Sequence alignment for CL0301

PF10528

A7EUJ3_SCLS1/778-898-------------------------------------------------------------QLAIVHTGYVYARKA.GTY
A6S3P8_BOTFB/439-550-------------------------------------------------------------YLVIDNRGYLFAQMT.GTY
A1DK36_NEOFI/304-416-------------------------------------------------------------WVCIVIQGYLWAKEGPGNY
YI48_SCHPO/278-394-------------------------------------------------------------CKVIVYQFFLRIPET.DTY
FTA5_SCHPO/254-364-------------------------------------------------------------CKTIVYQFFFRVPAT.DNW
YKL1_SCHPO/1093-1204-------------------------------------------------------------CKAIVYQFFFRVPYT.DTY
YQ39_SCHPO/481-593-------------------------------------------------------------CKVIVYQFFFRVPVT.DTF
Q6FNG2_CANGA/139-259-------------------------------------------------------------NFTMILYGYFMPKTT.AFH

PF07691

Q8IKW0_PLAF7/216-383KADGL.MASYYNNAYFSGYPTA................IHNDKYINFIWDTGIPIENIPYQHFSIRWDGYLKIPES-DNY
Q7SG54_NEUCR/435-585GKPGV.TIEWFKGDKFKGEPV.................VIQRRTNTDLFLWDSAPLAQTGPEWSAIATTYLTPKHS-GKH
BGLS_SCHPO/398-544GKHGYVAKFYLEPATSENRTLI................DDYDLEDGVVRFYDYCNDKMKDGYFYIDIEGYLIPDED-AVY
FLO1_YEAST/100-249DSYG.NWGCKGMG.........................ACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQT-GSY
Q87YU8_PSESM/308-470SNSGV.KAEYYANTTLSGDPVANRIEPG....VNLDWT..TNTNVTDNGSTAVSGYTPAAGSFSARFTGKIKPTIT-GAH
Q9ZGH5_9ACTO/429-559AGAGA.TVTYETGEET......................FGTQIPAGNLSPAFNQGHQLEPGKAGALYDGTLTVPAD-GEY
PAG_BACAN/44-179SSQGL.LGYYFSDLNFQAPMVV...............TSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKS-DEY
FLO10_YEAST/121-271DNTTLSSKTEKRE.........................NDDCDQGAAYWSSDLFGFYTTPTNVTVEMTGYFLPPKT-GTY
Q880I7_PSESM/435-593SNSGV.KAEYFSNTSFSGDPALTRVEPG....VNLNWA..TGTNVTNAGSTAVSGFSPSAGAFSARFTATIKPTVS-GAQ
PSIA_DICDI/117-261LRTASGNYIYDNDFFFPIDYEG................FDTDPANRIYKDDESTNKTYHNYHFCFQFDNRFLF..K-GNE
Q9PF33_XYLFA/452-607GHPGL.KGEYFDTIDFAGPPHL................VRQDRIIAFNWDHVAPAPGMNPHRYAVRWTGELLPPGP-GTY
Q8P3G5_XANCP/475-625SQNGL.TGDYFRGRALAGQPVLTRIDPR....IAFRWDRNAPTDDAVGRGELQPGQALGKDDFSVRWHGQLLPPVS-GNY
Q8PLM2_XANAC/307-446KAGALTARYAINGKHILERRES...............EVNYQYLSDLTKYPKKAITKDKNSRMQVTWEGEIEALTG-GEH
Q82PE8_STRAW/53-196EAHGL.KGEYYTQSAPGAFDFAELKATGFDPGLDFDSL...........ESRLSAATGRADDVSVRWTGEVVPEKS-GPT
HEXA_PORGI/626-766PKPGL..TIRTAYGDLYDVPDLQQVA........SWEVGTVSSLEEIMHGKEKITSPEVLERRVVEATGYVLIPED-GVY
Q8A3K6_BACTN/262-401WVNGL.KGIYTQDSKGVGHLRS................EKIDPVIDFDWDWYKPADDFSFNDYQVTWSGKLKAPST-GEY
Q8A341_BACTN/847-985GKSVL.ELSLYKDDDLRTLAGV...............TQDNKIDRTFADGAQPDPLLPANQSFSAIWDGKLKAPQS-GTY
Q8CK54_STRCO/42-184QEPGVTLRVFDVQTPLNELCTLKP...........GQTPNHDKLMPTVDWSTTADFGGIADNFVSQASGYLVAPRD-GTY
Q7UKT3_RHOBA/181-327SKHGLSVSIYEGKGWKKENRKI................ERVDSVVDFDFGKEGPGEGVPWDEFHAHWDGGLRVEQT-GRY
Q7URI2_RHOBA/387-524LEPGLDYRMYLGKFKKLPEFET................MEVERTGQVDSLNLEEIQGDQRDDFALSINAMFRVPEE-GLY
O68843_STRAT/370-503AGAGS.TVRYSTGEETV.....................GVPVPQSAPLPRPRPSGEVFPAGGGGVLYDGTITVPVT-GSY
Q7Z9M4_HYPJE/396-546GAPGMRWRVFNEPPGTPNRQHIDELFFTKTDMHLVDYY.................HPKAADTWYADMEGTYTADED-CTY
Q8AAF9_BACTN/630-763LNSGLKAVWHKFRGNLCAD...................IDAAPVNGEYVVESVSIPEEVKGDIGLIITGYLEVPAD-GIY
Q8N9V0_HUMAN/31-179DWCGSSIQQLRRN.........................LHFPLYPHIRTTLRKLAVSPKWTNYGLRIFGYLHPFTD-GKI
Q83X74_STRRO/410-541LGRGA.QVSYAEGEDV......................EGEPIPAAAFEPPFSGGTVLQPARSGVVYDGRLTVDKA-GLY
PSIF_DICDI/104-263QTAGSQNYYSYSNTSFFPLNELGWYNPSIKGDYEFKKYQDSN...............KKEQNFHFCMHASFIMSTN-CKE
Q8A3E5_BACTN/456-595GRPGL.TATYWNNMNLSGDVAAT..............SQITSPINLSNGGNTVFATGVGLYNFTAVYEGTFRPKES-GAY
Q7RP37_PLAYO/216-383KADGL.TGSYYDNAYFSGYPLS................INNDKYINFIWDSGVPIEMIPYQHFSVRWDGYIKIPQT-DNY
Q7ULK4_RHOBA/523-652TRTVY.HGSWKQLPKF......................DSLKPVSKDQVSGLKFDDLKRRNNFGVVYETDLHVNAD-TKL
Q9RIU6_STRCO/39-182EIHGL.KGEYYTQSAPGAFDFHELKATGFDPQVDFNSL...........EPRLAFATGQSDDVSVRWTGKLVPEET-GAH
Q7UF11_RHOBA/396-557LRSGVLVETFEPVAPSPPLSSIAEL.........RDDETFVANTPSTASDISSFSYSAAPGAKVSRIRGIVSPPVS-GHY
Q9XBE0_AMYOR/30-171QEPGVTMRVFDVQVPLNDYCKLKP...........GQTPNVDKLMPAIDWSSNADFGIA.DRFVTEVSAYLHVSTA-GTY
O86171_CLOBO/19-153TINGL.MGYYFENDFFNLNII.................SPTLDGNLTFSKEDINSILGNKIIKSARWIGLIKPSIT-GEY
Q84FS9_BACFO/634-770VTDGMFLRYRIKFGECYRVDSIE..............LIKSHPEVTKVVKSRRISCAELKHSMPPYAEGYVDIAKA-GVY

PF10528

A7EUJ3_SCLS1/778-898TFNI.TS------FDDIVMGW------IGS.NAFGSY---SSS.......NADLNAASS.......DTHNAVTTVSKTLT
A6S3P8_BOTFB/439-550TFST.TS------ADDIFFLW------VGA.NAYSGW---TRA.......NANLIA..........TLTYPSQKFTINLV
A1DK36_NEOFI/304-416TLSSGAN------TDNAFYAW------HGT.KAYNDY---QKN.......NYDYLAG.........NYIKQAGSVTVQVG
YI48_SCHPO/278-394TLVV.NN------VDDVFFGW------FGD.KAISGW---SNN.......NFDAYSYWHESPNMGLGTVGMGNFTVGNYP
FTA5_SCHPO/254-364SLFV.KN------VDDAFFGW------FGD.KAISGW---SNV.......NYDAYAHWRI......GAYGMGTFDLGYLE
YKL1_SCHPO/1093-1204ELNV.YN------VDDVFYGW------FGD.KAISGW---SNT.......NYDAYAYWHVTT....GQTGMGSFSMGTLT
YQ39_SCHPO/481-593SLDV.TN------VDDVFYGW------FGD.KAISGW---SNT.......NYDTYAYWHATN....GQTGIASFSMGSLT
Q6FNG2_CANGA/139-259TFYV..T------ADDLLFMN------FGAGNAFDCC---RREETADKFGNYAAYSVW........GKKSLKNELTVYLH

PF07691

Q8IKW0_PLAF7/216-383IF..SVD......HDCGIRIF......LDNSPIIVDNMPFPKEEESEEIRPISIQSFDKMN-----SKVHKTNSEKLGLI
Q7SG54_NEUCR/435-585TI..SYM......SVGPGKLY......INGKLSLDLW...DWTE............EGEAM-----FDGSVDYLVELEMV
BGLS_SCHPO/398-544EF..GIS......VFGTALLF......IDDVLLIDNK...TKQTP...........TNHTF-----EFGTIEERNSIYLK
FLO1_YEAST/100-249TF..KFA.....TVDDSAILS......VGGATAFNCC...AQQQPPITSTNFTIDGIKPWG-----GSLPPNIEGTVYMY
Q87YU8_PSESM/308-470VF..KVR......ADGAYKLW......INDELVLEDE...GAQV.............SFDL-----IPVIPRTVKTPTLK
Q9ZGH5_9ACTO/429-559RI..AVR......ATGGYATV......QLGSHTIEAG...QVYG.................-----.....KVSSPLLKL
PAG_BACAN/44-179TF..ATS......ADNHVTMW......VDDQEVINKA........................-----.....SNSNKIRLE
FLO10_YEAST/121-271TF..GFA.....TVDDSAILS......VGGNVAFECC...KQEQPPITSTDFTINGIKPWN-----ADAPTDIKGSTYMY
Q880I7_PSESM/435-593VF..KVR......ADGPYKLW......VNDELVLQSD...GVPY.............SGDV-----VNALTTSGKTAELS
PSIA_DICDI/117-261TF..KFT......GDDDVWVF......INKQLVVDLG....................GTHP-----AASSSVDLSTLGLT
Q9PF33_XYLFA/452-607TFAVHVARCFDCNGHDPVRLS......IDDRQIIPDNATAAQAT.............TAPQ-----QTDNTHLEATLHFT
Q8P3G5_XANCP/475-625EL..QIA......ADDGVRLY......LDGKPLIDQW......................SD-----APRMRSSTATVALQ
Q8PLM2_XANAC/307-446TF..SLY......SSEYAKLY......VDGKLVVDRW...RQNW.................-----..NPWNHEFKLDLE
Q82PE8_STRAW/53-196TF..SIT......GDNGFRLW......VDGKLTIDHW...VDDW.................-----..DREQTSQPVDLT
HEXA_PORGI/626-766EF...........STENNEFW......IDNVKLIDNV...GEVK.................-----...KFSRRNSSRAL
Q8A3K6_BACTN/262-401TL..GIQ......ADDGARLY......INGELLIDDW.....................KSH-----SFSYQPTQKKISLE
Q8A341_BACTN/847-985MI..GVT......SDQGMRLS......VNGQRIVDEW...RNNK.................-----...ELTVVRPFLLK
Q8CK54_STRCO/42-184VF..RLV......SDDGSRLA......LDGATVIDHD...GLHGA..........EP....-----.......KDGTVEL
Q7UKT3_RHOBA/181-327EI..VVR......SKTSFTMDF....GHDSKQLIDNH...VQSE.................-----..GRNEFRRTLLLT
Q7URI2_RHOBA/387-524RF..QIT......SDDGSRVF......LHDKLFLDHD...GNHP.................-----....PMTVSRLVRA
O68843_STRAT/370-503RI..AAR......AQGGNAYV.....ELDGQEPFGRR...PWVY.................-----....GDVSSRPMRL
Q7Z9M4_HYPJE/396-546EL..GLV......VCGTAKAY......VDDQLVVDNA...TKQVP...........GDAFF-----GSATREETGRINLV
Q8AAF9_BACTN/630-763TF..ALL......SDDGSTLK......LDGELLGDND...GAHS.................-----....PVEIIVQKAL
Q8N9V0_HUMAN/31-179QF..AIA......ADDNAEFWLSLDDQVSGLQLLASVGKTGKEWT...........APGEF-----GKFRSQISKPVSLS
Q83X74_STRRO/410-541RI..AAR......VTGGNGSL.....QIDGGDPVSFG...EVFG.................-----.....KLTSVPLRL
PSIF_DICDI/104-263VF..KFK......GDDDVWVF......INDVLVLDIG...GVHGVQDG.....TVDMANLP-----EKIHDSTNSKLGNC
Q8A3E5_BACTN/456-595EL..LIE......GDDGYRVY......VNGEKVIDYW...GEHA.................-----...SAKREYTLKAI
Q7RP37_PLAYO/216-383II..SIE......HDCGVRIF......LDNSPIIVNNMPDPKEEESEEIKPIYILPINKIN-----SNVQKISSEKLGLI
Q7ULK4_RHOBA/523-652TF..YLA......SDDGSALE......IDGHRLENDG........................-----.IHPHKTVQAEYEL
Q9RIU6_STRCO/39-182TF..SII......GDNGFRLW......VGGQLAIDHW...VDDW.................-----..DREQTAQPIELT
Q7UF11_RHOBA/396-557TF..HLA......ASDEAELW......LSQGVTSDTSRLIASVATP.........TLMEGF-----TDANAGLSASVYLV
Q9XBE0_AMYOR/30-171DF..RLT......SDDGARFL......LDGTQVIDHPGRHGATA.................-----.......KDGSAQL
O86171_CLOBO/19-153IL...ST......NSPNCRVE......LNGEIFNLSL...NTSN.................-----.........TVNLI
Q84FS9_BACFO/634-770YF...........SSDLQEVW......VDGRRLISNT...GETK.................-----...RFSRRDCSVAL

PF10528

A7EUJ3_SCLS1/778-898AGQLLPFKVLWANGASSGSLGFSIKGPDSILLSSSSGSAKDVITTPSSIQTFSF
A6S3P8_BOTFB/439-550AGEYYPMRFLWANGDGPGLFAFSVTAPDGTTILDG.....NTVASPYVV.QFSC
A1DK36_NEOFI/304-416VGELVPFTFMWVNGGGPGQAYLTITDPAGKAHADT........TGFFVPANSTC
YI48_SCHPO/278-394EGYFLPVRFVVANGAYIGGFDFYFTSDSTGPLATT........SYSY...TKTC
FTA5_SCHPO/254-364QDSFVPVRFVLANGAYIGGFDFAFNSSSTGPVRTT........SYSY...TSTC
YKL1_SCHPO/1093-1204QGSFLPIRLIVANGGGKGGFNFDF.SSSTDTYAAT........SYAY...TATC
YQ39_SCHPO/481-593ADTYVPVRFVVANGAGKGGFDFSFVDSEGNSYNPT........SYAY...TATC
Q6FNG2_CANGA/139-259TGVYYPIRLFYNNRDYIAQLDIRFKTEHSNAIITN......FTDYFYSVDDSSL

PF07691

Q8IKW0_PLAF7/216-383GGKKYKIRIEYFHLSTMKFANPH.ISHIILYWKSN--------NIMEEIIPSNY
Q7SG54_NEUCR/435-585ANRPVELRVEMTNELRPLSKQKQ..MGMTHRYGGC--------RIGYKEADQID
BGLS_SCHPO/398-544KGRKYNVRVEYGSAATYTLS.........TNLSPS--------TGGRYSIGCVK
FLO1_YEAST/100-249AGYYYPMKVVYSNAVSWGTL........PISVTLP--------DGTTVSDDFEG
Q87YU8_PSESM/308-470AGTEYNVRLEYRRLKGNFIPVLGGLNGVQMSWASL--------RPPKNLADYDA
Q9ZGH5_9ACTO/429-559TKGTHKLTISGFAMSATPLS.......LELGWVTP--------AAADATIAKAV
PAG_BACAN/44-179KGRLYQIKIQYQRENPTEKGL.....DFKLYWTDS--------QNKKEVISSDN
FLO10_YEAST/121-271AGYYYPIKIVYSNAVSWGTL........PVSVVLP--------DGTEVNDDFEG
Q880I7_PSESM/435-593AGKTYTVKLEYQRIQGNFIPVL....GGLTGVQMS--------WASLRPPKDLS
PSIA_DICDI/117-261VGKVYPFNFFYCERHTSRSTIR...IETSLELYCD--------KYDYCGVCNGD
Q9PF33_XYLFA/452-607DTRPHHIRLDMEHRGEDQGV........RLEWLAP--------AAPQLAEAERA
Q8P3G5_XANCP/475-625AGKAYDLRVEYYEATRDAGV........RLAWRMP--------GAKPPLQEAVD
Q8PLM2_XANAC/307-446PGQRHTVKVEWDLIDPSYI.........ALLHRDP--------LPAAEAKDLSL
Q82PE8_STRAW/53-196AGRAYDIKVEYFEHFGGSNL........HLRWTPP--------GGSKSAVPQSA
HEXA_PORGI/626-766QKGYHPIKTIWVGAIQGGWP.........TYWNYS--------RVMIRLKGEEK
Q8A3K6_BACTN/262-401AGKMYDIKLEYYQHEWSSRI........KLSWIRP--------DKKSSTSLLTG
Q8A341_BACTN/847-985AGDEVAVRVEYSQRNPTGSV........QLVWSLP--------DHAAIAPQELL
Q8CK54_STRCO/42-184TAGAHPLRIDHFDRGGGQQV........QLSWMPP--------GESGFTVVPTE
Q7UKT3_RHOBA/181-327GGRVYPLEIDLNQRKRKGETPP...ASISLSWVPP--------GGIETIIPASA
Q7URI2_RHOBA/387-524GAGLHPIRIDYFEGGGAQTL........TAALTRL--------DVAGDDDGDDS
O68843_STRAT/370-503AAGTHKLRITGAALAKSPMT.......FELTWVTP--------QAAQEAIDRAV
Q7Z9M4_HYPJE/396-546KGNTYKFKIEFGSAPTYTL.KG...DTIVPGHGSL--------RVGGCKVIDDQ
Q8AAF9_BACTN/630-763KAGLHPIEVRYFDCNGGVL.........QMELVNE--------KGEKEVLPKEW
Q8N9V0_HUMAN/31-179ASHRYYFEVLHKQNEEGTDH.......VEVAWRRN--------DPGAKFTIIDS
Q83X74_STRRO/410-541SAGTHTVKISGGALVDQPMR.......LDLSWVTP--------ARAQEAIDQAV
PSIF_DICDI/104-263KNGTYPFDFFYCERHTKASNCL...FETNMGFTCS--------YYDYCGICNGK
Q8A3E5_BACTN/456-595AGTDYKIRIEYMQAGAE...A.....LLRFDLGIY--------RHISPEMVVDR
Q7RP37_PLAYO/216-383GGKKYKFRIEYFHLSTIKHENPD.TAHIILYWKSD--------KIIDEEIIPSQ
Q7ULK4_RHOBA/523-652KAGVYPIRVEYFDGGGQTSL........SLEVESD--------TFARDDIAYWV
Q9RIU6_STRCO/39-182AGQSYDIKLEYFEHYGGSNL........HLRWTEP--------GGSKEAIPQSA
Q7UF11_RHOBA/396-557AGQDYYVETLQVHDDPVAKNH......LSVAWTRP--------DQLASGPQLIG
Q9XBE0_AMYOR/30-171AAGHHALRIDHFDADFDQRL........KLEWRPP--------GAAEYTVVPNS
O86171_CLOBO/19-153QGNVYDIRIEQLMSENQLLKNY...EGIKLYWETS--------DIIKEIIPSEV
Q84FS9_BACFO/634-770AKGLHEFKVVFLGHIIGGWP.........SNWGNG--------SVKIRKADAEK

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window