Sequence alignment for CL0301

PF10528

A0A0B2WZZ0_9HYPO/91-182----------------------------------------------------------ASVIHQGFLLAPE.SGNYTF--
A0A086TDF0_ACRC1/781-871----------------------------------------------------------STIIHQSFLLAPV.MGDYVF--
T5ADT9_OPHSC/260-350----------------------------------------------------------AAMEYRTFLFACQ.AGKYKF--
T5A1B7_OPHSC/595-685----------------------------------------------------------AALDLRTTLYVCE.GGKYKF--
G3JUQ9_CORMM/524-614----------------------------------------------------------AAASYRGFLFACQ.AGRYRF--
A0A0A1TC47_9HYPO/423-513----------------------------------------------------------AAVGYRTFLFACQ.NGTYRL--
E9ECG4_METAQ/427-517----------------------------------------------------------AAIEYRAFLYACQ.DGWYTF--
A0A094GD32_9PEZI/25-116----------------------------------------------------------VAVNHRGYLYAHQ.DGEYSF--
A0A074WAH8_9PEZI/114-207----------------------------------------------------------ITINNRGYLYAKE.SGNYTF--
A0A093ZSP4_9PEZI/404-495----------------------------------------------------------TVINHRAYIFAQQ.SGTYTF--
A0A094D2R0_9PEZI/733-825----------------------------------------------------------TTVKHRAYIFAQQ.SGTYTF--
A0A0F4GI42_9PEZI/1356-1452----------------------------------------------------------TVLHHRGYLFAQQ.AGTFQF--
C7ZNI1_NECH7/1109-1200----------------------------------------------------------KAISHVALLYAPY.SGDYEI--
N1RBK8_FUSC4/1012-1103----------------------------------------------------------KAVNHRAFLYAPI.NGTYSV--
G2XFJ8_VERDV/583-676----------------------------------------------------------TAVNHRAFLYAPV.TGTYTI--
X0BL31_FUSOX/275-364----------------------------------------------------------KAVNHQAFLYAPD.TGDYKV--
I1RLE3_GIBZE/216-305----------------------------------------------------------KAVNHRGFLYAPE.TGIYEV--
A0A074X201_AURPU/260-353----------------------------------------------------------WVIDHVFYLFARQ.DGYYSF--
A0A074VRD6_9PEZI/194-287----------------------------------------------------------LVLDHTFYLFASQ.TGYYSL--
A0A074WM41_9PEZI/172-262----------------------------------------------------------LALNHVFYLFAGRGTGFYYI--
A0A074YDL6_9PEZI/858-950----------------------------------------------------------VTLNHVFYIFAGHGTGYYSI--
A0A074VKQ1_9PEZI/171-261----------------------------------------------------------LALNHVFYVFAGHGTGYYHI--
S8BMH2_DACHA/580-671----------------------------------------------------------LAINHRGYIFAPQ.DGKYTF--
G1XGI6_ARTOA/484-575----------------------------------------------------------VAINHRAYIFAPE.DGTYTF--
A7EUJ3_SCLS1/779-870----------------------------------------------------------LAIVHTGYVYARK.AGTYTF--
W7N9N6_GIBM7/348-442----------------------------------------------------------AALLFNAYFYAKE.TGTYTF--
M7SG56_EUTLA/320-413----------------------------------------------------------AAIMLQGFFVARQ.TGTYTF--
R1EBX7_BOTPV/294-386----------------------------------------------------------AAILLQGFFVAQA.TGTYTI--
W3XGQ9_9PEZI/307-400----------------------------------------------------------AALLLQGFFIAKQ.TGTYTF--
A1DK36_NEOFI/305-396----------------------------------------------------------VCIVIQGYLWAKEGPGNYTL--
S8ADJ9_DACHA/331-422----------------------------------------------------------MIVNHKFYFLAQY.DGEYTF--
K2RZA0_MACPH/498-586----------------------------------------------------------INVMHIGYLYART.TGTYTF--
S8BYP3_DACHA/2186-2274----------------------------------------------------------YILNHRGFFYAPK.TQAYLF--
S8C0J3_DACHA/2496-2584----------------------------------------------------------YFLNHRGFFYAPT.TQQYTF--
W7HLW7_9PEZI/321-413----------------------------------------------------------YVLNHRGYFYAPV.SGRYNF--
S8A4K8_DACHA/645-738----------------------------------------------------------YAMAHKGYFYVPK.TQSYSF--
S8AQ37_DACHA/2223-2316----------------------------------------------------------YALMYRGYFVAPI.AATYNF--
S8ASY7_DACHA/3112-3205----------------------------------------------------------YILNYRGYFYAPV.TGTYNF--
W7HLW7_9PEZI/526-616----------------------------------------------------------YALLWRGYFYAPV.AGTYRF--
S8A1N3_DACHA/591-679----------------------------------------------------------TGYNHRGYFYAPY.DDTYNF--
S7ZZI6_DACHA/2911-3001----------------------------------------------------------YTLNYRGYFFAPN.TTTYTF--
S8CBM4_DACHA/176-268----------------------------------------------------------YVLNHRGYFYAPK.TMSYTF--
S8BKE7_DACHA/3488-3580----------------------------------------------------------YTLNYRGYFYAPV.TATYTF--
S8BVC1_DACHA/2418-2512----------------------------------------------------------YVLQYRGYFYAPK.DTTYIF--
G1X1S1_ARTOA/579-670----------------------------------------------------------YAILWRGFFYAPR.SGEYTI--
S8C299_DACHA/204-294----------------------------------------------------------YTLNYRGYFYAPK.TADYTL--
G1X146_ARTOA/206-299----------------------------------------------------------YVLNYRGFFYSPN.TTTYTF--
S8AMM4_DACHA/974-1067----------------------------------------------------------YTLNYRGYFFAPR.STTYTF--
S8AJM2_DACHA/341-433----------------------------------------------------------IALNYCGYFYAPN.STWYNF--
G1X1S1_ARTOA/369-459----------------------------------------------------------HVINHRGYFYAPK.TETYSF--
G1X799_ARTOA/580-673----------------------------------------------------------LMVMHRGFFYVPR.DGHYTF--
S8C0J3_DACHA/2893-2986----------------------------------------------------------MTIMYRGFFYSPV.SSTYTF--
S8BM05_DACHA/166-259----------------------------------------------------------MALMYRGFFWAPR.AATYTF--
S8B8A3_DACHA/836-925----------------------------------------------------------IALMYRGYFYAPS.STDYSI--
A0A0A1TQX0_9HYPO/1374-1461----------------------------------------------------------LTIMLRSFLYPCV.DGTFQM--
S8A3Y9_DACHA/3004-3101----------------------------------------------------------TAVMYRGYFFAPK.TSQYKF--
S7ZXT0_DACHA/2911-2999----------------------------------------------------------PATNQKGYFYAPY.SRNYTF--
S7ZZI6_DACHA/2289-2382----------------------------------------------------------FTLNYRGYFYAPY.TKTYTF--
S8B9B5_DACHA/2938-3024----------------------------------------------------------YALNYKGYFYAPI.NQTYTF--
S8C0J3_DACHA/2697-2789----------------------------------------------------------YTLNIQGFFYAPI.TTTYTF--
S8A3Y9_DACHA/2524-2611----------------------------------------------------------YGLSYAGFFYAPI.TETYTF--
S8A3B1_DACHA/619-709----------------------------------------------------------YGLMLRGWFYAPK.TQLYTF--
S8A1N3_DACHA/396-486----------------------------------------------------------WTVMARGWFYAPK.SQLYTF--
S7ZZI6_DACHA/2508-2600----------------------------------------------------------FSLNYRGWFFAPV.TQTYTV--
S8A6I0_DACHA/2775-2868----------------------------------------------------------YVLNYRGYFYAPK.TQNYLF--
S7ZXT0_DACHA/2299-2389----------------------------------------------------------FSLNYRGFFYASK.TQAYTF--
S8AG65_DACHA/629-715----------------------------------------------------------FALNFRGYFYANT.TQTYTI--
S7ZXT0_DACHA/2705-2794----------------------------------------------------------ITLGYRGWFFAPV.SQNYTF--
S8A3Y9_DACHA/2333-2418----------------------------------------------------------YYMSYRGYFYAPI.TQDYTF--
G1X799_ARTOA/378-459----------------------------------------------------------FALIYRGYFYAPR.TQEYTF--
S8ASY7_DACHA/2901-2993----------------------------------------------------------YTMQYRGYFYSPK.TTSYTF--
S7ZZI6_DACHA/2706-2798----------------------------------------------------------YTMQYRGYFYAPK.TSVYTF--
S8A139_DACHA/2580-2672----------------------------------------------------------YAMQLRGYFYAPR.TGVYTF--
W7I935_9PEZI/152-240----------------------------------------------------------YALNFRGYFLCPK.TQQYDI--
W7HXJ4_9PEZI/154-246----------------------------------------------------------YTLNLRGYFLCPA.DGTFTI--
S8C706_DACHA/675-767----------------------------------------------------------FVLNFRGFFNCPI.SGSYNI--
S8A139_DACHA/2986-3076----------------------------------------------------------YTLNMRGYLYCPV.SGNYGV--
S8A139_DACHA/2788-2878----------------------------------------------------------FTLNYRGYFLCPQ.TTTYTI--
B6JV38_SCHJY/1821-1913----------------------------------------------------------KALVYQFFFRAPV.TSTYTF--
B6JZE1_SCHJY/1129-1223----------------------------------------------------------KALIYQFFFRVPK.DDKYSF--
FTA5_SCHPO/255-347----------------------------------------------------------KTIVYQFFFRVPA.TDNWSL--
YKL1_SCHPO/1094-1188----------------------------------------------------------KAIVYQFFFRVPY.TDTYEL--
E5A174_LEPMJ/1539-1631----------------------------------------------------------VAIVYTGYFRPII.SGTYSL--
K2RA80_MACPH/537-628----------------------------------------------------------TAIVYAGYFTVPT.TGTYTI--
B8MKN9_TALSN/239-331----------------------------------------------------------WTVVFQGYLHATQ.TGNYTV--
A0A010SLV3_9PEZI/1724-1813----------------------------------------------------------WYIQQAGYFHPSQ.SGTYTF--
S8C706_DACHA/1017-1106----------------------------------------------------------FTLVLKGYFTVTK.TSTYSF--
K2RJ77_MACPH/7947-8035----------------------------------------------------------TALIFRGYFYAPT.SGLWTF--
R1EZ58_BOTPV/617-705----------------------------------------------------------SATIFRGYFYANV.TGTWTF--
E5A174_LEPMJ/1740-1828----------------------------------------------------------RAIVFRGYFAANV.TGTWTF--
A0A0G2EHZ4_9PEZI/336-424----------------------------------------------------------TAFIYRGYFLPNT.TGSYTF--
A0A0F4G9N9_9PEZI/1838-1930----------------------------------------------------------FSLNHRGYFYIYA.TGVWTF--
A0A0F4GEC4_9PEZI/1297-1384----------------------------------------------------------YSINHRGYFYTYA.TGNWTF--
M3CY60_SPHMS/384-476----------------------------------------------------------FSAMYRGYLYIYS.SGTWTF--
G0VGU9_NAUCC/472-572----------------------------------------------------------FVAEFKAYFIPPV.SGSYTF--
G0VGW7_NAUCC/817-917----------------------------------------------------------FVAEFKAYFIPQT.SGAYTF--
G0V539_NAUCC/472-572----------------------------------------------------------FSAEFTSFFVPPT.TGTYTF--
G0VGX5_NAUCC/118-218----------------------------------------------------------FVAEYTGFFVPPT.SGQYTF--
G0VGW7_NAUCC/459-558----------------------------------------------------------FAAEYTSFFVPQS.TGTYTF--
G0WDM7_NAUDC/115-212----------------------------------------------------------FVAEATGYFVPPT.TGTYTF--
A7TJN8_VANPO/109-209----------------------------------------------------------FTVELTGYFIPET.SGIHTF--
Q6FQ05_CANGA/107-201----------------------------------------------------------LLVQLQGYFVPPV.SGQYTF--
B4UN21_CANGA/106-200----------------------------------------------------------LLVELQGYFVPTQ.SGMYTF--
B4UN22_CANGA/101-195----------------------------------------------------------LLVELRGYFVPPN.SGQYTF--
B4UN20_CANGA/107-201----------------------------------------------------------LLVELQGYFVPPE.SGNYTF--
Q6FII8_CANGA/107-201----------------------------------------------------------LLVYMVAYFVPTE.TGEYTF--
Q6FQ10_CANGA/103-199----------------------------------------------------------ILIEFRGYFIPPK.SGTYTF--
Q6CWZ6_KLULA/31-126----------------------------------------------------------FTMLLSGYFYAPK.SGEYQF--
Q6CSM7_KLULA/32-128----------------------------------------------------------FTMLLSGYFYAPK.SGEYQF--
Q6CN84_KLULA/123-215----------------------------------------------------------FTMVLSGYFYARM.TGDYQF--
Q755B8_ASHGO/129-229----------------------------------------------------------FAYVGTGYFRADQ.DGSYNF--
Q755B7_ASHGO/122-222----------------------------------------------------------FAYLATGYFRAEQ.DGAYNF--
G8JP44_ERECY/128-228----------------------------------------------------------FAYLATGYFRADQ.DGVYNF--
G8ZY99_TORDC/133-231----------------------------------------------------------FSMLITGYFKAPK.TGTYKF--
C5DFQ4_LACTC/123-219----------------------------------------------------------FSMLLTGYFLPPV.TGTYSL--
G8ZY82_TORDC/121-219----------------------------------------------------------FAMLITGYFLAKT.TGTYSF--
A0A0A8L5C6_9SACH/118-214----------------------------------------------------------FSMLITGYFYAPK.TGSYDF--
Q6CX19_KLULA/128-224----------------------------------------------------------FSMLITGYFYAPK.TGSYEF--
Q6FUW4_CANGA/154-251----------------------------------------------------------FTMILYGYFQPKV.TGYHTF--
Q6FUW5_CANGA/141-238----------------------------------------------------------FTMLLYGYFRPKV.TGFHTF--
Q6FR82_CANGA/143-240----------------------------------------------------------FTMLLYGYFKPKV.TAKHTF--
Q6FVP4_CANGA/154-251----------------------------------------------------------FTMILFGYFKPKI.SGNHIF--
Q6FUW3_CANGA/134-231----------------------------------------------------------FTMILYGYFKAQT.TGLHTF--
A0A0F4X5N7_HANUV/148-251----------------------------------------------------------FAFHMNGYLVPNI.TGEYTL--
A0A0F4X4Q0_HANUV/112-215----------------------------------------------------------FTFHMNGYIVPNV.TGEYTL--
G3B2Y3_CANTC/22-123----------------------------------------------------------FGLRLTGYLLATE.TGTYTI--
G3BFW5_CANTC/104-201----------------------------------------------------------FGLRLSGYFYAST.TGDYTF--
G3B766_CANTC/106-202----------------------------------------------------------FGLRLSGYFYAST.TGDYTF--
G3BFW8_CANTC/100-197----------------------------------------------------------FGLRLTGYLYAET.TGDYTI--
G3BFW6_CANTC/100-197----------------------------------------------------------FGLRLTGYLYAEA.TGDYTI--
G3BDF6_CANTC/105-202----------------------------------------------------------FGLRLSGYFYATT.TGDYTF--
E7NPI2_YEASO/136-237----------------------------------------------------------ITLEITGYFLPPQ.TGSYTF--
G8ZW36_TORDC/116-218----------------------------------------------------------FTVEVSGYFLAPL.TGQYTI--
C5DWW7_ZYGRC/131-231----------------------------------------------------------FTVELTGYFLAPQ.DGTYTF--
B5RT28_DEBHA/101-200----------------------------------------------------------FSVELTGYFLAPE.TGDYQL--
G8YSS6_PICSO/109-208----------------------------------------------------------FTMELTGYFLAPE.TGNYTL--
J7SA32_KAZNA/173-268----------------------------------------------------------IVVELTGYLLAPS.TGVYTF--
C4R3B0_KOMPG/294-397----------------------------------------------------------ATIEYVGFFQAPA.NGNYEL--
C4QYW7_KOMPG/115-219----------------------------------------------------------MLLELKGYFRADA.SGNYGL--
A0A099NWW7_PICKU/260-356----------------------------------------------------------YVAQLTGYIYASE.SGLYEF--
A0A099P2U2_PICKU/395-490----------------------------------------------------------YVNQLTGYFRPKT.SGLHVF--
A0A099NW94_PICKU/107-207----------------------------------------------------------YALEYTGYFKAAK.SGIYKF--
A0A099P0F8_PICKU/109-208----------------------------------------------------------FLMEANGYFKAPE.SGIYQF--
I2JQE4_DEKBR/45-143----------------------------------------------------------FLLELDGYFYANV.SGLYTF--
I2JQS0_DEKBR/141-239----------------------------------------------------------FALELDGYFYAET.SGIYTL--
I2JVD5_DEKBR/75-173----------------------------------------------------------FLVELDGYFYAKT.SGVYTL--
I2JQS5_DEKBR/113-211----------------------------------------------------------FVMELDGYFFATT.SGVYTL--
A0A099NRU8_PICKU/4-98----------------------------------------------------------VLVELQGYFVAPE.TGLYTV--
A0A074VE73_9PEZI/156-257----------------------------------------------------------FTIVWTGYFAPQV.SGSYQF--
A0A074WDA2_9PEZI/352-450----------------------------------------------------------FTFVWTGYFVPQQ.SGSYQF--
A0A0L0NI94_9HYPO/325-423----------------------------------------------------------FTLVFTGYYRAPA.TGKYRF--
A0A063BVW4_9HYPO/426-524----------------------------------------------------------FTLVWTGYYYART.TGVYRF--
X0BNJ8_FUSOX/200-297----------------------------------------------------------FTLVYTGYYQAPE.TGTYEL--
A0A0L0N435_9HYPO/186-282----------------------------------------------------------FTLVYDGFYHAPT.TGKYTL--
W8F3T8_9BACT/80-158----------------------------------------------------------FSARWKGHLYAPV.TGVYTF--
W3XRF7_9PEZI/1047-1135----------------------------------------------------------FILDYVGYIYATT.SGTYTF--
A0A074YRC0_9PEZI/482-571----------------------------------------------------------MILNHRGYFFAPS.SGNYTF--
A0A074VXF3_9PEZI/474-563----------------------------------------------------------MVLNHRGYFFAPT.SGDYTF--
W3X397_9PEZI/326-418----------------------------------------------------------FVLNHRGYFYAPT.TGVYTF--
A0A094FMT6_9PEZI/175-267----------------------------------------------------------FALNHRGYIHALQ.GGQYTF--
A0A093ZUD3_9PEZI/181-273----------------------------------------------------------FALNHRGYIHALQ.GGTYTF--
A0A093YH60_9PEZI/179-271----------------------------------------------------------FVLNHRGYIHAIQ.GGTYTF--
A0A094IS29_9PEZI/174-266----------------------------------------------------------FALNHRGYLHALE.GGTYTF--
M3AT14_SPHMS/263-351----------------------------------------------------------FALNHQGYIYAVL.SGTYSF--
A0A0F4GTF0_9PEZI/940-1034----------------------------------------------------------WALNHQGYIYPDV.SGPYTF--
F9X7F6_ZYMTI/152-245----------------------------------------------------------FAINHQGYIYPDV.SGTYTF--
A0A0F4GBG0_9PEZI/1115-1205----------------------------------------------------------FALNHQGYIFADA.NGTYTF--
A0A074X474_9PEZI/92-181----------------------------------------------------------FTLNHVGYIFAQS.SGTYTF--
A0A074XY07_9PEZI/284-373----------------------------------------------------------FTLNHVGYIFAQN.TGTYTF--
W3XLK6_9PEZI/287-376----------------------------------------------------------FALNHKGYLFAVL.SGIYTF--
W3X411_9PEZI/275-367----------------------------------------------------------FALDHKGYLFAVA.TGTYKF--
A0A0E9NSQ7_9ASCO/713-805----------------------------------------------------------IALNHRGYLFARQ.TGTYTF--
A0A094IZG8_9PEZI/404-495----------------------------------------------------------FALNHRGYLFAPS.TGVYTF--
A0A0F9XST2_TRIHA/266-356----------------------------------------------------------FVLNHHGYIYARQ.TGTYTF--
G9NK78_HYPAI/264-354----------------------------------------------------------FVLNHRGYIYARQ.TGAYTF--
M7UTE3_BOTF1/440-528----------------------------------------------------------LVIDNRGYLFAQM.TGTYTF--
W3XQ89_9PEZI/311-407----------------------------------------------------------IALNYRGYLYAGQ.TGSFTF--
E9F784_METRA/160-253----------------------------------------------------------FALNHHAYFYACE.AGTYSI--
R8BCW8_TOGMI/99-192----------------------------------------------------------FALNHHTYLYACD.EGTYRI--
G0RSD2_HYPJQ/160-253----------------------------------------------------------FALNHHAYIYACE.GGTYTV--
G9MGK0_HYPVG/152-245----------------------------------------------------------FALNHHAYIYACE.AGTYSI--
C7Z3G4_NECH7/188-281----------------------------------------------------------FALNHHGYIYACE.TGTYQF--
A0A0D2YBA4_FUSO4/190-283----------------------------------------------------------FALNHHGYLYSCD.AGTYKF--
I1RLP4_GIBZE/191-284----------------------------------------------------------FALNHHGYIYTCE.AGTYKF--
A0A074XM69_9PEZI/572-665----------------------------------------------------------FILNHRGYLFAQI.AGTYTF--
A0A074X564_AURPU/566-657----------------------------------------------------------FILNHRGYIFAQV.PGTYTF--
A0A074YDZ5_9PEZI/572-664----------------------------------------------------------FILNHRGYIFAQV.PGTYTF--
A0A074YDM0_9PEZI/284-375----------------------------------------------------------FVLNHRGYIFAQV.AGVYTF--
A0A074X2Q8_AURPU/7-102----------------------------------------------------------FYLSHKGYFFAQV.TGYYNF--
W3WNL0_9PEZI/490-580----------------------------------------------------------FALDHKGYFFAPV.SGRYIF--
G0RTH6_HYPJQ/765-860----------------------------------------------------------TIVQQIGWFVPAI.AGTYTF--
A0A010S4E5_9PEZI/1789-1880----------------------------------------------------------IIVQHIGYFHPAT.SGTYTF--
A0A063C682_9HYPO/1999-2090----------------------------------------------------------MVVQHVAYFNPSM.TGTYVF--
A0A063BY70_9HYPO/1576-1664----------------------------------------------------------AAVQHVGYFHPAI.TGLYNF--
A0A063BY70_9HYPO/1354-1443----------------------------------------------------------IVTQNVGYFHPAI.TGSYNF--
A0A063BSF4_9HYPO/209-297----------------------------------------------------------IVIQFVGYFHPAL.TGNYVF--
A0A0B4GHB0_9HYPO/273-365----------------------------------------------------------FFMSWTGYLVPKH.TGSYTF--
J4USI0_BEAB2/283-374----------------------------------------------------------FLMFWTGFLVPRT.TGPYTF--
J3NZ77_GAGT3/223-313----------------------------------------------------------SLIVHRGYIRAGR.SGTYSI--
L2FXC7_COLGN/218-309----------------------------------------------------------NILVHRGYLRASL.SGSYEF--
T0JL19_COLGC/335-426----------------------------------------------------------NTLVHRGYIKATL.PGAYEF--
L2FWT7_COLGN/243-334----------------------------------------------------------GIVQHRGYINVT..PGVYTV--
A0A0C4E9R0_MAGP6/214-301----------------------------------------------------------AVLQHRGYIMADQ.TGIYKA--
A0A0C4DSB4_MAGP6/155-240----------------------------------------------------------SVLQACGCIVADR.VTTYHI--
A0A0F4GAQ0_9PEZI/216-306----------------------------------------------------------YGVKHTGYIFARV.TGDYVY--
F9XCF6_ZYMTI/199-288----------------------------------------------------------FSVKHTGWIWAQT.TGAYVF--
F9XCF6_ZYMTI/436-525----------------------------------------------------------IGIKHLGYIYARV.SGEYVF--

PF07691

Q8IKW0_PLAF7/216-383KADGL.MASYYNNAYFSGYPTA............IHNDKYINFIWDTGIPIENIPYQHFSIRWDGYLKIPE-SDNYIF..
BGLS_SCHPO/398-544GKHGYVAKFYLEPATSENRTLI............DDYDLEDGVVRFYDYCNDKMKDGYFYIDIEGYLIPDE-DAVYEF..
FLO1_YEAST/100-249DSYG.NWGCKGMG.....................ACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQ-TGSYTF..
Q87YU8_PSESM/308-470SNSGV.KAEYYANTTLSGDPVANRIEPGVNLDWT..TNTNVTDNGSTAVSGYTPAAGSFSARFTGKIKPTI-TGAHVF..
PAG_BACAN/44-179SSQGL.LGYYFSDLNFQAPMVV...........TSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKK-SDEYTF..
FLO10_YEAST/121-271DNTTLSSKTEKRE.....................NDDCDQGAAYWSSDLFGFYTTPTNVTVEMTGYFLPPK-TGTYTF..
Q880I7_PSESM/435-593SNSGV.KAEYFSNTSFSGDPALTRVEPGVNLNWA..TGTNVTNAGSTAVSGFSPSAGAFSARFTATIKPTV-SGAQVF..
PSIA_DICDI/117-261LRTASGNYIYDNDFFFPIDYEG............FDTDPANRIYKDDESTNKTYHNYHFCFQFDNRFLF..-KGNETF..
Q9PF33_XYLFA/452-607GHPGL.KGEYFDTIDFAGPPHL............VRQDRIIAFNWDHVAPAPGMNPHRYAVRWTGELLPPG-PGTYTFAV
Q8P3G5_XANCP/475-625SQNGL.TGDYFRGRALAGQPVLTRIDPRIAFRWDRNAPTDDAVGRGELQPGQALGKDDFSVRWHGQLLPPV-SGNYEL..
HEXA_PORGI/626-766PKPGL..TIRTAYGDLYDVPDLQQVA....SWEVGTVSSLEEIMHGKEKITSPEVLERRVVEATGYVLIPE-DGVYEF..
Q8A3K6_BACTN/262-401WVNGL.KGIYTQDSKGVGHLRS............EKIDPVIDFDWDWYKPADDFSFNDYQVTWSGKLKAPS-TGEYTL..
Q8A341_BACTN/847-985GKSVL.ELSLYKDDDLRTLAGV...........TQDNKIDRTFADGAQPDPLLPANQSFSAIWDGKLKAPQ-SGTYMI..
Q8CK54_STRCO/42-184QEPGVTLRVFDVQTPLNELCTLKP.......GQTPNHDKLMPTVDWSTTADFGGIADNFVSQASGYLVAPR-DGTYVF..
Q7UKT3_RHOBA/181-327SKHGLSVSIYEGKGWKKENRKI............ERVDSVVDFDFGKEGPGEGVPWDEFHAHWDGGLRVEQ-TGRYEI..
Q7URI2_RHOBA/387-524LEPGLDYRMYLGKFKKLPEFET............MEVERTGQVDSLNLEEIQGDQRDDFALSINAMFRVPE-EGLYRF..
Q8AAF9_BACTN/630-763LNSGLKAVWHKFRGNLCAD...............IDAAPVNGEYVVESVSIPEEVKGDIGLIITGYLEVPA-DGIYTF..
Q8A3E5_BACTN/456-595GRPGL.TATYWNNMNLSGDVAAT..........SQITSPINLSNGGNTVFATGVGLYNFTAVYEGTFRPKE-SGAYEL..
Q7RP37_PLAYO/216-383KADGL.TGSYYDNAYFSGYPLS............INNDKYINFIWDSGVPIEMIPYQHFSVRWDGYIKIPQ-TDNYII..
Q7UF11_RHOBA/396-557LRSGVLVETFEPVAPSPPLSSIAEL.....RDDETFVANTPSTASDISSFSYSAAPGAKVSRIRGIVSPPV-SGHYTF..
F6R443_MACMU/31-177.WCGSSIQQLRRN.....................LHFPLYPHIRTTLRKLAVSPRWTNYGLRIFGYLHPFT-DGKIQF..
G0RWC1_HYPJQ/397-546GAPGMRWRVFNEPPGTPNRQHID.........ELFFTKTDMHLVDYY....HPKAADTWYADMEGTYTADE-DCTYEL..
Q7SG54_NEUCR/449-597GKPGV.TIEWFKGDKFKGEPVV.............IQRRTNTDLFLWDSAPLAQTGPEWSAIATTYLTPKH-SGKHTI..

PF10528

A0A0B2WZZ0_9HYPO/91-182.IF....GQADDIVLVW------LGNN....AF...RG.....W---TRA........NA..DIER....TY........
A0A086TDF0_ACRC1/781-871.KM.G...FTDDTTIIW------LGDS....AY...EG.....W---TTE........NA..DVVR....QY........
T5ADT9_OPHSC/260-350.TS....PKSDDITLMW------FGDE....HV...KH.....S---TRD........NA..DIFQ....SW........
T5A1B7_OPHSC/595-685.SS....PKSDDISILW------LGEA....QV...KN.....A---TRE........NA..DFIQ....AW........
G3JUQ9_CORMM/524-614.NS....PYSDDITIMW------FGDK....AY...GN.....Y---TRD........NA..DIIQ....FF........
A0A0A1TC47_9HYPO/423-513.SS....PYSDDITIMW------FGER....AY...QG.....W---TRD........NA..DIIQ....FY........
E9ECG4_METAQ/427-517.HS....YRSDDITLMW------FGPK....AY...RG.....W---TRQ........NA..DISQ....FY........
A0A094GD32_9PEZI/25-116.TA....PIADNLSLLW------LAPN....AY...SG.....Y---TRA........NA..NLEA....TY........
A0A074WAH8_9PEZI/114-207.TA.P...SVDDIFLLW------LGPN....AY...NN.....Y---TRR........DA..NLVQ....NY...VD...
A0A093ZSP4_9PEZI/404-495.RL....PLVDDISILW------VGPA....AY...SG.....F---TRA........NA..NIVQ....SF........
A0A094D2R0_9PEZI/733-825.RF....PFVDDISLLL------VGPA....AL....G.....Y---TRS........NA..NIVQ....LQ........
A0A0F4GI42_9PEZI/1356-1452.FF.N...IADDIAILW------VGPT....AL...NGQ....F---SRG........NA..ATTQ....HYNA.SQ...
C7ZNI1_NECH7/1109-1200.SV....PVSDEITLVW------VGDK....AI...SD.....W---TRE........NA..DVEQ....RY........
N1RBK8_FUSC4/1012-1103.VV....PYSDEVTLVW------FGNK....AL...ST.....W---TRA........NA..DLEQ....NY........
G2XFJ8_VERDV/583-676.TV....PDSDEITLVW------LGDK....AI...ST.....W---TRA........NA..DLEQ....DY........
X0BL31_FUSOX/275-364.TI....PNSDEITLIW------FGTK....AI...SG.....W---TRQ........NA..DLEQ....DY........
I1RLE3_GIBZE/216-305.TV....PNSDEITLVW------FGNK....AL...SS.....W---TRD........NA..DLEQ....DY........
A0A074X201_AURPU/260-353.NI....PYTDDLQMVW------YGDK....AV...SG.....W---TRD........NA..DIVQ....FW........
A0A074VRD6_9PEZI/194-287.NI....PYTDDIQFVW------VGAN....AV...SG.....W---TRA........NA..DITQ....FW........
A0A074WM41_9PEZI/172-262.DL.P...QADDVTLFW------LGSF....AI...SG.....Y---NRS........NA..QLIQ....SW........
A0A074YDL6_9PEZI/858-950.NL....PQADDITLVW------VGPN....AL...SG.....Y---TRA........NA..QMVQ....NY........
A0A074VKQ1_9PEZI/171-261.NL....PQADDVTLLW------VGPN....AL...SG.....Y---TRA........NA..QLIQ....TW........
S8BMH2_DACHA/580-671.SL....PSSDDITFLW------VGQT....AY...TG.....W---TRQ........NA..NIIQ....KF........
G1XGI6_ARTOA/484-575.SL....PSSDDITLLW------VGQK....AY...SG.....W---NRQ........NA..DIIQ....QF........
A7EUJ3_SCLS1/779-870.NI.T...SFDDIVMGW------IGSN....AF...GS.....Y---SSS........NA..DLNA....AS...SD...
W7N9N6_GIBM7/348-442.SI...PNDIDNWGYLW------VNDA....AY...T......W---DSG............AWAI....EGTRTGG...
M7SG56_EUTLA/320-413SSS...RDYIDNWGYLW------LGDA....AY...ST.....W---SDS........NTAFQASR....TG........
R1EBX7_BOTPV/294-386.ST..SSSYIDNYGYLW------TGDA....AY...S......W---ADN........TAAYAATR....TG........
W3XGQ9_9PEZI/307-400SSS...KDYIDNWGYLW------TGDV....AY...ST.....W---SDS........NT..NFQA....SR........
A1DK36_NEOFI/305-396SSG....ANTDNAFYAW------HGTK....AY...ND.....Y---QKN........NY..DYLA....GNYI......
S8ADJ9_DACHA/331-422.SS....SSVDDGVWFW------IGPN....AY...SG.....W---GRA........NP..........AW........
K2RZA0_MACPH/498-586.TA.A...NADDIVYLW------VGSN....AI...SG.....Y---TNS........NA..NFRI....YY........
S8BYP3_DACHA/2186-2274.KI....NNADDRAAIW------LGEK....AY...SL.....W---WTG............NMTA....DS........
S8C0J3_DACHA/2496-2584.AL....SDADNRALIW------LGDI....AY...SN.....W---FTK........NATVDSSG....VV........
W7HLW7_9PEZI/321-413.SF....TQADDYAGLW------VGQN....AY...SA.....W---ERS........NL..NAVA....LI........
S8A4K8_DACHA/645-738.RL....DSGKDWAGMW------LGPN....AY...VG.....W---TRD............NVNV....VS........
S8AQ37_DACHA/2223-2316.TI....TRGDNWSGIW------LNNT....AI...DN.....W---SRA........NV..DAKA....IY........
S8ASY7_DACHA/3112-3205.TI....TIGDNWAGIW------LSTK....AK...TN.....W---SRP........NV..DAQA....IL........
W7HLW7_9PEZI/526-616.TI....FSADDYAAVW------LGAT....AL...TG.....W---TGQ........NA..NAAR....LL........
S8A1N3_DACHA/591-679.QL....LIPDVRIDLW------LGDV....AY...SG.....W---ETT........NS..NLTA....ERQ.......
S7ZZI6_DACHA/2911-3001.RI....SNGDNWSGFW------IGPT....AY...TD.....W---TRA........NV..NGTS....IW........
S8CBM4_DACHA/176-268.RV....SQADDWCGVW------AGEK....AY...TN.....W---NKD........NL..DAAS....IYGPGGS...
S8BKE7_DACHA/3488-3580.KL....FGVDNIAGLW------VDYK....AF...SG.....W---SRE........NT..DGFS....QL........
S8BVC1_DACHA/2418-2512.KI....STADNDAAIW------VGDL....AY...SG.....W---TRA........NA..QAIS....SL........
G1X1S1_ARTOA/579-670.KV....SRGDNFGAFW------TGDI....AR...SG.....W---TRA........NV..NAIT....YW........
S8C299_DACHA/204-294.LV....TDADDIALFW------AGTT....AR...TG.....W---VRD........NS..DGIT....TF........
G1X146_ARTOA/206-299.RI....SDADDYAGFW------TGSK....AQ...IG.....W---TRA........NE..DGES....TF........
S8AMM4_DACHA/974-1067.TA....YNTDNIMIMW------HGCI....SK...SG.....W---TRA........ND..DGEA....LW........
S8AJM2_DACHA/341-433.HI....YGADDFAEFW------VGTD....AY...SR.....W---TRS........NGYITQHN....TD........
G1X1S1_ARTOA/369-459.RI....FNADDAGWLW------VGQN....AY...TA.....W---TRA........NA..NALS....VY........
G1X799_ARTOA/580-673.HI....AGIKDGGWMW------FGQK....AY...TA.....W---TAS............NYDC..............
S8C0J3_DACHA/2893-2986.AF....SNVHNAAWIW------TGTN....AY...TT.....Y---ETT........NA..DLEV....KM........
S8BM05_DACHA/166-259.NF....TNVHSGIWLW------TGST....AY...SG.....W---DLT........NF..DVSA....VM........
S8B8A3_DACHA/836-925.AF.....NGNDITMIW------VGGR....AI...SG.....Y---TRA............NNNA....I.........
A0A0A1TQX0_9HYPO/1374-1461.DI....DSGESLVAGW------HGNE....AF...SE.....W---HES........NV..NLEL....VS........
S8A3Y9_DACHA/3004-3101.EL....YQTTGVFQMW------LGPT....SY...AN.....Y---EEN............LSYI....TM........
S7ZXT0_DACHA/2911-2999.TI....VELADDGNLW------VGPL....AY...SG.....W---TGA........NS..QIHT....WW........
S7ZZI6_DACHA/2289-2382.ML....SDMDDIAQIW------TGNK....SV...TD.....W---TTS........NT..DLSG....KF........
S8B9B5_DACHA/2938-3024.TI....SSVVDQLMFF------AGNR....AY...TD.....W---TQQ........NI...TAG....TF........
S8C0J3_DACHA/2697-2789TTP....NDANDGFDLW------VDDL....AY...SSN....W---TFT........NS..VLSS....RV........
S8A3Y9_DACHA/2524-2611.SL....PLGDDAVDIW------LGED....AY...TN.....W---DLS............NANA....TA........
S8A3B1_DACHA/619-709.RA....DDPDDILGLW------VGVK....AL...SR.....W---ATT........NA..NLRT....IY........
S8A1N3_DACHA/396-486.KA....DNPDDYIALW------LGGK....AI...SR.....W---SGA........NT..DLHG....LY........
S7ZZI6_DACHA/2508-2600.RT....YGVDNSLAVW------MGDN....AY...TY.....W---NTG........NTNSTTVV....TS........
S8A6I0_DACHA/2775-2868.NL....YNMDDITGLW------VGDK....AH...DK.....W---SGS........NA..DIIG....KY........
S7ZXT0_DACHA/2299-2389.KI....YNVEEIVGLW------VGDK....AL...GN.....W---RKS........NC..DATY....VW........
S8AG65_DACHA/629-715.KV....ANADDRLGVW------TGEK....AY...TK.....W---STS........NA..DILG....FF........
S7ZXT0_DACHA/2705-2794.SI....RDPNDVVGFW------IGEN....AF...SQ.....F---TTQ........NA..DILH....IW........
S8A3Y9_DACHA/2333-2418.YV....YSADDAITLW------LDQK....AL...GD.....W---YSD........NK..DLFT..............
G1X799_ARTOA/378-459FTY.....DVDDKFYYW------LGDN....AF...D......W---SEA........NH..........NY........
S8ASY7_DACHA/2901-2993.NV....TSINDIVIFW------VGNK....AL...TN.....W---TRA........NA..DGEG....VY........
S7ZZI6_DACHA/2706-2798.NV....SHINDIVCLW------TGQK....AI...TG.....W---TKA........NA..DGCD....VY........
S8A139_DACHA/2580-2672.NG....SRVNDIAFIW------LGEK....AI...TG.....W---TKE........NA..DGSS....VYVLGVG...
W7I935_9PEZI/152-240.KV....HNADDTVAVW------LNEP....AI...CN.....W---DRK........TA..ALFS....VW........
W7HXJ4_9PEZI/154-246.TF....HQADDVAYVW------VGEE....AK...CG.....W---TNP......VLTPGTTMRS....YW........
S8C706_DACHA/675-767.RL....NNFDDVGALW------LGQN....AY...LG.....Y---TES........NA..ALVS....RY........
S8A139_DACHA/2986-3076.QL....QGGDDIALVW------IGST....AV...SG.....W---TRA........NA..IMVN....VY........
S8A139_DACHA/2788-2878.AL....NNGDDIVLFW------YGDK....AK...EG.....W---MTA........NY..DLFN....GY........
B6JV38_SCHJY/1821-1913.TV....QNVDDVFYGW------FGDK....AI...SG.....W---SNT........NY..DAYA....KW........
B6JZE1_SCHJY/1129-1223.FV....ENVDDVFYGW------FGDK....AI...SG.....W---SNS........NY..DAYA....KWSKTTF...
FTA5_SCHPO/255-347.FV....KNVDDAFFGW------FGDK....AI...SG.....W---SNV........NY..DAYA....HW........
YKL1_SCHPO/1094-1188.NV....YNVDDVFYGW------FGDK....AI...SG.....W---SNT........NY..DAYA....YW........
E5A174_LEPMJ/1539-1631.SF..PASSQSDIAYLW------MGAA....AS...SGS....W---GET........NW..NMRS....TY........
K2RA80_MACPH/537-628.SF..QSLSTDDVAYLW------LGST....AL...QDT....W---GEA........NA..NLRS....TY........
B8MKN9_TALSN/239-331APY....LGEDNALFFW------GGEK....AY...RS.....Y---ANN........NT..DGGV....SY........
A0A010SLV3_9PEZI/1724-1813.AF....STADEGGYVW------VGDK....AL...ST.....F---TNS........NA..DLIR.....Y........
S8C706_DACHA/1017-1106.SL....TDADDGLWLW------VGAK....VY...AG.....W---KAS........NA..DVIS....IY........
K2RJ77_MACPH/7947-8035.TL.H...QPDDIGYLW------IGPN....AV...SA.....W---SDT........NF..NVIA....GL........
R1EZ58_BOTPV/617-705.AL....RNPDDIGYAW------IGPE....AV...ST.....W---SNT........NY..KLVA..............
E5A174_LEPMJ/1740-1828.TI.N...NPDDIGFLW------LGPN....AL...TT.....W---SEA........NA..NVVS....RL........
A0A0G2EHZ4_9PEZI/336-424.TL.A...NPDDVGYLW------VGTK....AV...SS.....W---SAA........NA..DAMA....GL........
A0A0F4G9N9_9PEZI/1838-1930.TA....TLVDDAFIFW------GGWF....AR...KG.....W---TKA........NS..DISS....YF........
A0A0F4GEC4_9PEZI/1297-1384.GF....TGVDDIAFLW------IGQK....AY...TG.....W---TRA........NS..DVSA....FY........
M3CY60_SPHMS/384-476.SV.S...GVDDYFGLW------LGSY....AQ...TG.....W---TKS........NA..NISL....AF...SY...
G0VGU9_NAUCC/472-572.QA....TDSDDYLAFL------FSDT...HVY...NC.....C---PGK.....ANYAPYADTLG....FF........
G0VGW7_NAUCC/817-917.QV....INSDDYVAFF------FNDK...SVY...NC.....C---PGQ..SNYAPSATTMAIFQ....SF........
G0V539_NAUCC/472-572.QL....SGSDDYAALF------FSDT....SY..FEC.....C---PGG.....QYSSPSATNMA....IY........
G0VGX5_NAUCC/118-218.TF....TGVDDNAALL------FSST...NTF...KC.....C---ANG........AY..DSSF....TY........
G0VGW7_NAUCC/459-558.QF....TGTDDYAALF------IDNT...ISY...QC.....C---SGD.....QVYQPSVDNLA....LY........
G0WDM7_NAUDC/115-212.SL....SSSDDVVGFF------LDTD...KAF...NC.....C---GDG........TSVPVAPT....TL........
A7TJN8_VANPO/109-209.EF....FDTDNSALLM------FANK..G.AF...KC.....C---NSD..K.....NI..EASY....DDISINA...
Q6FQ05_CANGA/107-201.SL....ENTNDAAIIF------FGNP..S.AF...PCGDLSAW---PQA........SA.DDITV....TD........
B4UN21_CANGA/106-200.SL....TGSDDAAIIF------IGNP..S.TF...PCDAFKTW---PQA........TA.NDITV....TD........
B4UN22_CANGA/101-195.TL....SDSDDAAIIF------LGNP..S.AF...PCGDLQNW---PKP........SE.EDITV....TD........
B4UN20_CANGA/107-201.TL....QGSDDAAILF------FANP...STF...ACGSQNDW---PQP.......REA..DITV....TD........
Q6FII8_CANGA/107-201.KL....VNSDDAAVMY------VGNP...SAF...PCGSIDTW---PEP.......RKE..DINV....CD........
Q6FQ10_CANGA/103-199.AL....YLTDDGSAMF------LGND...AAF...PCGNITSW---SNP........TNDQVSVS....DY........
Q6CWZ6_KLULA/31-126.KI....NRADDLAYAN------IGAG...SAF...DC.....C---QKS...DTVSNPAASDLIT....EL........
Q6CSM7_KLULA/32-128.NL....NRADDFAYVT------MGNG...STF...EC.....C---QEP........DT..DSNP....AAFELIT...
Q6CN84_KLULA/123-215.LL....NNVDEAAYGS------IGAG...NAF...DC.....C---QKS............DTIS....NPTTFDFG..
Q755B8_ASHGO/129-229.TL....DFVDDYAAIT------VGGG...RAF...TC.....C---REE...STVTSPSDFQISA....VW........
Q755B7_ASHGO/122-222.TL....DFVDDYASVA------LGGG...RAF...DC.....C---QKD...TGVKSPEGFQIDA....RW........
G8JP44_ERECY/128-228.TL....DFVDDFAVAS------FGSG...RAF...TC.....C---NEQ...RSLTNPTEFQLNA....TWSRSAP...
G8ZY99_TORDC/133-231.NL....RYVDDLVYIN------LGSG...NAF...EC.....C---QRD...STVTYPGGFVLRA....QW........
C5DFQ4_LACTC/123-219.DV....AYVDDLAYIN------VGAG...SAF...NC.....C---QVA............SSSS....NPGPFILQTK
G8ZY82_TORDC/121-219.NL....DYIDDLAYVN------VGAG...KAF...DC.....C---QQG...SSESKPAPFDLFA....QW........
A0A0A8L5C6_9SACH/118-214.IL....NYIDDLSFLN------VGAG...KAF...DC.....C---QLA...GSVSNPAPFDLSV....VW........
Q6CX19_KLULA/128-224.IL....DYIDDLTYLN------VGAG...RAF...DC.....C---GKT...SSVSNPGPFDLSV....MW........
Q6FUW4_CANGA/154-251.NL.....EADDLLFMN------LGAG...NAF...DC.....C---RAE.STLDNFGNY..QSYS....IW........
Q6FUW5_CANGA/141-238.TI.....SADDLLFVN------FGAG...NAF...DC.....C---RRD.SSADHFGNY..QAYA....IW........
Q6FR82_CANGA/143-240.TI.....FADDLLFLN------FGAG...NAF...DC.....C---QQQ.DTIDDFGNY..QAYA....LW........
Q6FVP4_CANGA/154-251.SL.....HGDDLIYLN------FGAG...NAF...DC.....C---RQE.SSADNFGNY..QAFS....LW........
Q6FUW3_CANGA/134-231.FV.....NADDLLYIN------FGAG...NAF...DC.....C---KRE............DSKT....KLGEYVAYDI
A0A0F4X5N7_HANUV/148-251.NL....DYIDDLAIMN------IGSN....AFHSPNC.....C---NNY..SPTGDVSGNNTIQS....IW........
A0A0F4X4Q0_HANUV/112-215.NL....NYIDDLAIIN------IGAN....GFDSTNC.....C---SNY..SPTGDVSGNNTIQS....IW........
G3B2Y3_CANTC/22-123.QF....TKADNEASLS------LGGY..TDTL...DC.....C---SSS.......SNL..PVEG....SV........
G3BFW5_CANTC/104-201.EI....SFADDAASFT------LGSG...VAM...DC.....C---GSK........PLTGNLDE....MA........
G3B766_CANTC/106-202.DI....DYVDDAASIT------LGAG...VAM...DC.....C---GSE........LTGNVEEN....AY........
G3BFW8_CANTC/100-197.SI....TFADDAASLS------IGAG...VAM...EC.....C---GSS........QF..PTAVTEYAHW........
G3BFW6_CANTC/100-197.AV....TYADDAASLS------IGAG...VAM...EC.....C---GST........QSPANVTEFA..HW........
G3BDF6_CANTC/105-202.DI....SNADDTASIT------LGAG...VAM...DC.....C---GSG......PLTGNLDENA....YY........
E7NPI2_YEASO/136-237.SF....ATVDDSAILS------VGGS...IAF...EC.....C---AQE.QPPITSTNFTINGIK....PW........
G8ZW36_TORDC/116-218.GL....PQVDDSAALQ------FGDG...AAF...NC.....C---QQN.LKPPKSTNFSIDAVR....PL........
C5DWW7_ZYGRC/131-231.AF....KHIDDSAILN------FGEG...IAF...DC.....C---DQG........NA..ANGN....TNFSINAIKP
B5RT28_DEBHA/101-200.SM.....SVDDGALVT------FGAG...QAF...GC.....C---NTV........ST..SNDG....NYALFTHWYS
G8YSS6_PICSO/109-208.SL.....AVDDGALVN------FGDG...EAF...SC.....C---EAS....TTSSDGNYSLFA....LY........
J7SA32_KAZNA/173-268.QF....DHVEDGAYFL------LGPQ...AAW...EC.....C---QRE...GGEVDKPTANLLA....TS........
C4R3B0_KOMPG/294-397.SF....SNIDYNAILF------LGSPATDSSL..........A---KRE....VQFLKP..ETSS....EY........
C4QYW7_KOMPG/115-219.SL....RNIDDSAILF------FGRE..T.AF...EC.....C---NEN..L....IPL..DEAP....TDYSLFT...
A0A099NWW7_PICKU/260-356.SI....DYSDDGSMVW------IGTN...DAF...AC.....C---QPD........NIPYNSEG....GRLIFA....
A0A099P2U2_PICKU/395-490.KI....KNVNDGAMVW------FGNN...DAF...AC.....C---QPD........DIPYDSQN.GALFF........
A0A099NW94_PICKU/107-207.DM....TKVDDGAMVF------IGNS....AY...DC.....C---QPG....SIPFGKADEAAMFSYKEW........
A0A099P0F8_PICKU/109-208.DI....QNVDDGVMAF------IGTS....AY...DC.....C---TGN.......LTPGSTTPL....IF........
I2JQE4_DEKBR/45-143.RL....LAVDDLAAIW------FGSG.....L...SC.....C---NSD........VPEDSESP....SFWASWDRTS
I2JQS0_DEKBR/141-239.KL....TDVDDYVAVW------FXSG.....L...DC.....C---DTSS......SDN..SIAP....DFATGRS...
I2JVD5_DEKBR/75-173.EL....NDIDDYAAIW------FGKG.....L...DC.....C---DTT........SSDDSIAP....DF........
I2JQS5_DEKBR/113-211.VL....DDVDDYAAIW------FGTG.....L...SC.....C---DPT........TPDDSIXP....DF........
A0A099NRU8_PICKU/4-98.TF....NGVNDGGFIW------LGAG....AF...EA.....C---SQE.....INDNSYADVLL....AL........
A0A074VE73_9PEZI/156-257.CM....NYADNRQAFY------IGSD..N.AF...PC.....G---DSAN..AATPTNA..TAFQ....DYWFDNP...
A0A074WDA2_9PEZI/352-450.CL....DYADNEQAFY------IGSD..T.AF...PC.....G---DSSN..AATPRNA..QAYE....RYWFASS...
A0A0L0NI94_9HYPO/325-423.CA.....QADNVDNFY------LGST...TAF...PCDQP..Y---NPA.....TPRNAKPLVRN....YY........
A0A063BVW4_9HYPO/426-524.CV....NDVDDVDFLY------MGSD...TAF...PCGSP..Y---SPP........RGARALLG....STCCYVG...
X0BNJ8_FUSOX/200-297.CV.....TADNANTLY------FGQG...NAF...EC.....G---TGE.......TDP..NAPA....LV......LT
A0A0L0N435_9HYPO/186-282.CT.....TADNENDVF------FGHG...NAF...SC.....L---TGR.......ADPAAKPVA....VS........
W8F3T8_9BACT/80-158.RM.....TTDDGMRVW------VGGQ...RIL...NS.....W---QNQ.............AVS....SY........
W3XRF7_9PEZI/1047-1135.YA.W...GVDDEFYMW------WGSQ....AY...SG.....W---NST........NY..NIDQ....KL........
A0A074YRC0_9PEZI/482-571.SI....PTCDDVAFFW------LGES....AY...SG.....F---NSS........NY..LILD..............
A0A074VXF3_9PEZI/474-563.SI....PTVDDAAFFW------LGDV....AY...SG.....F---NEF........NY..LLLD..............
W3X397_9PEZI/326-418.YM....PQVDDAGFVW------VGSK....AY...SG.....W---TRD........NADINFIT....SL........
A0A094FMT6_9PEZI/175-267TS.....LHADEIVLYW------IGPK....AY...SG.....W---TRA........NA..DLED....AW........
A0A093ZUD3_9PEZI/181-273TTH.....NSDEIVLYW------IGTK....AY...SG.....W---TRE........NA..DLED....AY........
A0A093YH60_9PEZI/179-271.TT....QSADEIVLFW------VGPE....AY...SN.....W---DRS........NA..DLED....AW........
A0A094IS29_9PEZI/174-266.TA....QRSDEIVLYW------IGPK....AY...SG.....W---TRE........NA..DLED....AY........
M3AT14_SPHMS/263-351.VV....SNADDWVGIW------IGPK....AY...SG.....W---LRS........NV..DASV....AY........
A0A0F4GTF0_9PEZI/940-1034.TS....TNADDLTLVW------VGPN....AY...SG.....W---TRA........NA..NIEQ....SF........
F9X7F6_ZYMTI/152-245.TS....TNGDDVALLW------LGSN....AY...TG.....W---NRA........NA..NLEQ....AF........
A0A0F4GBG0_9PEZI/1115-1205.TS....SGADEIALVW------VGPL....AY...RG.....W---TRG........NA..NLDQ....AY........
A0A074X474_9PEZI/92-181.TL....SEPDDIALLW------LGSK....AY...SG.....W---TRG........NA..DATA....VI........
A0A074XY07_9PEZI/284-373.TL....GNVDDIVLLW------LGDT....AV...RG.....W---TRG........NA..NALA....IY........
W3XLK6_9PEZI/287-376.NA.S...RVDDIFFLW------LGPK....AY...SG.....W---TRA........NA..DLVV....PI........
W3X411_9PEZI/275-367.SF....AGVDDIAALW------LGST....AY...AG.....W---TRA........NA..NLVV....PF........
A0A0E9NSQ7_9ASCO/713-805.IT.P...DSDDITIFW------LGPQ....AF...SG.....Y---TRQ........NA..NILQ....PY...NF...
A0A094IZG8_9PEZI/404-495.LV....TNPDDIAIIW------GGAD....AY...EG.....Y---TRA........NS..DSIA....TY........
A0A0F9XST2_TRIHA/266-356.TL....NLVDDAAYIW------IGPE....AY...SG.....W---TGA........NA..DLKA....LY........
G9NK78_HYPAI/264-354.TL....DKVDDAAFLW------VGGV....AF...SG.....W---AAA........NA..NLKV....VY........
M7UTE3_BOTF1/440-528.ST....TSADDIFFLW------VGAN....AY...SG.....W---TRA........NA..NLIA....TL........
W3XQ89_9PEZI/311-407.QI.T...SADDIVLVW------AGAT....AY...SG.....W---TRA........NA..LLDV....TYPELGA...
E9F784_METRA/160-253.NI....PYANDAVFVW------TGEK....AY...KG.....W---TDD........NA..DAKA....RY........
R8BCW8_TOGMI/99-192.DI....PYSNDAVYLW------IGAK....AY...AG.....W---TDE........NA..DAKA....RY........
G0RSD2_HYPJQ/160-253.DV....PYANDAVYLW------TGAK....AY...SG.....W---TDA........NA..DAKA....LY........
G9MGK0_HYPVG/152-245.SI....PYSNDAVYLW------TGAK....AY...SG.....W---TDN........NA..DAAA....LY........
C7Z3G4_NECH7/188-281.NI....PYANDAVYLW------IGAE....AY...AG.....W---SEG........NA..DAKA....RY........
A0A0D2YBA4_FUSO4/190-283.DI....PYANDALYLW------VGDK....AY...GG.....W---SSG........DA..DAKA....LY........
I1RLP4_GIBZE/191-284.DI....PYANDAVYLW------VGQS....AY...AG.....W---TKS........NA..PAKA....LY........
A0A074XM69_9PEZI/572-665.TL....SNPDDIVFLY------LGET....AK...HG.....W---SRG........NA..AAAA....SW........
A0A074X564_AURPU/566-657.II....SNPDDIVFLY------LGDN....AV...SG.....W---TRG........NA..NAVA....SCCSNY....
A0A074YDZ5_9PEZI/572-664.TI....SQPDDIVFLY------LGQT....AL...SG.....W---NQG........NA..AAVA....AW........
A0A074YDM0_9PEZI/284-375.TT....SQADDITYLY------LGDA....AY...KG.....Y---TRS........NY..NAKA....VC........
A0A074X2Q8_AURPU/7-102.TI.K...DADDIAYVW------MGDA....AY...SG.....W---TGG........PS..GGNY....VAKARCC...
W3WNL0_9PEZI/490-580.SV....TNVDDAVFLW------LGAT....AY...SG.....W---TRT........NA..DGFG....VS........
G0RTH6_HYPJQ/765-860.TA..PAATLDQSVYVW------LGAN....AV...AG.....Y---TNT........NADLVADA....NW........
A0A010S4E5_9PEZI/1789-1880.SF....SGVDDSVYLW------LGKS...VAK...TG.....Y---SNA........NY..DKNV....NY........
A0A063C682_9HYPO/1999-2090.SFQG...GDDDGAYLW------LGPN....AV...AG.....F---KRA........NA..NLVS....GT........
A0A063BY70_9HYPO/1576-1664.SF...NGYVNDAQYLW------LGKN....AV...SG.....W---TNN........NA..NLVA....TL........
A0A063BY70_9HYPO/1354-1443.SF...TGWINEAQYLW------LGNN....AM...SG.....W---NSG........NA..NLIG....TW........
A0A063BSF4_9HYPO/209-297.QLGP...NADEASYLW------VGNY....AV...SG.....W---NTG........NA..NAKL....AD........
A0A0B4GHB0_9HYPO/273-365.NM....WWTDDVSYLW------VGEH....AR...SE.....F---SES........NA..DLKV....DY........
J4USI0_BEAB2/283-374.YT....WWVDDSAYLW------VGDK....AL...SP......---TAT........NF..DMHI....RYASQDS...
J3NZ77_GAGT3/223-313.YM....PHVDDTLVAW------IGDR....AR...SG.....F---TIA........DATFKLNE....NS........
L2FXC7_COLGN/218-309.IV....GEADDVVMVW------LGDK....AK...SG.....F---DAN........NADITVQK....GFRS......
T0JL19_COLGC/335-426.LI..NQPPPGDVLFAW------FGDK....AK...SGS....F---SVS........NA..DIIV....PN........
L2FWT7_COLGN/243-334.FA.N...EPDDDLLLW------FGNN....AK...SGS....F---AAG........NS..DVYG....LY...AE...
A0A0C4E9R0_MAGP6/214-301.TA.....GADEMVLGW------FGAS....AV...SG.....W---TTA........NA..QLKA....GY........
A0A0C4DSB4_MAGP6/155-240.YF....NSAGELALGW------FGDE....AN...GN.....W---NSD........NA..RLVT..............
A0A0F4GAQ0_9PEZI/216-306.NL....GKPDDVAYLW------VNED...VGF...T......Y---TGD........NA..DMVS....SY........
F9XCF6_ZYMTI/199-288.DM....GKPDDVSLLW------VGDK....AL...HD.....W---TES........NA..ELRS....AF........
F9XCF6_ZYMTI/436-525.NF....GIPDDRAMLW------IGDK....AV...SG.....W---DES........NA..DIDA....RL........

PF07691

Q8IKW0_PLAF7/216-383SVD......HDCGIRIF......LDNS---PII---VD-----NMPFPKE--------------------EESEEIRPIS
BGLS_SCHPO/398-544GIS......VFGTALLF......IDDV---LLI---DN-----K...TKQ--------------------TP........
FLO1_YEAST/100-249KFA.....TVDDSAILS......VGGA---TAF---NC-----C...AQQ--------------------QPPITSTNFT
Q87YU8_PSESM/308-470KVR......ADGAYKLW......INDE---LVL---ED-----E...GAQ--------------------V.........
PAG_BACAN/44-179ATS......ADNHVTMW......VDDQ---EVI---NK-----A......--------------------..........
FLO10_YEAST/121-271GFA.....TVDDSAILS......VGGN---VAF---EC-----C...KQE--------------------QPPITSTDFT
Q880I7_PSESM/435-593KVR......ADGPYKLW......VNDE---LVL---QS-----D...GVP--------------------Y.........
PSIA_DICDI/117-261KFT......GDDDVWVF......INKQ---LVV---DL-----G......--------------------..........
Q9PF33_XYLFA/452-607HVARCFDCNGHDPVRLS......IDDR---QII---PD-----NATAAQA--------------------T.........
Q8P3G5_XANCP/475-625QIA......ADDGVRLY......LDGK---PLI---DQ-----W......--------------------..........
HEXA_PORGI/626-766.........STENNEFW......IDNV---KLI---DN-----V...GEV--------------------K.........
Q8A3K6_BACTN/262-401GIQ......ADDGARLY......INGE---LLI---DD-----W......--------------------..........
Q8A341_BACTN/847-985GVT......SDQGMRLS......VNGQ---RIV---DE-----W...RNN--------------------K.........
Q8CK54_STRCO/42-184RLV......SDDGSRLA......LDGA---TVI---DH-----D...GLH--------------------GA........
Q7UKT3_RHOBA/181-327VVR......SKTSFTMDF....GHDSK---QLI---DN-----H...VQS--------------------E.........
Q7URI2_RHOBA/387-524QIT......SDDGSRVF......LHDK---LFL---DH-----D...GNH--------------------P.........
Q8AAF9_BACTN/630-763ALL......SDDGSTLK......LDGE---LLG---DN-----D...GAH--------------------S.........
Q8A3E5_BACTN/456-595LIE......GDDGYRVY......VNGE---KVI---DY-----W...GEH--------------------A.........
Q7RP37_PLAYO/216-383SIE......HDCGVRIF......LDNS---PII---VN-----NMPDPKE--------------------EESEEIKPIY
Q7UF11_RHOBA/396-557HLA......ASDEAELW......LSQG---VTS---DT-----SRLIASV--------------------ATP.......
F6R443_MACMU/31-177AIA......ADDNAEFWLSLDDQVSGL---QLL---AS-----V...GKT--------------------GKE.......
G0RWC1_HYPJQ/397-546GLV......VCGTAKAY......VDDQ---LVV---DN-----A...TKQ--------------------VP........
Q7SG54_NEUCR/449-597SYM......SVGPGKLY......INGK---LSL---DL-----W...DWT--------------------E.........

PF10528

A0A0B2WZZ0_9HYPO/91-182......IPPPGDETHTT...RHLE.QGTYYPVRVAWGD.KG.G.N----------------.TAMSVKIIA
A0A086TDF0_ACRC1/781-871.......QGF.PPETSIT..RRLE.AGTYYPIRVVWTD.FG.G.A----------------.AGLNVQIYG
T5ADT9_OPHSC/260-350........YGENKPQTVY..KTIE.AGKYYPIRVLWGN.TN.G.A----------------.GYLNLDIYG
T5A1B7_OPHSC/595-685........YGDNKPRTVE..KELK.AGDSMPIRVLWGN.TD.G.A----------------.GYLNINIIA
G3JUQ9_CORMM/524-614........YGDNRPRNIY..RDLE.AGTYYPIRVLWGN.TG.G.A----------------.SDLSLRIYG
A0A0A1TC47_9HYPO/423-513.......YGNNDPANVY...VDIE.AGTYYPIRVLWGN.TG.G.A----------------.ADLELRIFA
E9ECG4_METAQ/427-517........FGDNEPKRVS..RMLK.AGTHYPIRVMWGN.LG.S.V----------------.AELSLRIQG
A0A094GD32_9PEZI/25-116.......TPVGSAPLEYK..VTLG.KGKYYPIRFSWDN.SG.G.A----------------.GYYELKIKA
A0A074WAH8_9PEZI/114-207PR......LG.SSATTYS..INLT.QGTYTPLRFIYAN.AQ.Q.G----------------.GNYELKITA
A0A093ZSP4_9PEZI/404-495.......VSGAQTPVTYT..VTFE.EGKYYPMRVIWAN.GG.G.A----------------.GVMSFELKG
A0A094D2R0_9PEZI/733-825.....TGVPGAQTAVTYT..VVFE.EGKHYPMRVIWAN.GA.G.P----------------.GVFSSELKG
A0A0F4GI42_9PEZI/1356-1452PV......NA.QTSVSYS..YTAR.LGEYVPMRIIYAN.AG.G.D----------------.AEFRLTVIA
C7ZNI1_NECH7/1109-1200.......HYETREPQVVR..IHLE.AGSYNNLRILWAN.GQ.G.E----------------.FSFILSIKA
N1RBK8_FUSC4/1012-1103.......SSGPSSSKTLK..MQLT.AGTYTPFRVFWAN.AQ.G.D----------------.YSMIVTVTA
G2XFJ8_VERDV/583-676.....NTVDGPEETTVFR..IQLQ.AGTYTPFRLLWAN.AQ.G.E----------------.LSFIARVQA
X0BL31_FUSOX/275-364.........PGGTSKSFT..IHLT.AGTYTPFRLLWAN.AQ.G.D----------------.LNFIAEVQA
I1RLE3_GIBZE/216-305.........PGGTSKTFE..LELQ.AGTYTPFRLLWAN.AQ.G.E----------------.LNFIAEVKA
A0A074X201_AURPU/260-353.....SSQIAVQTPQTIA..VYLT.TGSYLPLRVMFAN.GG.G.A----------------.GELDFNIYG
A0A074VRD6_9PEZI/194-287.....SSQIATQTPQTLA..YYLT.VGQYLPIRTLWGN.GG.G.Q----------------.GDMRFNIYA
A0A074WM41_9PEZI/172-262........SA.PAPATVS..LYLT.ANTYYPIRIWFAN.GG.G.V----------------.GGFQFTLRA
A0A074YDL6_9PEZI/858-950.......VRGTPTPVTLS..FYLT.ANTYTAARIHFGN.GA.E.V----------------.GNFQVNVYA
A0A074VKQ1_9PEZI/171-261.........SAPAPATLG..FFLT.ANTYTPIRLWYAN.GG.G.Q----------------.GGFQFTMTA
S8BMH2_DACHA/580-671.......AGGNSKPTSTQ..IDLK.KGTYTPIRIVWAN.QG.G.A----------------.GNFKLRITA
G1XGI6_ARTOA/484-575.......VSSGGTPVVFR..TDLK.KGTYTPIRIAWAN.RG.G.A----------------.ANFKLRIMS
A7EUJ3_SCLS1/779-870........TH.NAVTTVS..KTLT.AGQLLPFKVLWAN.GA.S.S----------------.GSLGFSIKG
W7N9N6_GIBM7/348-442.......NPSLWKSGSYE..VQLN.KGDAIPFTYLWAN.GG.G.C----------------.GVSDLTVTT
M7SG56_EUTLA/320-413........AGYITGITT...VTLN.EGDAIPLAWLWAN.GG.G.V----------------.SQSYFQVTS
R1EBX7_BOTPV/294-386........AGYYGGSTS...ITMN.AGDAIPMTWLWAN.GG.G.V----------------.GRSHFVITT
W3XGQ9_9PEZI/307-400.......TGAGYYGGSYS..VTLN.AGDAIPLAWLWAN.GG.G.V----------------.SQSYFKLTS
A1DK36_NEOFI/305-396...........KQAGSVT..VQVG.VGELVPFTFMWVN.GG.G.P----------------.GQAYLTITD
S8ADJ9_DACHA/331-422...FQVPGARIGAQVDYK..KILE.KGKMYPIRIVWGN.SA.G.Y----------------.GYLDFSITD
K2RZA0_MACPH/498-586.........T.QAPVSYS..ITLQ.AGTYTPFRVFWGN.VD.G.G----------------.GNLQFTITN
S8BYP3_DACHA/2186-2274........NGEVAPSQIS..IALE.AGTYYPLRIVYLN.GA.T.R----------------.AQFDFSVTG
S8C0J3_DACHA/2496-2584...........APASVS...VTIQ.AGTYFPFRLIFHN.GG.Q.I----------------.AKFTFTVKG
W7HLW7_9PEZI/321-413......DSGTAVRPTSYA..IDLE.AGSYTPFRIVYGN.GL.G.K----------------.SEFNFAITG
S8A4K8_DACHA/645-738FTDHDTHS...VTDSDNT..RDLV.AGSYYPLRVMFGS.AS.N.L----------------.AGVKITITG
S8AQ37_DACHA/2223-2316.......ASTVAGDSQGTKRIALT.AGQYLPIRIVLAN.AG.G.P----------------.AVFGLQITD
S8ASY7_DACHA/3112-3205.......YSTIPSEVQGTKIVSLT.AGQYYPIRIVLGN.AG.G.P----------------.AQYKLEVSS
W7HLW7_9PEZI/526-616........SDGATPASGT..ADLT.AGQYLPIRVLLAT.VG.G.N----------------.IALDFEIVH
S8A1N3_DACHA/591-679...........VNSGVIQ..QHLT.AGTYLPIRVFLGD.DN.G.S----------------.ATNNGNIAA
S7ZZI6_DACHA/2911-3001........STSSSVSTVN..INLT.AGQYLPFRAMIGS.WA.G.P----------------.IHFTLEIYD
S8CBM4_DACHA/176-268...........ISTGEFK..LTLT.GGSFTPLRILLAN.AG.G.A----------------.VKFAFEIIG
S8BKE7_DACHA/3488-3580......LSGGSSSVGTIT..KSIV.GGKYFPFRIVFAN.SG.G.P----------------.ATLRFEIYD
S8BVC1_DACHA/2418-2512....TSITPRESSEGNVT..ISLT.AGTYTPIRVWYGN.TG...A----------------EVSYKFEITD
G1X1S1_ARTOA/579-670.......VSPDFVNGEAT..FTLV.GGTFLPLRVITAN.TG.A.A----------------.SRLDFEILD
S8C299_DACHA/204-294........SSSPIPGQKT..FSLT.AGQYFPIRVMYAN.RG.G.P----------------.GKYTFQIFD
G1X146_ARTOA/206-299.......HPPADPPVVGQIQLALS.AGEYTPLRIIFAN.RG.G.A----------------.GKYTFEVVD
S8AMM4_DACHA/974-1067.....NAVAQTYSNLTYQ..IALT.AGEYLPIRLMFAN.SA.G.A----------------.AHYDMEITD
S8AJM2_DACHA/341-433...........GSSSQATAHLYLP.AGTYLPLRILYAN.GGFN.G----------------.SEYRFEIYD
G1X1S1_ARTOA/369-459........RSSNASNTFT..ITLT.AGSYTPMRIIYAN....GLR----------------SGYFSFEIKD
G1X799_ARTOA/580-673RYLLKTGIGG.YNEDAHT..VHLT.AGTYFPFRIMIAD.GG.E.G----------------.GTFNLEIFD
S8C0J3_DACHA/2893-2986.....ATTTSPVASGSWN..VMLA.AGTYTPIRIMFAD.GDAG..----------------.GSFDLEVTD
S8BM05_DACHA/166-259.....ASPSSLPANASWT..IELE.AQSYTPMRILYGD.GDAG..----------------.GSFTLEITD
S8B8A3_DACHA/836-925.....SGTSI.ASTSPYR..FFGG.AGSYVPIRIFFAN.GDAS.D----------------.GSYAITITD
A0A0A1TQX0_9HYPO/1374-1461...........KHHHSWS..IRAS.PEQIVPLRLLITT.NN.H.D----------------.PKTAIKITS
S8A3Y9_DACHA/3004-3101YQNQPTRGII.RGSSRLVNIKAIG.AGTYIPFRVLWVD.GP.G.G----------------.GSFKLNVTD
S7ZXT0_DACHA/2911-2999..........QQPAKKYT..IALQ.AGSYTPIRIVAGDNGG.G..----------------.YWVNLRIDD
S7ZZI6_DACHA/2289-2382.....STTTAISPSSTFD..IALD.AGTYLPIRIIFGN.GG.G.V----------------.AKFTLEIRD
S8B9B5_DACHA/2938-3024...........ASSLTYS..TLLT.AGTYLPIRLIHIGTAA...T----------------.GHFSFGVTD
S8C0J3_DACHA/2697-2789........GNNALRYTYS..VALT.AGTYYPLRMFYTK.ST.G.N----------------.TKWVLTVTD
S8A3Y9_DACHA/2524-2611R........G.TTNTLYT..VQLT.AGTYYPLRVLFNN.VA.G.A----------------.SGFYFRVTD
S8A3B1_DACHA/619-709........TGTGTTSSYQ..ISLP.AGSYTPIRILLIN.TG.G.P----------------.AKFGYNVFG
S8A1N3_DACHA/396-486........TGSSQSFTYQ..INLS.AGSYTPIRLMMIN.AG.T.A----------------.ASFAFNVVG
S7ZZI6_DACHA/2508-2600........AFTSETKEFS..ITLT.QGSYTPLRMVWYN.SG.G.K----------------.GRYDLDIIG
S8A6I0_DACHA/2775-2868.....ILSTATSESKVFQ..VTLT.AGSYTPLRLIFGN.GG.G.G----------------.SKFDFDIIG
S7ZXT0_DACHA/2299-2389........IDGIPSRSYT..VTLE.AGSYTPIRWVYSNRGG.G..----------------.VWYDLDITG
S8AG65_DACHA/629-715............VEVSFE..VSLN.AGDYMPLRVIYGN.GG.G.Y----------------.ATYDLDITG
S7ZXT0_DACHA/2705-2794.........PLTTAKSVV..KTLN.AGTYYPIRIMVAN.SN.G.A----------------.TQYNFDVVG
S8A3Y9_DACHA/2333-2418...........GGGAGVT..VNIV.AGTYYPMRFIQSTVMQ...I----------------.GQYNMSIIG
G1X799_ARTOA/378-459...........RNNRVN...VRIE.GGTYYPIRILYGN.GG.G.G----------------.GEFHLDITG
S8ASY7_DACHA/2901-2993......SRTTGAASFRVT..INLQ.AGIYNPIRIQHAD.GG.N.G----------------.GGFRMNIKD
S7ZZI6_DACHA/2706-2798........VRGIGAANFTVDISIA.GGTYLPMRIQHAD.GGNG..----------------.GEFQFNVKD
S8A139_DACHA/2580-2672...........PGNFTFQ..KTLA.AGSYTPIRIMHAD.GG.N.Q----------------.GSFSLNIQG
W7I935_9PEZI/152-240..........LYPLQTAK..FSCK.QGQFVPIRIVWAN.QA.G.P----------------.RGWNFNLYG
W7HXJ4_9PEZI/154-246........TLFENTLDF....TCT.KGAFTPLRIIWADIAG...P----------------.RSLFMDIKD
S8C706_DACHA/675-767........SGGTGSHNVQTTFTCV.AGQYYPIRLIWGN.KS.G.S----------------.RSYDVDIKG
S8A139_DACHA/2986-3076........NGQTQDQSRP..FTCT.KGQYMPFRIMWGN.QS.G.A----------------.GNFDFYISG
S8A139_DACHA/2788-2878........NAQSQSQSTT..FSCT.AGDYVPIRIIFSNIWG...P----------------.RAFDLDITS
B6JV38_SCHJY/1821-1913.....RRSATGMGSWSL...GTLQ.ADSFLPVRLIVAN.GY.N.V----------------.GGFNFHFVD
B6JZE1_SCHJY/1129-1223........ETGMGEWDL...GELK.DGEYLPVRLIVAN.GY.G.L----------------.GGFYFYFVD
FTA5_SCHPO/255-347.......RIGAYGMGTFDL.GYLE.QDSFVPVRFVLAN.GA.Y.I----------------.GGFDFAFNS
YKL1_SCHPO/1094-1188.....HVTTGQTGMGSFSM.GTLT.QGSFLPIRLIVAN.GG.G.K----------------.GGFNFDFSS
E5A174_LEPMJ/1539-1631.........GVNRGGPVS..QSFV.AGQLYPITILYGN.GP.G.F----------------.AYLELDITT
K2RA80_MACPH/537-628.........N.RNGGTLS..RWFT.AGYLYPVVVLYAN.AP.G.G----------------.AALNLEISP
B8MKN9_TALSN/239-331.......TQPAGLPHTFS..YEMV.AGEFLPITFIYAN.GY.G.P----------------.ALNRLTITS
A0A010SLV3_9PEZI/1724-1813........TQQSTTPTFS..FTAV.AGAYYPIRFLYVN.AQ.G.C----------------.YGNGLTITN
S8C706_DACHA/1017-1106............GGGLVSKNFHFT.AGSFIPIRLMYAN.GG.GAA----------------.GNFNLTVTD
K2RJ77_MACPH/7947-8035.........N.TPTASTT..MTLT.AGSLTPIRLVYGD.GN.G.A----------------.ISFTLRTTD
R1EZ58_BOTPV/617-705........GLNSPQASYQ..MTLA.AGSLTPIRLIYAD.GI.G.S----------------.VSFTMRTID
E5A174_LEPMJ/1740-1828.........L.GTAGTYS..VSLT.AGTLTPIRMVFAN.GP.G.G----------------.MSYTLQTRD
A0A0G2EHZ4_9PEZI/336-424.........N.TDPDSVT..VSLT.AGTYVPFRMIFAD.GT.G.A----------------.LSWQLKTTE
A0A0F4G9N9_9PEZI/1838-1930......TYGPGNGRGSVS..LTLT.AGTYLPVRVVFGQAVG.G..----------------.AGFNLNITD
A0A0F4GEC4_9PEZI/1297-1384...........AIPGQVT..LALE.QATYYPMRIVFGQ.AN.G.G----------------.AAFQLVVTD
M3CY60_SPHMS/384-476N.......TG.GPSLAIT..GQFT.AGQYVPIRVVHGQ.SV.G.G----------------.FAYTLSVTD
G0VGU9_NAUCC/472-572....QSYSHFGAGTDSVT..YLLQ.KGQAYPIQINYLN.RL.G.T----------------.ANYDVSFID
G0VGW7_NAUCC/817-917.......SALGAGTSSVT..FLLQ.KGQAYPIQITYLN.RL.G.T----------------.AGYNVNFID
G0V539_NAUCC/472-572......QAYSVIGAGTNTAQFTLQ.AGVPYPIKVTYLN.RV.G.T----------------.GVLNLAFTD
G0VGX5_NAUCC/118-218.NVALFASYNTQGTGSISTTVTLQ.KGLAYPIKMTYVN.RF.S.T----------------.GIFNVAFKD
G0VGW7_NAUCC/459-558.......QAYSSASQSINVKIVLQ.KGVAYPIKITFLNRSQ...Q----------------.ANLNVAFID
G0WDM7_NAUDC/115-212....QLFQQTPTTTGSVK..LTLT.QGVPYPIKYVYLN.RQ.G.D----------------.GAFNPSFTD
A7TJN8_VANPO/109-209VKQWQ....T.SEKTYFA..DYLH.AGFAYPIRIVYLN.AG.G.D----------------.ANLDLKYID
Q6FQ05_CANGA/107-201........GT.FPSRTL....FLK.AGVAYPMRISYYN.SL.G.S----------------.GNLAVSFTD
B4UN21_CANGA/106-200........SI.NPSRTL....YMV.KGVAYPLRIAYYN.GL.G.N----------------.GVLNAAFTD
B4UN22_CANGA/101-195........HL.FPSRTL....YLI.EGVAYPMRIAYYN.GI.G.A----------------.GRLNAAFID
B4UN20_CANGA/107-201...........TLVPSRT..LYLV.KGVAYPIRIAYYN.GS.G.D----------------.GKLNVSFKD
Q6FII8_CANGA/107-201...........KISASTK..LYME.KGLAYPVRLVWYN.GG.G.D----------------.GQFNAQFID
Q6FQ10_CANGA/103-199..........DPKKKTLT..VYMV.AGVAYPLRIAYYN.REKG..----------------.GSLTASFVD
Q6CWZ6_KLULA/31-126...........GASSNAT..VNLQ.AGVFYPLRLLYIN.RY.G.N----------------.LGLEFQFVD
Q6CSM7_KLULA/32-128.......ELD.GEAANAS..VTLK.AGVFYPLKLLFVN.KW.G.N----------------.PSLEFQFVD
Q6CN84_KLULA/123-215...........VTSSSVT..VSMQ.AGVFYPLRVLYLN.AR.G.N----------------.LAMQFQFVD
Q755B8_ASHGO/129-229.....SREAPAGRAWTV...VNLQ.RGAYYPLRVFYVN.TN.N.W----------------.AGIRFTFTD
Q755B7_ASHGO/122-222.....ARNGPVGRAWTV...VNLQ.RGAYYPLRVFYVN.TN.N.W----------------.AGIRFTFTD
G8JP44_ERECY/128-228...........EGRSSAP..VRLQ.RGVYYPVRLFYVN.TN.N.W----------------.GGISLTYTD
G8ZY99_TORDC/133-231........FSTQTTQKVS..VDLV.GGVYYPIRVFYVN.RD.N.L----------------.GALDLTIID
C5DFQ4_LACTC/123-219WP.........DTSSSVK..IDLV.AGYYYPIRFFFTN.RN.Y.A----------------.GGLKFYFTS
G8ZY82_TORDC/121-219........ASSKPTDSIQ..ADLI.AGLYYPIRLFYVN.RD.Y.I----------------.GGLQFSYTD
A0A0A8L5C6_9SACH/118-214..........PQSANTVT..TYLL.GGYYYPIRIFFVN.RQ.G.L----------------.AGLTVSFKD
Q6CX19_KLULA/128-224.........PQTQNTAT...VYLL.GGFYYPLRIFYIN.RE.G.V----------------.GGLTVTFKD
Q6FUW4_CANGA/154-251........GTDKATADLT..VFLV.SGIYYPIRLFYVN.RD.N.N----------------.AVLDFSFST
Q6FUW5_CANGA/141-238........GSKTAKDELT..VHLD.AGVYYPIRLFYNN.REYD..----------------.GALSFTFKT
Q6FR82_CANGA/143-240........GSDTQQNTLT..VNLD.ANIYYPIRMFYNN.RDFK..----------------.GALNMYFTT
Q6FVP4_CANGA/154-251........GINWEKKTLT..VYLD.MNTYYPIRIFYNN.RD.Y.Q----------------.AIFNFSFKT
Q6FUW3_CANGA/134-231WHVD.......SSKNKVS..LFLE.KDLYYPIRMFFNNIGK...D----------------.SSLDLSFSV
A0A0F4X5N7_HANUV/148-251........TPSGPSGTNQIVLQLV.AGVAYPIEFFFVN.RG.G.A----------------.DGIQFEYTD
A0A0F4X4Q0_HANUV/112-215........ASNGPTGINEISMILV.AGVAYPIEFFFVN.RG.G.A----------------.GAIEFEFTD
G3B2Y3_CANTC/22-123YAHLLDTSGA.VNTTVIT..VSLV.AGEYYPVKIMYYQ.AGPG.V----------------.ASLELSIKY
G3BFW5_CANTC/104-201......SVYASGEASSATETVTLT.GGVYYPIKVVYYQ.AT.G.L----------------.GQLNMSVTY
G3B766_CANTC/106-202.......IYAVKKSTTVRKTVTLT.AGVYYPIKVVYYQ.ANAY..----------------.AEFEMSVLY
G3BFW8_CANTC/100-197........YAEGESTSVAKTVHLT.AGVYYPIKVVFMNVVS.G..----------------.AHFNMSVTY
G3BFW6_CANTC/100-197........YGHLESTSVSKTVSLT.AGVYYPIKVVYFN.VEDG..----------------.GEFNMSVTY
G3BDF6_CANTC/105-202........IQGSGSTTATETVTLT.AGVYYPIKIVYYQ.EG.G.P----------------.SSFTMSVTY
E7NPI2_YEASO/136-237.........HGSLPDNIAGTVYMY.AGFYYPMKIVYSN.AV.S.W----------------.GTLPISVTL
G8ZW36_TORDC/116-218......DAVGYNAQSSAQ..VSLI.ADFYYPIRLVYTN.LQ.G.N----------------.AVLGFNITL
C5DWW7_ZYGRC/131-231NN.........GPTGHTTIEVDLA.ANYYYPIKIVFTN.TE...Q----------------IAMLYTTVTL
B5RT28_DEBHA/101-200TS.........NAPGQTVSTQHLT.AGYYYPMKIFYVN.MQ.N.P----------------.MSMTFKVTT
G8YSS6_PICSO/109-208.......GSESDVQDSTVSTKHLT.ADNYYPLKIVYVN.RQ.S.P----------------.LSLDFTITT
J7SA32_KAZNA/173-268...........DCPKSTT..FYLK.QGYYYPLRVVYVN.AL.A.A----------------.GSLKTKLTL
C4R3B0_KOMPG/294-397...VLFFDHGKDAGQTVSTTQYLS.AGLYYPLRIVLAAVSE...R----------------.AQLDFQITL
C4QYW7_KOMPG/115-219IKEGEAST.N.PDSYTYT..QYLE.AGRYYPVRTFFAN.IR.T.R----------------.AVFNFTMTL
A0A099NWW7_PICKU/260-356...........GDEEKVTGYAYLT.EGYYYPVRVVMVN.WY.G.D----------------.SALEMSMIT
A0A099P2U2_PICKU/395-490........TTGDDVTAY...VHFD.AGKYYPMRVVLVN.MLLS..----------------.SVLDIEVIT
A0A099NW94_PICKU/107-207.......NTPSSESISW...VYLE.AHSYYPIKIVYVN.VISA..----------------.GGIELLVTP
A0A099P0F8_PICKU/109-208....SSKAFNSDDPTQVSSWVYLE.AGSLYPFRVVYLN.AI.S.A----------------.GSMNFQVTT
I2JQE4_DEKBR/45-143NE.........NGAAVAN..LYLT.AGIYYPIKVRFAN.TN.R.A----------------.GALAFEVVD
I2JQS0_DEKBR/141-239.....LNSNX.NGGTTYS..VYLS.AGSYYPIKIRFAN.VV.V.G----------------.AYLDFSIID
I2JVD5_DEKBR/75-173.ATGRSYSTNTNGESSYS..IYLS.AGSYYPIKIRYVN.VVTK..----------------.XXLGFSVVD
I2JQS5_DEKBR/113-211.ATGRSNNENTNGXSEYS..VYLT.AGSYYPIKIRYAN.VL.Y.A----------------.GDLIFSVVD
A0A099NRU8_PICKU/4-98........RGDGAHSSF...VYLE.EGVMYPMRTTFIN.IFFD..----------------.AVFDFEVVR
A0A074VE73_9PEZI/156-257........TL.FLSVCQN..MTLT.AGFYYPIRAVYGN.NG.L.P----------------.ASSNFTVSG
A0A074WDA2_9PEZI/352-450........DY.NQAVCKN..MTLT.AGFYYPIRAVYGT.MD.F..----------------...QHLLSSS
A0A0L0NI94_9HYPO/325-423........GRTKRTVCAN..MKLI.RGLYYPLRAVYGN.WG.T.P----------------.SSLVFTVRA
A0A063BVW4_9HYPO/426-524...........GAQICSS..ITLF.AGYFYPIRSVFGN.YV.S.N----------------.SALNLLVST
X0BNJ8_FUSOX/200-297ATGYHFN....NPTQCGH..VDLI.AGRHYPVRNVMGN.KN.A.V----------------.SAFEFSVTT
A0A0L0N435_9HYPO/186-282.....TGGNFINGIKCTD..VNLV.EGGYYPVRNVMGN.WQ.G.P----------------.SAFNFTIQK
W8F3T8_9BACT/80-158.................TAQIALT.AGRYYPIRVDYYQ.AG....----------------.QDSRASLAW
W3XRF7_9PEZI/1047-1135.........Y.AGYKTAT..ITLT.KGTYLPLRILYRQ.DT.G.P----------------.GYFNINLYD
A0A074YRC0_9PEZI/482-571........NQGSGTKSAT..VTLM.AGIYYPIRLIYGNVGG.G.P----------------.GSLYFQVEQ
A0A074VXF3_9PEZI/474-563........NQADGTQNAT..VTLT.AGSYYPIRLIYGNVGG.G.P----------------.GSLYFQITQ
W3X397_9PEZI/326-418........PFDQQKTSVN..IQLV.AGQFLPVRILFVQ.AQ.G.G----------------.VVLQLQVTG
A0A094FMT6_9PEZI/175-267......YSPTSGQLISFT..TELQ.EGQYYALRIVFAN.AQTG..----------------.SNEAVSVTA
A0A093ZUD3_9PEZI/181-273...FAP..TH.GQLRTFT..AELE.EGQYYALRIVFAN.AQ.V.H----------------.AVENIGVTA
A0A093YH60_9PEZI/179-271......YGPGSGQLKSFD..VNLE.AGQYYALRIVFAN.AQLT..----------------.AQEIINVRA
A0A094IS29_9PEZI/174-266........GAPTHTQLITFTAELE.EGKYYALRIVFAN.AQ.G.A----------------.ATENISVAT
M3AT14_SPHMS/263-351..........GFGSATYN..TTFV.AGQYYALRIMFAQ.AQ.G.D----------------.AAFAMRVTA
A0A0F4GTF0_9PEZI/940-1034....GGGARDSSIPQRYT..VNLV.AGQYYPIRIIGAN.GN.N.A----------------.AEFRVTATR
F9X7F6_ZYMTI/152-245.....GGSRPTSTPQTYS..VELI.AGTYYPIRIIGAN.GA.G.A----------------.TSLQITATR
A0A0F4GBG0_9PEZI/1115-1205........QGTSPKNPFR..INLV.AGQYYPIRIISGN.SG.G.V----------------.TALNLRATR
A0A074X474_9PEZI/92-181........FGSPSASAT...VNLV.QGDYLPFRIVFGQ.AQ.G.E----------------.ISFYLSLTA
A0A074XY07_9PEZI/284-373.........SSQPTASAS..IELV.QGQYLPFRVVFGN.AQ.G.A----------------.ISFSLQLAA
W3XLK6_9PEZI/287-376........YN.PGSGSTS..IDLV.EGQYLPLRIMFGQ.GA.Y.P----------------.AEFQISVTA
W3X411_9PEZI/275-367.....HQGYG.PGSGSTT..IDLV.EGQYLPIRVLFGQ.GQ.G.N----------------.AVFQLSVTA
A0A0E9NSQ7_9ASCO/713-805.E......GA.DSHVTAQ..IDLV.EGQYYPFRILYGN.GQ.G.N----------------.AQFAFNVYA
A0A094IZG8_9PEZI/404-495.......PLTDDQQRSYE..VELV.AGEYYPIRVIFGQ.GV.G.P----------------.AIFYTSVTA
A0A0F9XST2_TRIHA/266-356........NNGPGTGAFT..ADLQ.EGQYYPFRIVYGQ.GP.R.I----------------.AEFDVTVSA
G9NK78_HYPAI/264-354........NNGPAQGTYT..VNLQ.EGRYYPFRIFYGQ.GP.R.I----------------.AEFDINVKA
M7UTE3_BOTF1/440-528..........TYPSQKFT..INLV.AGEYYPMRFLWAN.GD.G.P----------------.GLFAFSVTA
W3XQ89_9PEZI/311-407GS......GG.GGSIVGT..YTAT.AGEYIPIRILFSQ.GD.G.P----------------.FGFNVQVTA
E9F784_METRA/160-253.....NQPDHIAGQASFK..VNVP.ADTYVPIRFVYGQ.AQYG..----------------.GGFYFTVTT
R8BCW8_TOGMI/99-192.....DQPDHIAGSATFE..FTIP.AGTYVPLRFFYGQ.AQYG..----------------.GGFYFNVTA
G0RSD2_HYPJQ/160-253.....DQPDHVAGRSSFR..FNVP.ADTYVPVRFFYGQ.AQYG..----------------.GGFSFNVTA
G9MGK0_HYPVG/152-245.....NQPDHIAGRANFN..LDIP.ANSYVPIRFFYGQ.AQYG..----------------.GGFNFNITT
C7Z3G4_NECH7/188-281.....NQPDHIAGSASFS..IDMP.AGAYVPIRFVYGQ.AQYG..----------------.GGFYFTITT
A0A0D2YBA4_FUSO4/190-283.....NQPDHIAGSAHFE..VDLR.AGEYIPIRFVYGQ.AQYG..----------------.GGFTFTVTA
I1RLP4_GIBZE/191-284.....NQPDHIAGSVSYE..IAMP.AGQYIPIRVVYGQ.AQSG..----------------.GGFTFKVTA
A0A074XM69_9PEZI/572-665.....NSDTGFQSTATAT..YTLK.AGEYLPYRIFFGQ.MG.G.P----------------.VKFSFSIKA
A0A074X564_AURPU/566-657...........PTRASTS..YTLE.AGDYLPFRIFFGQ.QG.G.P----------------.VRFAFSITA
A0A074YDZ5_9PEZI/572-664.....DNANF.GRYDTAS..YTLK.AGDYLPFRIFFGQ.QG.G.P----------------.VKFAFSITA
A0A074YDM0_9PEZI/284-375.......CDAPANSASGT..YTLE.SGQYLPFRLVFGQ.QG.G.P----------------.VVFSFSVTA
A0A074X2Q8_AURPU/7-102WP.......P.ENTNTTT..YWME.AETYVPFRIVLGQ.QD.G.S----------------.TSVGLTITA
W3WNL0_9PEZI/490-580.......NQGNGFTRAF...ADLT.AGQYLPVRLMLAQ.SE.G.P----------------.ASFSFFITA
G0RTH6_HYPJQ/765-860.........LSGSNLDLEVVSAAQ.VGTYIPIRILWVN.AQ.D.C----------------.GQFDLTITD
A0A010S4E5_9PEZI/1789-1880........YDTNMSGTFT..FTAT.AGQYYPIRILFVN.AQ.Q.C----------------.GLFNFSLTN
A0A063C682_9HYPO/1999-2090.......QAS.LTGPTVS..YSAI.AGTFIPMRILCVN.SP.G.P----------------.TACGFTLID
A0A063BY70_9HYPO/1576-1664...........MSTQSFT..FSAT.AGTYIPFRLLYAN.AQ.A.V----------------.GALAFTLTD
A0A063BY70_9HYPO/1354-1443.........G.QVNQSFT..LSAT.AGDYIPFRLLFVN.AQ.T.T----------------.SALSFTLTD
A0A063BSF4_9HYPO/209-297...........SGASSLV..YSAT.AGTFIPFRLLFVN.AQ.G.S----------------.SGLGFSLKD
A0A0B4GHB0_9HYPO/273-365......ASIDTFGKKRFS..YAAE.QGKPVPIRVINVQ.AA.G.P----------------.YSLCFDVTD
J4USI0_BEAB2/283-374...........YGVKRYT..VNAV.AGKPIPYTVLNVQ.SG.G.P----------------.FSLCFAIKE
J3NZ77_GAGT3/223-313..........IPPSRAWS..FDLA.AGDVVPFRLFWSN.GG.G.P----------------.GGLNIQIRD
L2FXC7_COLGN/218-309...........YPYSEF...IYFETVEEYIPFRIFWSN.GR.G.G----------------.GAFSSGVYP
T0JL19_COLGC/335-426........NNGWPYRYF...VYFRDASEYIPFRLFWSH....G.R----------------.GRSEVLVGV
L2FWT7_COLGN/243-334........PG.QSRLVDT..FVFT.ESAYIPFRVYWDN.RN.G.P----------------.GGLRLKVKN
A0A0C4E9R0_MAGP6/214-301..........GFGTSQYT..FTAT.AGDVIPFRVLFVN.AQ.G.C----------------.YYLGFTLTR
A0A0C4DSB4_MAGP6/155-240...........GRYAYRA..IQAK.AGDVIPFRILYIN.AQ.G.C----------------.YSFGFTIYK
A0A0F4GAQ0_9PEZI/216-306.........QDASTKTYA..VSLT.CGAYYPFRIWYRA.YD.Y.P----------------NTFFSASITD
F9XCF6_ZYMTI/199-288.........FDSQPKTYI..AHLN.AGQYYPFRIVYKQ.YG.G.P----------------.GSFDHATIT
F9XCF6_ZYMTI/436-525........GD.ESPKEFR..KQLT.KGQYYPIRIVWAQ.GD.G.D----------------.ADFKPAILD

PF07691

Q8IKW0_PLAF7/216-383IQSFDKMNSKVHKTNSEK--LGLI-GGKKYKIRIEYFHLSTMKFANPH.ISHIILYWKSNNIMEEIIPSNY
BGLS_SCHPO/398-544...TNHTFEFGTIEERNS--IYLK-KGRKYNVRVEYGSAATYTLS.........TNLSPSTGGRYSIGCVK
FLO1_YEAST/100-249IDGIKPWGGSLPPNIEGT--VYMY-AGYYYPMKVVYSNAVSWGTL........PISVTLPDGTTVSDDFEG
Q87YU8_PSESM/308-470....SFDLIPVIPRTVKT--PTLK-AGTEYNVRLEYRRLKGNFIPVLGGLNGVQMSWASLRPPKNLADYDA
PAG_BACAN/44-179.............SNSNK--IRLE-KGRLYQIKIQYQRENPTEKGL.....DFKLYWTDSQNKKEVISSDN
FLO10_YEAST/121-271INGIKPWNADAPTDIKGS--TYMY-AGYYYPIKIVYSNAVSWGTL........PVSVVLPDGTEVNDDFEG
Q880I7_PSESM/435-593....SGDVVNALTTSGKT--AELS-AGKTYTVKLEYQRIQGNFIPV....LGGLTGVQMSWASLRPPKDLS
PSIA_DICDI/117-261....GTHPAASSSVDLST--LGLT-VGKVYPFNFFYCERHTSRSTIR...IETSLELYCDKYDYCGVCNGD
Q9PF33_XYLFA/452-607....TAPQQTDNTHLEAT--LHFT-DTRPHHIRLDMEHRGEDQGV........RLEWLAPAAPQLAEAERA
Q8P3G5_XANCP/475-625......SDAPRMRSSTAT--VALQ-AGKAYDLRVEYYEATRDAGV........RLAWRMPGAKPPLQEAVD
HEXA_PORGI/626-766...........KFSRRNS--SRAL-QKGYHPIKTIWVGAIQGGWP.........TYWNYSRVMIRLKGEEK
Q8A3K6_BACTN/262-401.....KSHSFSYQPTQKK--ISLE-AGKMYDIKLEYYQHEWSSRI........KLSWIRPDKKSSTSLLTG
Q8A341_BACTN/847-985...........ELTVVRP--FLLK-AGDEVAVRVEYSQRNPTGSV........QLVWSLPDHAAIAPQELL
Q8CK54_STRCO/42-184..EP...........KDG--TVEL-TAGAHPLRIDHFDRGGGQQV........QLSWMPPGESGFTVVPTE
Q7UKT3_RHOBA/181-327..........GRNEFRRT--LLLT-GGRVYPLEIDLNQRKRKGETPP...ASISLSWVPPGGIETIIPASA
Q7URI2_RHOBA/387-524............PMTVSR--LVRA-GAGLHPIRIDYFEGGGAQTL........TAALTRLDVAGDDDGDDS
Q8AAF9_BACTN/630-763............PVEIIV--QKAL-KAGLHPIEVRYFDCNGGVL.........QMELVNEKGEKEVLPKEW
Q8A3E5_BACTN/456-595...........SAKREYT--LKAI-AGTDYKIRIEYMQAGAE...A.....LLRFDLGIYRHISPEMVVDR
Q7RP37_PLAYO/216-383ILPINKINSNVQKISSEK--LGLI-GGKKYKFRIEYFHLSTIKHENPD.TAHIILYWKSDKIIDEEIIPSQ
Q7UF11_RHOBA/396-557..TLMEGFTDANAGLSAS--VYLV-AGQDYYVETLQVHDDPVAKN......HLSVAWTRPDQLASGPQLIG
F6R443_MACMU/31-177.WTAPGEFGKFRSQISKP--VSLS-ASHRYYFEVLHKQNEEGTDH.......VEVAWRRNDPGAKFTIID.
G0RWC1_HYPJQ/397-546...GDAFFGSATREETGR--INLV-KGNTYKFKIEFGSAPTYTLKG....DTIVPGHGSLRVGGCKVIDD.
Q7SG54_NEUCR/449-597...EGEAMFDGSVDYLVE--LEMV-ANRPVELRVEMTNELRPLSKQK..QMGMTHRYGGCRIGYKEADQ..

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window