-30-------KLHRRQFLQGI.GVGT.AAVT.LA..ACSST-----
E1SV42_FERBD/37-62-------GISRRDFMKWS.AVTT.TALA.LP..MQFAP-----
E1V5E5_HALED/26-51-------HVSRRRVMQGG.LGMA.AMTV.LG..GFGLA-----
E3IZ75_FRASU/27-52-------SVNRRRFLQWG.GAVA.GAMA.LA..GPGGV-----
E4NKU9_HALBP/8-33-------DIDRRAFLKAA.GGAA.AAAT.LA..GCAAD-----
E4TIF3_CALNY/4-29-------KVTRRQFLKTA.GAAT.AAGA.AM..TIGAP-----
E4U153_SULKY/2-27-------QESRREFLKAS.AATA.AATA.VG..MVLPS-----
E6SEF0_INTC7/2-27-------AIDRRTMLRGS.AAVA.GAAA.LG..GPFQG-----
E6VZW1_DESAO/9-34-------AWSRRRFLRAG.AMTA.MAVA.LG..GCAKN-----
E6WME5_PANSA/3-28-------TFSRRHFIQAG.VGLG.AAAM.LT..PGFSA-----
E6WZJ9_NITSE/1-25-------.MQRRDFLKTL.SVAA.AASL.LG..SAGTL-----
E6X0K6_NITSE/2-27-------GMNRRDFLKSS.AAAA.AASA.VG..ITVPS-----
E6X374_NITSE/16-41-------DLSRRDFLKGG.AALP.LLAL.GA..SQSAS-----
E8RH92_DESPD/2-27-------AINRRDFLKFS.AGAG.LMLT.AA..PTRGQ-----
E8U9S8_DEIML/11-36-------PTSRRQFLRGL.GVAG.AGVA.LA..SCAPS-----
E8UXX1_TERSS/1-25-------.MDKRDFLKGS.AALA.ATMA.VA..GIADA-----
E8UYJ9_TERSS/16-41-------GQDRRSVLKAG.AGVV.AASF.LT..SNTAA-----
E8V6N5_TERSS/29-54-------VVSRRDFLRSA.TVVG.AVAA.TG..LSQSA-----
E8X0G7_GRATM/2-27-------EVSRRSFLVGS.AAVC.AATG.LH..APLLA-----
F0JBX6_DESDE/10-35-------TVSRRGFLKAL.GVGP.AGAL.VP..AAPVL-----
F0JDE1_DESDE/9-34-------RLSRRDFLKAG.AMTV.VGAG.VA..GCAKN-----
F0JJ42_DESDE/5-30-------ALNRRDFLKLG.ALAG.AAAA.IT..ALPVR-----
F0JK08_DESDE/2-27-------HTNRRNFLKLS.AVAA.TATA.FG..GLGFG-----
F0LRJ7_VIBFN/3-27-------NK.RRQFLKSG.LAVG.GVGA.FA..AGYAT-----
F0LYV3_VIBFN/8-33-------NMTRRDALKGG.SALG.ALAL.VG..GTISL-----
F0SJN1_RUBBR/7-32-------STSRRDFLSTL.AVAG.AATA.FT..GSSSL-----
F0SSR7_RUBBR/6-31-------SLSRRHMLRGS.AALG.AALF.TT..PGLFA-----
F2I1Z6_PELSM/8-34-------SVSRRSFLKGG.AATA.LGLSIVG..NLVLG-----
F2REW9_STRVP/3-28-------ETSRRHLLLGG.AAVS.AGAL.LT..ACTSN-----
F3Z0A3_DESAF/2-27-------NNSRRSFLKYA.GVAA.AAVA.AT..PVVRA-----
F4F141_VERMA/4-29-------HPNRRQLLTIG.AALA.AAGL.TV..GSTAP-----
F4F447_VERMA/3-28-------QHSRRRLLFGG.AAVG.AGVL.LA..GCTSN-----
F4FAY2_VERMA/3-28-------MMSRRTLLAAL.GAVG.AATL.TG..CEPAG-----
F4GNP9_PUSST/29-54-------AYSRRGFLKSG.LGLS.AALF.LS..GPISA-----
F4GT71_PUSST/2-27-------DIKRRDFVKGC.AAAS.ACIL.LP..GVASA-----
F4H9X7_GALAU/2-28-------DNKRRNLLKGG.LAVGGAAAF.VA..GYSPK-----
F7PNZ0_9EURY/6-31-------DYDRRQFLKAA.VATG.GVAA.LS..ACLDV-----
F7UU98_EEGSY/2-27-------DVSRRDLLKGG.AVLG.AGLA.VS..AGLAS-----
F7UV28_EEGSY/5-30-------ELTRRGFLTGA.AAAG.ALTA.FG..AMTGC-----
F7UW46_EEGSY/4-29-------TLTRRSFIKWG.TAAA.GATA.LV..GFTGC-----
F7UWS7_EEGSY/7-32-------NLDRRTFLKGG.IAVG.AGAA.AG..SLLAA-----
F7UXE4_EEGSY/2-27-------ELSRRSFLKSA.GLVG.AGAM.VA..GLAGC-----
F7UXF1_EEGSY/3-28-------SLSRRDLLKGA.AVGA.ASVS.TL..GILAA-----
F7UXP4_EEGSY/4-29-------SIDRRNFIKGA.LATG.ALAA.GG..AALAG-----
F7UXV7_EEGSY/3-28-------EISRRSFLQGA.GILG.AGAA.LA..GLVGC-----
F7UY57_EEGSY/2-27-------ELNRRDFLKGA.GAVG.ALGA.LG..TVGLV-----
F7UY82_EEGSY/3-28-------SMNRRDFLKGA.AVTG.GAAA.LM..GLAGC-----
F7UYS2_EEGSY/17-42-------GIDRRSFLKGT.AALG.AVAA.LG..TLAGC-----
F7UZP8_EEGSY/2-27-------EVTRRSFIKGS.LALG.ALTA.GG..AALSA-----
F7UZS5_EEGSY/2-27-------QLSRRSFLKGA.ASVG.IVGA.AA..GLAGC-----
F8BW31_OLICO/16-41-------VVHRRNFLAAG.AGLA.AATM.VG..NEAIA-----
F8D4C0_HALXS/14-39-------SVSRRTFVKAA.GAGG.ASVS.LA..GCIYG-----
F8D541_HALXS/27-52-------RIPRRDFMKAG.AAAG.AMGS.LA..GCTGL-----
F8D649_HALXS/22-47-------PITRRTVLKIT.GVAG.VTTA.LA..GCGGP-----
F8E2T7_CORRG/14-39-------LVSRRGFLKGA.AAVT.ATTA.AG..AVLAA-----
F8E622_FLESM/5-30-------LFDRRKFLKGM.AVTG.ATLG.VA..AIVKP-----
F8E623_FLESM/23-48-------NFDRRTFLKFS.TATA.ALAG.LS..TMPSV-----
F8ELR6_RUNSL/21-44-------GVHRRSFLKWA.GGTA.AATS.....LILTG-----
F8JB86_HYPSM/2-27-------DLSRRDILKAG.AAVS.AIAA.LP..SWPAR-----
F8JFW7_HYPSM/19-44-------SLNRRQILKGA.AALS.VMGA.TG..MPSRG-----
F8JG38_HYPSM/8-33-------EMSRRHVLAGS.AASA.AAVK.VA..GVATP-----
F9ZRR4_ACICS/4-29-------TIQRRQFIGTS.LVAG.AAVT.LA..GGALL-----
G0FM11_AMYMS/15-40-------VPSRRSFLRGL.AAVG.ALPL.TP..ALLAA-----
G0FQ95_AMYMS/5-30-------DFSRRTLLRAG.GVAA.AAGM.LP..GVAFA-----
G0FQE4_AMYMS/7-32-------PPSRRSFLKLG.GAVG.AGVA.LG..GLRPF-----
G0FRK5_AMYMS/4-29-------RFTRRQLIKGG.LAVA.AVPL.LP..AVASA-----
G0FSP1_AMYMS/6-31-------QVNRRRFLTAT.GVTA.AAAL.AA..GATQV-----
G2IRF7_9SPHN/6-31-------RFHRRHFLKFA.GGAA.ASSL.LM..PSAAL-----
G2MFU5_9ARCH/5-30-------NTSRRRFLKAT.GSAA.AAVG.LA..GCAGD-----
G2MI99_9ARCH/1-25-------.MKRRDFLRAT.GGSG.AAVA.LG..SGAAA-----
G2MIK7_9ARCH/1-26-------MVERRTFLKAA.SGVV.LGTF.LA..GCTAG-----
G2MIQ9_9ARCH/9-34-------DLDRRSFLKAS.ALAG.AVAL.GG..GGAGQ-----
G2MJ28_9ARCH/4-29-------DLSRRRFVRGL.GASG.LALT.LA..GCSSS-----
G2MM55_9ARCH/1-25-------.MDRRQVLKAG.GVAA.AAGI.TG..LAGCS-----
G2NMX8_STREK/5-30-------AHSRRTFLAGA.AAAG.AAAL.TS..GCVAS-----
G2PP00_MURRD/6-31-------MSKRRSFLKSA.TALG.AATL.LH..QTTWG-----
G4L0X3_OSCVS/5-30-------EISRRSFLKGS.AAAG.LSVA.AA..GLFSA-----
G8AYV2_AZOBR/1-25-------.MKRRQFFKGA.AVVA.GAST.LA..APAIA-----
G8MCY8_9BURK/3-28-------QMSRRQFLKVS.ASTL.AGSS.LA..AMGFS-----
G8MI05_9BURK/8-33-------AASRRNFIKAA.GAGT.AAAA.FG..AVSLT-----
G8PTH7_PSEUV/2-27-------SISRRSVLKGT.AAAS.AAAV.AA..PAILK-----
G8RH95_MYCRN/2-27-------LISRRDVLKGA.AAVP.AALA.VG..AGLQA-----
G8S5P0_ACTS5/3-26-------D..RRQVLRFG.AVAA.AAPA.LG..GAVAS-----
G8SD84_ACTS5/4-29-------DVSRRDLLRCA.AGVA.AVGA.LG..GCALG-----
G8TB93_NIAKG/1-26-------MYNRRNFLKAT.GALG.AGIL.IS..RSAFS-----
G8UJ43_TANFA/2-27-------SIDRRNFLKAS.LGSA.ALAT.MA..ACSGG-----
H0Q4M3_9RHOO/5-30-------KITRRTFLKAS.AGTT.AAAA.TA..PRLLH-----
H2J1A7_RAHAC/1-26-------MINRRNFLLGS.GAVS.AAAL.MG..LVPSL-----
H5WJY3_9BURK/6-31-------DNSRRQFVRAT.ASAG.ALAS.FG..APLIA-----
H6R1U8_NOCCG/6-31-------DLSRRQLLRIG.AAGT.ATVL.VG..AGVAS-----
H6RD94_NOCCG/2-27-------GLSRRQLLRFG.GVAS.AAAL.AG..SCAVS-----
I0GVN9_SELRL/2-26-------KFSRRDFLK...AMAM.SAAM.LA.TGCGTK-----
I0I6E3_CALAS/13-38-------EVNRRSFLRAT.AGLV.GAAA.LA..GCAPV-----
I3ZGD2_TERRK/9-34-------KLSRRGFLEFS.TAVA.AAAV.LP..SVAAA-----
I3ZME3_TERRK/2-27-------PLTRRNFLQLG.AAAT.AAAA.LP..LSFAD-----
I4C558_DESTA/5-30-------GIKRRDFMKMG.LLTA.AASA.LG..SGVMK-----
I4EW09_MODMB/9-34-------SLSRRTVLKGG.AAAA.AALA.LS..SFTPE-----
I4F085_MODMB/2-27-------SLSRRSFLAGA.VAAP.ALAA.LA..GCAGT-----
LYS25_MYCTU/2-27-------SVSRRDVLKFA.AATP.GVLG.LG..VVASS-----
I7BPQ5_NATSJ/49-74-------SPGRRTFIKTS.GVVA.ASAA.LA..GCAGD-----
I7CFX4_NATSJ/3-28-------KHTRRKVLKAS.AGTA.AASG.LT..GVASA-----
I7DZS0_PHAIB/9-34-------SPSRRQFLAGA.AAIG.AGAV.TG..RPAEA-----
J9SA21_9ACTN/3-28-------DLNRRNLIRAG.GAVG.AAGA.VA..ALSQT-----
K0C8M5_ALCDB/3-28-------TIKRRDFLKGS.AALA.GAGM.LS..GLSVP-----
K4L5L2_9FIRM/3-28-------EINRRNFLKAS.MLGA.AAAA.VA..SASVV-----
K7RKS4_PROA4/3-28-------PATRRQFLRGL.GAVT.ALGA.LG..GLQGC-----
L0AF89_NATGS/11-36-------DLTRRSVLQTA.GAAA.VATS.LG..GCLSG-----
L0AFI8_NATGS/19-44-------ELERRSFLKAT.GGAA.GALA.LA..GCVGE-----
L0AFL1_NATGS/1-25-------.MDRRTLLKGT.AVAT.ALTL.AG..CTENG-----
L0AHM5_NATGS/21-46-------PISRRTALKIT.GGAA.ATAL.VA..GCNGN-----
L0D548_SINAD/6-31-------QPSRRSFLKSA.AVAS.AAPA.VA..TTKLS-----
L0DM21_SINAD/1-26-------MIDRRSFLKGT.GATI.AAAT.MG..VPALA-----
L0DMS4_SINAD/5-30-------SPSRREFLQTG.AAGV.AAAA.LS..GAAAP-----
L0DQ06_SINAD/14-39-------GPSRRDFLRGS.GLAA.ASAV.LT..AQATT-----
L0DVG7_THIND/2-27-------TVSRRNFLKAG.IAAS.TASM.AG..LSLGP-----
L0F1Y7_DESDL/7-32-------KLSRRQFLKGT.AATG.AMVG.TM..GAVGF-----
L0F5P9_DESDL/13-38-------GVSRRTFIKGT.GAVA.AAAA.VG..GIGIT-----
L0F638_DESDL/6-31-------NVSRRNFVKGG.LATA.VAAA.AV..GIGLV-----
L0FCG2_DESDL/163-186-------KLSRRTFLK...ASAV.TAAA.TG..AIAAN-----
L0I690_HALRX/6-31-------DVSRRTALKLT.GAAA.AATT.LA..GCGSS-----
L0I6J5_HALRX/4-29-------ATNRRTVLKAT.GASL.AAVT.LA..GCGSS-----
L0IEI3_HALRX/26-51-------EITRRTLLKTG.AAAG.AAMG.MG..AIPSQ-----
L0IZA3_MYCSM/2-27-------AISRRDVLKYA.AAAP.AVLG.LG..AGLQA-----
L0JWA8_9EURY/18-43-------SISRRSLLASG.AAVG.ATTA.LG..GCLSS-----
M1PD90_DESSD/4-30-------LFSRRNFLKGGLATTA.AAAV.LK..NKETK-----
M1WPH7_DESPC/11-36-------KYSRRQMLKLA.GAAT.MLGA.LG..PIALA-----
M1XQY1_NATM8/4-29-------KIDRRDVLKGA.GVTG.LAAL.AG..CTGNG-----
M1XTF6_NATM8/4-29-------RPSRRNVLKGL.GAAT.ALTV.AG..CTDST-----
M5DMI1_9GAMM/3-28-------KINRRNFLKSS.AAAG.VVAS.AA..TASPM-----
M9X4V4_MEIRD/27-52-------EMDRRTFLKTT.AAVG.AAGL.MG..SSFAQ-----
N0AR99_9BACI/15-40-------KFSRRDMLKTA.GVGG.VGAL.LG..ASGLE-----
PSRA_WOLSU/4-29-------TMTRRDFLKSA.GAAG.AAGL.VW..SQTIP-----
EFEN_BACSU/10-35-------QIHRRDILKWG.AMAG.AAVA.IG..ASGLG-----
P74431_SYNY3/5-30-------CYSRRHFLQSA.AAVG.LATG.LG..GCWPG-----
Q02A50_SOLUE/3-28-------NCSRRNFLKAS.LAAG.VLAG.TG..GLPLR-----
Q082H0_SHEFN/3-28-------ELNRRHFLKGA.GASG.ATCA.LA..SMLPG-----
Q0A5X1_ALKEH/7-32-------KLNRRRFLQAS.GAAG.AAGV.AG..LNAIP-----
Q0AVN1_SYNWW/9-34-------GITRRQFFKGA.GMLT.MAAV.IS..GVFAK-----
Q0KEL7_CUPNH/1-24-------MISRRQFLA...AALA.APAL.PG..MPARA-----
Q0VTK9_ALCBS/4-29-------EINRRGFLKLS.AAGS.AVLA.TG..SGLAL-----
Q11EZ0_CHESB/2-27-------QMNRRDILKST.AGIG.AAAM.MG..LTPRG-----
Q122Y5_POLSJ/24-49-------GLSRRDFLRFS.GAGA.AAAL.AG..GASFA-----
Q12JZ7_SHEDO/26-51-------QLSRRNFVKSG.LGLS.AMTA.FA..GAGLV-----
Q15SL6_PSEA6/17-42-------AFSRRQVLKGG.SVAA.ASTA.FM..ALSSK-----
Q161T0_ROSDO/14-39-------MLSRRNFFKAS.AMTG.AAAA.LG..GVVAT-----
Q161Y3_ROSDO/14-39-------KLNRRQMLKGT.AAVG.AMAM.MP..KGAAM-----
Q163P9_ROSDO/11-36-------TMNRRSTLKAA.LAVT.ALTT.IS..ACATL-----
Q18HF0_HALWD/4-29-------NIDRRTFLTTA.GSAA.AAAT.LA..GCSGS-----
Q18K43_HALWD/6-31-------EVNRRRFLRAT.GAVA.ATVG.VA..GCSQG-----
Q1AV94_RUBXD/5-30-------GISRRDFLKIG.GAGA.AGAA.LL..GLAGC-----
Q1D1D7_MYXXD/2-27-------TTTRRDLLKFG.ALAA.ASAA.LP..GWAKP-----
Q1ITZ0_KORVE/7-32-------DVSRRTFLKFG.AAGT.TLAA.LT..PTAVA-----
Q1QIE9_NITHX/16-41-------VVHRRNFLTVG.AGLA.AVTL.AG..GETVA-----
Q1R007_CHRSD/26-51-------HVSRRDIMRGG.LSLA.ALGM.LG..GIGGL-----
Q1R069_CHRSD/22-47-------SPSRRHFLKTA.GASG.LAVA.AA..PALSS-----
Q21CR9_RHOPB/27-52-------EPSRRRFIAGG.ASLG.ALTL.LT..GCDVS-----
Q24R29_DESHY/3-28-------NISRRNFIKGG.VAGT.ATLG.LS..GSLLF-----
Q24R33_DESHY/9-34-------GFSRRSFLKGS.TALG.LSMG.LF..GLTAC-----
Q24Y63_DESHY/12-37-------KISRRNFLKAT.AAGT.ASLA.LA..GCGSG-----
Q24Z51_DESHY/4-29-------EISRRGFLKGA.AGAV.GAIA.VT..GLAGC-----
Q2IEH6_ANADE/8-33-------EIGRRSFLLSA.GVLA.AAPL.LG..GAAAQ-----
Q2IN74_ANADE/2-27-------TISRRDLLKGA.VAAG.AAVA.IP..ATAEA-----
Q2IPE7_ANADE/2-27-------PLTRRDFLKAS.AAAS.ALAG.LG..LPVDA-----
Q2JHC9_SYNJB/4-29-------SFNRRQVLKMG.ALAG.AGAA.LG..PQIWV-----
Q2JK59_SYNJB/33-58-------RLQRRQVLQGG.IAAA.VATF.FG..LPALN-----
Q2K0A7_RHIEC/6-31-------SMKRRHFLRAS.AAAT.LVGA.AP..GLLSS-----
Q2K6V5_RHIEC/9-34-------STTRRSFLKGA.GVVS.AAVV.TG..SFPMP-----
Q2LXY3_SYNAS/13-38-------QLSRRSFMKGL.IVAG.LAGL.DV..MLLAQ-----
Q2RH81_MOOTA/29-54-------KLSRRQFLKAS.AATA.VLAG.TA..GATRY-----
Q2RLA8_MOOTA/5-30-------KITRRTFLKGS.LAAG.ALAT.FG..GKLIP-----
Q2YAJ8_NITMU/9-34-------TMSRRTFLKAA.AATT.AAIG.AS..ALPFG-----
Q314N2_DESAG/2-27-------HISRRSFIKAT.AASG.IAAA.FG..GLGLS-----
Q31EQ5_THICR/3-28-------KQSRRDFLKLA.SATT.AATL.TG..SALAS-----
Q31I24_THICR/3-25-------...RRSFLKGT.LATG.AAAV.AV..NAGLL-----
Q39SV3_GEOMG/2-27-------NINRRDFLKLA.GAGG.LALA.LP..GCAGN-----
Q3A7K4_PELCD/1-25-------.MNRRQFLKTG.LAAT.AGIL.MP..WPAMA-----
Q3A917_CARHZ/2-27-------KLTRRSFLKAS.AATG.ALAA.LS..GGVMS-----
Q3INA4_NATPD/2-27-------NPSRRTVLKSG.VGVA.AAAA.LA..GCNGN-----
Q3INZ1_NATPD/4-28-------HINRRNVLKAA.GAAS..MVA.LA..GCNGN-----
Q3IP77_NATPD/2-27-------ELSRRDALRAG.GGLL.AAAA.LS..GCVEE-----
Q3IRF4_NATPD/4-28-------QVSRRRLLQ.A.GGVG.AAAS.FA..GCGYM-----
Q3IUK2_NATPD/6-31-------NLDRRNVLKAA.GGTA.VAAA.LA..GCSVL-----
Q3IWZ3_RHOS4/5-30-------HYSRRTLLKGA.AAAG.LASA.FP..APMIW-----
Q3JEL9_NITOC/6-31-------NLSRRQFLKTT.GAVA.MASS.VA..GFSDV-----
Q3Z693_DEHM1/7-32-------IVSRRDFMKAL.GLAG.AGVG.TT..AAVAP-----
Q3Z6A6_DEHM1/7-32-------MVSRRDFMKGL.GMAG.AGIG.AV..AASAP-----
Q3Z6B6_DEHM1/7-32-------TLSRRDFMKSL.GVVG.AGLG.TI..SAAAP-----
Q3Z7B4_DEHM1/3-28-------EVNRRDFLKAA.GVGA.AGLG.VA..AAGSY-----
Q3Z847_DEHM1/7-32-------TVSRRDFMKGL.GLVG.AGLG.TA..TATAP-----
Q3ZA28_DEHM1/7-32-------AVTRRDFMKGL.GLAG.AGIG.TA..AAVSP-----
Q47BB4_DECAR/3-28-------LMKRRDFLKVG.AAAG.AMAS.LY..GCAGG-----
Q47F22_DECAR/2-27-------TFNRRQFLAAG.AALG.ATTA.IA..QPTSP-----
Q4FUY8_PSYA2/33-58-------RLNRRSILKGG.TGLT.AAAF.FG..ALPLV-----
Q4JY48_CORJK/16-41-------QFTRRQVLQTS.AAGA.AAVG.IG..AVAAN-----
Q5F6W2_NEIG1/2-27-------DMKRRDFLKMT.AALA.AAGV.SP..SLLAA-----
Q5LDH1_BACFN/2-27-------DISRRGFLKTA.ALAG.AAMA.MP..SGLGK-----
Q5LT02_RUEPO/1-25-------.MDRRQFLKAA.LAGG.TAAT.MV..SPPQA-----
Q5LVE1_RUEPO/14-39-------MLSRRDLFRTG.AVVA.AGAA.LG..SVAAP-----
Q5NX34_AROAE/1-26-------MMNRRDFLLFA.ASAA.VATA.LP..LPAQA-----
Q5P0M6_AROAE/4-29-------EVSRRQFLLSS.AAVA.AGLA.LP..SAPLF-----
Q5QVI8_IDILO/3-28-------QFNRRDFLKLF.AATG.AAVT.VS..TALQG-----
Q5SIF7_THET8/3-28-------KVKRRDLLKAG.AALA.AAGT.LG..KGFAQ-----
Q5UWE5_HALMA/11-36-------HLSRRTLLKTG.AAVT.GMTG.IG..AVETE-----
Q5UXL1_HALMA/6-31-------SMERRSFLKAT.GSAA.AAAA.LA..GCSSD-----
Q5V4M3_HALMA/4-29-------DLDRRTFIRTT.AAVS.GAGL.LA..GCGGS-----
Q5V4X2_HALMA/48-73-------SLGRRDFMKAG.VAAG.AMGS.VA..GCSAL-----
Q5V5G3_HALMA/11-36-------QASRRTFLKAT.GVAT.AAAA.TG..AGVGT-----
Q65K97_BACLD/3-28-------NPSRRQFLKGF.LGLA.AAGL.FT..AAGGL-----
Q67LX9_SYMTH/4-29-------EISRRSFLKWS.AVVG.AGAA.LG..GAAAL-----
NAPA_SYMTH/2-27-------KFTRRSFVKAS.ALAT.AMVA.AG..CSPQP-----
Q67T99_SYMTH/3-28-------ELSRRDFLKLG.GVAA.GALA.VG..LPQRP-----
Q6LHL3_PHOPR/17-41-------KLSRRHFLKGS.AALS.ATTA.AA..T.LPS-----
Q6MNS7_BDEBA/6-31-------NLTRRGFIAGG.AVAG.AAAL.VA..TPYER-----
Q6N9R5_RHOPA/17-42-------HMKRRDFLKSA.TALA.AGAM.VP..APAIW-----
Q6NGW1_CORDI/1-25-------.MSRRGFLTGT.AGVA.AAGA.LS..ACTEP-----
Q6NJ97_CORDI/6-31-------RYSRRDFFKIS.GAVG.LAAG.FA..ATLSA-----
Q73XH5_MYCPA/3-28-------SVSRRDLLKFA.AAAP.ALLG.LG..VAGST-----
Q74F32_GEOSL/2-27-------GISRRQFLQGG.ALAG.AALA.LS..GTPGE-----
Q7CGY2_YERPE/14-39-------PNSRRSVLKAA.LGMT.AAGV.IG..GIGLG-----
Q7CRW6_AGRFC/35-60-------QLSRRSLLKTS.LALA.ATTG.LA..GIAAA-----
Q7MZ75_PHOLL/11-36-------SSSRRNFLKSS.AVIT.ATAA.LA..PMNLA-----
Q7N4K6_PHOLL/1-26-------MFSRRDILKAS.AIGA.AAAS.MG..GMIKT-----
Q7ND06_GLOVI/3-28-------EYSRRELLKFL.GVTG.GAAL.LG..SMIPG-----
Q7NN53_GLOVI/4-29-------VMQRRDFLEFL.AAAG.AATL.LP..APAEA-----
Q7NV55_CHRVO/3-26-------S..RRQFLKAG.ALGS.AALL.LA..GYWAA-----
Q7UGD1_RHOBA/28-53-------PNSRRDFLKTV.GVAS.AATL.TP..WALPA-----
Q7VJL3_HELHP/8-33-------NQTRRKFLKTA.GVGG.AVVA.IG..SLSLT-----
NAPA_HELHP/11-36-------TLSRRDFIKSA.AAAS.AAAS.VG..LSIPS-----
Q7VK36_HELHP/41-66-------GFSRRDFMKWS.GMMT.AALA.LP..ATFAP-----
Q82BT5_STRAW/2-27-------NINRRQVLLAG.GAMG.ASAL.LA..ACSGG-----
Q82BU3_STRAW/10-35-------ALHRRSFLKYS.GALG.AAAA.LS..SSLAA-----
Q882H4_PSESM/18-43-------QPSRRNFLKFG.ASGI.AAAT.LS..TWIPS-----
Q88GT2_PSEPK/9-34-------SSSRRDFLKLG.AMLT.AAGA.LP..LLSSL-----
Q89KW2_BRADU/3-28-------DLNRRHLLAGA.AAVG.AAAV.TG..LGPIT-----
Q89MJ0_BRADU/1-25-------.MKRRTFLQGG.AVAG.ATTL.VA..APAIA-----
Q89NU1_BRADU/19-45-------KMKRRDFLKVS.AAGA.AATAAVA..SPAIA-----
GH109_SHEON/3-28-------NIHRRHFLKAA.GAVT.AGLV.TA..NIALN-----
Q8FR53_COREF/13-38-------PINRRTFLKVT.GVAA.AAGA.AG..ILVAP-----
Q8FSR2_COREF/4-29-------TINRRQFLQGL.TLAG.AAGV.LA..ACGQP-----
AIOB_HERAR/4-29-------QTSRRNFLKIA.GSSA.AVAG.AG..LVSGN-----
Q8NND9_CORGL/7-32-------QLSRRQFLQTT.AVTA.GLAT.FA..GTPAR-----
Q8NQP1_CORGL/3-28-------QISRRHFLAAA.TVAG.AGAT.LA..ACAGT-----
Q8P7J7_XANCP/5-30-------DPARRQVLKGS.AAVM.AAGA.LG..SLSAL-----
NAPA_YERPE/2-27-------KLSRRDFMKAN.AAVA.AAAA.AG..MTIPT-----
Q92YP3_RHIME/3-28-------NLTRRQFLRYS.GATG.VALG.TG..SLASF-----
Q9HMW9_HALSA/43-68-------NTSRRRFLKAT.GAAA.LTAT.VA..GCSDS-----
Q9YG40_AERPE/2-27-------SMNRRDFLKLA.GAAG.AGLV.VG..GLGGY-----
R4JXY6_CLOPA/2-27-------KISRRDFLKWS.AATA.VALN.LE..LDMGK-----
R4T3U2_AMYOR/4-29-------RFSRRWLLKGG.LVVA.ASPL.LA..PTASA-----
R4W979_9EURY/6-31-------DIRRRSFIKAA.GGGV.ALTG.LA..GCLDR-----
R5EJQ2_9BURK/7-32-------FFSRRNILKGS.AASL.AAAA.LG..SSSAA-----
R5GKC3_9BACT/8-34-------QISRRDFLKTA.GVAGVAAAG.LV..ACTGK-----
R5I2G7_9BACT/6-31-------KVSRRDFLKIT.GAAG.AATI.LT..AGCAS-----
R5ME60_9MOLU/4-29-------KISRRDFLKGA.GVVA.AGVA.LS..NVELK-----
R5RRP7_9BACE/2-27-------NIDRRDFIKTA.GAGA.LAVG.VA..SLTGC-----
R6PXQ8_9FIRM/9-34-------SISRRSFLKAS.GVVG.AASI.LA..ACGGS-----
R6Q079_9FIRM/9-34-------KLDRRSFLKGA.GVIG.AAGL.LS..ACGGS-----
R6Q1G5_9FIRM/4-29-------ELTRRSFLKLA.GAGA.LAVA.MS..GSLTG-----
R6Q292_9FIRM/4-29-------TFSRRSFLKYT.AVAA.VAVA.GS..SMFTG-----
R6Q615_9FIRM/2-27-------KISRRQFVQVL.AVAG.ASAL.LT..ACGGS-----
R6Q9W4_9FIRM/5-30-------KFSRRSFLKSG.AVAA.AAAS.LP..GFSLP-----
R6QGA4_9FIRM/4-29-------EFSRRDFLKGM.AVVT.ASGL.LV..ACGGG-----
R6VCV9_9BACT/4-30-------EMSRRSFLKTG.AAAA.LGLAVVP..STVLG-----
R6X1V5_9BACT/4-29-------EMSRRSFLKTG.TAVA.AGIA.VA..PNIII-----
R6Y2L7_9PORP/1-26-------MITRRDFLKVT.AAGG.ALAS.LG..SVTEA-----
R7BXB3_9BURK/3-28-------GMNRRSLIQGS.LALG.AAGF.IG..AAEAS-----
R7INW9_9BURK/5-30-------ETSRRNLLKAG.TAAA.AAVA.AA..PLAAQ-----
R7J8I8_9PORP/1-26-------MMNRRNFLKAS.LAGG.AVTA.LN..QIPVQ-----
S0EZA0_CHTCT/5-30-------EMSRRKFLQAT.GGAV.AATA.LG..AATEA-----
S5Y465_PARAH/4-29-------DLSRRSFLKLA.GAGV.AATS.LG..AMGFG-----
S6AJ73_9PROT/1-25-------.MKRREFLKGA.LAGG.ALLA.TS..SPAEA-----
S6AWG2_PSERE/11-36-------GLSRRDFLRAS.GVVA.GGSL.LA..GFSSG-----
S6BXW9_9ACTN/10-35-------GLTRRNFLKST.GVAA.AAVA.AG..GAGAF-----
S6C0Y3_9ACTN/3-28-------EVSRRSFLKGS.ALAA.AGAA.GA..AALAG-----
S6C1N4_9ACTN/4-29-------DVSRRSFLKGA.GLAA.AATA.AV..GISGC-----
S6C3M3_9ACTN/4-29-------NPTRRTFLKGT.AATA.ALAA.VG..TCSVA-----
S6C7R1_9ACTN/21-46-------HLTRRSFIKAT.TAAT.ALAA.AS..SLTAC-----
S6C7U9_9ACTN/22-47-------GLTRRSFLKWT.GAAA.TVPA.LG..QLVAC-----
S6CDN0_9ACTN/13-38-------GLSRRSFIKGA.AATA.ALGT.LA..GCAPQ-----
S6CFK7_9ACTN/4-29-------ELSRRSFIRGG.AAAV.AATA.VG..AAGVL-----
T0MVM0_9EURY/6-31-------DVSRRNFLKTL.VGLS.AVAA.VG..GLGKA-----
U3TSR5_9ENTR/64-89-------NMQRRHFLKLT.AALS.AAGA.LP..FWSRS-----
U5T3P9_9GAMM/2-27-------SIKRRDFLKAG.AGVA.AGSG.II..GAPMV-----
U5T4J4_9GAMM/24-49-------GVSRRDFLRGA.AGAA.GLTA.IG..GLVSP-----
U5VSY9_9ACTN/3-28-------DMSRRRILFGG.AALG.AGAL.LT..ACTSN-----
U5W9X1_9ACTN/6-31-------SISRRNLLFGA.AGVA.AAGL.LA..ACGDS-----
V4IGW4_9DELT/9-34-------EYSRRLFLKTS.TALL.AGGV.LG..SVTAN-----
V5UIQ4_9BURK/3-28-------NMSRRQFLKVS.GATL.AGSS.LA..MLGFA-----
V6F1Z5_9PROT/2-27-------SVNRRDFIKGA.AGGG.AALA.TA..AVVSV-----
V6KIX4_STRNV/5-30-------PPGRRQFLAGT.GAVG.AAAL.LS..GCVTS-----
W0EZL3_9SPHI/2-27-------NYNRRNFLKSS.SAAA.AAGL.FF..PYGES-----
W0JVM8_9EURY/53-78-------ELNRRDFVKAG.VATG.AMAG.LA..GCSGD-----
W0JY22_9EURY/11-36-------PSSRRQFIKTG.AVVS.AAGI.TG..LAGCT-----
W0K0F7_9EURY/1-25-------.MRRRTFIKTG.GAAT.LAGL.LA..GCASP-----
W0K6I7_9EURY/1-25-------.MDRRNFLKAA.GAAG.AAGL.TA..GCLGQ-----
W0PEW0_9BURK/10-35-------RLARRDFIKGG.LAVT.AVIG.TG..TASAQ-----
W0RCZ1_9BACT/15-40-------NVSRRRVLKVL.ALTP.AAAA.LG..AQQPA-----
W5TAK3_9NOCA/41-66-------PVSRRNFLRGS.AAAA.AVAA.VG..TTPFG-----
W5W606_9PSEU/4-29-------HLSRRGLLRGA.AALG.AVGV.AG..AVAVQ-----
A0A068NJU4_9BACT/5-30-------SISRRHLIRAG.TALG.AASA.FG..LGIAE-----
W5Y3W3_9CORY/2-27-------NVTRRQFLLGG.LGIA.GGVT.LA..ACGGQ-----
W6RPE6_9RHIZ/1-26-------MISRRELLKAA.AALS.AMAG.LP..KIAFA-----
W8KMQ7_HALHR/4-29-------RFSRRNFLRAL.GAGG.AATA.LA..ACGTM-----
W8RUD9_9RHOB/14-39-------MLSRRNFFKGG.AAVA.AGAA.AG..GGLVA-----
W8X901_CASDE/12-37-------AHSRRSFLRSS.LAAA.LAVA.AG..GALPG-----
X5DCG6_9BACT/2-27-------KTNRRDFFKVT.GAVG.AGIA.AG..GLTSC-----
X5DHD8_9BACT/2-27-------KTNRRNFLRTT.AAAT.AGTM.LV..SPAFA-----
X5E4R1_9BACT/8-33-------PVTRRDFIKVS.AATT.AAVS.AM..SFGAC-----

PF08802

UCRI_SYNP2/9-46---D.VPDLGRRQFLNLLWVGTA-AGTALGGLYPVIKYFIPPS
UCRIC_NOSS1/9-45---S..PSLSRRQLLNFITGATV-AVTAGAALYPAGKFLIAPA
UCRI_THEEB/9-46---D.VPDMGRRQFMNLLTFGTI-TGTALGALYPVVKYFIPPA
UCRI_GLOVI/7-44---QEIP.MSRRQLLSFVTGGAI-AATTAATLYPVVLYFLPPS
UCRIA_SOLTU/59-97---DRVPDMEKRNLMNLLLLGAL-ALPTGGMLVPYATFFAPPG
UCRIA_ORYSJ/54-92---DRVPDMGKRQLMNLLLLGAI-SLPTVGMLVPYGAFFIPAG
A4RS90_OSTLU/44-81---D.VPDMTKRSVMNLLLVGAI-GLPATSLIGGYAYFFVPPS
B3EMF9_CHLPB/39-76---DGV.DFERRSFLGKAVVGVG-AVVAASTLYPVVNYIIPPP
A8J9Y1_CHLRE/34-72---SEVPDMNKRNIMNLILAGGA-GLPITTLALGYGAFFVPPS
UCRIB_NOSS1/10-45---...PSMSRRQLLNFFTGAIV-ATTASAAIYPATKFFMPPA

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window