Sequence alignment for CL0301

PF10528

A7EUJ3_SCLS1/778-898---------------------------------------------------------QLAIVHTGYVYARKAGTYTF--N
YI48_SCHPO/278-394---------------------------------------------------------CKVIVYQFFLRIPETDTYTL--V
FTA5_SCHPO/254-364---------------------------------------------------------CKTIVYQFFFRVPATDNWSL--F
YKL1_SCHPO/1093-1204---------------------------------------------------------CKAIVYQFFFRVPYTDTYEL--N
YQ39_SCHPO/481-593---------------------------------------------------------CKVIVYQFFFRVPVTDTFSL--D
Q6FNG2_CANGA/139-259---------------------------------------------------------NFTMILYGYFMPKTTAFHTF--Y

PF07691

Q8IKW0_PLAF7/216-383KADGL.MASYYNNAYFSGYPTA............IHNDKYINFIWDTGIPIENIPYQHFSIRWDGYLKIPESDNYIF..S
BGLS_SCHPO/398-544GKHGYVAKFYLEPATSENRTLI............DDYDLEDGVVRFYDYCNDKMKDGYFYIDIEGYLIPDEDAVYEF..G
FLO1_YEAST/100-249DSYG.NWGCKGMG.....................ACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTF..K
Q87YU8_PSESM/308-470SNSGV.KAEYYANTTLSGDPVANRIEPGVNLDWT..TNTNVTDNGSTAVSGYTPAAGSFSARFTGKIKPTITGAHVF..K
PAG_BACAN/44-179SSQGL.LGYYFSDLNFQAPMVV...........TSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTF..A
FLO10_YEAST/121-271DNTTLSSKTEKRE.....................NDDCDQGAAYWSSDLFGFYTTPTNVTVEMTGYFLPPKTGTYTF..G
Q880I7_PSESM/435-593SNSGV.KAEYFSNTSFSGDPALTRVEPGVNLNWA..TGTNVTNAGSTAVSGFSPSAGAFSARFTATIKPTVSGAQVF..K
PSIA_DICDI/117-261LRTASGNYIYDNDFFFPIDYEG............FDTDPANRIYKDDESTNKTYHNYHFCFQFDNRFLF..KGNETF..K
Q9PF33_XYLFA/452-607GHPGL.KGEYFDTIDFAGPPHL............VRQDRIIAFNWDHVAPAPGMNPHRYAVRWTGELLPPGPGTYTFAVH
Q8P3G5_XANCP/475-625SQNGL.TGDYFRGRALAGQPVLTRIDPRIAFRWDRNAPTDDAVGRGELQPGQALGKDDFSVRWHGQLLPPVSGNYEL..Q
HEXA_PORGI/626-766PKPGL..TIRTAYGDLYDVPDLQQVA....SWEVGTVSSLEEIMHGKEKITSPEVLERRVVEATGYVLIPEDGVYEF...
Q8A3K6_BACTN/262-401WVNGL.KGIYTQDSKGVGHLRS............EKIDPVIDFDWDWYKPADDFSFNDYQVTWSGKLKAPSTGEYTL..G
Q8A341_BACTN/847-985GKSVL.ELSLYKDDDLRTLAGV...........TQDNKIDRTFADGAQPDPLLPANQSFSAIWDGKLKAPQSGTYMI..G
Q8CK54_STRCO/42-184QEPGVTLRVFDVQTPLNELCTLKP.......GQTPNHDKLMPTVDWSTTADFGGIADNFVSQASGYLVAPRDGTYVF..R
Q7UKT3_RHOBA/181-327SKHGLSVSIYEGKGWKKENRKI............ERVDSVVDFDFGKEGPGEGVPWDEFHAHWDGGLRVEQTGRYEI..V
Q7URI2_RHOBA/387-524LEPGLDYRMYLGKFKKLPEFET............MEVERTGQVDSLNLEEIQGDQRDDFALSINAMFRVPEEGLYRF..Q
Q8AAF9_BACTN/630-763LNSGLKAVWHKFRGNLCAD...............IDAAPVNGEYVVESVSIPEEVKGDIGLIITGYLEVPADGIYTF..A
Q8A3E5_BACTN/456-595GRPGL.TATYWNNMNLSGDVAAT..........SQITSPINLSNGGNTVFATGVGLYNFTAVYEGTFRPKESGAYEL..L
Q7RP37_PLAYO/216-383KADGL.TGSYYDNAYFSGYPLS............INNDKYINFIWDSGVPIEMIPYQHFSVRWDGYIKIPQTDNYII..S
Q7UF11_RHOBA/396-557LRSGVLVETFEPVAPSPPLSSIAEL.....RDDETFVANTPSTASDISSFSYSAAPGAKVSRIRGIVSPPVSGHYTF..H
F6R443_MACMU/31-177.WCGSSIQQLRRN.....................LHFPLYPHIRTTLRKLAVSPRWTNYGLRIFGYLHPFTDGKIQF..A
G0RWC1_HYPJQ/397-546GAPGMRWRVFNEPPGTPNRQHID.........ELFFTKTDMHLVDYY....HPKAADTWYADMEGTYTADEDCTYEL..G
Q7SG54_NEUCR/449-597GKPGV.TIEWFKGDKFKGEPVV.............IQRRTNTDLFLWDSAPLAQTGPEWSAIATTYLTPKHSGKHTI..S

PF10528

A7EUJ3_SCLS1/778-898IT-----SFDDIVMGW------IGS.NAFGSY---SSS.......NADLNAASS.......DTHNAVTTVSKTLTAGQLL
YI48_SCHPO/278-394VN-----NVDDVFFGW------FGD.KAISGW---SNN.......NFDAYSYWHESPNMGLGTVGMGNFTVGNYPEGYFL
FTA5_SCHPO/254-364VK-----NVDDAFFGW------FGD.KAISGW---SNV.......NYDAYAHWRI......GAYGMGTFDLGYLEQDSFV
YKL1_SCHPO/1093-1204VY-----NVDDVFYGW------FGD.KAISGW---SNT.......NYDAYAYWHVTT....GQTGMGSFSMGTLTQGSFL
YQ39_SCHPO/481-593VT-----NVDDVFYGW------FGD.KAISGW---SNT.......NYDTYAYWHATN....GQTGIASFSMGSLTADTYV
Q6FNG2_CANGA/139-259V.-----TADDLLFMN------FGAGNAFDCC---RREETADKFGNYAAYSVW........GKKSLKNELTVYLHTGVYY

PF07691

Q8IKW0_PLAF7/216-383VD......HDCGIRIF......LDNSPIIVDNMPFPKEEESEEIRPISIQSFDKMN-----SKVHKTNSEKLGLIGGKKY
BGLS_SCHPO/398-544IS......VFGTALLF......IDDVLLIDNK...TKQTP...........TNHTF-----EFGTIEERNSIYLKKGRKY
FLO1_YEAST/100-249FA.....TVDDSAILS......VGGATAFNCC...AQQQPPITSTNFTIDGIKPWG-----GSLPPNIEGTVYMYAGYYY
Q87YU8_PSESM/308-470VR......ADGAYKLW......INDELVLEDE...GAQV.............SFDL-----IPVIPRTVKTPTLKAGTEY
PAG_BACAN/44-179TS......ADNHVTMW......VDDQEVINKA........................-----.....SNSNKIRLEKGRLY
FLO10_YEAST/121-271FA.....TVDDSAILS......VGGNVAFECC...KQEQPPITSTDFTINGIKPWN-----ADAPTDIKGSTYMYAGYYY
Q880I7_PSESM/435-593VR......ADGPYKLW......VNDELVLQSD...GVPY.............SGDV-----VNALTTSGKTAELSAGKTY
PSIA_DICDI/117-261FT......GDDDVWVF......INKQLVVDLG....................GTHP-----AASSSVDLSTLGLTVGKVY
Q9PF33_XYLFA/452-607VARCFDCNGHDPVRLS......IDDRQIIPDNATAAQAT.............TAPQ-----QTDNTHLEATLHFTDTRPH
Q8P3G5_XANCP/475-625IA......ADDGVRLY......LDGKPLIDQW......................SD-----APRMRSSTATVALQAGKAY
HEXA_PORGI/626-766........STENNEFW......IDNVKLIDNV...GEVK.................-----...KFSRRNSSRALQKGYH
Q8A3K6_BACTN/262-401IQ......ADDGARLY......INGELLIDDW.....................KSH-----SFSYQPTQKKISLEAGKMY
Q8A341_BACTN/847-985VT......SDQGMRLS......VNGQRIVDEW...RNNK.................-----...ELTVVRPFLLKAGDEV
Q8CK54_STRCO/42-184LV......SDDGSRLA......LDGATVIDHD...GLHGA..........EP....-----.......KDGTVELTAGAH
Q7UKT3_RHOBA/181-327VR......SKTSFTMDF....GHDSKQLIDNH...VQSE.................-----..GRNEFRRTLLLTGGRVY
Q7URI2_RHOBA/387-524IT......SDDGSRVF......LHDKLFLDHD...GNHP.................-----....PMTVSRLVRAGAGLH
Q8AAF9_BACTN/630-763LL......SDDGSTLK......LDGELLGDND...GAHS.................-----....PVEIIVQKALKAGLH
Q8A3E5_BACTN/456-595IE......GDDGYRVY......VNGEKVIDYW...GEHA.................-----...SAKREYTLKAIAGTDY
Q7RP37_PLAYO/216-383IE......HDCGVRIF......LDNSPIIVNNMPDPKEEESEEIKPIYILPINKIN-----SNVQKISSEKLGLIGGKKY
Q7UF11_RHOBA/396-557LA......ASDEAELW......LSQGVTSDTSRLIASVATP.........TLMEGF-----TDANAGLSASVYLVAGQDY
F6R443_MACMU/31-177IA......ADDNAEFWLSLDDQVSGLQLLASV...GKTGKE........WTAPGEF-----GKFRSQISKPVSLSASHRY
G0RWC1_HYPJQ/397-546LV......VCGTAKAY......VDDQLVVDNA...TKQVP...........GDAFF-----GSATREETGRINLVKGNTY
Q7SG54_NEUCR/449-597YM......SVGPGKLY......INGKLSLDLW...DWTE............EGEAM-----FDGSVDYLVELEMVANRPV

PF10528

A7EUJ3_SCLS1/778-898PFKVLWANGASSGSLGFSIKGPDSILLSSSSGSAKDVITTPSSIQTFSF
YI48_SCHPO/278-394PVRFVVANGAYIGGFDFYFTSDSTGPLATT........SYSY...TKTC
FTA5_SCHPO/254-364PVRFVLANGAYIGGFDFAFNSSSTGPVRTT........SYSY...TSTC
YKL1_SCHPO/1093-1204PIRLIVANGGGKGGFNFDF.SSSTDTYAAT........SYAY...TATC
YQ39_SCHPO/481-593PVRFVVANGAGKGGFDFSFVDSEGNSYNPT........SYAY...TATC
Q6FNG2_CANGA/139-259PIRLFYNNRDYIAQLDIRFKTEHSNAIITN......FTDYFYSVDDSSL

PF07691

Q8IKW0_PLAF7/216-383KIRIEYFHLSTMKFANPH.ISHIILYWKSN--------NIMEEIIPSNY
BGLS_SCHPO/398-544NVRVEYGSAATYTLS.........TNLSPS--------TGGRYSIGCVK
FLO1_YEAST/100-249PMKVVYSNAVSWGTL........PISVTLP--------DGTTVSDDFEG
Q87YU8_PSESM/308-470NVRLEYRRLKGNFIPVLGGLNGVQMSWASL--------RPPKNLADYDA
PAG_BACAN/44-179QIKIQYQRENPTEKGL.....DFKLYWTDS--------QNKKEVISSDN
FLO10_YEAST/121-271PIKIVYSNAVSWGTL........PVSVVLP--------DGTEVNDDFEG
Q880I7_PSESM/435-593TVKLEYQRIQGNFIPV....LGGLTGVQMS--------WASLRPPKDLS
PSIA_DICDI/117-261PFNFFYCERHTSRSTIR...IETSLELYCD--------KYDYCGVCNGD
Q9PF33_XYLFA/452-607HIRLDMEHRGEDQGV........RLEWLAP--------AAPQLAEAERA
Q8P3G5_XANCP/475-625DLRVEYYEATRDAGV........RLAWRMP--------GAKPPLQEAVD
HEXA_PORGI/626-766PIKTIWVGAIQGGWP.........TYWNYS--------RVMIRLKGEEK
Q8A3K6_BACTN/262-401DIKLEYYQHEWSSRI........KLSWIRP--------DKKSSTSLLTG
Q8A341_BACTN/847-985AVRVEYSQRNPTGSV........QLVWSLP--------DHAAIAPQELL
Q8CK54_STRCO/42-184PLRIDHFDRGGGQQV........QLSWMPP--------GESGFTVVPTE
Q7UKT3_RHOBA/181-327PLEIDLNQRKRKGETPP...ASISLSWVPP--------GGIETIIPASA
Q7URI2_RHOBA/387-524PIRIDYFEGGGAQTL........TAALTRL--------DVAGDDDGDDS
Q8AAF9_BACTN/630-763PIEVRYFDCNGGVL.........QMELVNE--------KGEKEVLPKEW
Q8A3E5_BACTN/456-595KIRIEYMQAGAE...A.....LLRFDLGIY--------RHISPEMVVDR
Q7RP37_PLAYO/216-383KFRIEYFHLSTIKHENPD.TAHIILYWKSD--------KIIDEEIIPSQ
Q7UF11_RHOBA/396-557YVETLQVHDDPVAKN......HLSVAWTRP--------DQLASGPQLIG
F6R443_MACMU/31-177YFEVLHKQNEEGTDH.......VEVAWRRN--------DPGAKFTIID.
G0RWC1_HYPJQ/397-546KFKIEFGSAPTYTLKG....DTIVPGHGSL--------RVGGCKVIDD.
Q7SG54_NEUCR/449-597ELRVEMTNELRPLSKQK..QMGMTHRYGGC--------RIGYKEADQ..

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window